Macro-IML manual for DEC PDP 11 computer with controller DEC CA 11-A/BORER type 1,533 A
International Nuclear Information System (INIS)
Kubitz, M.; Kind, R.
1975-03-01
The IML-implementations follow the Macro-Syntax as given in Appendix A of the document 'CAMAC. The Definitior of IML (A Language For Use in CAMAC Systems)'. This document has been adopted as a description by ESONE and AEC NIM in August/September 74 and has been published in October 74. They have been designed for the DEC PDP 11 computer with the branch controller DEC CA 11-A and the Single Crate Controller BORER Type 1,533 A. For both DEC operating systems, DOS V08/09 and RSX-11D/M a full set of macros has been implemented except the block transfer on special LAM, X-error control statements and the subscript mode. Transfer modes not implemented by the hardware of the CA 11-A are simulated by software. (orig.) [de
FILOSOFIA THEORETICA VoI. 1 No. 1 Dec. 2011 MENTAL ...
African Journals Online (AJOL)
JONATHAN CHIMAKONAM OKEKE
2011-12-01
Dec 1, 2011 ... investigate the problem of personal identity (Furman and Avila, 146). Others include, Thomas Reid ... disembodied thoughts and memories are the bastion of personal identity. This does not suggest the .... may make a little sense to me when I say that I'm what I think I am, but how far does this go? How do I ...
The dates of publication of Blume’s Flora Javae
Danser, B.H.
1939-01-01
The actual dates of publication of the greater part of BLUME’s Flora Javae (lit. 1) appear to be unknown among taxonomists. The title-page of the first volume is dated 1828, and we find the same year at the base of the preface. The volume containing the Orchideae (lit. 2) is dated 1858, but further
281-- 14 Dec 2009--[ Final VERSION].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... reason is that, when it comes to motivation, there is the issue of intention and secondary intention. An example: ... this in Europe are the public health service and agriculture. ... Christians in need and should expect no reward.
Fragrance material review on 1-spiro[4.5]dec-7-en-7-yl-4-pent-1-one.
Scognamiglio, J; Letizia, C S; Api, A M
2013-12-01
A toxicologic and dermatologic review of 1-spiro[4.5]dec-7-en-7-yl-4-pent-1-one when used as a fragrance ingredient is presented. 1-Spiro[4.5]dec-7-en-7-yl-4-pent-1-one is a member of the fragrance structural group Alkyl Cyclic Ketones. These fragrances can be described as being composed of an alkyl, R1, and various substituted and bicyclic saturated or unsaturated cyclic hydrocarbons, R2, in which one of the rings may include up to 12 carbons. Alternatively, R2 may be a carbon bridge of C2-C4 carbon chain length between the ketone and cyclic hydrocarbon. This review contains a detailed summary of all published and unpublished toxicology and dermatology papers that are related to this individual fragrance ingredient and is not intended as a stand-alone document. Available data for 1-spiro[4.5]dec-7-en-7-yl-4-pent-1-one were evaluated then summarized and includes acute toxicity, skin irritation, mucous membrane (eye) irritation, skin sensitization, phototoxicity, photoallergy, repeated dose, and genotoxicity data. A safety assessment of the entire Alkyl Cyclic Ketones will be published simultaneously with this document; please refer to Belsito et al. (2013) for an overall assessment of the safe use of this material and all Alkyl Cyclic Ketones in fragrances. Copyright © 2013 Elsevier Ltd. All rights reserved.
308 --- 16 Dec 2009 [ final version].indd
African Journals Online (AJOL)
2009-12-16
Dec 16, 2009 ... Secondly, an effort has to be made to at least try to avoid the fallacies of ... The metaphor says one thing but means something else; it needs to ... New Testament scholarship with literary criticism, defines the parables as narrative ..... the parable in the context of Jesus' public career some forty years.
26 CFR 1.1271-0 - Original issue discount; effective date; table of contents.
2010-04-01
... Code. (g) Basis adjustment. (h) Debt instruments denominated in a currency other than the U.S. dollar... instruments issued for money. (1) Issue price. (2) Issue date. (b) Publicly traded debt instruments issued for property. (1) Issue price. (2) Issue date. (c) Debt instruments issued for publicly traded property. (1...
Houston, R
2000-01-01
DEC-fortified salt has been used successfully as a principal public health tool to eliminate lymphatic filariasis (LF) in China and, less extensively, in several other countries. Studies from 1967 to the present conducted in Brazil, Japan, Tanzania, India, China, and Taiwan involving administration of DEC salt for 18 days to 1 year, have shown this intervention to be effective for both bancroftian and brugian filariasis, as measured by reductions in both microfilarial density and positivity, and in some studies through reduction in mosquito positivity rates as well. Furthermore, studies suggest specific advantages from using DEC salt, including lack of side effects, particularly for bancroftian filariasis, and ability to reduce prevalence below 1% when used in conjunction with standard regimens of DEC tablets. However, use of DEC salt as a control tool suffers from a concern that health authorities might find it difficult to manage a programme involving a commodity such as salt. In the past decade, the very successful global efforts to eliminate iodine deficiency through universal salt iodization have demonstrated that partnership with the salt industry can be both successful and effective as a public health tool. Use of DEC salt can be most successfully implemented in areas in which (a) there is adequate governmental support for its use and for elimination of filariasis, (b) filariasis-endemic areas are clearly defined, (c) political leaders, health officials and the salt industry agree that DEC salt is an appropriate intervention, (d) the salt industry is well-organized and has known distribution patterns, (e) a successful national salt iodization effort exists, (f) a monitoring system exists that ensures adequacy of salt iodine content during production and that can also measure household coverage, and (g) measurement of impact on transmission of LF with the new antigen or filarial DNA detection methods can be established. There are advantages and disadvantages
DEFF Research Database (Denmark)
Chen, Li; Fink, Trine; Ebbesen, Peter
2006-01-01
Chondrogenesis occurs in vivo in a hypoxic environment, in which the hypoxia inducible factor 1, HIF-1, plays a regulatory role, possibly mediated through the transcription factor DEC1. We have analyzed the effect of hypoxia (1% oxygen) alone and in combination with insulin on the chondrogenic di...
Rhythmic expression of DEC2 protein in vitro and in vivo.
Sato, Fuyuki; Muragaki, Yasuteru; Kawamoto, Takeshi; Fujimoto, Katsumi; Kato, Yukio; Zhang, Yanping
2016-06-01
Basic helix-loop-helix (bHLH) transcription factor DEC2 (bHLHE41/Sharp1) is one of the clock genes that show a circadian rhythm in various tissues. DEC2 regulates differentiation, sleep length, tumor cell invasion and apoptosis. Although studies have been conducted on the rhythmic expression of DEC2 mRNA in various tissues, the precise molecular mechanism of DEC2 expression is poorly understood. In the present study, we examined whether DEC2 protein had a rhythmic expression. Western blot analysis for DEC2 protein revealed a rhythmic expression in mouse liver, lung and muscle and in MCF-7 and U2OS cells. In addition, AMP-activated protein kinase (AMPK) activity (phosphorylation of AMPK) in mouse embryonic fibroblasts (MEFs) exhibited a rhythmic expression under the condition of medium change or glucose-depleted medium. However, the rhythmic expression of DEC2 in MEF gradually decreased in time under these conditions. The medium change affected the levels of DEC2 protein and phosphorylation of AMPK. In addition, the levels of DEC2 protein showed a rhythmic expression in vivo and in MCF-7 and U2OS cells. The results showed that the phosphorylation of AMPK immunoreactivity was strongly detected in the liver and lung of DEC2 knockout mice compared with that of wild-type mice. These results may provide new insights into rhythmic expression and the regulation between DEC2 protein and AMPK activity.
, improving, and protecting Alaska's natural resources and environment to enhance the health, safety, economic , Assessment and Restoration Environmental Health Drinking Water Food Safety & Sanitation Laboratory Environmental Conservation Alaska Department of Environmental Conservation Search DEC State of Alaska Conserving
EAMJ Dec Presure Ulcer 09.indd
African Journals Online (AJOL)
2009-12-01
Dec 1, 2009 ... Geriatric surgery, comprehensive care of the elderly ... Galdin, J.E. Sepsis associated with decubitus ulcer. Amer. J. Med. 1976 ... Ann. Platy. ... A multisite study of the predictive validity of the. Braden scale. Nurs. Res. 1998; 47: ...
Evaluation of DEC`s GIGAswitch for distributed parallel computing
Energy Technology Data Exchange (ETDEWEB)
Chen, H.; Hutchins, J.; Brandt, J.
1993-10-01
One of Sandia`s research efforts is to reduce the end-to-end communication delay in a parallel-distributed computing environment. GIGAswitch is DEC`s implementation of a gigabit local area network based on switched FDDI technology. Using the GIGAswitch, the authors intend to minimize the medium access latency suffered by shared-medium FDDI technology. Experimental results show that the GIGAswitch adds 16.5 microseconds of switching and bridging delay to an end-to-end communication. Although the added latency causes a 1.8% throughput degradation and a 5% line efficiency degradation, the availability of dedicated bandwidth is much more than what is available to a workstation on a shared medium. For example, ten directly connected workstations each would have a dedicated bandwidth of 95 Mbps, but if they were sharing the FDDI bandwidth, each would have 10% of the total bandwidth, i.e., less than 10 Mbps. In addition, they have found that when there is no output port contention, the switch`s aggregate bandwidth will scale up to multiples of its port bandwidth. However, with output port contention, the throughput and latency performance suffered significantly. Their mathematical and simulation models indicate that the GIGAswitch line efficiency could be as low as 63% when there are nine input ports contending for the same output port. The data indicate that the delay introduced by contention at the server workstation is 50 times that introduced by the GIGAswitch. The authors conclude that the GIGAswitch meets the performance requirements of today`s high-end workstations and that the switched FDDI technology provides an alternative that utilizes existing workstation interfaces while increasing the aggregate bandwidth. However, because the speed of workstations is increasing by a factor of 2 every 1.5 years, the switched FDDI technology is only good as an interim solution.
Dec-POMDPs as Non-Observable MDPs
Oliehoek, F.A.; Amato, C.
2014-01-01
A recent insight in the field of decentralized partially observable Markov decision processes (Dec-POMDPs) is that it is possible to convert a Dec-POMDP to a non-observable MDP, which is a special case of POMDP. This technical report provides an overview of this reduction and pointers to related
1983-01-01
The DEC (Digital Equipment Corporation) VT220 is a text terminal which uses an redesigned keyboard(LK201). The VT220 improved on the earlier VT100 series of terminals with much smaller physical packaging and and a much faster microprocessor.
337-- 11 Dec 2009 [final version].indd
African Journals Online (AJOL)
2009-12-11
Dec 11, 2009 ... deterministic, it can easily be so construed (as clearly illustrated by the Westminster .... from Britain (especially from Calvinist Scotland) and Germany would be sinful ..... The Cambridge history of the Bible 1, pp. 510–541,.
African Journals Online (AJOL)
Missing intrauterine contraceptive device (IUCD) is a known complication of ... complaints of missing IUCD over an 11 year period, from 1 January 1990 to 31 ... removal were extracted and analysed using tabulations and simple ... Nigerian Journal of Surgery • Dec. ... abdominal pain 5(25%) and string not felt 4(20%).
Pani, SP; Subramanyam Reddy, G; Das, LK; Vanamail, P; Hoti, SL; Ramesh, J; Das, PK
2002-01-01
Background The tolerability and efficacy of single dose albendazole (400 mg), diethylcarbamazine citrate (DEC) (6 mg/kg bodyweight) or co-administration of albendazole (400 mg) + DEC (6 mg/kg bodyweight) was studied in 54 asymptomatic Wuchereria bancrofti microfilaraemic volunteers in a double blind hospital-based clinical study. Results There was no significant difference in the overall incidence of adverse reactions between the three drug groups [42.1% (albendazole), 52.9% (DEC) and 61.1% (...
37 CFR 1.211 - Publication of applications.
2010-07-01
... disparaging material. (e) The publication fee set forth in § 1.18(d) must be paid in each application... publication fee which must be paid within three months from the date of mailing of the notice of allowance to... not published under this section, the publication fee (if paid) will be refunded. [65 FR 57058, Sept...
Kshirsagar, Nilima A; Gogtay, N J; Garg, B S; Deshmukh, P R; Rajgor, D D; Kadam, V S; Thakur, P A; Gupta, A; Ingole, N S; Lazdins-Helds, J K
2017-10-01
Lymphatic filariasis (LF) affects 73 countries, causes morbidity and impedes socioeconomic development. We had found no difference in safety and micro (Mf) and macro filarial action of single-dose diethylcarbamazine (DEC) and DEC + albendazole (ABZ) in an F01 study done in India (year 2000). There was a programmatic need to evaluate safety and efficacy of multiple annual treatments (F02). Subjects (155) from the F01 study, meeting inclusion-exclusion criteria, were enrolled in F02 and treated with further two annual doses of DEC or DEC + ABZ. Efficacy was evaluated for Mf positivity by peripheral smear (PS) and nucleopore (NP) filter, circulating filarial antigen (CFA) and filarial dance sign (FDS) positivity and Mf count at yearly follow-up. Safety was assessed for 5 days after drug administration. Total of 139 subjects evaluated for efficacy (69 DEC and 70 DEC + ABZ group). Mf positivity prevalence declined progressively by 95% (PS), 66% (NP), and 95% (PS) and 86% (NP); CFA positivity prevalence declined by 15% and 9%; FDS by 100% each; Mf count declined by 75.5 and 76.9% with three annual treatment of DEC and DEC + ABZ, respectively. Addition of ABZ did not show any advantage over DEC given as three annual rounds for LF. DEC and DEC + ABZ were well tolerated. There was no correlation between result of CFA and FDS, (both claimed to be indicative of adult worm). Analysis of published studies and our data indicate that macrofilaricidal effect of DEC/DEC + ABZ may be seen in children and not adults, with three or more annual dosing.
African Journals Online (AJOL)
2008-12-12
Dec 12, 2008 ... wheeze in the past year, and 174 who did not. Interventions:Administered .... best of three spirometer readings was taken, and any individual with ... all those wheezers with reported ever having asthma, and the 'negatives' to ...
Networking DEC and IBM computers
Mish, W. H.
1983-01-01
Local Area Networking of DEC and IBM computers within the structure of the ISO-OSI Seven Layer Reference Model at a raw signaling speed of 1 Mops or greater are discussed. After an introduction to the ISO-OSI Reference Model nd the IEEE-802 Draft Standard for Local Area Networks (LANs), there follows a detailed discussion and comparison of the products available from a variety of manufactures to perform this networking task. A summary of these products is presented in a table.
278----9 Dec 2009 [FINAL VERSION].indd
African Journals Online (AJOL)
2009-12-09
Dec 9, 2009 ... different to the opening word 'hkyaee' found in Lamentations 1, 2 and. 4. ... Remembrance of events gives way to remembrance .... presence of the Most High and of one's case being subverted. (cf. ... standard reading of Lamentations is the fact that the narrator, ..... The form of Lamentations is that of a long.
Seed storage protein electrophoretic profiles in some Iranian date ...
African Journals Online (AJOL)
use
2011-12-05
Dec 5, 2011 ... 2International Center for Science, High Technology and Environmental Sciences, Kerman, Iran. Accepted 31 October, 2011 ... Mesopotamia, date palm is cultivated for fruit production and all parts of the tree are used for many ...... assembly of the head of bacteriophage T4. Nature, 227(5259): 680-. 685.
African Journals Online (AJOL)
2008-12-12
Dec 12, 2008 ... cardiac-arrhythmias cardio-myopathy, HIV/AIDS, Left Ventricular ... (LVH), infective endocarditis, atrial septal aneurysm, carotid plaques with or ... patients who died had anterior circulation ischaemic stroke as per ... disturbance of cerebral function of sudden onset ..... of strict blood pressure control (15, 32).
Wu, Yunyan; Liu, Qiang; Yan, Xu; Kato, Yukio; Tanaka, Makiko; Inokuchi, Sadaki; Yoshizawa, Tadashi; Morohashi, Satoko; Kijima, Hiroshi
2016-06-01
Podoplanin is reported involved in the collective cell invasion, another tumor invasion style which is distinct from the single cell invasion, so-called epithelial-mesenchymal transition (EMT). In this study, we investigated the correlation between podoplanin and EMT-related markers in esophageal squamous cell carcinoma (ESCC), and evaluated its linkage with the basic helix-loop-helix (bHLH) transcription factor differentiated embryonic chondrocyte (DEC) 1 and DEC2. Three ESCC cell lines and human squamous cell carcinoma A431 cells were subjected to western blot analyses for podoplanin and EMT markers, as well as the expression of DEC1 and DEC2. By RT-qPCR and western blotting, we found that TGF-β increased the expression of podoplanin and mensenchymal markers (e.g., N-cadherin and vimentin), while decreased the expression of epithelial markers (e.g., Claudin-4 and E-cadherin), accompanied by Smad2 phosphorylation and slug activation. Moreover, TGF-β has different effects on the expression of DEC1 and DEC2, that is, it upregulates DEC1, but downregulates DEC2. Capability of cell proliferation, invasion and migration were further analyzed using CCK-8 assay, Matrigel-invasion assay, and the wound-healing assay, respectively. The proliferation, invasion and migration ability were significantly lost in podoplanin-knockdown cells when compared with the scrambled siRNA group. In addition to these changes, the expression of Claudin-4, but not that of Claudin-1 or E-cadherin, was induced by the siRNA against podoplanin. On the contrary, overexpression of DEC1 and DEC2 exhibits opposite effects on podoplanin, but only slight effect on Claudin-4 was detected. These data indicated that podoplanin is significantly associated with EMT of TE-11 cells, and may be directly or indirectly regulated by bHLH transcription factors DEC1 and DEC2.
The Disasters Emergency Committee (DEC) and the Humanitarian Industry in Britain, 1963-85.
Jones, Andrew
2015-01-01
This article explores the history of modern British humanitarianism. Specifically, it charts the rise of an extensive humanitarian aid 'industry' in Britain, between 1963 and 1985. It does so through a focus on the Disasters Emergency Committee (DEC), an umbrella body for joint emergency fundraising established in 1963. The DEC is an enduring and important presence in the British humanitarian landscape, as it brings together leading aid agencies to make fundraising campaigns on television after major disasters. This article represents the first systematic historical analysis of the DEC, which it uses to illuminate larger questions about the politics of non-state humanitarianism, state-voluntary sector relations, the political impact of television, and the end of empire. It is shown that while DEC appeals fuelled the growth of its members, this was also a problematic process. Many principal aid agencies wished to shift their focus away from short-term disaster relief work to tackling the long-term structural causes of global poverty instead. It is argued that, despite an increasing political focus, humanitarian organizations were constrained from doing so by the power of television; a perceived lack of public support; the interventions of the British government; and competition between aid agencies in a crowded marketplace. Consequently, continued involvement in short-term, apolitical emergency assistance remained a requirement even for agencies sceptical about its value and impact. This analysis complicates linear narratives of a transition from emergency relief to development aid in post-war British humanitarianism, instead presenting the period as characterized by competing and even contradictory trajectories.
A Public Presentations of Gendered Bodies: A Look at Gay and Lesbian Online Dating Profiles
Directory of Open Access Journals (Sweden)
Andrew Latinsky
2012-10-01
Full Text Available This paper examines how stereotypes and media presentations related to gender norms influence public presentations of gay men and lesbian women. Using online profiles from the online dating website Match.com, this paper examines the body types daters use to describe themselves, their ideal date, and if the poster has a photograph of themselves on their profile. These profiles are used as a method of observing public presentations that are in a unique situation to be tailored towards notions of publically displayed social desirability. Findings indicate that gay men present their online bodies as stereotypically masculine and athletic, while lesbian women are willing to display a slightly broader range of body types. In addition, regardless of gender, both gay men and lesbian women present their ideal dates as stereotypically attractive, with gay men having a particular affinity for dating athletic men. Regression analysis suggests that intersectional variables such as race and age influence a person’s willingness to display a profile picture in the public arena. Overall, this study concludes that heteronormative standards of masculinity combined with structural influences from both the media and peer groups likely have an impact on gay men’s ideal gendered body, while the comparative exclusion of lesbian women from these media influences allow other experiences of gender norms slightly more freedom.
Effects of mutants in bHLH region on structure stability and protein-DNA binding energy in DECs.
Kong, Yi; Wang, Zhen; Jia, Yanfei; Li, Ping; Hao, Shuhua; Wang, Yunshan
2017-07-01
The human DEC subfamily contains two highly conserved members belonging to basic helix-loop-helix (bHLH) transcription factors. This conserved family is spread widely among various species with the function of regulating various crucial molecular signaling pathways. Due to the significance of DECs for important biological processes, their relationship with diseases and the lack of experimentally proven structures, we have implemented a comparative modeling for the bHLH region of DECs as homodimers with themselves and heterodimers with HES-1. Three mutants with predicted roles in reducing intramolecular binding (H57A, R65A, and LL7879AA in DEC1 and LL7071AA in DEC2) were investigated on DEC monomers. Molecular dynamics (MD) simulations were also employed to evaluate the behavior of the mutant molecules in aqueous solution. The monomer was divided into subregions for accurate investigation. The fluctuation in the basic region of mutants was higher than that of wild-type molecules. The binding energy value between protein and DNA obviously increased in the homodimer harboring R65A mutants, which led to more unstable status between protein and DNA. Thus, the mutant R65A interfered DNA-binding affinity. A study on the spatial structures of wild-type and mutant DECs may facilitate functional prediction for mutation effects and dynamic behavior under various conditions and may ultimately help in targeted drug design.
Evaluation of Fall Planting Dates of Cumin (Cuminum cyminum L. Ecotypes in Mashhad Conditions
Directory of Open Access Journals (Sweden)
Z Khorasani
2012-07-01
Full Text Available In order to study the effects of fall planting dates on yield and yield components of six cumin (Cuminum cyminum L. ecotypes an experiment was arranged in a randomized complete block design as a split-plot with three replications during 2007-08 growing season at the Agricultural Research Station of Ferdowsi University of Mashhad. Three planting dates (18 Oct. (first, 8 Nov. (second and 29 Dec. (third and six cumin ecotypes (Torbat heydarieh, Khaf, Sabzevar, Ghaen, Ghoochan and RZ19 were allocated to main and sub plots, respectively. Results showed that the effects of planting dates, ecotypes and interaction effects of planting dates and cumin ecotypes were significant for yield components (winter survival percentage, number of umbel per plant, number of seeds per umbel and 1000-seed weight and seed yield and biological yield. There was a reduction on yield components (number of umbel per plant, number of seeds per umbel and 1000-seed weight, seed yield and biological yield due to delay planting date from 18 Oct. to 29 Dec. The highest winter survival percentage was achieved on the third planting date. The highest and lowest amount for all of the traits, were achieved in Ghaen and RZ19 ecotypes, respectively. According to the useful results and for the deployment of cumin fall planting in other locations of province, continuation of this study to recommended.
Stream traffic data archival, querying, and analysis with TransDec.
2011-01-01
The goal of research was to extend the traffic data analysis of the TransDec (short for : Transportation Decision-Making) system, which was developed under METRANS 09-26 : research grant. The TransDec system is a real-data driven system to support de...
NASA ARCH- A FILE ARCHIVAL SYSTEM FOR THE DEC VAX
Scott, P. J.
1994-01-01
The function of the NASA ARCH system is to provide a permanent storage area for files that are infrequently accessed. The NASA ARCH routines were designed to provide a simple mechanism by which users can easily store and retrieve files. The user treats NASA ARCH as the interface to a black box where files are stored. There are only five NASA ARCH user commands, even though NASA ARCH employs standard VMS directives and the VAX BACKUP utility. Special care is taken to provide the security needed to insure file integrity over a period of years. The archived files may exist in any of three storage areas: a temporary buffer, the main buffer, and a magnetic tape library. When the main buffer fills up, it is transferred to permanent magnetic tape storage and deleted from disk. Files may be restored from any of the three storage areas. A single file, multiple files, or entire directories can be stored and retrieved. archived entities hold the same name, extension, version number, and VMS file protection scheme as they had in the user's account prior to archival. NASA ARCH is capable of handling up to 7 directory levels. Wildcards are supported. User commands include TEMPCOPY, DISKCOPY, DELETE, RESTORE, and DIRECTORY. The DIRECTORY command searches a directory of savesets covering all three archival areas, listing matches according to area, date, filename, or other criteria supplied by the user. The system manager commands include 1) ARCHIVE- to transfer the main buffer to duplicate magnetic tapes, 2) REPORTto determine when the main buffer is full enough to archive, 3) INCREMENT- to back up the partially filled main buffer, and 4) FULLBACKUP- to back up the entire main buffer. On-line help files are provided for all NASA ARCH commands. NASA ARCH is written in DEC VAX DCL for interactive execution and has been implemented on a DEC VAX computer operating under VMS 4.X. This program was developed in 1985.
17 CFR 232.13 - Date of filing; adjustment of filing date.
2010-04-01
..., shall not affect the date of filing. (2) If the conditions of paragraph (a)(1) of this section are... and consistent with the public interest and the protection of investors. (c) Payment of fees. Fees...
Siemionow, Maria; Cwykiel, Joanna; Heydemann, Ahlke; Garcia, Jesus; Marchese, Enza; Siemionow, Krzysztof; Szilagyi, Erzsebet
2018-06-01
Duchenne Muscular Dystrophy (DMD) is a progressive and lethal disease caused by mutations of the dystrophin gene. Currently no cure exists. Stem cell therapies targeting DMD are challenged by limited engraftment and rejection despite the use of immunosuppression. There is an urgent need to introduce new stem cell-based therapies that exhibit low allogenic profiles and improved cell engraftment. In this proof-of-concept study, we develop and test a new human stem cell-based approach to increase engraftment, limit rejection, and restore dystrophin expression in the mdx/scid mouse model of DMD. We introduce two Dystrophin Expressing Chimeric (DEC) cell lines created by ex vivo fusion of human myoblasts (MB) derived from two normal donors (MB N1 /MB N2 ), and normal and DMD donors (MB N /MB DMD ). The efficacy of fusion was confirmed by flow cytometry and confocal microscopy based on donor cell fluorescent labeling (PKH26/PKH67). In vitro, DEC displayed phenotype and genotype of donor parent cells, expressed dystrophin, and maintained proliferation and myogenic differentiation. In vivo, local delivery of both DEC lines (0.5 × 10 6 ) restored dystrophin expression (17.27%±8.05-MB N1 /MB N2 and 23.79%±3.82-MB N /MB DMD ) which correlated with significant improvement of muscle force, contraction and tolerance to fatigue at 90 days after DEC transplant to the gastrocnemius muscles (GM) of dystrophin-deficient mdx/scid mice. This study establishes DEC as a potential therapy for DMD and other types of muscular dystrophies.
26 CFR 1.1362-7 - Effective dates.
2010-04-01
...) INCOME TAXES Small Business Corporations and Their Shareholders § 1.1362-7 Effective dates. (a) In... consideration the statute; its legislative history; the provisions of §§ 18.1362-1 through 18.1362-5 (see 26 CFR... 26 Internal Revenue 11 2010-04-01 2010-04-01 true Effective dates. 1.1362-7 Section 1.1362-7...
26 CFR 1.383-0 - Effective date.
2010-04-01
... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Effective date. 1.383-0 Section 1.383-0 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.383-0 Effective date. (a) The regulations under section 383 (other...
26 CFR 1.547-7 - Effective date.
2010-04-01
... TAXES (CONTINUED) Personal Holding Companies § 1.547-7 Effective date. The deduction for deficiency dividends, in computing personal holding company tax for any taxable year, is allowable only with respect to... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Effective date. 1.547-7 Section 1.547-7 Internal...
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.7258 >orf19.7258; Contig19-2507; 88880..89851; DDI1*; response to DNA alkyl...ation; MQLTISLDHSGDIISVDVPDSLCLEDFKAYLSAETGLEASVQVLKFNGRELVGNATLSELQIHDNDLLQLSKKQVA
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ruitment factor; MAKTRSKSAATAAATSPKASPTAAKVTKNKVTKPSTASPSKTTKTKAVKKTTTKKATPKKEEEEKK... Ca19AnnotatedDec2004aaSeq orf19.124 >orf19.124; Contig19-10035; 67601..68698; CIC1*; protease substrate rec
Annals of Medical and Health Sciences Research – Jul. - Dec., 2011 ...
African Journals Online (AJOL)
EGOLUM
2011-12-22
Dec 22, 2011 ... Annals of Medical and Health Sciences Research – Jul. – Dec., 2011 – Vol. ... Method: The study was a cross-sectional survey of pregnant women in Enugu; South-East Nigeria. The ..... Medical Encyclopedia. {Assessed on ...
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.4748 >orf19.4748; Contig19-10215; complement(47336.....47731); MSL1*; U2 snRNA-associated protein; MPSTKRSSSTEYSHKDSKKKVKLDYVNLKPSQTLYVKNLNTKINKKILLHNLYLLFSAFGDIISINLQNGFAFIIFSNLNSATLALRNLKNQDFFDKPLVLNYAVKESKAISQEKQKLQDENDEEVMPSYE*
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.2370 >orf19.2370; Contig19-10147; complement(50671..52716); DSL1*; retrogra...de ER-to-golgi transport; MPSIEQQLEDQELYLKDIEQNINKTLSKINKTTLENDNDFRKQFEEIPQDSNTTESN
MetaUniDec: High-Throughput Deconvolution of Native Mass Spectra
Reid, Deseree J.; Diesing, Jessica M.; Miller, Matthew A.; Perry, Scott M.; Wales, Jessica A.; Montfort, William R.; Marty, Michael T.
2018-04-01
The expansion of native mass spectrometry (MS) methods for both academic and industrial applications has created a substantial need for analysis of large native MS datasets. Existing software tools are poorly suited for high-throughput deconvolution of native electrospray mass spectra from intact proteins and protein complexes. The UniDec Bayesian deconvolution algorithm is uniquely well suited for high-throughput analysis due to its speed and robustness but was previously tailored towards individual spectra. Here, we optimized UniDec for deconvolution, analysis, and visualization of large data sets. This new module, MetaUniDec, centers around a hierarchical data format 5 (HDF5) format for storing datasets that significantly improves speed, portability, and file size. It also includes code optimizations to improve speed and a new graphical user interface for visualization, interaction, and analysis of data. To demonstrate the utility of MetaUniDec, we applied the software to analyze automated collision voltage ramps with a small bacterial heme protein and large lipoprotein nanodiscs. Upon increasing collisional activation, bacterial heme-nitric oxide/oxygen binding (H-NOX) protein shows a discrete loss of bound heme, and nanodiscs show a continuous loss of lipids and charge. By using MetaUniDec to track changes in peak area or mass as a function of collision voltage, we explore the energetic profile of collisional activation in an ultra-high mass range Orbitrap mass spectrometer. [Figure not available: see fulltext.
... Room Social Media Publications Injury Center Teen Dating Violence Recommend on Facebook Tweet Share Compartir On This ... serious forms of violence. What is teen dating violence? Teen Dating Violence [550 KB, 2 Pages, 508] ...
Energy Technology Data Exchange (ETDEWEB)
Carpenter, Charles [Waste Policy Institute, Blacksburg, VA (United States)
1992-07-01
This paper presents information, examples, and opinions leading to the authors conclusions on practical dates for phase-out of 1,1,2-trichloro-1,1,2-trifluoroethane (CFC-113) and 1,1,1 trichloroethane (mythyl chloroform) when used as industrial solvents and cleaners. The dates refer to an expected Amendment to the Montreal Protocol. The paper is based on information obtained from the Department of Energy, the Air Force, from author participation on the United Nations Environmental Panel Solvents, Coatings, and Adhesives Technical Options Committee, and from recent publications. The paper informs the reader of impending legislature, possible impacts of that legislature, and of less obvious requirements which will impact cost of compliance and will extend the time required to reach compliance. The purpose of the paper is show users of CFC-113 and 1,1,1-trichloroethane the legal and moral necessity of rapid phase-out of those chemicals, point the user in the right direction for long-term solutions, and urge lawmakers to balance the need for action with the realities of the technical and economic situation. (author)
International Nuclear Information System (INIS)
Carpenter, Charles
1992-01-01
This paper presents information, examples, and opinions leading to the authors conclusions on practical dates for phase-out of 1,1,2-trichloro-1,1,2-trifluoroethane (CFC-113) and 1,1,1 trichloroethane (mythyl chloroform) when used as industrial solvents and cleaners. The dates refer to an expected Amendment to the Montreal Protocol. The paper is based on information obtained from the Department of Energy, the Air Force, from author participation on the United Nations Environmental Panel Solvents, Coatings, and Adhesives Technical Options Committee, and from recent publications. The paper informs the reader of impending legislature, possible impacts of that legislature, and of less obvious requirements which will impact cost of compliance and will extend the time required to reach compliance. The purpose of the paper is show users of CFC-113 and 1,1,1-trichloroethane the legal and moral necessity of rapid phase-out of those chemicals, point the user in the right direction for long-term solutions, and urge lawmakers to balance the need for action with the realities of the technical and economic situation. (author)
Information Impact Vol. 6(3) Dec 2015
African Journals Online (AJOL)
2015-12-10
Dec 10, 2015 ... a case study of University of Lagos, 3 faculties within the university constituted the study population ... career advancement, women, academics, information communication ... provides a great development opportunity and.
The 2016 CIOMS guidelines and public-health research ethics
African Journals Online (AJOL)
2017-12-01
Dec 1, 2017 ... CIOMS International Ethical Guidelines for Biomedical Research Involving ... mention of public health in relation to social value. • The new guideline 7, .... reports, can be obtained from conventional media sources such as.
Information Impact Vol. 6(3) Dec 2015
African Journals Online (AJOL)
2015-12-10
Dec 10, 2015 ... was small. ... organizational effectiveness and one of such .... Instead, contingency-situation theories were developed to indicate that ... development, a company will experience ..... Journal of Applied Psychology 53,. 87-92.
Shimokawa, Takuya; Shoda, Makoto; Sugano, Yasushi
2009-02-01
DyP isozymes (DyP2 and DyP3) from the culture fluid of the fungus Thanatephorus cucumeris Dec 1 by air-membrane surface bioreactor were purified and characterized. The characteristics of DyP2 were almost the same as those of a recombinant DyP reported previously, but different from DyP3.
Information Impact Vol. 6(3) Dec 2015
African Journals Online (AJOL)
2015-12-10
Dec 10, 2015 ... 2Justice Development and Peace Commission, Onitsha, Nigeria ... Community information comprises of services offered by libraries and information ... poor and marginalized groups to improve their standard of living and ...
ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.6649; Contig19-10251; complement(36800..38461); BR...87398.1| ... TFIIB related subunit of TFIIIB (BRF1) [Candida ... albicans] pir||B55483 transcr...L Transcription factor IIIB 70 kDa ... subunit (TFIIIB) (B-related factor)
ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.2029; Contig19-10139; 79190..80278; RFC5*; DNA replicationn factor C | lead...ing strand elongation mismatch repair ... (ATPase); >1a5t0 2 329 7 339 1e-22 ... gb|EAL00
EAMJ The Prevalence Dec 09.indd
African Journals Online (AJOL)
2009-12-12
Dec 12, 2009 ... Case definitions: The primary outcome was having a documented ADR after exposure to HAART. The cases were defined according to the guidelines contained in the Kenya National Clinical Manual for. ART providers (8), which mainly follows the criteria used by the AIDSClinical Trials Group (ACTG) (9).
289-- 14 Dec 2009 [Final Version].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... tragedy in a sea of simplifications. The complex .... Different levels of communication often sharpen the discussion. ... resistance, mounting costs and rising discontent on the home front' in ... of Evangelicals in Orlando, Florida).
26 CFR 1.846-4 - Effective/applicability date.
2010-04-01
... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Effective/applicability date. 1.846-4 Section 1.846-4 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Other Insurance Companies § 1.846-4 Effective/applicability date. (a) In general...
195--10 Dec 2009 [ Final version].indd
African Journals Online (AJOL)
2009-12-10
Dec 10, 2009 ... Accepted: 25 June 2009. Published: ... This paper will focus on the Leuenberg Agreement as a possible ... to confuse the true meaning of the Confession. ... Differences were minimalised as a matter of terminology and words.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Protection of victims of domestic violence, dating violence, and stalking in public and Section 8 housing. 5.2005 Section 5.2005 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development GENERAL HUD PROGRAM REQUIREMENTS; WAIVERS Protection for...
Public health officials and MECs for health should be held criminally ...
African Journals Online (AJOL)
2017-12-01
Dec 1, 2017 ... MEC and his colleagues award the same company a service contract ... the intention to kill; (ii) the person's act or omission was unlawful; ..... Director of Public Prosecution Gauteng v Pistorius 2016(1) SACR 431 (SCA). 6.
283---14 Dec 2009 [ Final version].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... the removal of artificial, man-made barriers' (Stiglitz 2003:xviii). This definition focuses on ..... States that have signed on to the WTO face losing 'most- ..... Retrenched women clothing workers cannot find work in the regulated,.
Bancroftian filariasis: long-term effect of the DEC provocative day test on microfilaraemia
DEFF Research Database (Denmark)
Simonsen, Poul Erik; Meyrowitsch, Dan Wolf; Makunde, W.H.
1997-01-01
The diethylcarbamazine (DEC) provocative day test has been widely used for daytime diagnosis of Wuchereria bancrofti infections in areas where microfilariae exhibit nocturnal periodicity. Since DEC is also the primary drug for treatment of bancroftian filariasis, we examined the long term effect...... amicrofilaraemic. No significant reduction of microfilaraemia was observed in the placebo group. The results imply that the DEC provocative day test should not be used as a diagnostic tool in follow-up studies on microfilaraemias....
276----14 Dec 2009 [Final version].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... study of authors themselves (the literate few) and in studies of analogy and ..... power. The expectation of future vindication, even taking part in divine judgment ...... Anna Rebecca Solevåg (PhD candidate, Oslo. University ...
322--14 Dec 2009 [Final version].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... Attribution License. 581. Vol. 65 No. ... are at this time of global financial crisis despite the historic moment in United States and world politics that occurred .... its theory gave rise to the category of 'anti-societal language'. His.
OVERVIEW OF ADVANCED PETROLEUM-BASED FUELS-DIESEL EMISSIONS CONTROL PROGRAM (APBF-DEC)
Energy Technology Data Exchange (ETDEWEB)
Sverdrup, George M.
2000-08-20
The Advanced Petroleum-Based Fuels-Diesel Emissions Control Program (APBF-DEC) began in February 2000 and is supported by government agencies and industry. The purpose of the APBF-DEC program is to identify and evaluate the optimal combinations of fuels, lubricants, diesel engines, and emission control systems to meet the projected emission standards for the 2000 to 2010 time period. APBF-DEC is an outgrowth of the earlier Diesel Emission Control-Sulfur Effects Program (DECSE), whose objective is to determine the impact of the sulfur levels in fuel on emission control systems that could lower the emissions of NOx and particulate matter (PM) from diesel powered vehicles in the 2002 to 2004 period. Results from the DECSE studies of two emission control technologies-diesel particle filter (DPF) and NOx adsorber-will be used in the APBF-DEC program. These data are expected to provide initial information on emission control technology options and the effects of fuel properties (including additives) on the performance of emission control systems.
Reich, Mike
2015-12-03
The dates of publication of Hubert Ludwig's (1852-1913) comprehensive monograph Die Seewalzen [= Sea cucumbers] are reviewed. The precise publication dates of his volume, originally published in 16 fascicles and 8 parts/issues, delivered between 1889 and 1892, has been re-examined. Additionally, a short biographical note on Hubert Ludwig's life and a discussion of all new taxa introduced by him in his monograph is given.
Information Impact Vol. 6(3) Dec 2015
African Journals Online (AJOL)
2015-12-10
Dec 10, 2015 ... Selective Dissemination of Information (SDI) Services in a Nigerian University: A. Report. 75. Information ... that Libraries that are ICT driven have continued to provide ... take advantage of technology in providing reference and .... 6. Teaching Profile ... history, Varieties of English,. English. Syntax/Semantics,.
299---09 Dec 2009 [Final version].indd
African Journals Online (AJOL)
2009-12-09
Dec 9, 2009 ... a country is going, the politics, social justice, whether elections will be ... money laundering, human trafficking and sexual exploitation, sex tourism, the ... to the transformation and improvement of education, including affordability and access. ..... extent do individuals and groups learn from their failures.
310---11 Dec 2009 [ Final version].indd
African Journals Online (AJOL)
2009-12-11
Dec 11, 2009 ... sola fides. God has done all this in his love and his sovereignty, ..... them across Europe to countries such as Scotland, England,. Italy and .... faith is, the seed of the word has preceded; where there is preaching there is the ...
299---09 Dec 2009 [Final version].indd
African Journals Online (AJOL)
2009-12-09
Dec 9, 2009 ... money laundering, human trafficking and sexual exploitation, sex ... to the transformation and improvement of education, including affordability and access. ... A greater understanding of differences, and what gives rise to them, will hopefully lead to ..... The bridging function of spirituality is premised by two.
Effects of different levels of nitrogen fertilizer and sowing dates on
Directory of Open Access Journals (Sweden)
korosh ehteramian
2009-06-01
Full Text Available The purpose of this research was to determine the optimal level of nitrogen fertilizer and planting date for cumin (Cuminum cyminum L. planting in Kooshkak region located in Doroodzan Dam Areas which represents a typical semiarid region. This research was carried out in the fall and winter 2000 and using a factorial experiment with two factors based on completely randomized block design with nitrogen fertilizer at three rates (0, 30, and 60 kg N ha-1 and sowing date (Nov. 6th, Dec. 21th, Feb. 6th, and March 6th in four replications. The effects of different nitrogen rates were significant on plant height, number of umbrella per plant and number of seed per umbrella, but it was not significant on number of seeds per plant, 1000-seed weight, biological yield, seed yield and harvest index. The effects of sowing dates were significant on number of seeds per umbrella, number of seeds per plant; 1000-seed weight, biological yield and seed yield; but it was not significant on plant height and harvest index. The interaction of nitrogen rates and sowing dates were significant on plant height, number of umbrella per plant and seed yield, but it was not significant on number of seeds per umbrella, number of seeds per plant, 1000-seed weight, biological yield and harvest index. It was concluded that for obtaining the high cumin yield, application of 30 kg N ha-1 and the late planting date (February 6th and March 6th due to probable winter cold, are recommended for this region.
ORF Alignment: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available chizosaccharomyces pombe] ref|NP_594201.1| spindle poison ... sensitivity related protein. [Schizosac...charomyces pombe] ... pir||T11624 spindle poison sensitivity protein - fis...inger protein | spindle poison sensitivity related protein; >1rgoA 8 70 40 92 2e-04 ... emb|CAB16391.1| scp3 [S... Ca19AnnotatedDec2004aaSeq orf19.7385; Contig19-2513; 105328..106833; LEE1*; zinc f
Spectral Estimation by the Random Dec Technique
DEFF Research Database (Denmark)
Brincker, Rune; Jensen, Jacob L.; Krenk, Steen
1990-01-01
This paper contains an empirical study of the accuracy of the Random Dec (RDD) technique. Realizations of the response from a single-degree-of-freedom system loaded by white noise are simulated using an ARMA model. The Autocorrelation function is estimated using the RDD technique and the estimated...
Spectral Estimation by the Random DEC Technique
DEFF Research Database (Denmark)
Brincker, Rune; Jensen, J. Laigaard; Krenk, S.
This paper contains an empirical study of the accuracy of the Random Dec (RDD) technique. Realizations of the response from a single-degree-of-freedom system loaded by white noise are simulated using an ARMA model. The Autocorrelation function is estimated using the RDD technique and the estimated...
Indian Academy of Sciences (India)
client1
2007-12-05
Dec 5, 2007 ... glycerol and aminoacids such as alanine and proline. They are believed to stabilize cellular proteins and membranes at low temperature and hence called cryoprotectants. The cryoprotec- tive role of glycine betaine (GB) in bacteria is beginning to be understood. Antifreeze Proteins: An Overview. Birds ...
319----14 Dec 2009.indd [Final version].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... Creative Commons. Attribution License. 545 ..... this money on an alternative and apparently 'lawful' project, a burial field for foreigners .... Ultimately, however, the success or failure of the Jewish political campaign to discredit ...
Information Impact Vol. 6(3) Dec 2015
African Journals Online (AJOL)
2015-12-10
Dec 10, 2015 ... East zone of Nigeria was examined through a descriptive survey. ... Variables and Utilization (QOLBUVAU) making a return rate of 86.6%. ... sampling technique was adopted as the respondents vary in size ... the structure and location of the library in ... the reviewed literature in this study. ..... The decision.
320--14 dec 2009 [Final version].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... Original Research: Boston Papers. A ... From a macro-narrative perspective, the dynamics of Jesus' healing ... After a close reading of these textual exchanges, I suggest that each of these .... critically, this paper will focus on the four Matthean healing ... of economics and the structural dynamics of exchange.
311----10 Dec 2009 [ Final version].indd
African Journals Online (AJOL)
2009-12-10
Dec 10, 2009 ... Fighting crime in the new South Africa has taken on new challenges under a ... spurred on by Gordon MacDonald's own 'renewed challenge of insisting that my life of following ... Postfoundationalism has emerged from the work of Wentzel van Huyssteen .... contribute to providing a solution in this regard.
161---8 Dec 2009.indd [final version].indd
African Journals Online (AJOL)
2009-12-08
Dec 8, 2009 ... The theory is attractive to practical theologians for two reasons. ... They consider conforming to principles to be of more importance than cultivating harmony. ...... Francis, L.J. & Atkins, P., 2000, Exploring Luke's Gospel: A guide.
127 -08 Dec 2009.indd [FINAL VERSION].indd
African Journals Online (AJOL)
2009-12-08
Dec 8, 2009 ... (as opposed to it being entirely superseded by a new 'Christian' identity) and interpreting him as still operating .... the rich enterprise of cultural or social anthropology. ...... millennial hopes were not realised by Paul's messiah.
26 CFR 1.846-4T - Effective dates (temporary).
2010-04-01
... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Effective dates (temporary). 1.846-4T Section 1.846-4T Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Other Insurance Companies § 1.846-4T Effective dates (temporary). (a) [Reserved...
Vært for @AUforsker på Twitter 5.-11. dec. 2013
DEFF Research Database (Denmark)
Damkjaer, Maja Sonne
2013-01-01
@AUforsker på Twitter: Uafhængigt drevet af forskere fra Aarhus Uni. En forsker = en uge. Bliv klogere på vores forskning, undervisning og hverdag. 5.-11. dec. 2013 bestyret af @Majasdamkjaer Aarhus University, Denmark · au.dk......@AUforsker på Twitter: Uafhængigt drevet af forskere fra Aarhus Uni. En forsker = en uge. Bliv klogere på vores forskning, undervisning og hverdag. 5.-11. dec. 2013 bestyret af @Majasdamkjaer Aarhus University, Denmark · au.dk...
280---14 Dec 2009 [Final version].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... principles which are derived from the covenant order of communion. Ellul (in Kraus .... of a status confessionis refers to the practice of the church as well as to its teaching. .... east Asian countries (except Malaysia), the International. Monetary ... a significant rise in taxes on consumption (VAT). As a result,.
151---8 Dec 2009.indd [ Final version].indd
African Journals Online (AJOL)
2009-12-08
Dec 8, 2009 ... and sustained polemic against Paul himself. (Sim 2002:777). Here Sim .... implicit points resemble Luke's more explicit presentation in .... I now turn my attention. Matthew's ...... in memory of William G. Thompson, pp. 22–41 ...
We Cannot Walk Away: DEC's Position of Child Abuse, Neglect, and Trauma
Corr, Catherine
2016-01-01
This article details two important reasons why supporting young children with disabilities who have experienced abuse and neglect and their families is the responsibility and obligation of the Division for Early Childhood of the Council for Exceptional Children (DEC): (1) Although prevalent in their work, this population is overlooked; and (2)…
Low, Martyn E Y; Evenhuis, Neal L
2013-01-01
The dates of publication and exact titles of the 83 parts of the Zoology of the Report of the Scientific Results of the Voyage of H.M.S. Challenger During the Years 1873-76 are presented. Exact dates of publication for 71 of these parts have been determined using notices of their publication in contemporary publications. The dates of publication of the two Narrative volumes of the voyage of the H.M.S. Challenger (which contain available indications of new names) are also determined.
124---14 Dec 2009.indd [FINAL VERSION].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... convinced as Danny Postel (2006:15) was three years ago, during the most .... Every forty days, the masses re-appeared to mourn, as Shi'ite. Muslims do, the ...... the modernising of Islamic countries in a European fashion.
164----8 Dec 2009 [Final Version].indd
African Journals Online (AJOL)
2009-12-08
Dec 8, 2009 ... the issues in such struggles for justice appear more straightforward to outsiders than they do to ... that produced them, as well as the idea of the gospels as mirrors simply reflecting the ..... such counter-cultural reading communities must never ... to point to the way in which hegemony limits the possibility of.
325-- 11 Dec 2009 [ Final version].indd
African Journals Online (AJOL)
2009-12-11
Dec 11, 2009 ... with some light clouds and there are no clouds without water; as there are no birds ... food security as a high priority in many countries. Water and .... The above reasons for the availability of water resources reiterate that all living ... government infrastructure at various levels of agreement and not necessarily ...
Meshes optimized for discrete exterior calculus (DEC).
Energy Technology Data Exchange (ETDEWEB)
Mousley, Sarah C. [Univ. of Illinois, Urbana-Champaign, IL (United States); Deakin, Michael [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Knupp, Patrick [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Mitchell, Scott A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2017-12-01
We study the optimization of an energy function used by the meshing community to measure and improve mesh quality. This energy is non-traditional because it is dependent on both the primal triangulation and its dual Voronoi (power) diagram. The energy is a measure of the mesh's quality for usage in Discrete Exterior Calculus (DEC), a method for numerically solving PDEs. In DEC, the PDE domain is triangulated and this mesh is used to obtain discrete approximations of the continuous operators in the PDE. The energy of a mesh gives an upper bound on the error of the discrete diagonal approximation of the Hodge star operator. In practice, one begins with an initial mesh and then makes adjustments to produce a mesh of lower energy. However, we have discovered several shortcomings in directly optimizing this energy, e.g. its non-convexity, and we show that the search for an optimized mesh may lead to mesh inversion (malformed triangles). We propose a new energy function to address some of these issues.
131-7 Dec 2009.indd [FINAL VERSION].indd
African Journals Online (AJOL)
2009-12-07
Dec 7, 2009 ... This interpretation of love that Jesus offers in his story gives ... philosophy, shed light on a possible new reading of sacred texts in which the question of identity ... neither can a home (oikos) offer hospitality to all as that would.
161---8 Dec 2009.indd [final version].indd
African Journals Online (AJOL)
2009-12-08
Dec 8, 2009 ... United Kingdom population norms, preachers within this sample were ... University of Warwick, .... hand, feeling types make judgements based on subjective, personal values. ... and female Bible College students (Francis, Penson & Jones. 2001) .... link between psychological type preference and choice of.
309 ----10 Dec 2009 [Final version].indd
African Journals Online (AJOL)
2009-12-10
Dec 10, 2009 ... parable showed traces of the sola fidei principle of the Reformation, .... (j. Sanh. 6.23c par; j. Hagh. 2.77). This folk-tale ends where Bar .... Egyptian and Jewish accounts. ...... (1989:151), the dogs that licked Lazarus are most probably wild .... and to finance his extravagant building projects (the building of ...
286---15 Dec 2009.indd [Final version] .indd
African Journals Online (AJOL)
2009-12-15
Dec 15, 2009 ... on economic ethics to assess economic processes in relation to how they serve life. ... justice and fellowship – as gifts of God – that serve as an orientation ..... total ban, and pleaded for money to be allowed to make a profit,.
Wadwa, Munisch; Klopfleisch, Robert; Buer, Jan; Westendorf, Astrid M.
2016-01-01
The endocytotic c-type lectin receptor DEC-205 is highly expressed on immature dendritic cells. In previous studies, it was shown that antigen-targeting to DEC-205 is a useful tool for the induction of antigen-specific Foxp3+ regulatory T cells and thereby can prevent inflammatory processes. However, whether this approach is sufficient to mediate tolerance in mucosal tissues like the gut is unknown. In this study, we established a new mouse model in which the adoptive transfer of naive hemagglutinin (HA)-specific CD4+Foxp3– T cells into VILLIN-HA transgenic mice leads to severe colitis. To analyze if antigen-targeting to DEC-205 could protect against inflammation of the gut, VILLIN-HA transgenic mice were injected with an antibody–antigen complex consisting of the immunogenic HA110–120 peptide coupled to an α-DEC-205 antibody (DEC-HA) before adoptive T cell transfer. DEC-HA-treated mice showed significantly less signs of intestinal inflammation as was demonstrated by reduced loss of body weight and histopathology in the gut. Strikingly, abrogated intestinal inflammation was mediated via the conversion of naive HA-specific CD4+Foxp3– T cells into HA-specific CD4+Foxp3+ regulatory T cells. In this study, we provide evidence that antigen-targeting to DEC-205 can be utilized for the induction of tolerance in mucosal organs that are confronted with large numbers of exogenous antigens. PMID:27141310
48 CFR 952.204-75 - Public affairs.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Public affairs. 952.204-75... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.204-75 Public affairs. As prescribed in 904.7201, insert the following clause: Public Affairs (DEC 2000) (a) The Contractor must...
272--11 Dec 2009 [final version].indd
African Journals Online (AJOL)
2009-12-11
Dec 11, 2009 ... e o lo g ic a l S tu d ie s http://www.hts.org.za. HTS. Original Research. A rtic le # .... of departure is only possible due to an extra-biblical maxim, to ... John Hart points out ...... Jean-Pierre Changeaux and the philosopher Paul Ricoeur, is ..... De Cruchy, J.W., 1986, The church struggle in South Africa, Collins.
ePESSTO reclassification of SN2018bsz as the lowest redshift SLSN to date
Anderson, J. P.; Dessart, Luc; Pessi, P.; Smartt, S. J.; Inserra, C.; Leloudas, G.; Roy, R.; Gal-Yam, A.; Tonry, J.; Denneau, L.; Heinze, A.; Weiland, H.; Rest, B. Stalder A.; Smith, K. W.; McBrien, O.; Young, D. R.; Wright, D. E.
2018-05-01
ePESSTO, the extended Public ESO Spectroscopic Survey for Transient Objects (see Smartt et al. 2015, A & A, 579, 40 http://www.pessto.org), reports a reclassification of SN2018bsz (RA=16:09:39.19, DEC=-32:03:45.2).
153--7 Dec 2009.indd [FINAL VERSION].indd
African Journals Online (AJOL)
2009-12-07
Dec 7, 2009 ... Over the past century, many Western mission agencies and ... regard to travel.3 During this time, the evangelical movement influenced Korean Christians to become involved in world ... well as effective mission strategies and policies for the mature .... 'I have had no difficulties in adapting to the culture and.
DEFF Research Database (Denmark)
Kristensen, Kasper; Jørgensen, Poul; Jansik, Branislav
2012-01-01
We demonstrate that the divide-expand-consolidate (DEC) scheme – which has previously been used to determine the second-order Møller–Plesset (MP2) correlation energy – can be applied to evaluate the MP2 molecular gradient in a linear-scaling and embarrassingly parallel manner using a set of local......-box manner to ensure that the error in the DEC-MP2 correlation energy compared to a standard MP2 calculation is proportional to a single input threshold denoted the fragment optimization threshold (FOT). The FOT also implicitly controls the error in the DEC-MP2 molecular gradient as substantiated...... by a theoretical analysis and numerical results. The development of the DEC-MP2 molecular gradient is the initial step towards calculating higher order energy derivatives for large molecular systems using the DEC framework, both at the MP2 level of theory and for more accurate coupled-cluster methods....
185---11 Dec 2009.indd Final version].indd
African Journals Online (AJOL)
2009-12-11
Dec 11, 2009 ... period conceptions of how to live, despite death, coram Deo. ... analysing the moral sensitivities within these ancient holy texts without ... answer to the first question: No, not in any direct manner (what Smit [1992:316] terms deontological and .... is the case too now that hardly any Christian theologian of the.
26 CFR 1.860-5 - Effective date.
2010-04-01
... real estate investments trusts. Section 859 (as in effect before the enactment of the Revenue Act of... 26 Internal Revenue 9 2010-04-01 2010-04-01 false Effective date. 1.860-5 Section 1.860-5 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME...
318----14 Dec 2009.indd [ final version].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... in social behaviour and thinking, including those relating to cosmology ... exercise power through the global economy, as well as by means of their military and ..... local forms of Israelite religion in the face of pressures from the hierocratic .... expression 'telling' is used to refer to a probable act of Jesus (the.
Avaliação da anatomia de molares decíduos por meio de microtomografia computadorizada
Ana Caroline Fumes
2013-01-01
O conhecimento prévio da anatomia interna e externa dos dentes decíduos é de fundamental importância para o sucesso do tratamento endodôntico. O objetivo do presente estudo foi analisar a morfologia das raízes e dos canais radiculares de molares decíduos superiores e inferiores, por meio de microtomografia computadorizada (micro-CT). Foram usados 40 molares decíduos, divididos em quatro grupos, sendo 10 primeiros molares inferiores, 10 segundos molares inferiores, 10 primeiros molares superio...
DEFF Research Database (Denmark)
Simonsen, Paul E; Magesa, Stephen M; Meyrowitsch, Dan W
2005-01-01
The effect of eight half-yearly treatment rounds with diethylcarbamazine (DEC; 6mg/kg bodyweight) on Wuchereria bancrofti-specific circulating filarial antigen (CFA), a marker of adult worm infection, was followed in 79 individuals who were CFA-positive before start of treatment. Half of these we...... values. Repeated DEC therapy thus appears to have a slow but profound and persistent macrofilaricidal effect, which in the long run may be beneficial to populations undergoing DEC-based control interventions by reducing the probability of future morbidity development....
167-- 8 Dec 2009.indd [FINAL VESION].indd
African Journals Online (AJOL)
2009-12-08
Dec 8, 2009 ... canonical scriptures – in the reformed tradition – and were therefore deemed unworthy of dogma and proclamation (Kaiser 2004:6). They could be used for teaching – as the Belgic Confession states – but this rarely, if at all, happened in a reformed congregation. However, a few factors have contributed to a ...
Aplicação do triglicerídeos de cadeia média (TCM na prevenção de úlceras de decúbito
Directory of Open Access Journals (Sweden)
Vânia Declair
1994-03-01
Full Text Available Aproximadamente 75.000 das 1.000.000 pessoas hospitalizadas a cada ano desenvolvem Úlceras de Decúbito. Graças à tecnologia avançada, hoje temos várias opções de tratamento destas úlceras, ainda que isto seja dispendioso para os pacientes e hospitais. Porém, melhor que desenvolver um processo curativo, é poder desenvolver um processo preventivo eficaz. Com o objetivo de avaliar a eficácia do uso tópico de triglicerídeos de cadeia média (TCM na prevenção de Úlceras de Decúbito, a autora utilizou o método duplo-cego em 86 pacientes, onde 50% foi submetido ao uso de solução com TCM e 50% ao uso Solução Glicerinada. Em ambos os casos, houve diminuição da instalação de Úlceras de Decúbito, porém, dos pacientes que se submeteram ao uso de solução com TCM, apenas de 2 (dois desenvolveram Úlcera de Decúbito (Grau 1; e dos pacientes que se submeteram ao uso de Solução com Glicerina, 12 (doze desenvolveram Úlcera de Decúbito (Graus 1 e 2. Concluiu-se que o TCM é de grande auxílio na prevenção de Úlceras de Decúbito, tem excelente absorção para uso tópico, forma uma película protetora à pele, previne escoriações devido à sua alta capacidade de hidratação e proporciona nutrição celular local.
41 CFR 101-39.102-2 - Effective date of determination.
2010-07-01
... VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 101-39.102-2 Effective date of determination. Unless a longer time is... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Effective date of...
Automation of TL brick dating by ADAM-1
International Nuclear Information System (INIS)
Cechak, T.; Gerndt, J.; Hirsl, P.; Jirousek, P.; Kubelik, M.; Musilek, L.; Kanaval, J.
2000-01-01
Thermoluminescence has become an established dating method for ceramics and more recently for bricks. Based on the experiences of the work carried out since the late 1970's at the Rathgen-Forschungslabor in Berlin on the dating of bricks from historic architecture, and after evaluating all commercially available and some individually built automated and semi-automated TL-readers, a specially adapted machine for the fine grain dating of bricks was constructed in an interdisciplinary research project, undertaken by a team recruited from three faculties of the Czech Technical University in Prague. The result is the automated TL-reader ADAM-1 (Automated Dating Apparatus for Monuments) for the dating of historic architecture. Both the specific adaptation of the technique and the necessary optimal automation have influenced the design of this TL-reader. The principle advantage of brick as opposed to ceramic TL-dating emerges from the possibility of being able to obtain both a large number of samples and an above average quantity of datable material from each sample. This, together with the specific physical and chemical conditions in a brick wall, allowed a rethinking of the traditional error calculation and thus lower error margins as those obtained when dating ceramic shards. The TL-reader must therefore be able to measure and evaluate automatically numerous samples. The annular sample holder of ADAM-1 has 60 sample positions, which allow the irradiation and evaluation of samples taken from two locations. The thirty samples from one sampling point are divided into subgroups, which are processed in various ways. Three samples serve for a rough estimate of the TL sensitivity of the brick material. Nine samples are used for the measurement of 'natural TL' of the material. A further nine samples are used for testing the sensitivity of the material to beta radiation. The last nine samples serve for the testing of the sensitivity to alpha radiation. To determine the
26 CFR 1.860A-1 - Effective dates and transition rules.
2010-04-01
... and ending before January 1, 1990. (2) Tax avoidance rules—(i) Transfers of certain residual interests... TAX (CONTINUED) INCOME TAXES Real Estate Investment Trusts § 1.860A-1 Effective dates and transition... inclusions accrue in an amount sufficient to satisfy the taxes on the excess inclusions. (iii) Residual...
DIRECT ENERGY CONVERSION (DEC) FISSION REACTORS - A U.S. NERI PROJECT
International Nuclear Information System (INIS)
Beller, D.; Polansky, G.
2000-01-01
The direct conversion of the electrical energy of charged fission fragments was examined early in the nuclear reactor era, and the first theoretical treatment appeared in the literature in 1957. Most of the experiments conducted during the next ten years to investigate fission fragment direct energy conversion (DEC) were for understanding the nature and control of the charged particles. These experiments verified fundamental physics and identified a number of specific problem areas, but also demonstrated a number of technical challenges that limited DEC performance. Because DEC was insufficient for practical applications, by the late 1960s most R and D ceased in the US. Sporadic interest in the concept appears in the literature until this day, but there have been no recent programs to develop the technology. This has changed with the Nuclear Energy Research Initiative that was funded by the U.S. Congress in 1999. Most of the previous concepts were based on a fission electric cell known as a triode, where a central cathode is coated with a thin layer of nuclear fuel. A fission fragment that leaves the cathode with high kinetic energy and a large positive charge is decelerated as it approaches the anode by a charge differential of several million volts, it then deposits its charge in the anode after its kinetic energy is exhausted. Large numbers of low energy electrons leave the cathode with each fission fragment; they are suppressed by negatively biased on grid wires or by magnetic fields. Other concepts include magnetic collimators and quasi-direct magnetohydrodynamic generation (steady flow or pulsed). We present the basic principles of DEC fission reactors, review the previous research, discuss problem areas in detail and identify technological developments of the last 30 years relevant to overcoming these obstacles. A prognosis for future development of direct energy conversion fission reactors will be presented
43 CFR 30.148 - Will interest or penalties charged after the date of death be paid?
2010-10-01
... date of death be paid? Interest or penalties charged against claims after the date of death will not be... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Will interest or penalties charged after the date of death be paid? 30.148 Section 30.148 Public Lands: Interior Office of the Secretary of the...
Costs of decommissioning nuclear power plants as reported to the public to date
International Nuclear Information System (INIS)
Strasma, J.D.
1982-01-01
This paper attempts to determine what information has been available to the public, in the United States, concerning the cost of decommissioning nuclear power plants. The search was conducted in the Television News Index and Abstracts, in the annual indexes to The Reader's Digest, and in two computer-based bibliographic retrieval systems, Lockheed's DIALOG Magazine Index and the New York Times Information Bank. Fewer than ten articles appeared in widely read places, with none at all in the Reader's Digest and none on the evening TV news, from 1974 to date. The cost of decommissioning nuclear power plants was reported in various ways, with a wide range of estimates and relatively little actual experience. Costs were given in dollars of different years, in percentages of construction costs, in cost per KWH as per month to the consumer, etc., making the range of reported costs seem even wider than it really was. It is not surprising that the public fears that decommissioning costs will be alarmingly high. The public debate on energy policy might be more rational with better information on decommissioning costs. 16 references
Estimation of Correlation Functions by the Random DEC Technique
DEFF Research Database (Denmark)
Brincker, Rune; Krenk, Steen; Jensen, Jakob Laigaard
The Random Dec Technique is a versatile technique for characterization of random signals in the time domain. In this paper a short review of the most important properties of the technique is given. The review is mainly based on recently achieved results that are still unpublished, or that has just...
2010-04-08
... DEPARTMENT OF THE INTERIOR Bureau of Land Management [LLCA930000; CACA 7817] Public Land Order No. 7736; Partial Revocation of the Bureau of Reclamation Order Dated February 19, 1952; California AGENCY: Bureau of Land Management. ACTION: Correction. SUMMARY: The Bureau of Land Management published a...
Mgbakoigba, Journal of African Studies. Vol.5 No.1. December 2015 ...
African Journals Online (AJOL)
Charles
2015-12-01
Dec 1, 2015 ... contributions in terms of public service and democratic processes. Within the ... the public interest, convenience, or necessity" (communications Act of 1934). According ... the interests of sponsors and investors while garnering the largest audience advertisers ..... Beyond Party Propaganda: A Case Study of.
Vermont Center for Geographic Information — This dataset represents the DEC Wetlands Program's Advisory layer. This layer makes the most up-to-date, non-jurisdictional, wetlands mapping avaiable to the public...
26 CFR 1.1494-2 - Effective date.
2010-04-01
... Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Tax on Transfers to Avoid Income Tax § 1.1494-2 Effective date. Chapter 5 (section 1491 and following) of the Internal Revenue Code of 1954 and the regulations prescribed thereunder apply with respect...
School Counselors' Role in Dating Violence Intervention
Craigen, Laurie M.; Sikes, April; Healey, Amanda; Hays, Danica
2009-01-01
Dating violence among adolescents is a major public health concern. The purpose of this paper is to examine five factors of which school counselors must be aware in order to recognize, intervene, and report incidence of dating violence. These factors are (a) understanding the diverse definitions of dating violence, (b) recognizing dating violence…
International Nuclear Information System (INIS)
1974-01-01
The Secretary of Health, Education, and Welfare is required, Subpart 3, Section 2, Part F of Title III of the Public Health Service Act; 42 USC et seq. (Public Law 90-602), to submit an annual report to the President for transmittal to the Congress on or before April 1 on the adminstration of the Radiation Control for Health and Safety Act. The detailed information required to be included in the report is outlined in Section 360D of Public Law 90-602. The Food and Drug Administration, through its Bureau of Radiological Health, has been delegated the authority for the day-to-day administration of the Act. This report covers the detailed operation of the Agency in carrying out that responsibility for calendar year 1974
Energy Technology Data Exchange (ETDEWEB)
Bader, Tobias; Finkenzeller, Michael; Trinkl, Christoph; Zoerner, Wilfried [Hochschule Ingolstadt (Germany). Kompetenzfeld Erneuerbare Energien
2010-07-01
The field of competence for renewable energy at the Ingolstadt University (Federal Republic of Germany) examines and optimizes an innovative, solar powered air conditioning system with DEC technology (DEC = Desiccant and Evaporative Cooling) in a multi-functional industrial buildings. In addition to a geothermal heat pump system for basic energy supply of heating and cooling, the building is fitted with two solar thermal solar collector panels and a sorption supported air conditioning system. This air conditioner consists of two units, each with a nominal air flow of 8,000 m{sup 3} per hour. The two solar collector panels provide the heat necessary for the regeneration of the sorption rotors and support the domestic preparation of hot water.
45 CFR 99.33 - Effective date of Assistant Secretary's decision.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Effective date of Assistant Secretary's decision. 99.33 Section 99.33 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND Posthearing Procedures, Decisions § 99.33...
Structure-Property Relationships in Polycyanurate / Graphene Networks
2015-12-12
Briefing Charts 3. DATES COVERED (From - To) 17 Nov 2015 – 12 Dec 2015 4. TITLE AND SUBTITLE Structure-Property Relationships in Polycyanurate...ANSI Std. 239.18 1 DISTRIBUTION STATEMENT A. Approved for public release; distribution is unlimited. Structure-Property Relationships in...the attractive processing characteristics of LECy are retained in graphene oxide / LECy mixtures. Impurities, such as aryl phenols and transition metals
1609.pdf | dec102000 | currsci | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; currsci; dec102000; 1609.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube · Twitter · Facebook · Blog. Academy News. IAS Logo. Ethical Guidelines and Procedures document. Posted on 17 January 2017. A revised version of the ...
Baessa, Mohamed
2016-06-15
As our repository matured we found that a concerted effort was needed to establish it as a resource that institutional stakeholders knew they could turn to for reliable information about the research outputs produced by researchers affiliated with or funded by our institution. The initial impetus for this project was the adoption of an institutional open access policy, which necessitated a process to track the publications of institutional authors, deposit items with applicable open access licenses, and notify authors when an accepted manuscript was needed. To support this process we developed a local publications tracking system independent of our hosted DSpace repository that regularly queries publisher and indexer APIs for new publications, checks for relevant permissions policies, identifies institutional authors and helps us send manuscript request emails. We also harvested records for past items and modified our repository to accommodate metadata-only records. The success of these tracking and harvesting services in making our repository comprehensive and up-to-date has allowed us to rely on our repository as the key source of publications information for additional integrations that update ORCID records with publication information, populate a PlumX metrics dashboard and, most recently, support the implementation of a current research information system (CRIS).
Baessa, Mohamed A.; Grenz, Daryl M.; Wang, Han
2016-01-01
As our repository matured we found that a concerted effort was needed to establish it as a resource that institutional stakeholders knew they could turn to for reliable information about the research outputs produced by researchers affiliated with or funded by our institution. The initial impetus for this project was the adoption of an institutional open access policy, which necessitated a process to track the publications of institutional authors, deposit items with applicable open access licenses, and notify authors when an accepted manuscript was needed. To support this process we developed a local publications tracking system independent of our hosted DSpace repository that regularly queries publisher and indexer APIs for new publications, checks for relevant permissions policies, identifies institutional authors and helps us send manuscript request emails. We also harvested records for past items and modified our repository to accommodate metadata-only records. The success of these tracking and harvesting services in making our repository comprehensive and up-to-date has allowed us to rely on our repository as the key source of publications information for additional integrations that update ORCID records with publication information, populate a PlumX metrics dashboard and, most recently, support the implementation of a current research information system (CRIS).
TRASYS - THERMAL RADIATION ANALYZER SYSTEM (DEC VAX VERSION WITH NASADIG)
Anderson, G. E.
1994-01-01
. The flexible structure of TRASYS allows considerable freedom in the definition and choice of solution method for a thermal radiation problem. The program's flexible structure has also allowed TRASYS to retain the same basic input structure as the authors update it in order to keep up with changing requirements. Among its other important features are the following: 1) up to 3200 node problem size capability with shadowing by intervening opaque or semi-transparent surfaces; 2) choice of diffuse, specular, or diffuse/specular radiant interchange solutions; 3) a restart capability that minimizes recomputing; 4) macroinstructions that automatically provide the executive logic for orbit generation that optimizes the use of previously completed computations; 5) a time variable geometry package that provides automatic pointing of the various parts of an articulated spacecraft and an automatic look-back feature that eliminates redundant form factor calculations; 6) capability to specify submodel names to identify sets of surfaces or components as an entity; and 7) subroutines to perform functions which save and recall the internodal and/or space form factors in subsequent steps for nodes with fixed geometry during a variable geometry run. There are two machine versions of TRASYS v27: a DEC VAX version and a Cray UNICOS version. Both versions require installation of the NASADIG library (MSC-21801 for DEC VAX or COS-10049 for CRAY), which is available from COSMIC either separately or bundled with TRASYS. The NASADIG (NASA Device Independent Graphics Library) plot package provides a pictorial representation of input geometry, orbital/orientation parameters, and heating rate output as a function of time. NASADIG supports Tektronix terminals. The CRAY version of TRASYS v27 is written in FORTRAN 77 for batch or interactive execution and has been implemented on CRAY X-MP and CRAY Y-MP series computers running UNICOS. The standard distribution medium for MSC-21959 (CRAY version
TRASYS - THERMAL RADIATION ANALYZER SYSTEM (DEC VAX VERSION WITHOUT NASADIG)
Vogt, R. A.
1994-01-01
. The flexible structure of TRASYS allows considerable freedom in the definition and choice of solution method for a thermal radiation problem. The program's flexible structure has also allowed TRASYS to retain the same basic input structure as the authors update it in order to keep up with changing requirements. Among its other important features are the following: 1) up to 3200 node problem size capability with shadowing by intervening opaque or semi-transparent surfaces; 2) choice of diffuse, specular, or diffuse/specular radiant interchange solutions; 3) a restart capability that minimizes recomputing; 4) macroinstructions that automatically provide the executive logic for orbit generation that optimizes the use of previously completed computations; 5) a time variable geometry package that provides automatic pointing of the various parts of an articulated spacecraft and an automatic look-back feature that eliminates redundant form factor calculations; 6) capability to specify submodel names to identify sets of surfaces or components as an entity; and 7) subroutines to perform functions which save and recall the internodal and/or space form factors in subsequent steps for nodes with fixed geometry during a variable geometry run. There are two machine versions of TRASYS v27: a DEC VAX version and a Cray UNICOS version. Both versions require installation of the NASADIG library (MSC-21801 for DEC VAX or COS-10049 for CRAY), which is available from COSMIC either separately or bundled with TRASYS. The NASADIG (NASA Device Independent Graphics Library) plot package provides a pictorial representation of input geometry, orbital/orientation parameters, and heating rate output as a function of time. NASADIG supports Tektronix terminals. The CRAY version of TRASYS v27 is written in FORTRAN 77 for batch or interactive execution and has been implemented on CRAY X-MP and CRAY Y-MP series computers running UNICOS. The standard distribution medium for MSC-21959 (CRAY version
2011-02-18
... DEPARTMENT OF THE TREASURY United States Mint Public Meeting ACTION: Notification of Citizens Coinage Advisory Committee March 1, 2011, Public Meeting. SUMMARY: Pursuant to United States Code, Title... (CCAC) public meeting scheduled for March 1, 2011. Date: March 1, 2011. Time: 10 a.m. to 1 p.m. Location...
2010-10-01
...: Data Security for Toxic Substances Control Act Confidential Business Information (DEC 1997) The... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Data Security for Toxic Substances Control Act Confidential Business Information (DEC 1997). 1552.235-78 Section 1552.235-78 Federal...
DECS tries out instructional materials on AIDS prevention education.
1994-01-01
A national try-out of the newly developed print and non-print instructional materials on AIDS Education is being conducted by the Department of Education, Culture and Sports (DECS) this school year 1993-to 1994. To determine the effectiveness of these materials, various public and private schools in Region IV (Southern Tagalog), VII (Central Visayas) XI (Southern Mindanao) and National Capital Region (Metro, Manila) were chosen as try-out institutions. The AIDS education materials will be tried out in different subjects in some grade and year levels such as civics and culture (grade one); science and health (grades three and six); home economics and livelihood education (grade five); physical education, health and music (second year) and Pilipino Language (third year). The materials for the elementary level consist of posters, cut-out pictures, voice tapes, jingles, talking books and slides, while the secondary school level utilizes modules. For the tertiary level, a Resource Book on AIDS Prevention Education is used by the Teacher Training Institutions and the Non-Formal Education employs the Facilitator's Guide for Levels I-III. These materials will be tried out in both urban and rural schools, with control school and experimental school at each level. full text
Findings and decisions of the Constitutional Court/Decision G46/82 dated 16 Dec 1983
International Nuclear Information System (INIS)
Roessler, D.; Thaler, B.
1984-01-01
The ban of nuclear power in Austria by law does not violate the guarantee for proprietorship and the principle of equality. Mere restrictions of proprietorship do not form a legal expropriation in the strict sense. This restriction is the public interest. (Bernh)
Efeito da perda prematura de molares decíduos na sobressaliência
Directory of Open Access Journals (Sweden)
Yérica M García
2011-01-01
Full Text Available A perda precoce de molares decíduos predispõe as maloclusões, entre estas o apinhamento dentário, impactação de dentes permanentes e alteração da relação molar e canino. O objetivo do estudo foi determinar o efeito das perdas precoces dos molares decíduos na relação horizontal incisiva. O estudo é do tipo documentado, retrospetivo e observacional. Foram avaliados os registros ortodônticos (histórias clínicas, fotografias e radiografias de 209 pacientes na faixa etária de 4 a 15 anos de idade. A relação incisiva horizontal foi considerada normal para os pacientes do GRUPO 1, com contato entre a face incisal dos incisivos inferiores e a face palatina dos incisivos superiores. No GRUPO 2, a relação incisiva horizontal foi considerada aumentada, com distância positiva entre eles e no GRUPO 3, a relação incisiva horizontal foi considerada negativa quando as faces incisais dos incisivos superiores e inferiores se encontravam a topo ou em mordida cruzada. Os dados foram analisados através do coeficiente Pearson (p ≤ 0,001. Na análise dos dados coletados, o total de quarenta e cinco pacientes (22% apresentaram perdas prematuras. A prevalência destas perdas não apresentou diferença significativa entre sexos e foi maior no grupo de faixa etária de 7 a 9 anos de idade. Dos pacientes com perda prematura seis (13,3% foram clasificados no GRUPO 1; doze (26,7% no GRUPO 2 e vinte e sete (60% no GRUPO 3. A relação entre o número de molares perdidos e a presença de mordida cruzada anterior foi encontrada, e a média de molares perdidos (4,7 foi maior no GRUPO 3. Os resultados mostraram que as perdas precoces dos molares decíduos apresentam uma relação estatisticamente significante com a mordida cruzada anterior, sugerindo que a falta de suporte oclusal pode favorecer o desenvolvimento protrusivo da mandibula.
1 CFR 10.1 - Publication required.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Publication required. 10.1 Section 10.1 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER SPECIAL EDITIONS OF THE FEDERAL REGISTER PRESIDENTIAL PAPERS Regular Publication § 10.1 Publication required. The Director publishes a special edition...
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.1278 >orf19.1278; Contig19-10104; complement(13162...4..>132028); ; conserved hypothetical protein; truncated protein IQNNKCSGCNLKLDFPVIHFKCKHSFHQKCLSTNLIATSTESS
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.4711 >orf19.4711; Contig19-10212; complement(29836...7..>300616); ; acidic repetitive protein; truncated protein DRSDYNEEDNNDFTRKLNEIQSKESNHEDLAQSEVQEGQKDEPDSVNQ
1 CFR 5.1 - Publication policy.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Publication policy. 5.1 Section 5.1 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER THE FEDERAL REGISTER GENERAL § 5.1 Publication... Federal Register shall publish a serial publication called the Federal Register to contain the following...
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.3361 >orf19.3361; Contig19-10173; 157397..>158185;... YAT2*; carnitine acetyltransferase; gene family | truncated protein MSTYRFQETLEKLPIPDLVQTCNAYLEALKPLQTEQEHE
Cuartero Sala, Mireia; Betbesé Roig, Antoni-Jordi; Universitat Autònoma de Barcelona. Departament de Medicina
2012-01-01
Es tracta d'un estudi observacional prospectiu en 18 pacients afectats de la síndrome de destret respiratori agut que van requerir un canvi de posició de decúbit supí a decúbit pron per tal de millorar l'oxigenació. La hipòtesi de treball era que aquest canvi de posició podia augmentar la pressió intraabdominal i, en conseqüència, alterar la funció renal per causa prerrenal. Foren registrades variables hemodinàmiques, respiratòries i pressions intrabdominals, i valorada la funció renal. La po...
Cuartero Sala, Mireia
2012-01-01
Es tracta d’un estudi observacional prospectiu en 18 pacients afectats de la síndrome de destret respiratori agut que van requerir un canvi de posició de decúbit supí a decúbit pron per tal de millorar l’oxigenació. La hipòtesi de treball era que aquest canvi de posició podia augmentar la pressió intraabdominal i, en conseqüència, alterar la funció renal per causa prerrenal. Foren registrades variables hemodinàmiques, respiratòries i pressions intrabdominals, i valorada la funció renal. La po...
International Nuclear Information System (INIS)
Hayamizu, Kikuko; Aihara, Yuichi
2004-01-01
Two binary mixed solvent systems typically used for lithium batteries were studied by measuring the self-diffusion coefficients of the solvent, lithium ion and anion, independently by using the multi-nuclear pulsed field-gradient spin-echo (PGSE) 1 H, 7 Li and 19 F NMR method. One system was propylene carbonate (PC) and diethyl carbonate (DEC) system and the other binary system was PC and 1,2-dimethoxyethane (DME), and the lithium salt used was LiN(SO 2 CF 3 ) 2 (LiTFSI). The relative ratio of the PC was changed from zero (pure DME and DEC) to 100% (pure PC) in the DME-PC and the DEC-PC systems, respectively. The self-diffusion coefficients of the solvents were measured with and without the lithium salt, and the two solvents had almost the same diffusion coefficient in the DEC-PC system, while DME diffused faster than PC in the DME-PC system. In the electrolytes the solvents diffused the fastest, followed by the anion with the lithium ion diffusing the slowest. The degree of ion dissociation was estimated for each electrolyte by comparing the ionic conductivities estimated from the ion diffusion and those measured directly by the electrochemical method
Odonnell, R. A.; Weissinger, D.
1988-01-01
The results of the Independent Orbiter Assessment (IOA) of the Failure Modes and Effects Analysis (FMEA) and Critical Items List (CIL) are presented. The IOA effort first completed an analysis of the Landing/Deceleration (LDG/DEC) hardware, generating draft failure modes and potential critical items. To preserve independence, this analysis was accomplished without reliance upon the results contained within the NASA FMEA/CIL documentation. The IOA contained within the NASA FMEA/CIL documentation. The IOA results were then compared to the NASA FMEA/CIL baseline with proposed Post 51-L updates included. A resolution of each discrepancy from the comparison is provided through additional analysis as required. This report documents the results of that comparison for the Orbiter LDG/DEC hardware. The IOA product for the LDG/DEC analysis consisted of 259 failure mode worksheets that resulted in 124 potential critical items being identified. Comparison was made to the NASA baseline which consisted of 267 FMEA's and 120 CIL items. This comparison produced agreement on all but 75 FMEA's which caused differences in 51 CIL items.
Luminescence dating of some historical/pre-historical natural hazards of India
International Nuclear Information System (INIS)
Gartia, R.K.
2008-01-01
The Indian sub-continent is characterized by host of natural hazards like earthquake, tsunami, cyclones, floods, landslides/mudflows. It is necessary to build-up a database of historical/pre-historical natural hazards for planning scenarios for emergency response to various them. In short, there is a vast scope of providing chronology to hazardous events by using known techniques of dating including luminescence dating which has an excellent window span down from few hundred years to one hundred thousand years. In this work we report the dates of some historical/pre-historical natural hazards of India. In particular we focus on three kinds of natural hazards namely, earthquakes, tsunami, and mudflows. For example of earthquake we cover a historical earthquake of Manipur that created two massive fissures at Kumbi, 25 km from the state capital, Imphal. For pre-historical ones, we cover Assam-Shillong area known for its highest levels of seismicity in India. We demonstrate the evidence of a paleo-tsunami that devastated Mahabalipuram near Chennai. Incidentally, Mahabalipuram was badly affected by the great tsunami of 26th Dec 2004. Finally, luminescence dating technique has been applied to some historical/pre-historical mudflows of Manipur. A recent mudflow on 10th July 2004 damaged more than 90 houses, block National Highway-39, the life-line of Manipur for more than a fort-night. (author)
Public-Private Partnerships in Chronic Disease Prevention-Part 1
Centers for Disease Control (CDC) Podcasts
2009-04-06
This podcast is the first of a seven part series discussing public health partnerships with the private sector. In this segment, CDC's Elizabeth Majestic and University of North Carolina's Gene Matthews talk about the history of public health partnerships with the for profit sector. Created: 4/6/2009 by National Center for Chronic Disease Prevention and Health Promotion (NCCDPHP). Date Released: 4/6/2009.
7 CFR 15a.1 - Purpose and effective date.
2010-01-01
... FROM FEDERAL FINANCIAL ASSISTANCE Introduction § 15a.1 Purpose and effective date. The purpose of this... education program or activity receiving Federal financial assistance, whether or not such program or...
Program for the evaluation of TL-brick dating: 'ADAM-1-EVA'
International Nuclear Information System (INIS)
Novotna, V.; Kubelik, M.; Musilek, L.
2000-01-01
Although the evaluation of the TL-mean date has presented very little diversity since first published, the error evaluation has prompted a lot of discussion. Particularly the physical, chemical, statistical and mathematical differences as reflected in the specifics of the evaluation of the individual random and systematic errors in ceramic and brick dating are undervalued in literature. The construction of an automated TL-Reader (ADAM-1) at the Czech Technical University in Prague was taken as an opportunity to create a whole new software package for the evaluation ('EVA') of TL-dates. ADAM-1 is designed primarily for brick dating, using the fine-grain technique. The philosophy of data processing is similar to that applied by the Berlin group in their research of Venetian Villas. The program was developed using Delphi, as it is user-friendlier than pure Pascal, offers a strong graphic platform and allows flexibility in data management. This was important, as the program was conceived to either interact directly with ADAM-1, or to be operated independently for data evaluation and management. The software package consists of two discrete yet combinable components: one for the calculation of the TL mean date, using all raw data obtained from ADAM-1 and peripheral measurements; the other for the evaluation of systematic, random and context errors of individual samples and sample groups. All steps in the calculations are also graphically available, e.g. glow curves, plateau test, TL vs. dose dependence and charts summarising the results of all calculations for an individual sample and a given context. (author)
ORF Sequence: Ca19AnnotatedDec2004aaSeq [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Ca19AnnotatedDec2004aaSeq orf19.710 >orf19.710; Contig19-10065; complement(47186.....>47710); LSC2*; succinate-CoA ligase beta subunit; truncated protein | overlap LGFDDNASFRQEEVFSWRDPTQEDPQEAE
Linguistic dating of biblical texts
DEFF Research Database (Denmark)
Young, Ian; Rezetko, Robert; Ehrensvärd, Martin Gustaf
Since the beginning of critical scholarship biblical texts have been dated using linguistic evidence. In recent years this has become a controversial topic, especially with the publication of Ian Young (ed.), Biblical Hebrew: Studies in Chronology and Typology (2003). However, until now there has...... been no introduction and comprehensive study of the field. Volume 1 introduces the field of linguistic dating of biblical texts, particularly to intermediate and advanced students of biblical Hebrew who have a reasonable background in the language, having completed at least an introductory course...... in this volume are: What is it that makes Archaic Biblical Hebrew archaic , Early Biblical Hebrew early , and Late Biblical Hebrew late ? Does linguistic typology, i.e. different linguistic characteristics, convert easily and neatly into linguistic chronology, i.e. different historical origins? A large amount...
Molecular marker analysis of heading date Hd1 locus in Egyptian ...
African Journals Online (AJOL)
Nine molecular markers derived from the heading date QTL Hd1 DNA sequence for cultivated rice were used to study the heading date allelic diversity of the cultivated Egyptian rice varieties. The results showed that among the nine simple sequence repeats (SSR) and sequence tagged-sites (STS) markers used, one SSR ...
Some programming aids for the DEC PDP-10
International Nuclear Information System (INIS)
McNamara, B.
1979-01-01
A simplified system has been written to help in FORTRAN programming of physics and mathematical problems. The system is described in Appendix A. A magnetic tape has been made of the complete system as used on the DEC-10 by M-Division for Magnetic Fusion related calculations. The system turns out to use many of the locally developed goodies, such as the TEDI text editor, the TV80 graphics system, and Tektronix 4012 videos. The facilities are briefly described in the HLP files on the tape
Additional dates of Sir Andrew Smith's Illustrations of the Zoology of South Africa.
Low, Martyn E Y; Evenhuis, Neal L
2014-05-14
We update the collation of the dates of publication of Smith's Illustrations of the Zoology of South Africa provided by Waterhouse (1880) and Barnard (1950, 1952). In the case of nine parts, we are able to provide more accurate dates of publication (including day-dates for seven of these parts). For workers of invertebrate taxonomy, we provide an accurate date of publication for W. S. Macleay's volume on Annulosa.
Directory of Open Access Journals (Sweden)
Hironobu Yanagisawa
2016-03-01
Full Text Available The presence of high molecular weight double-stranded RNA (dsRNA within plant cells is an indicator of infection with RNA viruses as these possess genomic or replicative dsRNA. DECS (dsRNA isolation, exhaustive amplification, cloning, and sequencing analysis has been shown to be capable of detecting unknown viruses. We postulated that a combination of DECS analysis and next-generation sequencing (NGS would improve detection efficiency and usability of the technique. Here, we describe a model case in which we efficiently detected the presumed genome sequence of Blueberry shoestring virus (BSSV, a member of the genus Sobemovirus, which has not so far been reported. dsRNAs were isolated from BSSV-infected blueberry plants using the dsRNA-binding protein, reverse-transcribed, amplified, and sequenced using NGS. A contig of 4,020 nucleotides (nt that shared similarities with sequences from other Sobemovirus species was obtained as a candidate of the BSSV genomic sequence. Reverse transcription (RT-PCR primer sets based on sequences from this contig enabled the detection of BSSV in all BSSV-infected plants tested but not in healthy controls. A recombinant protein encoded by the putative coat protein gene was bound by the BSSV-antibody, indicating that the candidate sequence was that of BSSV itself. Our results suggest that a combination of DECS analysis and NGS, designated here as “DECS-C,” is a powerful method for detecting novel plant viruses.
41 CFR 101-1.104-1 - Publication.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Publication. 101-1.104-1 Section 101-1.104-1 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS GENERAL 1-INTRODUCTION 1.1-Regulation System § 101-1.104-1...
Scaling Up Optimal Heuristic Search in Dec-POMDPs via Incremental Expansion (extended abstract)
Spaan, M.T.J.; Oliehoek, F.A.; Amato, C.
2011-01-01
We advance the state of the art in optimal solving of decentralized partially observable Markov decision processes (Dec-POMDPs), which provide a formal model for multiagent planning under uncertainty.
ilc-25.pdf | dec2005 | jess | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; jess; dec2005; ilc-25.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held ...
Displaying DIII-D plasma data using DEC's X window system
International Nuclear Information System (INIS)
Greene, K.L.
1992-01-01
This paper reports on the DIII-D tokamak program funded by the Department of Energy, which carries out plasma physics and fusion energy research experiments. The machine began operation in February 1986; at that time, approximately 7 Mbytes of data was collected for each shot. Since that time, the shot size has steadily increased to over 50 Mbytes with the average shot size between 35 and 45 Mbytes. Shots are fired every 12 to 15 minutes and last approximately 5 to 10 seconds. Between 30 and 40 shots are fired each day when plasma experiments are scheduled. In 1990, both programs were converted from User Interface Services (UIS) routines, which are part of the MicroVMS workstation graphics software, to DEC's X Window System using the DECWindows window manager. These modifications were required because of a move by Digital Equipment Corporation (DEC) to support Xwindows and phase out UIS. Due to the nature and purpose of each program, MFITD needed only simple graphics conversion while MFITPLAY was completely rewritten. The DECWindows version of MFITPLAY offers a number of improvements, such as a more intuitive user interface
42 CFR 488.440 - Civil money penalties: Effective date and duration of penalty.
2010-10-01
... 42 Public Health 5 2010-10-01 2010-10-01 false Civil money penalties: Effective date and duration... Civil money penalties: Effective date and duration of penalty. (a)(1) The per day civil money penalty... by CMS or the State. (2) A civil money penalty for each instance of noncompliance is imposed in a...
1 CFR 9.1 - Publication required.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Publication required. 9.1 Section 9.1 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER SPECIAL EDITIONS OF THE FEDERAL REGISTER THE UNITED STATES GOVERNMENT MANUAL § 9.1 Publication required. The Director of the Federal Register shall...
Energy Technology Data Exchange (ETDEWEB)
Bykov, Dmytro; Kristensen, Kasper; Kjærgaard, Thomas [Department of Chemistry, qLeap Center for Theoretical Chemistry, University of Aarhus, DK-8000 Århus C (Denmark)
2016-07-14
We report an implementation of the molecular gradient using the divide-expand-consolidate resolution of the identity second-order Møller-Plesset perturbation theory (DEC-RI-MP2). The new DEC-RI-MP2 gradient method combines the precision control as well as the linear-scaling and massively parallel features of the DEC scheme with efficient evaluations of the gradient contributions using the RI approximation. We further demonstrate that the DEC-RI-MP2 gradient method is capable of calculating molecular gradients for very large molecular systems. A test set of supramolecular complexes containing up to 158 atoms and 1960 contracted basis functions has been employed to demonstrate the general applicability of the DEC-RI-MP2 method and to analyze the errors of the DEC approximation. Moreover, the test set contains molecules of complicated electronic structures and is thus deliberately chosen to stress test the DEC-RI-MP2 gradient implementation. Additionally, as a showcase example the full molecular gradient for insulin (787 atoms and 7604 contracted basis functions) has been evaluated.
International Nuclear Information System (INIS)
Bykov, Dmytro; Kristensen, Kasper; Kjærgaard, Thomas
2016-01-01
We report an implementation of the molecular gradient using the divide-expand-consolidate resolution of the identity second-order Møller-Plesset perturbation theory (DEC-RI-MP2). The new DEC-RI-MP2 gradient method combines the precision control as well as the linear-scaling and massively parallel features of the DEC scheme with efficient evaluations of the gradient contributions using the RI approximation. We further demonstrate that the DEC-RI-MP2 gradient method is capable of calculating molecular gradients for very large molecular systems. A test set of supramolecular complexes containing up to 158 atoms and 1960 contracted basis functions has been employed to demonstrate the general applicability of the DEC-RI-MP2 method and to analyze the errors of the DEC approximation. Moreover, the test set contains molecules of complicated electronic structures and is thus deliberately chosen to stress test the DEC-RI-MP2 gradient implementation. Additionally, as a showcase example the full molecular gradient for insulin (787 atoms and 7604 contracted basis functions) has been evaluated.
International Nuclear Information System (INIS)
Ha, Jun Su; Kim, Sungyeop
2014-01-01
The fail safety design is referred to as an inherently safe design concept where the failure of an SSC (System, Structure or Component) leads directly to a safe condition. Usually the fail safe design has been devised based on the design basis accident (DBAs), because the nuclear safety has been assured by securing the capability to safely cope with DBAs. Currently regards have been paid to the DEC (Design Extension Condition) as an extended design consideration. Hence additional attention should be paid to the concept of the fail safe design in order to consider the DEC, accordingly. In this study, a case chosen from the Fukushima accident is studied to discuss the issue associated with the fail safe design in terms of DBA and DEC standpoints. For the fail safe design to be based both on the DBA and the DEC, a Mode Changeable Fail Safe Design (MCFSD) is proposed in this study. Additional discussions on what is needed for the MCFSD to be applied in the nuclear safety are addressed as well. One of the lessons learnt from the Fukushima accident should include considerations on the fail-safe design in a changing regulatory framework. Currently the design extension condition (DEC) including severe accidents should be considered during designing and licensing NPPs. Hence concepts on the fail safe design need to be changed to be based on not only the DBA but also the DEC. In this study, a case on a fail-safe design chosen from the Fukushima accident is studied to discuss the issue associated with the fail safe design in terms of DBA and DEC conditions. For the fail safe design to be based both on the DBA and the DEC, a Mode Changeable Fail Safe Design (MCFSD) is proposed in this study. Additional discussions on what is needed for the MCFSD to be applied in the nuclear safety are addressed as well
Dating Violence among Male and Female Youth seeking Emergency Department Care
Singh, Vijay; Walton, Maureen A; Whiteside, Lauren K; Stoddard, Sarah; Epstein-Ngo, Quyen; Chermack, Stephen T; Cunningham, Rebecca M
2014-01-01
Objective To determine prevalence and correlates of dating violence, dating victimization, and dating aggression among males and females age 14–20 seeking emergency department (ED) care. Methods Systematic sampling of subjects age 14–20 seeking care at a single large academic ED between 9/2010- 3/2013. Participants completed a computerized, self-administered, cross-sectional survey of demographics, dating violence from physical abuse measures of the Conflict in Adolescent Dating Relationships Inventory, associated behaviors, and ED health service use. Separate analyses were conducted for males and females. Results 4389 youth (86.1% participation rate) were screened, and 4089 (mean age 17.5 years, 58% female) were eligible for analysis. Almost 1 in 5 females (n= 215, 18.4%) and 1 in 8 males (n= 212, 12.5%) reported past year dating violence. Of females, 10.6% reported dating victimization, and 14.6% dating aggression, while of males, 11.7% reported dating victimization, and 4.9% reported dating aggression. Multivariate analyses showed variables associated with any male dating violence were African American race (AOR 2.26, CI 1.54–3.32), alcohol misuse (AOR 1.03, CI 1.00–1.06), illicit drug misuse (AOR 2.38, CI 1.68–3.38), and depression (AOR 2.13, CI 1.46–3.10); any female dating violence was associated with African-American race (AOR 1.68, CI 1.25–2.25), public assistance (AOR 1.64, CI 1.28–2.09), grades D and below (AOR 1.62, CI 1.07–2.43), alcohol misuse (AOR 1.04, CI 1.02–1.07), illicit drug misuse (AOR 2.85, CI 2.22–3.66), depression (AOR 1.86, CI 1.42–2.44), and any past year ED visit for intentional injury (AOR 2.64, CI 1.30–5.40). Conclusions Nearly 1 of 6 male and female adolescents seeking ED care report recent dating violence, and health disparities remain among this population. Dating violence was strongly associated with alcohol, illicit drug misuse, and depression, and correlated with prior ED service utilization among female
Date Fighting and Sexual Risk Behaviours among Adolescents ...
African Journals Online (AJOL)
The study seeks to examine the prevalence of date fighting and its role in sexual risk behaviours among 1079 boys and 1211 girls in 22 public secondary schools in Ibadan Nigeria. About 60% (1367) reported to have ever experienced at least a form of date fighting. Risk factors for date fighting in boys include, non use of ...
26 CFR 1.430(g)-1 - Valuation date and valuation of plan assets.
2010-04-01
... the adjusted fair market value of plan assets, assets that are added to a plan as a result of a plan... (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Certain Stock Options § 1.430(g)-1 Valuation date and.... Paragraph (c) of this section describes rules regarding the determination of the asset value for purposes of...
Directory of Open Access Journals (Sweden)
N. K. Oekar
2017-11-01
Full Text Available Lymphatic filariasis or more commonly known as elephantiasis disease has infected more than 120 million people in 80 countries; and more than 40 million of them are unable to work, in addition to disruption of aesthetic values. The problem faced by almost all people in combating this infectious disease is delayed diagnosis. The sufferers do not realize that they have been infected with this disease. A specific and accurate method of early detection is therefore needed. 99mTc-labeled Diethylcarbamazine-citrate (99mTc-DEC has been successfully prepared. However, as part of the discovery and development of new drugs, the fulfillment of pharmaceutical and safety requirements have to be evaluated. Physico-chemical aspects such as stability, purity levels, and other pharmaceutical requirements, as well as pharmacokinetic studies and route of administration, are important parameters to be studied. The stability test showed that after seven months of storage, a preparation in a dry kit retains an efficiency of labeling and a purity level of more than 90 % and its physico-chemical and biological characteristics remained steady. Biodistribution test in Wistar rat showed that the greatest accumulation occurred in the lymphatic system, especially in the popliteal glands and in lumbar and mesenteric lymph nodes. Imaging with a gamma camera after intradermal and intravenous injections to the experimental animals resulted in a positive image that showed 99mTc-DEC accumulation in the target organ. The results of this innovation are expected to contribute significantly to improving public health, particulary in early detection of filarial infections. In addition, this result is expected to be a concrete contribution to the program of "The Global Goal of Elimination of Lymphatic Filariasis as a Public Health Problem by the Year 2020”.
Adolescent Perceptions of Dating Violence: A Qualitative Study.
Taylor, Sarah; Calkins, Carrie A; Xia, Yan; Dalla, Rochelle L
2017-08-01
Scholars have identified dating violence as a public health issue among adolescents. Yet, minimal research has detailed adolescents' perceptions of dating violence, specifically gender differences in perceptions. Research suggests that in order for dating violence prevention and intervention to be effective, services need to be delivered in a manner that is understood by adolescents. Therefore, this study used a qualitative phenomenology study to investigate adolescents' perceptions of dating violence, including gender differences in adolescents' perceptions. Thirty adolescents between the ages of 14 and 19 from a Midwest public high school participated in focus groups. Focus group participants were asked semistructured interview questions regarding the definition of dating violence, risk and protective factors for dating violence, support for victims and perpetrators, and prevention efforts. Data were analyzed using qualitative content analysis methods, and common themes were identified. Adolescents' language revealed gender differences in perceptions toward dating violence. Males perceive dating violence through action, perpetration, and physical consequences. Females discuss dating violence by relating to the victim and the victim's emotions. Although gender differences existed in participants' perceptions, both males and females explained that dating violence is more often perpetrated by females, despite the view from society that males are more likely to perpetrate dating violence. Findings suggest that schools, practitioners, and policy makers are not meeting the needs of adolescents in regard to dating violence prevention and intervention. Prevention and intervention efforts could be improved by delivering education and services using language that adolescents find relevant. Findings also suggest that adolescents may benefit from prevention and intervention with gender specific components.
Weigensberg, Marc J; Vigen, Cheryl; Sequeira, Paola; Spruijt-Metz, Donna; Juarez, Magaly; Florindez, Daniella; Provisor, Joseph; Peters, Anne; Pyatak, Elizabeth A
2018-01-01
The transition of young adults with type 1 diabetes (T1D) from pediatric to adult care is challenging and frequently accompanied by worsening of diabetes-related health. To date, there are no reports which prospectively assess the effects of theory-based psycho-behavioral interventions during the transition period neither on glycemic control nor on psychosocial factors that contribute to poor glycemic control. Therefore, the overall aim of this study was to develop and pilot test an integrative group intervention based on the underlying principles of self-determination theory (SDT), in young adults with T1D. Fifty-one young adults with T1D participated in an education and case management-based transition program, of which 9 took part in the Diabetes Empowerment Council (DEC), a 12-week holistic, multimodality facilitated group intervention consisting of "council" process based on indigenous community practices, stress-reduction guided imagery, narrative medicine modalities, simple ritual, and other integrative modalities. Feasibility, acceptability, potential mechanism of effects, and bio-behavioral outcomes were determined using mixed qualitative and quantitative methods. The intervention was highly acceptable to participants, though presented significant feasibility challenges. Participants in DEC showed significant reductions in perceived stress and depression, and increases in general well-being relative to other control participants. Reduction in perceived stress, independent of intervention group, was associated with reductions in hemoglobin A1C. A theoretical model explaining the effects of the intervention included the promotion of relatedness and autonomy support, 2 important aspects of SDT. The DEC is a promising group intervention for young adults with T1D going through transition to adult care. Future investigations will be necessary to resolve feasibility issues, optimize the multimodality intervention, determine full intervention effects, and fully
Bullying Prevention for Public Health Practitioners
Centers for Disease Control (CDC) Podcasts
2012-01-19
This podcast discusses bullying as a public health problem, and provides information and resources for public health practitioners. Created: 1/19/2012 by National Center for Injury Prevention and Control (NCIPC). Date Released: 1/19/2012.
DecAID: a decaying wood advisory model for Oregon and Washington.
Kim Mellen; Bruce G. Marcot; Janet L. Ohmann; Karen L. Waddell; Elizabeth A. Willhite; Bruce B. Hostetler; Susan A. Livingston; Cay. Ogden
2002-01-01
DecAID is a knowledge-based advisory model that provides guidance to managers in determining the size, amount, and distribution of dead and decaying wood (dead and partially dead trees and down wood) necessary to maintain wildlife habitat and ecosystem functions. The intent of the model is to update and replace existing snag-wildlife models in Washington and Oregon....
Physical dating violence among adolescents and young adults with alcohol misuse.
Singh, Vijay; Epstein-Ngo, Quyen; Cunningham, Rebecca M; Stoddard, Sarah A; Chermack, Stephen T; Walton, Maureen A
2015-08-01
This study determined prevalence and correlates of physical dating violence (victimization or aggression) among male and female youth with alcohol misuse and seeking emergency department (ED) care. Patients age 14-20 seeking care at a single large university-based ED completed a computerized, self-administered, cross-sectional survey. Measures included demographics, alcohol and substance use, mental health problems, health service use, peer influences, parent support, and community involvement. Bivariate and multivariate regression assessed physical dating violence correlates. Among 842 male and female youth seeking ED care who screened positive for alcohol misuse, 22.3% (n=188) reported dating violence in the past year. Multivariate analyses showed variables associated with dating violence were female gender (AOR 2.17, CI 1.46-3.22), Caucasian race (AOR 0.59, CI 0.37-0.93), receipt of public assistance (AOR 1.82, CI 1.16-2.87), AUDIT Score (AOR 1.06, CI 1.02-1.10), older age of drinking onset (AOR 0.86, CI 0.77-0.96), suicidal ideation or attempt (AOR 1.95, CI 1.13-3.37), frequency of ED visits (AOR 1.22, CI 1.05-1.46), negative peer influences (AOR 1.05, CI 1.01-1.10), and positive peer influences (AOR 0.86, CI 0.80-0.93). Nearly 1 in 4 youth with alcohol misuse seeking ED care report dating violence. Key correlates of dating violence included alcohol use severity, suicidal ideation, ED services, and peer influences. Evidence-based dating violence interventions addressing these correlates are needed for youth with alcohol misuse seeking ED care. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.
Physical dating violence victimization in college women in Chile.
Lehrer, Jocelyn A; Lehrer, Evelyn L; Zhao, Zhenxiang
2010-05-01
There are no published studies on physical dating violence in college students in Chile, and campuses across the country currently lack systematized programs to prevent or respond to this public health problem. This is the first study to examine prevalence and predictors of physical dating violence victimization with a sample of female college students in Chile. A closed-ended questionnaire was administered to students enrolled in general education courses at a major public university. The prevalence of women's physical dating violence victimization was calculated, and generalized ordered logit models were used to estimate risk factors for such victimization (n = 441). Ancillary analyses examined associations of dating violence victimization with experiences of unwanted sexual contact and forced condom nonuse. Approximately 21% of subjects reported one or more incidents of physical dating violence not involving physical injury since age 14, and another 5% reported at least one incident resulting in physical injury during this time period. Risk factors identified in five sequential models were sexual abuse and witnessing of domestic violence in childhood, low parental education, residence away from the parental home, urban residence, and having had sexual intercourse. Maternal employment and religious participation had protective effects. Dating violence victimization was found to be significantly associated with experiences of unwanted sexual contact and forced condom nonuse. The study findings show a high prevalence of physical dating violence, strong associations between several sociodemographic factors and dating violence, and links between dating violence and sexual/reproductive risk. Our results indicate a need to expand attention to this public health problem in Chile as well as other developing countries, where research and prevention/response initiatives have generally been similarly limited. The findings also have important implications for the content of
7 CFR 999.1 - Regulation governing the importation of dates.
2010-01-01
... SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE SPECIALTY...) Dates in retail packages means whole or pitted dates, other than dates prepared or preserved, wrapped or... includes dates coated with a substance materially altering their color. (5) Dates prepared or preserved...
Atmospheric processes in reaction of Northern Sumatra Earthquake sequence Dec 2004-Apr 2005
Ouzounov, D.; Pulinets, S.; Cervone, G.; Singh, R.; Taylor, P.
2005-05-01
This work describes our first results in analyzing data from different and independent sources ûemitted long-wavelength radiation (OLR), surface latent heat flux (SHLF) and GPS Total Electron Content (TEC) collected from ground based (GPS) and satellite TIR (thermal infra-red) data sources (NOAA/AVHRR, MODIS). We found atmosphere and ionosphere anomalies one week prior to both the Sumatra-Andaman Islands earthquake (Dec 26, 2004) and M 8.7 - Northern Sumatra, March 28, 2005. We analyzed 118 days of data from December 1, 2004 through April 1, 2005 for the area (0°-10°,north latitude and 90°-100° east longitude) which included 125 earthquakes with M>5.5. Recent analysis of the continuous OLR from the Earth surface indicates anomalous variations (on top of the atmosphere) prior to a number of medium to large earthquakes. In the case of M 9.0 - Sumatra-Andaman Islands event, compared to the reference fields for the months of December between 2001 and 2004, we found strongly OLR anomalous +80 W/m2 signals (two sigma) along the epicentral area on Dec 21, 2004 five days before the event. In the case of M8.7 March 28, 2005 anomalues signatures over the epicenter appears on March 26 is much weaker (only +20W/m2) and have a different topology. Anomalous values of SHLF associated with M9.0 - Sumatra-Andaman Islands were found on Dec 22, 2005 (SLHF +280Wm2) and less intensity on Mar 23, 2005 (SLHF +180Wm2). Ionospheric variations (GPS/TEC) associated with the Northern Sumatra events were determine by five Regional GPS network stations (COCO, BAKO, NTUS, HYDE and BAST2). For every station time series of the vertical TEC (VTEC) were computed together with correlation with the Dst index. On December 22, four days prior to the M9.0 quake GPS/TEC data reach the monthly maximum for COCO with minor DST activity. For the M 8.7-March 28 event, the increased values of GPS/TEC were observed during four days (March 22-25) in quiet geomagnetic background. Our results need additional
Efeito da rotação da cabeça na pressão intraocular em decúbito ventral: estudo randomizado
Directory of Open Access Journals (Sweden)
M. Nuri Deniz
2013-04-01
Full Text Available JUSTIFICATIVA E OBJETIVOS: A elevação da pressão intraocular (PIO, que diminui a pressão de perfusão do nervo óptico, é aumentada pelo posicionamento em decúbito ventral. O objetivo de nosso estudo foi comparar o efeito da rotação lateral da cabeça a 45º em decúbito ventral no aumento da PIO de olhos posicionados para cima e olhos posicionados para baixo em pacientes submetidos à nefrolitotomia percutânea (NLPC. MÉTODOS: Quarenta e cinco pacientes foram randomicamente alocados em dois grupos. A PIO dos pacientes foi registrada bilateralmente em posição supina antes do início da operação. Os pacientes foram posicionados em decúbito ventral. A cabeça foi posicionada sobre um apoio sem compressão externa direta em ambos os olhos. Os pacientes do Grupo I foram estritamente mantidos em pronação neutra, enquanto os pacientes do Grupo II foram posicionados em pronação com rotação da cabeça a 45º para o lado direito. No fim da operação, os pacientes foram reposicionados em decúbito dorsal e a PIO foi imediatamente medida. RESULTADOS: Não houve diferença entre os dados demográficos, na duração da cirurgia, perda de sangue e reposição de líquido dos pacientes. Os valores pós-cirúrgicos da PIO em decúbito ventral aumentaram significativamente em comparação com os valores pré-operatórios em ambos os grupos (p < 0,05. Após a cirurgia em decúbito ventral, os valores da PIO nos olhos posicionados para cima no Grupo II foram significativamente menores do que no Grupo I e nos olhos posicionados para baixo no Grupo II (p < 0,05. CONCLUSÃO: A posição em decúbito ventral aumenta a PIO. Nos pacientes posicionados em decúbito ventral com rotação lateral da cabeça a 45º, a PIO nos olhos posicionados para cima foi significativamente menor.
Pukaki 1-01 : initial luminescence dating and radiometric measurements
International Nuclear Information System (INIS)
Rieser, U.
2001-01-01
Core from Pukaki 1-01 was sampled for luminescence dating and radiometric measurements on 14 March 2001 in the dark room laboratory at Victoria University. Seven samples were taken to get an overview of the crater history, and laboratory work was completed in August 2001. (author). 2 figs., 3 tabs
Dating violence among male and female youth seeking emergency department care.
Singh, Vijay; Walton, Maureen A; Whiteside, Lauren K; Stoddard, Sarah; Epstein-Ngo, Quyen; Chermack, Stephen T; Cunningham, Rebecca M
2014-10-01
We determine prevalence and correlates of dating violence, dating victimization, and dating aggression among male and female patients aged 14 to 20 years seeking emergency department (ED) care. This was a systematic sampling of subjects aged 14 to 20 years seeking care at a single large academic ED between September 2010 and March 2013. Participants completed a computerized, self-administered, cross-sectional survey of demographics, dating violence from physical abuse measures of the Conflict in Adolescent Dating Relationships Inventory, associated behaviors, and ED health service use. Separate analyses were conducted for male and female patients. Four thousand three hundred eighty-nine youths (86.1% participation rate) were screened, and 4,089 (mean age 17.5 years; 58% female patients) were eligible for analysis. Almost 1 in 5 female patients (n=215; 18.4%) and 1 in 8 male patients (n=212; 12.5%) reported past-year dating violence. Of female patients, 10.6% reported dating victimization and 14.6% dating aggression, whereas of male patients, 11.7% reported dating victimization and 4.9% reported dating aggression. Multivariate analyses showed that variables associated with any male dating violence were black race (adjusted odds ratio [AOR] 2.26; 95% CI 1.54 to 3.32), alcohol misuse (AOR 1.03; 95% CI 1.00 to 1.06), illicit drug use (AOR 2.38; 95% CI 1.68 to 3.38), and depression (AOR 2.13; 95% CI 1.46 to 3.10); any female dating violence was associated with black race (AOR 1.68; 95% CI 1.25 to 2.25), public assistance (AOR 1.64; 95% CI 1.28 to 2.09), grades D and below (AOR 1.62; 95% CI 1.07 to 2.43), alcohol misuse (AOR 1.04; 95% CI 1.02 to 1.07), illicit drug use (AOR 2.85; 95% CI 2.22 to 3.66), depression (AOR 1.86; 95% CI 1.42 to 2.44), and any past year ED visit for intentional injury (AOR 2.64; 95% CI 1.30 to 5.40). Nearly 1 of 6 male and female patients aged 14 to 20 years and seeking ED care report recent dating violence, and health disparities remain among
Directory of Open Access Journals (Sweden)
Alessandro Leite Cavalcanti
2008-07-01
Full Text Available Este estudo retrospectivo determinou a prevalência da perda precoce demolares decíduos em pacientes atendidos na clínica de Odontopediatria da Universidade Estadual da Paraíba. Foram examinados 515 prontuários, sendo os dados registrados em um formulário. Foram analisadas as variáveis: gênero, idade, tipo de molar decíduo perdido,arcada dentária (maxilar ou mandibular e lado (direito e esquerdo. Observou-se que a prevalência de perda precoce foi de 15,1%, existindo uma distribuição similar entre os gêneros. Em relação à idade da criança, a maior freqüência de perda acometeu pacientescom sete anos (32,1%. Houve distribuição equitativa da perda dentária entre as arcadas superior e inferior, com 43,6% cada uma, sendo o lado esquerdo o mais acometido (41%. O segundo molar superior esquerdo foi o mais acometido (17,9%, seguido do primeiromolar decíduo superior direito (16,1%. Pode-se concluir que a prevalência de perda precoce foi baixa e que os molares decíduos superiores foram os dentes mais comumente perdidos.This retrospective study determined the prevalence of early loss of deciduous molars in patients enrolled at the Pediatric Dentistry clinic at the State University of Paraíba. A review of 515 patient records were analyzed, registered in a form. The following variables were analyzed: gender, age, type of deciduous molar loss, region (maxilla or mandible and side (right and left. It was observed that the prevalence of early tooth loss was 15.1% and there was a similar distribution between the genders. In regard to age, the greatest frequency of tooth loss involved patients at 7 years old (32.1%. There was a similar distribution of tooth loss between the maxilla and mandible regions, at 43.6% each, with the left side being themost involved (41%. The second upper left deciduous molar was the most commonly missing tooth (17.9%, followed by the first upper right deciduous molar (16.1%. It can be concluded that the
Review of all-sky camera data for the period Sep. 1 to Dec. 1, 1976
International Nuclear Information System (INIS)
1978-02-01
The auroral and cloud conditions are presented in the form of a numerical code, in coordinate tables, the coordinates representing the date and universal time respectively. The compilation is intended to be a guide to available all-sky camera films, copies of which are supplied at self-cost prices by the Auroral Observatory. (JIW)
DSU Unit
2008-01-01
The final edition (Nos 51-52/2008 and 1-2/2009) of the last Weekly Bulletin of the year will be published on Friday 12 December and will cover events at CERN from 15 December 2008 to 12 January 2009. Announcements for publication in this issue should reach the Publication Section (Communication group) or the Staff Association, as appropriate by noon, on Tuesday 9 December. Bulletin publication 2009 The table below lists the 2009 publication dates for the paper version of the Bulletin and the corresponding deadlines for the submission of announcements. Please note that all announcements must be submitted by 12.00 midday on Tuesdays at the latest. Bulletin No. Week number Submission of announcements (before 12.00 midday) Publication date 3-4 Tuesday 6 January Monday 12 January 5-6 Tuesday 20 January Monday 26 January 7-8 Tuesday 3 February Monday 9 February 9-10 Tuesday 17 Februar...
OL-DEC-MDP Model for Multiagent Online Scheduling with a Time-Dependent Probability of Success
Directory of Open Access Journals (Sweden)
Cheng Zhu
2014-01-01
Full Text Available Focusing on the on-line multiagent scheduling problem, this paper considers the time-dependent probability of success and processing duration and proposes an OL-DEC-MDP (opportunity loss-decentralized Markov Decision Processes model to include opportunity loss into scheduling decision to improve overall performance. The success probability of job processing as well as the process duration is dependent on the time at which the processing is started. The probability of completing the assigned job by an agent would be higher when the process is started earlier, but the opportunity loss could also be high due to the longer engaging duration. As a result, OL-DEC-MDP model introduces a reward function considering the opportunity loss, which is estimated based on the prediction of the upcoming jobs by a sampling method on the job arrival. Heuristic strategies are introduced in computing the best starting time for an incoming job by each agent, and an incoming job will always be scheduled to the agent with the highest reward among all agents with their best starting policies. The simulation experiments show that the OL-DEC-MDP model will improve the overall scheduling performance compared with models not considering opportunity loss in heavy-loading environment.
Nagata, Takeshi
1947-01-01
In in the early morning of Dec. 21, 1946, a great destructive earthquake occurred in southern-western Japan. According to the seismogram obtained in our university, the earthquake motion began at Tokyo from 4 h 20 m 10.4 s on Dec. 21, 1946. The maximum amplitude of NS, EW, and up-down components of the earthquake motion at Tokyo was 12.0 mm, 14.0 mm and 3.0 mm respectively, while the initial motion was composed of 80 μ south, 67 μ west and 20 μ down movements.
Struga, Marta; Kossakowski, Jerzy; Stefańska, Joanna; Zimniak, Andrzej; Koziol, Anna E
2008-06-01
A new quaternary ammonium compound, bis-[2-hydroxy-3-(1,7,8,9,10-pentamethyl-3,5-dioxo-4-aza-tricyclo[5.2.1.0(2,6)]dec-8-en-4-yloxy)-propyl]-dimethyl-ammonium chloride (4), was synthesized. The compound was investigated for antibacterial activity, including Gram-positive cocci and Gram-negative rods, and antifungal activity. Compound 4 showed significant inhibition against Staphylococcus aureus. Research was carried out over 4 standard strains and 40 hospital strains. Elementary analysis and/or MS, (1)H NMR and (13)C NMR spectra confirmed the identity of the products. The molecular structure of 3 was determined by an X-ray analysis.
Um comentário sobre Gerasa, a cidade de Decápolis
Directory of Open Access Journals (Sweden)
Marisa Balsamo Steingberg
1969-09-01
Full Text Available Num remoto e quieto vale, junto às montanhas de Gilead, extendem-se as ruínas de Gerasa (Jerash atual, cidade da Decápolis . Sente-se seu poderio através de suas ruas e monumentos em bom estado de conservação: um dos mais complexos de cidade provincial romana.
Acculturation and Dating Violence Victimization among Filipino and Samoan Youths
Chung-Do, Jane J.; Goebert, Deborah A.
2009-01-01
Dating violence victimization is an important public health issue. Recent studies on minority youths have found higher risks of dating violence victimization compared to White youths. This study examined the influence of acculturation components on youths' experiences of dating violence by utilizing data from a survey of 193 Samoan and Filipino…
77 FR 46419 - 36(b)(1) Arms Sales Notification
2012-08-03
..., internal fuel tanks, spare and repair parts, tools and support equipment, publications and technical... Department: Army (VGB) (v) Prior Related Cases, if any: FMS Case UUF--$143M-13 Jun 00 FMS Case UTN--$116M-24 Dec 96 FMS Case USI--$ 37M-28 Dec 93 FMS Case ULY--$ 35M-29 Jun 89 FMS Case UKZ--$ 36M-30 Jun 87 FMS...
Nonreciprocal and Reciprocal Dating Violence and Injury Occurrence among Urban Youth
Directory of Open Access Journals (Sweden)
Swahn, Monica H
2010-08-01
Full Text Available Objective: Dating violence is a significant health problem among youth that leads to adverse health outcomes, including injuries. Reciprocal violence (perpetrated by both partners is associated with increased injury in adults, but very little is known about the prevalence and context for reciprocal violence, as well as injury rates, among youth. We sought to determine the prevalence and scope of reciprocal dating violence and injury occurrence among urban youth in a high-risk community. Methods: Analyses were based on data from the Youth Violence Survey, conducted in 2004, and administered to over 80% of public school students in grades 7, 9, 11, and 12 (N=4,131 in a high-risk, urban school district. The current analyses were restricted to those who reported dating in the past year and who also reported any dating violence (n=1,158. Dating violence was categorized as reciprocal (the participant reported both violence perpetration and victimization and non-reciprocal (the participant report either violence perpetration or victimization, but not both. Results: Dating violence reciprocity varied by sex. Girls who reported any dating violence were more likely to report reciprocal dating violence (50.4% than were boys (38.9%. However, reciprocity did not vary by race/ethnicity or grade level. Reciprocal dating violence was more common among participants who reported more frequent violence experiences. Reciprocal violence was also associated with greater injury occurrences relative to non-reciprocal relationships (10.1% versus 1.2%. Conclusion: Reciprocal dating violence is common among adolescents and leads more often to injury outcomes. In particular, relationships in which boys report reciprocal violence against their partner appear to lead to more frequent injury occurrences. These findings underscore the importance of addressing dating violence and factors that increase risk for reciprocal violence and therefore exacerbate injury occurrence
Dating violence and suicidal behavior in adolescents.
Holmes, Kristin; Sher, Leo
2013-01-01
The aim of this paper is to assess the possible consequences of adolescent physical, emotional and sexual dating violence through a review of the literature on the topic. An electronic search of major biomedical bibliographic databases (Pubmed, ISI, PsycINFO) was used to retrieve articles providing information on the prevalence rates, risk factors, associated consequences and possible preventive measures for adolescent dating violence across different populations. Currently, there have been few longitudinal studies conducted to identify potential risk factors for entering a violent dating relationship in adolescence. Risky behaviors such as early sexual intercourse may predispose someone for victimization. Dating violence itself is also a predictor of future dating violence. Adolescent dating violence was associated with an increase in other violence-related behaviors, substance use, depression, poorer educational outcomes, posttraumatic stress, unhealthy weight control and risky sexual behavior. The association between adolescent dating violence and an increase in suicidal behavior is a major public health concern. Future research should focus on longitudinal studies so that a causal relationship between dating violence and suicidality may be better understood.
41 CFR 50-203.22 - Effective date of determinations.
2010-07-01
... Public Contracts PUBLIC CONTRACTS, DEPARTMENT OF LABOR 203-RULES OF PRACTICE Minimum Wage Determinations Under the Walsh-Healey Public Contracts Act § 50-203.22 Effective date of determinations. Any minimum wage determination issued as a result of hearings held under this subpart shall take effect not less...
Directory of Open Access Journals (Sweden)
Néstor Hernando Campos
2012-04-01
Full Text Available Objetivo. Determinar la estructura de las poblaciones de crustáceos decápodos asociados a ensamblajes algales en el litoral rocoso del departamento de Córdoba. Materiales y métodos. Para la recolección de los especímenes se delimitó con un cuadrante de 625 cm2, un área con cinco repeticiones dispuestas al azar en cada estación. Para la separación de las macroalgas desde su disco de fijación en el sustrato, se empleó una espátula metálica. En un recipiente plástico se separaron los crustáceos decápodos del resto del material y se conservaron en alcohol al 70%. Resultados. Se identificaron representantes de 50 especies asociadas a los céspedes algales, agrupadas en 16 familias y 29 géneros. Especies como Acanthonyx petiverii, Epialtus bituberculatus, Eurypanopeus abbreviatus y Pachycheles serratus, presentaron un rango amplio de distribución, siendo características en las dos ecorregiones de estudio. Los cambios en cobertura de algas rojas como Gracilaria mammillaris, Hypnea musciformis y Acanthophora muscoides, determinaron la mayor asociación de crustáceos decápodos en la ecorregión Morrosquillo, mientras que los cambios en cobertura de G. damaecornis y Padina gymnospora, fueron las que determinaron la mayor asociación de crustáceos decápodos en el Darién cordobés. Conclusiones. Los resultados indicaron que las especies de crustáceos decápodos asociados a ensamblajes macroalgales, no se encontraron distribuidas de forma similar en las dos ecorregiones estudiadas, siendo P. armatus la especie con mayor porcentaje de abundancia en la ecorregión Morrosquillo, y E. bituberculatus en el sector comprendido entre los municipios de Moñitos y Los Córdobas.
Dating, sexual activity, and well-being in Italian adolescents
Ciairano, S; Bonino, S; Kliewer, W; Miceli, R; Jackson, S
Associations among dating, sexual activity, gender and adjustment were investigated in 2,2 73 Italian adolescents (54% female, ages 14 to 19 years) attending public high schools. After controlling for age and type of school attended, both being in a dating relationship and being male were associated
Digital Equipment Corporation (DEC): A case study of indecision, innovation and company failure
Goodwin, D.T.
2016-01-01
The minicomputer began a revolution in the computer industry and was influential in the industry for over twenty years until superseded by client server computing and the personal computer. The subject of the thesis is a case study of how DEC, which was number two in the world in 1988, became a
Terapia pulpar em dentes decíduos: possibilidades terapêuticas baseadas em evidências
Directory of Open Access Journals (Sweden)
Natalino Lourenço Neto
Full Text Available INTRODUÇÃO: A pulpotomia em dentes decíduos é uma técnica conservadora de terapia pulpar amplamente utilizada em Odontopediatria, sendo de fundamental importância para evitar a perda prematura desses dentes, quer seja por alterações provocadas pela cárie dentária ou traumatismo dentário. Apesar de ser uma técnica estudada há muitos anos, causa muitas controvérsias e discussões, principalmente em termos de biocompatibilidade dos medicamentos empregados e pelas dificuldades e falhas no diagnóstico da condição pulpar. OBJETIVO: Por meio de uma revisão sistemática da literatura, no período compreendido entre 2000 e 2011, e com enfoque em estudos clínicos randomizados, revisões sistemáticas e meta-análises, este trabalho teve como objetivo discutir, com base em evidências científicas, alternativas para o tratamento de pulpotomia em dentes decíduos humanos. CONCLUSÃO: As evidências científicas fidedignas com o uso de materiais capeadores pulpares e as técnicas de Eletrocirurgia e Laser de Baixa Potência foram escassas. Desta forma, sugere-se a realização de estudos complementares bem delineados estatisticamente para maiores esclarecimentos. As informações geradas em tais experimentos poderão contribuir para um melhor entendimento dos mecanismos da terapia pulpar, podendo gerar o desenvolvimento de protocolos com novas formas terapêuticas, que visam a melhorar a terapia pulpar em dentes decíduos.
Automated Program Analysis for Cybersecurity (APAC)
2016-07-14
report is the result of contracted fundamental research deemed exempt from public affairs security and policy review in accordance with SAF/AQR memorandum...contracted fundamental research deemed exempt from public affairs security and policy review in accordance with SAF/AQR memorandum dated 10 Dec 08 and...program was to measure the effectiveness and efficiency of the R&D teams in detecting malware in Android applications. In order to achieve this goal
A Moderator Model of Alcohol Use and Dating Aggression among Young Adults.
Collibee, Charlene; Furman, Wyndol
2018-03-01
Dating aggression has been identified as a priority public health concern. Although alcohol use is a known robust risk factor for dating aggression involvement, such usage is neither necessary nor sufficient for dating aggression involvement. As such, a growing topic of interest is a better understanding of when, and for whom, alcohol use increases risk. A theoretical moderator model posits that associations between alcohol use and dating aggression involvement vary depending on both background (e.g., psychopathology) and situational (e.g., relationship characteristics) risk factors. Alcohol use is thought to be more strongly associated with dating aggression in the context of these other risk factors. Using an intensive longitudinal design, we collected six waves of data spanning 6 months from 120 participants (60 females; M age W1 = 22.44). Alcohol use and relationship risk were both associated with increases in dating aggression involvement. Consistent with a moderator model, interactions emerged between alcohol use and relationship risk for subsequent dating aggression involvement. The findings underscore the importance of alcohol use and relationship risk for the development of intervention and prevention programs.
2010-10-01
... provisions of Article 34 and 25 of repayment contract I1r-1534, dated September 20, 1948, between the United... supplemented, Articles 34, and 25 of the Repayment Contract I1r-1534 dated Sept. 20, 1948, between the United... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Regulations. 424.1 Section 424.1 Public...
Leck, Kira
2006-10-01
Researchers have associated minimal dating with numerous factors. The present author tested shyness, introversion, physical attractiveness, performance evaluation, anxiety, social skill, social self-esteem, and loneliness to determine the nature of their relationships with 2 measures of self-reported minimal dating in a sample of 175 college students. For women, shyness, introversion, physical attractiveness, self-rated anxiety, social self-esteem, and loneliness correlated with 1 or both measures of minimal dating. For men, physical attractiveness, observer-rated social skill, social self-esteem, and loneliness correlated with 1 or both measures of minimal dating. The patterns of relationships were not identical for the 2 indicators of minimal dating, indicating the possibility that minimal dating is not a single construct as researchers previously believed. The present author discussed implications and suggestions for future researchers.
International Nuclear Information System (INIS)
Kuznietz, M.; Makeveth, D.; Israeli, O.
1978-09-01
The front-pages of 24 works, written by employees of the Nuclear Research Center - Negev, and published in 1977 by the Publishing Department of its Scientific and Technical Information Service, as publications in the NRCN series or in the NRCN(ER), NRCN(GP), and NRCN(TN) sub-series, are presented. The front-pages include the respective NRCN serial or sub-serial number, title, authors, date of publication, and abstract (and date of receipt, if substantially preceding the date of publication) in the original language (Hebrew or English). The front-page translations (into English or Hebrew, respectively) are also included. Various data, concerning the NRCN publications in 1977, are given, as well as a list of all publications and alphabetical lists of authors (in Hebrew and Latin transliteration)
Dating Violence and Self-Efficacy for Delayed Sex among ...
African Journals Online (AJOL)
In South Africa, dating violence is known to be widespread among adolescents, and is therefore a major public health issue because of its association with sexual risk behaviours. The objective of the study was to examine the relationship between dating violence and self-efficacy for delayed sex among school-going ...
Formatos de vídeo, códec y otros aspectos del montaje audiovisual
Cuadrado Sánchez, Rocío
2013-01-01
Este trabajo es una investigación sobre qué es un formato, qué códec hay en el mercado y los procesos que entran en juego a la hora de crear y desarrollar un proyecto para después compartirlo sin ningún problema
Dating Violence and Substance Use as Longitudinal Predictors of Adolescents' Risky Sexual Behavior.
Shorey, Ryan C; Fite, Paula J; Choi, HyeJeong; Cohen, Joseph R; Stuart, Gregory L; Temple, Jeff R
2015-08-01
The objectives of this study is to examine dating violence perpetration and victimization (physical, psychological, and sexual) and lifetime substance use (alcohol, marijuana, and hard drugs) as longitudinal predictors of adolescents' risky sexual behavior across 1 year and to determine whether predictors varied across adolescents' gender and ethnicity. A sample of Caucasian, African American, and Hispanic male and female adolescents from seven public high schools in Texas (N = 882) participated. Adolescents completed self-report measures of dating violence, lifetime substance use, and risky sexual behavior at baseline and, 1-year later, completed a second assessment of their risky sexual behavior. Path analysis demonstrated that greater physical dating violence victimization, lifetime alcohol use, lifetime marijuana use, and age (being older) were all significant predictors of risky sexual behavior at the 1-year follow-up. These results did not vary across gender or the three ethnic groups (Caucasian, African American, and Hispanic). Overall, substance use was a longitudinal predictor of risky sexual behavior across the three ethnic groups, with physical dating violence victimization being the only type of dating violence longitudinally predicting risky sexual behavior. Prevention efforts should consider the roles of physical dating violence and substance use in preventing risky sexual behavior.
Dating Violence and Substance Use among Ethnically Diverse Adolescents
Temple, Jeff R.; Freeman, Daniel H., Jr.
2011-01-01
Teen dating violence is a serious public health concern with numerous and long-lasting consequences. Although alcohol and drug use have been associated with dating violence, little is known about the role of specific substances, especially the use of club drugs and the nonmedical use of prescription drugs. Thus, the authors examined the…
Silicon tunnel FET with average subthreshold slope of 55 mV/dec at low drain currents
Narimani, K.; Glass, S.; Bernardy, P.; von den Driesch, N.; Zhao, Q. T.; Mantl, S.
2018-05-01
In this paper we present a silicon tunnel FET based on line-tunneling to achieve better subthreshold performance. The fabricated device shows an on-current of Ion = 2.55 × 10-7 A/μm at Vds = Von = Vgs - Voff = -0.5 V for an Ioff = 1 nA/μm and an average SS of 55 mV/dec over two orders of magnitude of Id. Furthermore, the analog figures of merit have been calculated and show that the transconductance efficiency gm/Id beats the MOSFET performance at low currents.
Dittrich, T. M.
2015-12-01
Much attention has been devoted in recent years to the importance of Science, Technology, Engineering, and Math (STEM) education in K-12 curriculum for developing a capable workforce. Equally important is the role of the voting public in understanding STEM-related issues that impact public policy debates such as the potential impacts of climate change, hydraulic fracturing in oil and gas exploration, mining impacts on water quality, and science funding. Since voted officials have a major impact on the future of these policies, it is imperative that the general public have an understanding of the basic science behind these issues. By engaging with the public in a more fundamental way, university students can play an important role in educating the public while at the same time enhancing their communication skills and gaining valuable teaching experience. I will talk about my own experiences in (1) evaluating and publishing water chemistry and hazardous waste cleanup curriculum on the K-12 engineering platform TeachEngineering.org, (2) organizing public tours of water and energy sites (e.g., abandoned mine sites, coal power plants, wastewater treatment plants, hazardous waste treatment facilities), and (3) other outreach and communication activities including public education of environmental issues through consultations with customers of a landscaping/lawn mowing company. The main focus of this presentation will be the role that graduate students can play in engaging and educating their local community and lessons learned from community projects (Dittrich, 2014; 2012; 2011). References: Dittrich, T.M. 2014. Adventures in STEM: Lessons in water chemistry from elementary school to graduate school. Abstract ED13E-07 presented at 2014 Fall Meeting, AGU, San Francisco, Calif., 15-19 Dec. Dittrich, T.M. 2012. Collaboration between environmental water chemistry students and hazardous waste treatment specialists on the University of Colorado-Boulder campus. Abstract ED53C
42 CFR 435.965 - Delay of effective date.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Delay of effective date. 435.965 Section 435.965 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... describing a good faith effort to come into compliance with the requirements of section 1137 of the Act and...
Opdyke, N. D.; Kent, D. V.; Huang, K.; Patel, J. P.
2007-12-01
Field work on this study was carried out in August of 2006 by field parties from the University of Florida and Rutgers University. Mt Kenya is believed to be Plio-Pleistocene in age and an Argon dating survey is underway Ten samples were taken at each site consisting of one exposure in individual lava Flows. These exposures are usually in road cuts, streambeds and in some cases roadbeds. We sampled 100 sites distributed around the Mt Kenya Massif and to the northeast along the Nyambini range. The equator bisex's Mt Kenya and all sites were sampled within 40" north or south of the equator . The samples were returned to the US and processed at the University of Florida paleomagnetic laboratory. Many sites were severely affected by lightning however after demagnetization 68 sites yielded directions with alpha 95's equal to or less than 10°. Normal magnetized sites dominate, with N=58 (Dec=1°,Inc -0.1°,α95=2.6°) whereas only 10 reverse sites(Dec. =181.9,Inc. .6°α 95=8°) were identified. The combined site mean direction is Dec=1.1°, Inc..= -0.2° and α 95=3.2°. This result is not significantly different from what is expected from the geocentric axial dipole. VGP's were calculated from each site and the dispersion is low with the ASD = 11° which is in agreement with model "G" of MacFadden and McElhinny .No transitional directions were identified . Quadrupole components are not resolved. 1 Department of geological Sciences, the University of Florida , 2 Dept of Geology, Rutgers University,3,dept of Physics ,The University of Nairobi
37 CFR 1.219 - Early publication.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Early publication. 1.219... COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions Publication of Applications § 1.219 Early publication. Applications that will be published under § 1.211 may be published...
Taylor, Katherine A; Sullivan, Terri N; Farrell, Albert D
2015-03-01
Dating violence is commonly perpetrated in adolescence, making it imperative to understand risk factors in order to inform prevention efforts. Although individual norms supporting dating violence are strongly related to its perpetration, few studies have examined their longitudinal impact. Moreover, the influence of class norms (i.e., norms for students in the same grade, cohort, and school) supporting dating violence on perpetration has rarely been studied. The current study examined longitudinal relationships between individual and class norms supporting dating violence and perpetration of physical and psychological dating violence. Participants were two cohorts of sixth graders from 37 schools who were in dating relationships at Wave 1 and 6 months later at Wave 2 (N = 2,022; 43% female; 52% African American, 21% Latino/a, 20% White, and 7% other). The analyses used a multilevel approach, with students represented at Level 1 and classes (n = 74) at Level 2. The models tested direct effects of Wave 1 individual and class norms supporting dating violence on subsequent changes in perpetration of dating violence at Wave 2 and the extent to which gender moderated these relationships. The findings indicated that greater individual norms supporting male dating violence predicted greater change in perpetration of physical and psychological dating violence and greater individual norms supporting female dating violence predicted greater change in perpetration of psychological dating violence. Greater class norms supporting male dating violence predicted greater change in perpetration of physical dating violence; whereas greater class norms supporting female dating violence predicted less change in perpetration of physical dating violence. These findings highlight the need to address norms in early adolescence.
15 CFR 60.1 - Public information.
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Public information. 60.1 Section 60.1 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade BUREAU OF THE CENSUS, DEPARTMENT OF COMMERCE PUBLIC INFORMATION § 60.1 Public information. The rules and procedures regarding...
Decúbito prono en pacientes con síndrome de distrés respiratorio agudo
Directory of Open Access Journals (Sweden)
Mariano Setten
Full Text Available RESUMEN El síndrome de distrés respiratorio agudo ocupa gran atención en la unidad de cuidados intensivos. A pesar del amplio conocimiento alcanzado sobre la fisiopatología de éste síndrome, el enfoque en la unidad de cuidados intensivos consiste, en gran parte, en un tratamiento de soporte vital y en evitar los efectos secundarios de las terapéuticas invasivas. Si bien, durante los últimos 20 años, se generaron grandes avances en ventilación mecánica con un impacto importante sobre la mortalidad, ésta continúa siendo elevada. Una característica de los pacientes con síndrome de distrés respiratorio agudo, sobre todo los más severos, es la presencia de hipoxemia refractaria debido a la existencia de shunt, pudiendo requerir tratamientos adicionales a la ventilación mecánica, entre ellos la ventilación mecánica en decúbito prono. Este método, recomendado para mejorar la oxigenación por primera vez en 1974, puede ser implementado fácilmente en cualquier unidad de cuidados intensivos con personal entrenado. El decúbito prono tiene un sustento bibliográfico sumamente robusto. Varios ensayos clínicos randomizados han demostrado el efecto del decúbito prono sobre la oxigenación en pacientes con síndrome de distrés respiratorio agudo medida a través de la relación PaO2/FiO2 e incluso su impacto en el aumento de la sobrevida de estos pacientes. Los integrantes del Comité de Kinesiología Intensivista de la Sociedad Argentina de Terapia Intensiva realizaron una revisión narrativa con el objetivo de exponer la evidencia disponible en relación a la implementación del decúbito prono, los cambios producidos en el sistema respiratorio por la aplicación de la maniobra y su impacto sobre la mortalidad. Por último, se sugerirán lineamientos para la toma de decisiones.
75 FR 53303 - Notice of Public Hearing
2010-08-31
... FINANCIAL CRISIS INQUIRY COMMISSION Notice of Public Hearing AGENCY: Financial Crisis Inquiry Commission. ACTION: Notice. SUMMARY: The next public hearing of the Financial Crisis Inquiry Commission (FCIC....gov . DATES: The hearing will be held on: Wednesday, September 1, 2010, 9 a.m. EDT; and Thursday...
48 CFR 1.105-1 - Publication and code arrangement.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Publication and code arrangement. 1.105-1 Section 1.105-1 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL FEDERAL ACQUISITION REGULATIONS SYSTEM Purpose, Authority, Issuance 1.105-1 Publication and code...
International Nuclear Information System (INIS)
Kuznietz, M.; Wiener, U.; Israeli, O.
1977-04-01
The front-pages of 35 works, written by employees of the Nuclear Research Center - Negev, and published in 1976 by the Publishing Department of its Scientific and Technical Information Service, as publications in the NRCN series or in the NRCN(ER), NRCN(ML), and NRCN(TN) sub-series, are presented. The front-pages include the respective NRCN serial or sub-serial number, title, authors, date of publication, and abstract (and date of receipt, if substantially preceding the date of publication) in the original language (Hebrew or English). The front-page translations (into English or Hebrew), if published, are also included. Various data, concerning the NRCN publications in 1976, are given as well as alphabetical lists of authors (in Hebrew and Latin transliteration)
Publication status of contemporary oncology randomised controlled trials worldwide.
Chen, Yu-Pei; Liu, Xu; Lv, Jia-Wei; Li, Wen-Fei; Zhang, Yuan; Guo, Ying; Lin, Ai-Hua; Sun, Ying; Mao, Yan-Ping; Ma, Jun
2016-10-01
Little is known about the extent of selective publication in contemporary oncology randomised controlled trials (RCTs) worldwide. This study aimed to evaluate the rates of publication and timely publication (within 24 months) for contemporary oncology RCTs from all over the world. We also investigated the trial characteristics associated with publication and timely publication. We identified all phase III oncology RCTs registered on ClinicalTrials.gov with a primary completion date between January 2008 and December 2012. We searched PubMed and EMBASE to identify publications. The final search date was 31 December 2015. Our primary outcome measure was the time to publication from the primary completion date to the date of primary publication in a peer-reviewed journal. We identified 598 completed oncology RCTs; overall, 398 (66.6%) had been published. For published trials, the median time to publication was 25 months (interquartile range, 16-37 months). Only 192 trials (32.1%) were published within 24 months. Timely publication was independently associated with trials completed late in 2012. Trials conducted in Asia and other regions were less likely to have timely publication, but trials conducted in different locations were all equally likely to be published. Industry- and NIH-funded trials were equally likely to be published timely or at any time after trial completion. Among 391 published trials with clear primary outcomes, there was a trend for timely publication of positive trials compared with negative trials. Despite the ethical obligations and societal expectations of disclosing findings promptly, oncology RCTs performed poorly. Copyright © 2016 Elsevier Ltd. All rights reserved.
Tree-Ring Dating of the Reshui-1 Tomb in Dulan County, Qinghai Province, North-west China
LI, M.; Xuemei, S.; Yin, Z. Y.; Xu, X.
2015-12-01
Tuyuhun and Tubo were two important states that thrived in north-western China during AD 311-900 in parallel with the Han Chinese dynasties of Sui and Tang periods. The Reshui Tomb Cluster located in Dulan County of the north-eastern Tibetan Plateau is an important cultural relic of the Tuyuhun-Tubo age. The official excavations of the Reshui tombs were regarded as top events in archaeology in the 1980s and 1990s in China. The Reshui-1 Tomb is the largest one among the tombs in the area. Since its excavation, there have been debates on whether the owner of the tomb belonged to the Tuyuhun or Tubo ethnicity. Therefore, accurately dating the Reshui-1 Tomb has a critical place in studying the Tubo and Tuyuhun histories. We collected 7 discs and 11 increment cores of Qilian juniper (Juniperus przewalskii Kom.) from the exposed and fallen beams of the roof of the Reshui-1Tomb. The lengths of the 16 tree-ring records are between 69 and 152 years. Based on a previously developed master dating chronology using Qilian juniper samples from the eastern Qaidam Basin, the calendar dates of the 16 specimens were determined by the COFECHA program and visual dating procedure. The average inter-series correlation among the dated sample series is 0.696, indicating good quality of cross-dating. The year of the outermost rings is AD 715 for the 7 discs and 4 out of the 9 increment cores. Moreover, the ring-width variations of the samples are consistent with the existing chronologies from the region. The presence of late-wood of AD 715 in the samples indicated that the Reshui-1 Tomb was completed in late AD 715 or early 716, which means that the Reshui-1 Tomb was finished in the Tubo age. This date provides direct evidence for archaeologists to determine the owner's ethnicity and identify of the Reshui-1 Tomb.
Tree-Ring Dating of the Reshui-1 Tomb in Dulan County, Qinghai Province, North-West China.
Directory of Open Access Journals (Sweden)
Mingqi Li
Full Text Available Tuyuhun and Tubo were two important states that thrived in north-western China during AD 311-900 in parallel with the Han Chinese dynasties of Sui and Tang periods. The Reshui Tomb Cluster located in Dulan County of the north-eastern Tibetan Plateau is an important cultural relic of the Tuyuhun-Tubo age. The official excavations of the Reshui tombs were regarded as top events in archaeology in the 1980s and 1990s in China. The Reshui-1 Tomb is the largest one among the tombs in the area. Since its excavation, there have been debates on whether the owner of the tomb belonged to the Tuyuhun or Tubo ethnicity. Therefore, accurately dating the Reshui-1 Tomb has a critical place in studying the Tubo and Tuyuhun histories. We collected 7 discs and 11 increment cores of Qilian juniper (Juniperus przewalskii Kom. from the exposed and fallen beams of the roof of the Reshui-1Tomb. The lengths of the 16 tree-ring records are between 69 and 152 years. Based on a previously developed master dating chronology using Qilian juniper samples from the eastern Qaidam Basin, the calendar dates of the 16 specimens were determined by the COFECHA program and visual dating procedure. The average inter-series correlation among the dated sample series is 0.696, indicating good quality of cross-dating. The year of the outermost rings is AD 715 for the 7 discs and 4 out of the 9 increment cores. Moreover, the ring-width variations of the samples are consistent with the existing chronologies from the region. The presence of late-wood of AD 715 in the samples indicated that the Reshui-1 Tomb was completed in late AD 715 or early 716, which means that the Reshui-1 Tomb was finished in the Tubo age. This date provides direct evidence for archaeologists to determine the owner's ethnicity and identify of the Reshui-1 Tomb.
75 FR 67393 - Notice of Public Meeting, Eastern Montana Resource Advisory Council Meeting
2010-11-02
... Public Meeting, Eastern Montana Resource Advisory Council Meeting AGENCY: Bureau of Land Management... 1972 (FACA), the U.S. Department of the Interior, Bureau of Land Management (BLM) Eastern Montana... Eastern Montana Resource Advisory Council will be held on Dec. 2, 2010 in Billings, Montana. The meeting...
41 CFR 101-4.100 - Purpose and effective date.
2010-07-01
... EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 101-4.100 Purpose and... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Purpose and effective date. 101-4.100 Section 101-4.100 Public Contracts and Property Management Federal Property Management...
46 CFR 121.420 - Charts and nautical publications.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Charts and nautical publications. 121.420 Section 121... publications. (a) As appropriate for the intended voyage, a vessel must carry adequate and up-to-date: (1... publication; (3) Coast Guard Light List; (4) Tide tables; and (5) Current tables, or a river current...
Strontium-90 and cesium-137 in total diet (from Jun. 1982 to Dec. 1982)
International Nuclear Information System (INIS)
1982-01-01
Strontium-90 and cesium-137 in total diet (from Jun. to Dec. 1982) were determined. A full one day ordinary diet including three meals, water, tea and other in-between snacks for five persons was collected as a sample of ''total diet'' from 22 sampling locations. The results are shown in a table. (Namekawa, K.)
Strontium-90 and cesium-137 in sea fish (from Jun. 1982 to Dec. 1982)
International Nuclear Information System (INIS)
1982-01-01
Strontium-90 and cesium-137 in sea fish (from Jun. to Dec. 1982) were determined. Fish was collected from 22 sampling locations. Only the edible part was used in case of larger sized fish, and the whole part was used in case of smaller ones. The results are sown in a table. (Namekawa, K.)
Displaying DIII-D plasma data using DEC's X window system
International Nuclear Information System (INIS)
Greene, K.L.
1991-11-01
The D3-D tokamak program, funded by the Department of Energy, carries out plasma physics and fusion energy research experiments. The machine began operation in February 1986; at that time, approximately 7 Mbytes of data was collected for shot. Since that time, the shot size has steadily increased to over 50 Mbytes with the average shot size between 35 and 45 Mbytes. Shots are fired every 12 to 15 minutes and last approximately 5 to 10 seconds. Between 30 and 40 shots are fired each day when plasma experiments are scheduled. In 1987 MFITD and MFITPLAY were written/modified. These two programs provide graphical output that allows the users to see, before the next shot, the plasma shape and the locations of the plasma and magnetic flux lines within the tokamak. MFITD performs the computations which calculate the shape and location of the plasma; it also graphically displays a small subset of timeslice data. MFITPLAY graphically displays the full set of timeslice data. Through interactive commands, MFITPLAY also allows the user to control the various aspects of how the data is displayed. In 1990, both programs were converted from User Interface Services (UIS) routines, which are part of the MicroVMS workstation graphics software, to DEC's X Window System using the DECWindows window manager. These modifications were required because of a move by Digital Equipment Corporation (DEC) to support X windows and phase out UIS. Due to the nature and purpose of each program, MFITD needed only simple graphics conversion while MFITPLAY was completely rewritten. The DECWindows version of MFITPLAY offers a number of improvements, such as a more intuitive user interface
Rational bandits: Plunder, public goods, and the Vikings
DEFF Research Database (Denmark)
Kurrild-Klitgaard, Peter; Svendsen, Gert Tinggaard
2003-01-01
The paper applies and extends insights from Mancur Olson's study of state making to the Vikings. In a world of roving bandits, a sub-optimal provision of public goods exists, most notably of security. Roving banditry leads to over-plundering and zero profits for the plunderers, which makes statio...... of the process being reflected in the variation in the number of raids and the amount of wealth extracted. Udgivelsesdato: DEC...
Dating Violence and Substance Use as Longitudinal Predictors of Adolescents’ Risky Sexual Behavior
Shorey, Ryan C.; Fite, Paula J.; Choi, HyeJeong; Cohen, Joseph R.; Stuart, Gregory L.; Temple, Jeff R.
2015-01-01
Objective To examine dating violence perpetration and victimization (physical, psychological, and sexual) and lifetime substance use (alcohol, marijuana, and hard drugs) as longitudinal predictors of adolescents’ risky sexual behavior across one year, and to determine whether predictors varied across adolescents’ gender and ethnicity. Methods A sample of Caucasian, African American, and Hispanic male and female adolescents from 7 public high schools in Texas (N = 882) participated. Adolescents completed self-report measures of dating violence, lifetime substance use, and risky sexual behavior at baseline and, 1-year later, completed a second assessment of their risky sexual behavior. Results Path analysis demonstrated that greater physical dating violence victimization, lifetime alcohol use, lifetime marijuana use, and age (being older) were all significant predictors of risky sexual behavior at the 1-year follow-up. These results did not vary across gender or the three ethnic groups (Caucasian, African American, and Hispanic). Conclusions Overall, substance use was a longitudinal predictor of risky sexual behavior across the three ethnic groups, with physical dating violence victimization being the only type of dating violence longitudinally predicting risky sexual behavior. Prevention efforts should consider the roles of physical dating violence and substance use in preventing risky sexual behavior. PMID:25797949
Carbonates in leaching reactions in context of "1"4C dating
International Nuclear Information System (INIS)
Michalska, Danuta; Czernik, Justyna
2015-01-01
Lime mortars as a mixture of binder and aggregate may contain carbon of various origins. If the mortars are made of totally burnt lime, radiocarbon dating of binder yields the real age of building construction. The presence of carbonaceous aggregate has a significant influence on the "1"4C measurements results and depending on the type of aggregate and fraction they may cause overaging. Another problem, especially in case of hydraulic mortars that continue to be chemically active for a very long time, is the recrystallization usually connected with rejuvenation of the results but also, depending on local geological structures, with so called reservoir effect yielding apparent ages. An attempt in separating the binder from other carbonaceous components successfully was made for samples from Israel by Nawrocka-Michalska et al. (2007). The same preparation procedure, after taking into account the petrographic composition, was used for samples coming from Poland, Nawrocka et al. (2009). To verify the procedure used previously for non-hydraulic samples determination an experimental tests on carbonaceous mortars with crushed bricks from Novae in Bulgaria were made. Additionally, to identify different carbonaceous structures and their morphology, a cathodoluminescence and scanning electron microscope with electron dispersive spectrometer were applied. The crushed bricks and brick dust used in mortars production process have been interpreted as an alternative use to other pozzolanic materials. The reaction between lime and pozzolanic additives take place easily and affects the rate and course of carbonates decomposition in orthophosphric acid, during the samples pretreatment for dating. The composition of the Bulgarian samples together with influence of climate conditions on mortar carbonates do not allow for making straightforward conclusions in chronology context, but gives some new guidelines in terms of hydraulic mortars application for dating. This work has mainly
1 CFR 10.10 - Publication required.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Publication required. 10.10 Section 10.10 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER SPECIAL EDITIONS OF THE FEDERAL REGISTER PRESIDENTIAL PAPERS Annual Publication § 10.10 Publication required. The Director of the Federal...
International Nuclear Information System (INIS)
Fortin, Ph.
2000-01-01
This document gives a first introduction to 14 C dating as it is put into practice at the radiocarbon dating centre of Claude-Bernard university (Lyon-1 univ., Villeurbanne, France): general considerations and recalls of nuclear physics; the 14 C dating method; the initial standard activity; the isotopic fractioning; the measurement of samples activity; the liquid-scintillation counters; the calibration and correction of 14 C dates; the preparation of samples; the benzene synthesis; the current applications of the method. (J.S.)
Calvete, Esther; Orue, Izaskun; Gamez-Guadix, Manuel; López de Arroyabe, Elena
2016-04-01
The aim of this study was to assess the reciprocal associations among social information processing (SIP) in dating conflicts and the perpetration of dating aggression. A first step involved the development of a measure (The Social Information Processing Questionnaire in Dating Conflicts, SIPQ-DC) to assess social information in scenarios of conflict with dating partners. A sample of 1,272 adolescents (653 girls, 619 boys; Mage = 14.74 years, SD = 1.21) completed measures of SIP and dating aggression perpetration in two different times, which were spaced 1 year apart. Confirmatory factor analyses provided support for a model with five correlated factors for the SIPQ-DC, namely, hostile attribution, anger, aggressive response access, anticipation of positive consequences for oneself, and anticipation of negative consequences for partners. Although the perpetration of dating aggression at T1 was cross-sectionally associated with all the SIP components, anger was the only component that predicted the residual increase in dating aggression behavior over time. The perpetration of dating aggression predicted a worsening of cognitive-emotional processes involved in dating conflicts. Some longitudinal paths were significant only in male adolescents. In conclusion, relationships among SIP and aggression are reciprocal. Gender differences in longitudinal paths can contribute to explaining men's higher perpetration of violence in adulthood. © The Author(s) 2014.
Directory of Open Access Journals (Sweden)
David Collu
2009-12-01
Full Text Available A series of twenty arylpiperazine derivatives of 1,7,8,9-tetrachloro-10,10-dimethoxy-4-azatricyclo[5.2.1.02,6]dec-8-ene-3,5-dione have been prepared. These derivatives were tested in vitro with the aim of identifying novel lead compounds active against emergent and re-emergent human and cattle infectious diseases (AIDS, hepatitis B and C, tuberculosis, bovine viral diarrhea. In particular, these compounds were evaluated in vitro against representatives of different virus classes, such as a HIV-1 (Retrovirus, a HBV (Hepadnavirus and the single-stranded RNA+ viruses Yellow fever virus (YFV and Bovine viral diarrhea virus (BVDV, both belonging to the Flaviridae. Compounds 2c, 2g and 3d showed a modest activity against CVB-2. The molecular structures of the starting imide 1 and one of propyl-piperazine derivatives, 3b, have been determined by an X-ray crystallography study.
2017-10-19
reviewing instructions, searching existing data sources, gathering and maintaining the data needed, and completing and reviewing the collection of...contracted fundamental research deemed exempt from public affairs security and policy review in accordance with SAF/AQR memorandum dated 10 Dec 08 and AFRL...subjected to cryogenic operating conditions was assessed by proposing a hierarchical physics -of-failure-based reliability assessment model. 15. SUBJECT
36 CFR 223.47 - Date of completion of permanent road construction.
2010-07-01
... permanent road construction. 223.47 Section 223.47 Parks, Forests, and Public Property FOREST SERVICE... Conditions and Provisions § 223.47 Date of completion of permanent road construction. (a) The date of completion of permanent road construction obligations as set forth in the Notice of Sale shall be...
Weight perceptions, misperceptions, and dating violence victimization among U.S. adolescents.
Farhat, Tilda; Haynie, Denise; Summersett-Ringgold, Faith; Brooks-Russell, Ashley; Iannotti, Ronald J
2015-05-01
Dating violence is a major public health issue among youth. Overweight/obese adolescents experience peer victimization and discrimination and may be at increased risk of dating violence victimization. Furthermore, given the stigma associated with overweight/obesity, perceptions and misperceptions of overweight may be more important than actual weight status for dating violence victimization. This study examines the association of three weight indices (weight status, perceived weight, and weight perception accuracy) with psychological and physical dating violence victimization. The 2010 baseline survey of the 7-year NEXT Generation Health Study used a three-stage stratified clustered sampling design to select a nationally representative sample of U.S. 10th-grade students (n = 1,983). Participants who have had a boyfriend/girlfriend reported dating violence victimization and perceived weight. Weight status was computed from measured height/weight. Weight perception accuracy (accurate/underestimate/overestimate) was calculated by comparing weight status and perceived weight. Gender-stratified regressions examined the association of weight indices and dating violence victimization. Racial/ethnic differences were also examined. The association of weight indices with dating violence victimization significantly differed by gender. Overall, among boys, no associations were observed. Among girls, weight status was not associated with dating violence victimization, nor with number of dating violence victimization acts; however, perceived weight and weight perception accuracy were significantly associated with dating violence victimization, type of victimization, and number of victimization acts. Post hoc analyses revealed significant racial/ethnic differences. White girls who perceive themselves (accurately or not) to be overweight, and Hispanic girls who are overweight, may be at increased risk of dating violence victimization. These findings suggest a targeted approach to
Directory of Open Access Journals (Sweden)
Marilyn K Nations
2008-04-01
Full Text Available This anthropological study critically evaluates Brazilian caregivers' symbolic production and significance of their malnourished offspring's primary teeth, as well as their own, and describes popular dental practices. From January to June 2004, ethnographic interviews of 27 poor, low-literacy mothers were conducted at a public Malnutrition Treatment Center in Fortaleza, Ceará State. Participant observation of clinical pathways and home environments supplemented the data. Content analysis was performed. Results confirm that primary teeth are imbued with cultural significance in Northeast Brazil. Mothers examine mouths, perceive signs of decay, associate primary with permanent tooth healthiness, identify ethnodental illnesses, seek assistance, and perform rituals with exfoliated teeth. The mother's motivation to care for primary teeth is sparked by her memories of past toothache and attempts to avoid stigma and discrimination. Social determinants, not mothers' beliefs or behaviors, are the most critical obstacles to effective dental care. Legitimizing lay knowledge and empowering caregivers and children can improve oral health in Northeast Brazil.Este estudo antropológico analisa a produção simbólica de cuidadoras brasileiras sobre a sua dentição e a de seus filhos desnutridos, descrevendo práticas populares de cuidados em saúde bucal. De janeiro a junho de 2004, foram conduzidas entrevistas etnográficas com 27 cuidadoras, numa instituição pública, no tratamento de desnutrição em Fortaleza, Ceará. A observação participante da dinâmica de atendimento e do ambiente domiciliar suplementaram os dados. Foi utilizada a análise temática. Os resultados confirmam que os dentes decíduos são imbuídos de significados culturais no nordeste brasileiro. As mães examinam as bocas dos filhos, percebem sinais de cárie, associam dentes decíduos saudáveis com permanentes hígidos, identificam enfermidades etnodentárias, procuram assist
A Protection Motivation Theory application to date rape education.
Singh, Shweta; Orwat, John; Grossman, Susan
2011-12-01
Date rape risk communication is a key component of education-based Date Rape Prevention Programs, common across colleges. In such programs, risk assessment in date rape is approached cautiously in order to avoid a tone of "victim blaming." Since it is important in the assessment of any risk to understand the surrounding social context of the risky situation and the individual's unique relationship with that social context, this study examines Protection Motivation Theory as it applies to handling the risk of date rape without victim blaming. The paper links individual personality and social contexts with risk communication. The study sample comprised 367 undergraduate women enrolled in a large Southern Public University. The study examines the relationships between dating activity, social competency, and type of information provided with the dependents variables of date rape related protection behavior (intent), belief, and knowledge. A factorial multiple analysis of covariance analysis found that the dependent variables had a significant relationship with aspects of social competency and dating activity. The exposure to varying information about date rape was not significantly related to the dependent variables of date rape-related protection behavior (intent), belief, and knowledge. The identification of social competency and dating activity status as protective factors in this study makes a significant contribution to the practice and research efforts in date rape education.
47 CFR 61.14 - Method of filing publications.
2010-10-01
... 47 Telecommunication 3 2010-10-01 2010-10-01 false Method of filing publications. 61.14 Section 61...) TARIFFS Rules for Electronic Filing § 61.14 Method of filing publications. (a) Publications filed... date of a publication received by the Electronic Tariff Filing System will be determined by the date...
37 CFR 1.221 - Voluntary publication or republication of patent application publication.
2010-07-01
... filing system requirements and be accompanied by the publication fee set forth in § 1.18(d) and the..., the Office will not publish the application and will refund the publication fee. (b) The Office will... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Voluntary publication or...
An Explanatory Model of Dating Violence Risk Factors in Spanish Adolescents.
Aizpitarte, Alazne; Alonso-Arbiol, Itziar; Van de Vijver, Fons J R
2017-12-01
Dating violence is a serious public health issue that needs further understanding in terms of risk factors that may be involved in it. The main goal of this study was to test a mediational model of dating violence risk factors. The sample was composed of 477 secondary and college students from Spain (59% females). A dynamic developmental explanatory model considering aggressiveness, insecure attachment, interparental conflict, and peer dating violence was tested using a multigroup structural equation model. Aggressiveness partially mediated the relation between anxious attachment and dating violence and fully mediated the association between interparental conflict resolution and dating violence. Furthermore, perceived peer dating violence was a direct predictor of dating violence. Implications for prevention and intervention plans are discussed. © 2017 The Authors. Journal of Research on Adolescence © 2017 Society for Research on Adolescence.
Vagi, Kevin J.; Rothman, Emily F.; Latzman, Natasha E.; Tharp, Andra Teten; Hall, Diane M.; Breiding, Matthew J.
2013-01-01
Dating violence is a serious public health problem. In recent years, the U.S. Centers for Disease Control and Prevention and other entities have made funding available to community based agencies for dating violence prevention. Practitioners who are tasked with developing dating violence prevention strategies should pay particular attention to…
76 FR 55368 - Notice of Commission Meeting and Public Hearing
2011-09-07
... special public meeting to be held on October 21, 2011 at 1 p.m. in the Patriots Theater at the War... the draft regulations through April 15, 2011 and received oral comment during six public hearing... ten days prior to the meeting date. Additional public records relating to the dockets may be examined...
CLIPS 6.0 - C LANGUAGE INTEGRATED PRODUCTION SYSTEM, VERSION 6.0 (DEC VAX VMS VERSION)
Donnell, B.
1994-01-01
command line version. For the UNIX version of CLIPS 6.0, the command line interface has been successfully implemented on a Sun4 running SunOS, a DECstation running DEC RISC ULTRIX, an SGI Indigo Elan running IRIX, a DEC Alpha AXP running OSF/1, and an IBM RS/6000 running AIX. Command line interface executables are included for Sun4 computers running SunOS 4.1.1 or later and for the DEC RISC ULTRIX platform. The makefiles may have to be modified slightly to be used on other UNIX platforms. The UNIX, Macintosh, and IBM PC versions of CLIPS 6.0 each have a platform specific interface. Source code, a makefile, and an executable for the Windows 3.1 interface version of CLIPS 6.0 are provided only on the IBM PC distribution diskettes. Source code, a makefile, and an executable for the Macintosh interface version of CLIPS 6.0 are provided only on the Macintosh distribution diskettes. Likewise, for the UNIX version of CLIPS 6.0, only source code and a makefile for an X-Windows interface are provided. The X-Windows interface requires MIT's X Window System, Version 11, Release 4 (X11R4), the Athena Widget Set, and the Xmu library. The source code for the Athena Widget Set is provided on the distribution medium. The X-Windows interface has been successfully implemented on a Sun4 running SunOS 4.1.2 with the MIT distribution of X11R4 (not OpenWindows), an SGI Indigo Elan running IRIX 4.0.5, and a DEC Alpha AXP running OSF/1 1.2. The VAX version of CLIPS 6.0 comes only with the generic command line interface. ASCII makefiles for the command line version of CLIPS are provided on all the distribution media for UNIX, VMS, and DOS. Four executables are provided with the IBM PC version: a windowed interface executable for Windows 3.1 built using Borland C++ v3.1, an editor for use with the windowed interface, a command line version of CLIPS for Windows 3.1, and a 386 command line executable for DOS built using Zortech C++ v3.1. All four executables are capable of utilizing extended memory
Zhao, Jing; Chen, Hongyi; Ren, Ding; Tang, Huiwu; Qiu, Rong; Feng, Jinglei; Long, Yunming; Niu, Baixiao; Chen, Danping; Zhong, Tianyu; Liu, Yao-Guang; Guo, Jingxin
2015-11-01
Initiation of flowering, also called heading, in rice (Oryza sativa) is determined by the florigens encoded by Heading date 3a (Hd3a) and RICE FLOWERING LOCUS T1 (RFT1). Early heading date 1 (Ehd1) regulates Hd3a and RFT1. However, different rice varieties have diverged alleles of Ehd1 and Hd3a/RFT1 and their genetic interactions remain largely unclear. Here we generated three segregating populations for different combinations of diverged Ehd1 and Hd3a/RFT1 alleles, and analyzed their genetic interactions between these alleles. We demonstrated that, in an ehd1 mutant background, Hd3a was silenced, but RFT1 was expressed (although at lower levels than in plants with a functional Ehd1) under short-day (SD) and long-day (LD) conditions. We identified a nonfunctional RFT1 allele (rft1); the lines carrying homozygous ehd1 and Hd3a/rft1 failed to induce the floral transition under SD and LD conditions. Like Hd3a, RFT1 also interacted with 14-3-3 proteins, the florigen receptors, but a nonfunctional RFT1 with a crucial E105K mutation failed to interact with 14-3-3 proteins. Furthermore, analyses of sequence variation and geographic distribution suggested that functional RFT1 alleles were selected during rice adaptation to high-latitude regions. Our results demonstrate the important roles of RFT1 in rice flowering and regional adaptation. © 2015 The Authors. New Phytologist © 2015 New Phytologist Trust.
IAEA Response and Assistance Network. Date Effective: 1 January 2011
International Nuclear Information System (INIS)
2010-01-01
This publication is a tool for (1) supporting the provision of international assistance in the event of a nuclear or radiological incident or emergency, (2) cooperation between States, their competent authorities and the IAEA, and (3) harmonization of response capabilities of States offering assistance under the Response and Assistance Network (RANET). The publication may also assist competent authorities and other response organizations in their efforts to establish and/or maintain their own response capabilities.
41 CFR 115-1.104 - Publication of FPMR.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Publication of FPMR. 115-1.104 Section 115-1.104 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1...
SATA II - Stochastic Algebraic Topology and Applications
2017-01-30
AFRL-AFOSR-UK-TR-2017-0018 SATA II - Stochastic Algebraic Topology and Applications 150032 Robert Adler TECHNION ISRAEL INSTITUTE OF TECHNOLOGY Final...REPORT TYPE Final 3. DATES COVERED (From - To) 15 Dec 2014 to 14 Dec 2016 4. TITLE AND SUBTITLE SATA II - Stochastic Algebraic Topology and Applications... Topology and Applications Continuation of, and associated with SATA: Stochastic Algebraic Topology and Applications FA8655-11-1-3039, 09/1/2011–08/31/2014
Taylor, Katherine A; Sullivan, Terri N
2017-09-01
Substance use and dating violence victimization are common in adolescence and represent significant public health concerns. Although theoretical accounts suggest a bidirectional association between substance use and victimization within dating relationships, this has not been tested during early adolescence. Thus, the current study examined bidirectional associations between physical and psychological dating violence victimization and substance use across 6 months among an ethnically diverse sample of early adolescents. Sex was also examined as a moderator. Participants included two cohorts of sixth graders from 37 schools who were in dating relationships in the last 3 months at Wave 1, in the fall of sixth grade, and 6 months later at Wave 2, in the spring of sixth grade ( n = 2,022; 43% female; 55% Black, 17% Latino/a, 16% White, 9% as multiracial, and 3% as another race/ethnicity). Students reported on the frequency of dating violence in the past 3 months and substance use in the past 30 days. Multilevel models, with students at Level 1 and classes (i.e., clusters of students in the same cohort at the same school; n = 74) at Level 2, tested hypotheses that positive reciprocal relations between physical and psychological dating violence victimization and substance use would be found over time, and that relations would be stronger for girls than boys. Sex, race/ethnicity, and family structure variables were included as Level 1 covariates; intervention condition and neighborhood concentrated disadvantage were included as Level 2 covariates. Results showed that higher levels of physical dating violence victimization at Wave 1 predicted increased substance use at Wave 2. Higher levels of substance use at Wave 1 predicted increased physical and psychological dating violence victimization at Wave 2. Findings highlight the importance of prevention efforts for dating violence and substance use early in adolescence.
26 CFR 1.1402(c)-2 - Public office.
2010-04-01
... 26 Internal Revenue 12 2010-04-01 2010-04-01 false Public office. 1.1402(c)-2 Section 1.1402(c)-2...) INCOME TAXES Tax on Self-Employment Income § 1.1402(c)-2 Public office. (a) In general—(1) General rule... public office does not constitute a trade or business. (2) Fee basis public officials—(i) In general. If...
10 CFR 1.28 - Office of Public Affairs.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Office of Public Affairs. 1.28 Section 1.28 Energy NUCLEAR... Office of Public Affairs. The Office of Public Affairs— (a) Develops policies, programs, and procedures for the Chairman's approval for informing the public of NRC activities; (b) Prepares, clears, and...
International Nuclear Information System (INIS)
Das, N.R.
2017-01-01
Since the discovery of natural radioactivity in uranium, in the last decade of the nineteenth century, the nuclear property of radioactive decay of radionuclides at immutable rates has been effectively utilized in dating of varieties of naturally occurring geological matrices and the organisms which constantly replenish their "1"4C supply through respiration when alive on earth. During the period, applications of radiometric dating techniques have been extensively diversified and have enabled the geologists to indicate the absolute time scales of geological formations and the evolution of the solar system, the earth, meteorites, lunar rocks, etc. and the archaeologists to record the facts of history of several important events like dinosaur era, Iceman, the Shroud in Turin and many other ancient artefacts. In the development of dating methods, varieties of naturally occurring radio-isotopic systems with favorable half-lives ranging from about 10 years to over 100 billion years have been used as radiometric clocks. (author)
48 CFR 1.303 - Publication and codification.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Publication and codification. 1.303 Section 1.303 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL FEDERAL ACQUISITION REGULATIONS SYSTEM Agency Acquisition Regulations 1.303 Publication and codification...
1 CFR 8.6 - Forms of publication.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Forms of publication. 8.6 Section 8.6 General... FEDERAL REGULATIONS § 8.6 Forms of publication. (a) Under section 1506 of title 44, United States Code, the Administrative Committee authorizes publication of the Code of Federal Regulations in the...
1 CFR 5.6 - Daily publication.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Daily publication. 5.6 Section 5.6 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER THE FEDERAL REGISTER GENERAL § 5.6 Daily publication. There shall be an edition of the Federal Register published for each official Federal working day...
LHD1, an allele of DTH8/Ghd8, controls late heading date in common wild rice (Oryza rufipogon).
Dai, Xiaodong; Ding, Younian; Tan, Lubin; Fu, Yongcai; Liu, Fengxia; Zhu, Zuofeng; Sun, Xianyou; Sun, Xuewen; Gu, Ping; Cai, Hongwei; Sun, Chuanqing
2012-10-01
Flowering at suitable time is very important for plants to adapt to complicated environments and produce their seeds successfully for reproduction. In rice (Oryza rufipogon Griff.) photoperiod regulation is one of the important factors for controlling heading date. Common wild rice, the ancestor of cultivated rice, exhibits a late heading date and a more sensitive photoperiodic response than cultivated rice. Here, through map-based cloning, we identified a major quantitative trait loci (QTL) LHD1 (Late Heading Date 1), an allele of DTH8/Ghd8, which controls the late heading date of wild rice and encodes a putative HAP3/NF-YB/CBF-A subunit of the CCAAT-box-binding transcription factor. Sequence analysis revealed that several variants in the coding region of LHD1 were correlated with a late heading date, and a further complementary study successfully rescued the phenotype. These results suggest that a functional site for LHD1 could be among those variants present in the coding region. We also found that LHD1 could down-regulate the expression of several floral transition activators such as Ehd1, Hd3a and RFT1 under long-day conditions, but not under short-day conditions. This indicates that LHD1 may delay flowering by repressing the expression of Ehd1, Hd3a and RFT1 under long-day conditions. © 2012 Institute of Botany, Chinese Academy of Sciences.
1 CFR 5.4 - Publication not authorized.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Publication not authorized. 5.4 Section 5.4... Publication not authorized. (a) Chapter 15 of title 44, United States Code, does not apply to treaties...) Chapter 15 of title 44, United States Code, prohibits the publication in the Federal Register of comments...
Visualizing Energy on Target: Molecular Dynamics Simulations
2017-12-01
ARL-TR-8234 ● DEC 2017 US Army Research Laboratory Visualizing Energy on Target: Molecular Dynamics Simulations by DeCarlos E...return it to the originator. ARL-TR-8234● DEC 2017 US Army Research Laboratory Visualizing Energy on Target: Molecular Dynamics...REPORT TYPE Technical Report 3. DATES COVERED (From - To) 1 October 2015–30 September 2016 4. TITLE AND SUBTITLE Visualizing Energy on Target
20 CFR 410.687a - Effective date.
2010-04-01
....686a, 410.686b, 410.686c, 410.686d, and 410.686e, shall be effective upon publication in the Federal... rendered in connection with those claims for which a fee has not been fully paid before this effective date, notwithstanding the fact that fee contracts for such services may have been entered into, or services rendered...
Public humanization policies: integrative literature review.
Moreira, Márcia Adriana Dias Meirelles; Lustosa, Abdon Moreira; Dutra, Fernando; Barros, Eveline de Oliveira; Batista, Jaqueline Brito Vidal; Duarte, Marcella Costa Souto
2015-10-01
The study aimed to investigate the scientific literature on Public Humanization Policies, available in online periodicals, from 2009 to 2012, in the health field. This is an integrative literature review conducted in the Virtual Health Library databases: Latin-America and Caribbean Health Sciences (Lilacs) and the Scientific Electronic Library Online (SciELO) and Portal Capes. Data were collected in July 2013. To this end, the following Health Sciences Descriptors (DeCS) were used: "Humanization of Care," "Public Policies," "National Humanization Policy". The sample consisted of 27 articles about the investigated theme. From the publications selected for the research, three categories emerged according to their respective approaches: National Human-ization Policy: history and processes involved in its implementation; National Humanization Policy: health professionals contribution; Humanization and in the care process. The study showed that the National Humanization Policy is an important benchmark in the development of health practices. For this reason, there is a pressing multiplication of related reflections on ways to promote human-ization in health services.
36 CFR 60.13 - Publication in the Federal Register and other NPS notification.
2010-07-01
... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Publication in the Federal Register and other NPS notification. 60.13 Section 60.13 Parks, Forests, and Public Property NATIONAL PARK...-day commenting period from date of publication will be provided. When necessary to assist in the...
Department of Energy Technology. Annual progress report 1 Jan - 31 Dec 1987
International Nuclear Information System (INIS)
Micheelsen, B.; List, F.
1988-03-01
The general development of the Department of Energy Technology at Risoe during 1987 is presented, and the activities within the major subject fields are described in some detail. Lists of staff and publications and included. 13 ills., 24 refs. (author)
1 CFR 17.3 - Criteria for emergency publication.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Criteria for emergency publication. 17.3..., AND PROCESSING OF DOCUMENTS FILING FOR PUBLIC INSPECTION AND PUBLICATION SCHEDULES Emergency Schedule § 17.3 Criteria for emergency publication. The emergency schedule is designed to provide the fastest...
International Nuclear Information System (INIS)
1991-01-01
The Secretary of Health and Human Services is required by Subpart 3, Part F of Title III of the Public Health Service Act; 42 USC 263b et seq. (Public Law 90-602) to submit an annual report to the President for transmittal to the Congress on or before April 1 on the administration of the Radiation Control for Health and Safety Act. The detailed information required in the report is outlined in Section 360D of the Public Health Service Act. The Food and Drug Administration, through its Center for Devices and Radiological Health, is responsible for the day-to-day administration of the Radiation Control for Health and Safety Act of 1968. The report provides a summary of the operations of the Center in carrying out that responsibility for calendar year 1990. In reviewing the operations of the Center for Devices and Radiological Health as reported in the document, it should be kept in mind that the day-to-day administration of the Act is only part of the Center's function. Other responsibilities include the administration and enforcement of the 1976 Medical Device Amendments to the Federal Food, Drug, and Cosmetic Act (not covered in the report). Manufacturers of electronic products are required by 21 CFR 1002.20 to report accidental radiation occurrences to the Center for Devices and Radiological Health. The Center no longer maintains a Radiation Incidents Registry, since accidental radiation occurrences are reported through the Device Experience Network (DEN) and through the requirements of the Medical Device Reporting (MDR) Regulations
41 CFR 105-1.104 - Publication of GSPMR.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Publication of GSPMR. 105-1.104 Section 105-1.104 Public Contracts and Property Management Federal Property Management....104 Publication of GSPMR. (a) Most GSPMR are published in the Federal Register. This practice helps to...
Cryptographic Properties of the Hidden Weighted Bit Function
2013-12-23
valid OMB control number. 1. REPORT DATE 23 DEC 2013 2. REPORT TYPE 3. DATES COVERED 00-00-2013 to 00-00-2013 4. TITLE AND SUBTITLE...K. Feng, An Infinite Class of Balanced Vectorial Boolean Functions with Optimum Algebraic Immunity and Good Nonlinearity, in: IWCC 2009, In: LNCS
37 CFR 1.215 - Patent application publication.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Patent application publication. 1.215 Section 1.215 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions Publication...
2007-01-01
The final edition (Nos 51-52/2007 and 1-2-3/2008) of the last Bulletin of the year will appear on Friday 14 December and will cover events at CERN from 17 December 2007 to 18 January 2008. Announcements for publication in this issue should reach the Publication Section (Communication group) or the Staff Association, as appropriate, by noon on Tuesday 11 December. The table below lists the 2008 publication dates for the paper version of the Bulletin and the corresponding deadlines for the submission of announcements. Please note that all announcements must be submitted by 12.00 midday on Tuesdays at the latest. Bulletin publication 2008 Bulletin N° 4-5 Publication: Monday 21 january Submission deadline for announcements: Tuesday 15 January Bulletin N° 6-7 Publication: Monday 4 february Submission deadline for announcements: Tuesday 29 January Bulletin N° 8-9 Publication: Monday 18 february Submission deadline for announcements: Tuesday 12 February Bulletin N° 10-11 P...
Safe Sex Messages Within Dating and Entertainment Smartphone Apps: A Review.
Huang, Evelyn Tzu-Yen; Williams, Henrietta; Hocking, Jane S; Lim, Megan Sc
2016-11-08
Smartphone apps provide a new platform for entertainment, information distribution, and health promotion activities, as well as for dating and casual sexual encounters. Previous research has shown high acceptability of sexual health interventions via smartphone apps; however, sexual health promotion apps were infrequently downloaded and underused. Integrating sexual health promotion into established apps might be a more effective method. The objective of our study was to critically review popular sex-related apps and dating apps, in order to ascertain whether they contain any sexual health content. Part 1: In January 2015, we used the term "sexual" to search for free apps in the Apple iTunes store and Android Google Play store, and categorized the sexual health content of the 137 apps identified. Part 2: We used the term "dating" to search for free geosocial-networking apps in the Apple iTunes and Android Google Play stores. The apps were downloaded to test functionality and to determine whether they included sexual health content. Part 1: Of the 137 apps identified, 15 (11.0%) had sexual health content and 15 (11.0%) contained messages about sexual assault or violence. The majority of the apps did not contain any sexual health content. Part 2: We reviewed 60 dating apps: 44 (73%) targeting heterosexual users, 9 (15%) targeting men who have sex with men (MSM), 3 (5%) targeting lesbian women, and 4 (7%) for group dating. Only 9 dating apps contained sexual health content, of which 7 targeted MSM. The majority of sex-related apps and dating apps contained no sexual health content that could educate users about and remind them of their sexual risks. Sexual health practitioners and public health departments will need to work with app developers to promote sexual health within existing popular apps. For those apps that already contain sexual health messages, further study to investigate the effectiveness of the content is needed. ©Evelyn Tzu-Yen Huang, Henrietta
International Nuclear Information System (INIS)
Thomas, J.; Douglas, M.; Watanabe, R.; Henrikson, H.E.; Iqbal, M.Z.; Mitchell, L.W.; O'Callaghan, B.M.G.; Wong, H.T.K.; Melvin, J.D.
1987-01-01
The authors built a high pressure xenon Time Projection Chamber to study double beta decay, a process of fundamental interest which, if observed, would indicate that the neutrino is a massive Majorana particle. Raw data rates from the TPC exceed 200 Kbytes per second. The TPC is operated through a CAMAC interface with a DEC LSI-11/73 computer networked to a Tektronix 6130 workstation. Data is transmitted at about 15 Kbytes per second although the network is capable of transmitting data at 80 Kbytes per second. The only system level programming required was to write a UDP-TCP/IP driver for the DEC-DEQNA Ethenet board on the 11/73
42 CFR 414.510 - Laboratory date of service for clinical laboratory and pathology specimens.
2010-10-01
... and pathology specimens. 414.510 Section 414.510 Public Health CENTERS FOR MEDICARE & MEDICAID... date of service for clinical laboratory and pathology specimens. The date of service for either a clinical laboratory test or the technical component of physician pathology service is as follows: (a...
International Nuclear Information System (INIS)
Faisal, W; Arumbinang, H; Taftazani, A; Widayati, S; Sumiyatno; Suhardi
1996-01-01
The absolute dating (radiocarbon, 14 C dating) and relative dating of Pringapus and Gondosuli temples in Temanggung regency (district) of Central Java Province have been carried out. The field sampling was done especially with the purpose to obtain vertical data, so that excavation method was adopted in the case. The main data were the ecofacts of organic habitation such as bones, woods, charcoals, shells, and paper artefacts. The artefacts data were used as a comparison. The comparative data analysis were conducted at Yogyakarta archaeological Department Laboratory, thus included dating of artefacts which were performed according to archaeological analysis procedures, generally based on the attributes attached to the artefacts, whereas the absolute dating of charcoal samples were performed in the Radiocarbon Dating Laboratory at Yogyakarta Nuclear Research Centre. Based on the relative dating of epigraphy content on the andesit rock from Gondosuli Temple which showed the year of 754 Saka or 832 AD, the Pringapus Temple was estimated to be built in the 850 AD. According to the absolute dating (Radiocarbon Dating with delta 13 C and tree ring corrections) the age for Gondosuli temple based on GDS/LU-2/Spit-7 samples is (384 -602) AD and from GDS/LU-2/Spit-8 = (452 - 652) AD. With these significant differences in the results obtained, it can be concluded that culture environment where the sample were collected already existed before the temple was built. Further investigation is still required
Direct radiocarbon dates for Vindija G1 and Velika Pećina Late Pleistocene hominid remains
Smith, Fred H.; Trinkaus, Erik; Pettitt, Paul B.; Karavanić, Ivor; Paunović, Maja
1999-01-01
New accelerator mass spectrometry radiocarbon dates taken directly on human remains from the Late Pleistocene sites of Vindija and Velika Pećina in the Hrvatsko Zagorje of Croatia are presented. Hominid specimens from both sites have played critical roles in the development of current perspectives on modern human evolutionary emergence in Europe. Dates of ≈28 thousand years (ka) before the present (B.P.) and ≈29 ka B.P. for two specimens from Vindija G1 establish them as the most recent dated Neandertals in the Eurasian range of these archaic humans. The human frontal bone from Velika Pećina, generally considered one of the earliest representatives of modern humans in Europe, dated to ≈5 ka B.P., rendering it no longer pertinent to discussions of modern human origins. Apart from invalidating the only radiometrically based example of temporal overlap between late Neandertal and early modern human fossil remains from within any region of Europe, these dates raise the question of when early modern humans first dispersed into Europe and have implications for the nature and geographic patterning of biological and cultural interactions between these populations and the Neandertals. PMID:10535913
The influence of online posting dates on the bibliometric indicators of scientific articles
Directory of Open Access Journals (Sweden)
Mercedes Echeverría
2017-09-01
Full Text Available This article analyses the difference in timing between the online availability of articles and their corresponding print publication and how it affects two bibliometric indicators: Journal Impact Factor (JIF and Immediacy Index. This research examined 18,526 articles, the complete collection of articles and reviews published by a set of 61 journals on Urology and Nephrology in 2013 and 2014. The findings suggest that Advance Online Publication (AOP accelerates the citation of articles and affects the JIF and Immediacy Index values. Regarding the JIF values, the comparison between journals with or without AOP showed statistically significant differences (P=0.001, Mann-Whitney U test. The Spearman’s correlation between the JIF and the median online-to-print publication delay was not statistically significant. As to the Immediacy Index, a significant Spearman’s correlation (rs=0.280, P=0.029 was found regarding the median online-to-print publication delays for journals published in 2014, although no statistically significant correlation was found for those published in 2013. Most journals examined (n=52 out of 61 published their articles in AOP. The analysis also showed different publisher practices: eight journals did not include the online posting dates in the full-text and nine journals published articles showing two different online posting dates--the date provided on the journal website and another provided by Elsevier’s Science Direct. These practices suggest the need for transparency and standardization of the AOP dates of scientific articles for calculating bibliometric indicators for journals.
Luminescence dating of Netherland's sediments
Wallinga, J.; Davids, F.; Dijkmans, J.W.A.
2007-01-01
Over the last decades luminescence dating techniques have been developed that allow earth scientists to determine the time of deposition of sediments. In this contribution we revity: 1) the development of the methodology, 2) tests of the reliability of luminescence dating on Netherlands' sediments;
Greenberg, Caprice C; Wind, Jennifer K; Chang, George J; Chen, Ronald C; Schrag, Deborah
2013-03-01
Stakeholder input is a critical component of comparative effectiveness research. To ensure that the research activities of the Developing Evidence to Inform Decisions about Effectiveness (DEcIDE) Network, supported by the Agency for Healthcare Research and Quality, translate into the greatest impact for everyday practice and policy-making in cancer, we were tasked with soliciting stakeholder input regarding priority areas in cancer-related comparative effectiveness research for the DEcIDE Cancer Consortium. Given the increasing emphasis on stakeholder engagement in research, many investigators are facing a similar task, yet there is limited literature to guide such efforts, particularly in cancer care. To help fill this gap, we present our approach to operationalizing stakeholder engagement and discuss it in the context of other recent developments in the area. We describe challenges encountered in convening stakeholders from multiple vantage points to prioritize topics and strategies used to mitigate these barriers. We offer several recommendations regarding how to best solicit stakeholder input to inform comparative effectiveness research in cancer care. These recommendations can inform other initiatives currently facing the challenges of engaging stakeholders in priority setting for cancer.
International Nuclear Information System (INIS)
Tuniz, C.; Zoppi, U.; Hotchkis, M.A.C.
2004-01-01
Modern forensic science has to deal not only with homicides and other traditional crimes but also with more global threats such as the smuggling of nuclear materials, clandestine production of weapons of mass destruction, stockpiling of illicit drugs by state controlled groups and war crimes. Forensic applications have always benefited from the use of advanced analytical tools that can characterize materials found at crime scenes. In this paper we will discuss the use of accelerator mass spectrometry (AMS) as an ultrasensitive tool for the crime laboratories of the third millennium. An important objective in forensic science is to order past events chronologically by analysing materials associated with criminal actions. Radiocarbon dating is known to the general public for its application to historical and prehistorical investigations. Examples of forensic significance include the assassination of the Inca Atahualpa by Francisco Pizarro in the early 1530s, the possible murder of the Tyrolean Ice Man (Oetzi) 5300 years ago and the analysis of the burial cloths allegedly associated with the crucifixion of Jesus Christ . Recent murders, including those associated with war crimes in the Balkans during the 1990s, can be studied using 14 C bomb pulse dating. This method has other forensic applications, including investigation of frauds related to food and wine counterfeiting, dating of opium crops and dating of substances used in biological warfare. AMS extends the applicability of the radiocarbon method, allowing the analysis of 14 C in submilligram organic samples. Specific molecular compounds extracted from bones, hair, skin and other carbon bearing substances of forensic significance can now be dated, enhancing the sensitivity and reliability of chronological determinations. AMS can also be used to analyse rare actinide isotopes released into the environment during the clandestine production of nuclear weapons or associated with the smuggling of nuclear materials. In
... for Teens / Dating Violence Bulletins for Teens: Dating Violence What is it? If you are a victim ... often. If You Are a Victim of Dating Violence, You Might… Think it's your fault. Feel angry, ...
Van Ouytsel, Joris; Torres, Elizabeth; Choi, Hye Jeong; Ponnet, Koen; Walrave, Michel; Temple, Jeff R.
2017-01-01
Dating violence is an important public health concern and is considered to be a form of school violence. While digital technologies have enabled perpetrators of dating violence to target their victims online (cyber dating abuse), little is known about how this form of perpetration relates to specific adolescent risk behaviors. This brief research…
Public relations 1. FK Příbram
Bauerová, Eva
2015-01-01
Title: Public relations 1. FK Příbram Objectives: The objective is analysis and assessment tools and activities Public Relations, which football club 1. FK Pribram uses, both in communication with fans and interact with their partners. Based on the analysis tool will suggest scheme so that communication by Public relations have been effective and successful. Methods: To acheave goals was chosen the case study method, which helped to get detail information. Data collection was performed using ...
International Nuclear Information System (INIS)
Moore, Glenis.
1987-01-01
Dating techniques are discussed and explained. The age range and sensitivity of different techniques are given. Potassium/argon dating, amino-acid dating, radiocarbon dating, dendrochronology, thermoluminescence and geomagnetic field dating are all mentioned. Each technique is explained and a brief history given. The techniques and equipment used by the British Museum, and some examples of archaeological articles dated are mentioned. (UK)
The final edition (Nos 51-52/2009 and 1-2/2010) of the last Weekly Bulletin of the year will be published on Friday 11 December and will cover events at CERN from 14 December 2009 to 8 January 2010. Announcements for publication in this issue should reach the Publication Section (Communications group) or the Staff Association, as appropriate, by noon on Tuesday 8 December. Bulletin publication 2010 The table below lists the 2010 publication dates for the paper version of the Bulletin and the corresponding deadlines for the submission of announcements. Please note that all announcements must be submitted by 12.00 midday on Tuesdays at the latest. Bulletin No. Week number Submission of announcements (before 12.00 midday) Bulletin Web version Bulletin Paper version 2-3 Tuesday 5 January Friday 8 and 15 January Wednesday 13 J...
41 CFR 302-2.4 - What is my effective transfer or appointment date?
2010-07-01
... 41 Public Contracts and Property Management 4 2010-07-01 2010-07-01 false What is my effective transfer or appointment date? 302-2.4 Section 302-2.4 Public Contracts and Property Management Federal Travel Regulation System RELOCATION ALLOWANCES INTRODUCTION 2-EMPLOYEES ELIGIBILITY REQUIREMENTS General...
Tritium/Helium-3 dating of groundwaters around Chernobyl site
Energy Technology Data Exchange (ETDEWEB)
Fourre, E.; Jean-Baptiste, P.; Dapoigny, A.; Baumier, D. [CEA, CNRS, LSCE, UVSQ, IPSL, F-91191 Gif Sur Yvette (France); Aquilina, L.; Labasque, T. [Geosciences Rennes - GR, CNRS UMR 6118, F-35000 Rennes (France); La Salle, C. Le Gal; Lancelot, J. [Nimes Univ, GIS/CEREGE, Nimes (France)
2010-07-01
Complete text of publication follows: Estimates of groundwater age allow geo-hydrologists to calculate recharge rates, assess aquifers contamination risks, and calibrate complex flow models. The {sup 3}H/{sup 3}He dating method offers a direct measure for the time since groundwater had its last gas exchange with the atmosphere. The aim of this study is to bring temporal constraints to the radionuclide transport model in the Chernobyl test site. Samples have been collected in the exclusion zone, close to a trench filled with low-level wastes, both in the upper eolian sand layer and deeper in the alluvial deposit. CFCs and SF6 have been measured as well in order to compare dating methods. The {sup 3}H/{sup 3}He results presented in Figure 1 clearly show increasing ages with depth (below groundwater table). This fully supports the groundwater stratification developed in the hydrogeological model of the area. The infiltration recharge rate is a sensitive key parameter of the model, and our data are consistent with a rate about 200 mm/yr (maximum estimate)
1 CFR 5.3 - Publication of other documents.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Publication of other documents. 5.3 Section 5.3 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER THE FEDERAL REGISTER GENERAL § 5.3 Publication of other documents. Whenever the Director of the Federal Register considers that publication of a...
2002-02-01
In order to keep subscribers up-to-date with the latest developments in their field, this current awareness service is provided by John Wiley & Sons and contains newly-published material on yeasts. Each bibliography is divided into 10 sections. 1 Books, Reviews & Symposia; 2 General; 3 Biochemistry; 4 Biotechnology; 5 Cell Biology; 6 Gene Expression; 7 Genetics; 8 Physiology; 9 Medical Mycology; 10 Recombinant DNA Technology. Within each section, articles are listed in alphabetical order with respect to author. If, in the preceding period, no publications are located relevant to any one of these headings, that section will be omitted. (3 weeks journals - search completed 5th. Dec. 2001)
International Nuclear Information System (INIS)
1974-01-01
The Environmental Protection Agency embarked on a program to evaluate the environmental impact of the transuranium elements and to consider whether further guidelines or standards are needed to assure adequate protection of the general ambient environment and of the public health from potential contamination of the environment by radionuclides of these elements. Public hearings were held in Washington, D. C., and Denver, Colorado, to gather information regarding the public and social implications of plutonium utilization; the factors involved in the balancing of costs vs benefits; dosimetry, health, and environmental effects; environmental levels and pathways; applications using plutonium; and control and cleanup technology. The proceedings of the hearing in Washington, D. C., Dec. 10-11, 1974, are presented. Data are included on current and potential sources of transuranium elements in the environment; animal studies on the tissue distribution of 233 U, 237 Np, 238 Pu, 239 Pu, 241 Am, 244 Cm, 249 Bk, 252 Cf, and 253 Es and pathological effects of body burdens of these radionuclides; and data on the health status of personnel known to have body burdens of 238 Pu or 239 Pu acquired during acute or chronic exposure, many of them over 30 years previously. It is pointed out that the lack of demonstrable biological effects of Pu in man provides presumptive evidence that the radiation protection standards in effect are adequate. (U.S.)
17 CFR 248.128 - Effective date, compliance date, and prospective application.
2010-04-01
... Affiliate Marketing § 248.128 Effective date, compliance date, and prospective application. (a) Effective date. This subpart is effective September 10, 2009. (b) Mandatory compliance date. Compliance with this... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Effective date, compliance...
1 CFR 5.10 - Forms of publication.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Forms of publication. 5.10 Section 5.10 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER THE FEDERAL REGISTER GENERAL § 5.10 Forms of publication. Pursuant to section 1506 of title 44, United States Code, the Administrative Committee publishes...
International Nuclear Information System (INIS)
2006-08-01
Radioactive material is widely used in industry, medicine, education and agriculture. In addition, it occurs naturally. The health risk posed by these materials vary widely depending on many factors, the most important of which are the amount of the material involved and its physical and chemical form. Therefore, there is a need to identify the quantity and type of radioactive material for which emergency preparedness and other arrangements (e.g. security) are warrant due to the health risk they pose. The aim of this publication is to provide practical guidance for Member States on that quantity of radioactive material that may be considered dangerous. A dangerous quantity is that, which if uncontrolled, could be involved in a reasonable scenario resulting in the death of an exposed individual or a permanent injury, which decreases that person's quality of life. This publication is published as part of the IAEA Emergency Preparedness and Response Series. It supports several publications including: the IAEA Safety Requirements 'Preparedness and Response for a Nuclear or Radiological Emergency', IAEA Safety Standards Series No. GS-R-2. IAEA, Vienna (2002); IAEA Safety Guide 'Categorization of Radioactive Sources', IAEA Safety Standards Series No RS-G-1.9, IAEA, Vienna (2005) and IAEA Safety Guide 'Arrangements for Preparedness for a Nuclear or Radiological Emergency' IAEA Safety Standards Series No. GS-G-2.1, IAEA, Vienna (2006). The procedures and data in this publication have been prepared with due attention to accuracy. However, as part of the review process, they undergo ongoing quality assurance checks. Comments are welcome and, following a period that will allow for a more extensive review, the IAEA may revise this publication as part of the process of continuous improvement. The publication uses a number of exposure scenarios, risk models and dosimetric data, which could be used during the response to nuclear or radiological emergency or other purposes
Chronic and Acute Relational Risk Factors for Dating Aggression in Adolescence and Young Adulthood.
Collibee, Charlene; Furman, Wyndol
2016-04-01
Dating aggression is a prevalent and costly public health concern. Using a relational risk framework, this study examined acute and chronic relational risk factors (negative interactions, jealousy, support, and relationship satisfaction) and their effects on physical and psychological dating aggression. The study also examined the interaction between chronic and acute risk, allowing us to assess how changes in acute risk have differing effects depending on whether the individual is typically at higher chronic risk. A sample of 200 youth (100 female) completed seven waves of data, which spanned 9 years from middle adolescence to young adulthood (M age at Wave 1 = 15.83). Using hierarchical linear modeling, analyses revealed both acute (within-person) and chronic (between-person) levels in jealousy, negative interactions, and relationship satisfaction, were associated with physical and psychological dating aggression. Significant interactions between chronic and acute risk emerged in predicting physical aggression for negative interactions, jealousy, and relationship satisfaction such that those with higher levels of chronic risk are more vulnerable to increases in acute risk. These interactions between chronic and acute risk indicate that risk is not static, and dating aggression is particularly likely to occur at certain times for youth at high risk for dating aggression. Such periods of increased risk may provide opportunities for interventions to be particularly effective in preventing dating aggression or its consequences. Taken together, these findings provide support for the role of relational risk factors for dating aggression. They also underscore the importance of considering risk dynamically.
76 FR 43337 - Order of Succession for the Office of Public Affairs
2011-07-20
... Office of Public Affairs AGENCY: Office of Public Affairs, HUD. ACTION: Notice of order of succession... Office of Public Affairs. This Order of Succession supersedes all prior orders of succession for the Office of Public Affairs. DATES: Effective Date: June 29, 2011. FOR FURTHER INFORMATION CONTACT: Neill...
17 CFR 248.18 - Effective date; transition rule.
2010-04-01
... Safeguarding Personal Information Relation to Other Laws; Effective Date § 248.18 Effective date; transition... customers on the compliance date. By July 1, 2001, you must have provided an initial notice, as required by § 248.4, to consumers who are your customers on July 1, 2001. (2) Example. You provide an initial notice...
jfewr ©2017 - jfewr Publications
African Journals Online (AJOL)
hi
2017-12-04
Dec 4, 2017 ... Longitude. 1. Akurba Osanya. AKB. 8.47104N. 8.58747E. 2. Opposite Tripple Zee farm. OTF. 8.45695N. 8.57489E. 3. Gandu. GAN. 8.45116N. 8.57304E. 4. Beside college of Agric. BCA. 8.55723N. 8.54292E. 5. Opposite college of Agric. OCA. 8.51061N. 8.52016E. 6. Between Lafia and Shabu 1. B/W L&S1.
Cannabis use and dating violence among college students: A call for research.
Shorey, Ryan C; Haynes, Ellen; Strauss, Catherine; Temple, Jeff R; Stuart, Gregory L
2017-01-01
Dating violence is a serious and prevalent problem on college campuses. Although there is a robust literature documenting that alcohol use is consistently associated with increased risk for perpetrating dating violence, little research has examined the role of cannabis in dating violence perpetration. With increasing legalisation of cannabis throughout the world, it is imperative to understand what role, if any, cannabis may play in the important public health problem of dating violence. In this commentary, we discuss the current state of the research on cannabis and dating violence and suggest avenues for additional research in this area. It is critical that we conduct methodologically sound research on the association between cannabis and dating violence so that we can understand what role, if any, cannabis exerts on this important problem. [Shorey RC, Haynes E, Strauss C, Temple JR, Stuart GL. Cannabis use and dating violence among college students: A call for research. Drug Alcohol Rev 2017;36:17-19]. © 2017 Australasian Professional Society on Alcohol and other Drugs.
Crustáceos decápodos de la cuenca del Río Sinú, Córdoba, Colombia
Directory of Open Access Journals (Sweden)
Jorge Alexander Quirós Rodríguez
2016-09-01
Full Text Available Para evaluar la composición, abundancia y distribución de los crustáceos decápodos en la cuenca del río Sinú, departamento de Córdoba (Colombia, se estudiaron ocho localidades: cuatro en el río Sinú y cuatro en el complejo cenagoso del bajo Sinú. Para ello, se realizaron seis muestreos entre abril de 2005 y mayo de 2006. En total se registraron 458 crustáceos decápodos distribuidos en tres familias, seis géneros y ocho especies. La familia mejor representada fue Trichodactylidae con cuatro géneros y cuatro especies, seguida de Palaemonidae con un género y tres especies, mientras que de la familia Atyidae solo registró una especie. Especies como Macrobrachium carcinus y M. acanthurus, presentaron el rango más amplio de distribución, siendo características tanto para el rio Sinú como para el CCBS. Entre las especies identificadas, Atya crassa en el río Sinú y Trichodactylus quinquedentatus en el CCBS son nuevos registros para el departamento de Córdoba.
2010-03-24
... DEPARTMENT OF ENERGY Southeastern Power Administration Proposed Rate Adjustment, Public Forum, and Opportunities for Public Review and Comment for Georgia-Alabama-South Carolina System of Projects AGENCY: Southeastern Power Administration, DOE. ACTION: Notice to change date and location of the Public Information...
Radiocarbon dates for Rangitoto and Motutapu, a consideration of dating accuracy
International Nuclear Information System (INIS)
Law, R.G.
1975-01-01
The carbon dates for the eruptions of Rangitoto and the occupation of Maori sites on Motutapu contain inconsistencies which are explicable only after the dates have been corrected to allow for the nature of the dating method. The only date which is reasonably established is a 14th or 15th century dating for the ash shower covering Motutapu. (auth.)
41 CFR 115-1.104-50 - Publication of EPPMR.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Publication of EPPMR. 115-1.104-50 Section 115-1.104-50 Public Contracts and Property Management Federal Property Management....104-50 Publication of EPPMR. (a) Material published in the EPPMR will generally not be of interest to...
Bullying and HIV Risk among High School Teenagers: The Mediating Role of Teen Dating Violence
Okumu, Moses; Mengo, Cecilia; Ombayo, Bernadette; Small, Eusebius
2017-01-01
Background: Teen dating violence (TDV), bullying, and HIV risk behaviors are public health concerns that impact adolescents in the United States. National estimates reveal high rates of these risk behaviors among high school students. Based on theoretical and empirical evidence, we hypothesized that experiencing teen dating violence (sexual and…
Stader, David L.
2011-01-01
Dating violence is a form of student-on-student victimization and is a serious school safety issue. Research indicates that at a minimum, 10 percent of high school students are victims of dating violence in one form or another. Among female high school students that date, some data indicate that as many as 30 percent may be victims of dating…
16 CFR 700.2 - Date of manufacture.
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Date of manufacture. 700.2 Section 700.2... MAGNUSON-MOSS WARRANTY ACT INTERPRETATIONS OF MAGNUSON-MOSS WARRANTY ACT § 700.2 Date of manufacture... after July 4, 1975. When a consumer purchases repair of a consumer product the date of manufacture of...
EIA publications directory, 1992
International Nuclear Information System (INIS)
1993-01-01
This directory contains abstracts and ordering information for EIA publications. The abstracts are arranged by broad subject category such as coal, petroleum, natural gas, and electric power. A comprehensive subject index, a title index, and a report number index are included. Each entry gives the title, report number, publication frequency, date, number of pages, and ordering information. Publication began with the 1979 edition
Antivirals Use During the Pandemic H1N1 2009 Outbreak
Centers for Disease Control (CDC) Podcasts
2012-01-23
Charisma Atkins, CDC public health analyst, discusses antiviral use during the 2009 H1N1 pandemic flu outbreak. Created: 1/23/2012 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID). Date Released: 1/23/2012.
International Nuclear Information System (INIS)
Rieser, U.
2013-01-01
The luminescence techniques have evolved over the last 40 years to a powerful dating instrument in archaeology and geoscience. Depending on how the luminescence is stimulated, one distinguishes the phenomena of thermoluminescence (TL), optically stimulated luminescence (OSL) and infrared stimulated luminescence (IRSL). Each of these phenomena has its specific potential for dating various archaeological materials in the time range from medieval back to palaeolithic periods, or, speaking in geological terms, for dating of Holocene and late Pleistocene objects. The OSL and IRSL techniques are sometimes treated together as 'optical dating'. The luminescence techniques differ from other major dating techniques, such as 14 C, essentially by their applicability to inorganic materials, their wide age-range from about 100 years to more than 100,000 years and the kind of datable events which are the last exposure to heat or to light. (author). 10 refs., 3 figs.
International Nuclear Information System (INIS)
Rieser, U.
2009-01-01
The luminescence techniques have evolved over the last 40 years to a powerful dating instrument in archaeology and geoscience. Depending on how the luminescence is stimulated, one distinguishes the phenomena of thermoluminescence (TL), optically stimulated luminescence (OSL) and infrared stimulated luminescence (IRSL). Each of these phenomena has its specific potential for dating various archaeological materals in the time range from medieval back to palaeolithic periods, or, speaking in geological terms, for dating of Holocene and late Pleistocene objects. The OSL and IRSL techniques are sometimes treated together as 'optical dating'. The luminescence techniques differ from other major dating techniques, such as 14 C, essentially by their applicability to inorganic materials, their wide age-range from about 100 years to more than 100,000 years and the kind of datable events which are the last exposure to heat or to light. (author). 10 refs., 3 figs.
International Nuclear Information System (INIS)
Rieser, U.
2008-01-01
The luminescence techniques have evolved over the last 40 years to a powerful dating instrument in archaeology and geoscience. Depending on how the luminescence is stimulated, one distinguishes the phenomena of thermoluminescence (TL), optically stimulated luminescence (OSL) and infrared stimulated luminescence (IRSL). Each of these phenomena has its specific potential for dating various archaeological materals in the time range from medieval back to palaeolithic periods, or, speaking in geological terms, for dating of Holocene and late Pleistocene objects. The OSL and IRSL techniques are sometimes treated together as 'optical dating'. The luminescence techniques differ from other major dating techniques, such as 14 C, essentially by their applicability to inorganic materials, their wide age-range from about 100 years to more than 100,000 years and the kind of datable events which are the last exposure to heat or to light. (author). 10 refs., 3 figs
International Nuclear Information System (INIS)
Rieser, U.
2012-01-01
The luminescence techniques have evolved over the last 40 years to a powerful dating instrument in archaeology and geoscience. Depending on how the luminescence is stimulated, one distinguishes the phenomena of thermoluminescence (TL), optically stimulated luminescence (OSL) and infrared stimulated luminescence (IRSL). Each of these phenomena has its specific potential for dating various archaeological materials in the time range from medieval back to palaeolithic periods, or, speaking in geological terms, for dating of Holocene and late Pleistocene objects. The OSL and IRSL techniques are sometimes treated together as 'optical dating'. The luminescence techniques differ from other major dating techniques, such as 14 C, essentially by their applicability to inorganic materials, their wide age-range from about 100 years to more than 100,000 years and the kind of datable events which are the last exposure to heat or to light. (author). 10 refs., 3 figs.
International Nuclear Information System (INIS)
Rieser, U.
2009-01-01
The luminescence techniques have evolved over the last 40 years to a powerful dating instrument in archaeology and geoscience. Depending on how the luminescence is stimulated, one distinguishes the phenomena of thermoluminescence (TL), optically stimulated luminescence (OSL) and infrared stimulated luminescence (IRSL). Each of these phenomena has its specific potential for dating various archaeological materals in the time range from medieval back to palaeolithic periods, or, speaking in geological terms, for dating of Holocene and late Pleistocene objects. The OSL and IRSL techniques are sometimes treated together as 'optical dating'. The luminescence techniques differ from other major dating techniques, such as 14 C, essentially by their applicability to inorganic materials, their wide age-range from about 100 years to more than 100,000 years and the kind of datable events which are the last exposure to heat or to light. (author). 10 refs., 3 figs
International Nuclear Information System (INIS)
Farkas, J.; Al-Charchafchy, F.; Al-Shaikhaly, M.H.; Mirjan, J.; Auda, H.
1974-01-01
Testing of the technical feasibility of radurization of fresh dates was attempted. In addition preliminary studies were carried out to investigate the applicability of gamma rays to date syrup manufacture. The varieties Zahdi, Lelwi and Tabarzel were studied at different stages of ripening. The eating quality of fresh dates was not affected significantly by irradiation even with doses of 270 and 540 krad. The duration of the softening process, after-ripening, of dates was prolonged by low doses of 10-30 krad in the majority of the experimental batches. The time period of after-ripening was reduced with 270 krad, as well as with 540 krad as a result of shortening of the induction period, i.e. the time after which the date begins to soften. The microbial spoilage of khalaal Lelwi dates was considerably reduced by irradiation with doses above 90 krad. The dibis yield of fully rutab dates was highly increased by the radiation doses of 375 to 2000 krad. The darkness and viable cell count of dibis pressed from irradiated dates were significantly lower than that of untreated dates. (F.J.)
Substitution of Sugar with Dates Powder and Dates Syrup in Cookies Making
W.A. Alsenaien; R.A. Alamer; Zhen-Xing Tang; S.A. Albahrani; M.A. Al-Ghannam; S.M. Aleid
2015-01-01
In this study, the effects of dates powder and dates syrup as a sugar substitution, on the physical properties and sensory attributes of cookies were studied. An increase in firmness and moisture content of cookies supplemented with dates was obtained. The diameter and spread ratio of cookies showed a decrease with increasing levels of date powder or date syrup. Partial replacement of sugar with date powder or date syrup produced cookies with more dark and red color. Sensory evaluation result...
Martin, Caitlin Eileen; Houston, Avril Melissa; Mmari, Kristin N; Decker, Michele R
2012-07-01
Adolescent dating violence is increasingly recognized as a public health problem. Our qualitative investigation sought input from urban, African-American adolescents at risk for dating violence concerning (Tjaden and Thoennes in Full report of the prevelance, incidence, and consequences of violence against women: findings from the national violence against women survey. US Department of Justice, Washington, DC, 2000) dating violence descriptions, (WHO multi-country study on women's health and domestic violence against women: Summary report of initial results on prevalence, health outcomes and women's responses. World Health Organization, Geneva, 2005) preferences for help-seeking for dating violence, and (Intimate partner violence in the United States. Bureau of Justice Statistics, US Department of Justice, Office of Justice Programs, Washington, DC, 2007) recommendations for a teen dating violence resource center. Four focus groups were conducted with urban, African American adolescents (n = 32) aged 13-24 recruited from an urban adolescent clinic's community outreach partners. Qualitative analysis was conducted. Participants assigned a wide range of meanings for the term "relationship drama", and used dating violence using language not typically heard among adults, e.g., "disrespect". Participants described preferences for turning to family or friends before seeking formal services for dating violence, but reported barriers to their ability to rely on these informal sources. When asked to consider formal services, they described their preferred resource center as confidential and safe, with empathetic, non-judgmental staff. Teens also gave insight into preferred ways to outreach and publicize dating violence resources. Findings inform recommendations for youth-specific tailoring of violence screening and intervention efforts. Current evidence that slang terms, i.e., "drama", lack specificity suggests that they should not be integrated within screening protocols
AGAR PENULISAN RESEP TETAP UP TO DATE
Directory of Open Access Journals (Sweden)
Rahmatini Rahmatini
2009-09-01
in dosage form and give it to the patient. Prescription is the final embodiment of competence, knowledge and expertise of physicians in applying his knowledge in the field of pharmacology and therapy. Writing prescriptions should be written clearly, so that it can be read by officials at the pharmacy. Not-clearly-written recipe will cause the error when compounding / preparation of drugs and the usage of prescription drugs.TINJAUAN PUSTAKA102The science of medicine is always changing, new drugs,always appeared in public. Generally, a physician must follow developments in drug therapy. When the side-effect from medication appear that should be known and can be prevented by a physician, the physician will deal with the law. To make prescribing up to date, a doctor should collect a variety of available information information source that can be used are: a reference book, Compendium of drugs, the National Essential Medicines List and guide therapy, medication Bulletin, Journal of Medicine, Center for drug information, information via computer, sources of information from the pharmaceutical industry, and verbal information. Compare to the advantages and disadvantages of various sources of information. Duty of a doctor is doing the best way to keep up to date by signing up resources that can be utilized. Find at least one of the following: (1 medical journal: (2 drug bulletin, (3 reference books or reference to clinical pharmacology, (4 commission and consultant therapy, or a magister pharmacology graduated. With their knowledge and ability to critically assess any form of information, it is expected physician keep up to date in writing prescriptions Key words: Prescribing – up to date
Biyabani, S. R.
1994-01-01
-field boundaries. Three machine versions of INS3D are available. INS3D for the CRAY is written in CRAY FORTRAN for execution on a CRAY X-MP under COS, INS3D for the IBM is written in FORTRAN 77 for execution on an IBM 3090 under the VM or MVS operating system, and INS3D for DEC RISC-based systems is written in RISC FORTRAN for execution on a DEC workstation running RISC ULTRIX 3.1 or later. The CRAY version has a central memory requirement of 730279 words. The central memory requirement for the IBM is 150Mb. The memory requirement for the DEC RISC ULTRIX version is 3Mb of main memory. INS3D was developed in 1987. The port to the IBM was done in 1990. The port to the DECstation 3100 was done in 1991. CRAY is a registered trademark of Cray Research Inc. IBM is a registered trademark of International Business Machines. DEC, DECstation, and ULTRIX are trademarks of the Digital Equipment Corporation.
2017-06-18
To investigate the awareness of acquired immune deficiency syndrome (AIDS) knowledge and AIDS-related behaviors among youth students in gay dating sites, and to provide evidences for AIDS prevention education through the internet. The students in gay dating sites, selected by a snowball sampling, were interviewed by questionnaires. Chi-square tests were used to analyze the awareness of AIDS knowledge among the students of different characteristics. The Logistic regression was used to analyze the factors associated with ever testing for HIV. In the study, 469 youth students in gay dating sites filled in the questionnaires, and a total of 442 (94.2%) valid samples were collected. The awareness of HIV/AIDS knowledge for the public among the youth students in gay dating sites was 83.9% (371).The awareness of HIV/AIDS knowledge for the youth students was 77.1% (341), and the rate of ever testing for HIV was 52.0% (230). The awareness of HIV/AIDS knowledge for the public in the students were different in different age groups (P=0.001), different marital statuses (Pdating sites was 75.1% (332), and the rate of multiple sexual partnerships among the youth students was 41.3% (137). Compared with homosexual orientation, sexual orientation as heterosexual (OR=0.282, 95%CI: 0.151 to 0.528) and not sure (OR=0.175, 95%CI: 0.035 to 0.885) were risk factors of ever testing for HIV. Multiple sexual partnerships (OR=2.103, 95%CI: 1.278 to 3.462) were promoting factors of ever testing for HIV. The rate of high-risk behaviors among the youth students in gay dating sites was high. The concern should be raised to heterosexual male students who had tendency to homosexual behavior. The AIDS prevention education should be developed in gay dating sites, to improve the self-protection awareness of the youth students.
76 FR 60461 - 36(b)(1) Arms Sales Notification
2011-09-29
... DEPARTMENT OF DEFENSE Office of the Secretary [Transmittal Nos. 11-27] 36(b)(1) Arms Sales... Department of Defense is publishing the unclassified text of a section 36(b)(1) arms sales notification. This... any: FMS Case JAH-$402 million-11Dec91. FMS Case ZUF-$375 million-22Dec08. (vi) Sales Commission, Fee...
76 FR 43336 - Delegation of Authority for the Office of Public Affairs
2011-07-20
... the Office of Public Affairs AGENCY: Office of the Secretary, HUD. ACTION: Notice of Delegation of... Secretary for Public Affairs with respect to developing policy and procedures for external and internal... Assistant Secretary for Public Affairs. DATES: Effective Date: June 29, 2011. FOR FURTHER INFORMATION...
16 CFR 314.5 - Effective date.
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Effective date. 314.5 Section 314.5 Commercial Practices FEDERAL TRADE COMMISSION REGULATIONS UNDER SPECIFIC ACTS OF CONGRESS STANDARDS FOR SAFEGUARDING CUSTOMER INFORMATION § 314.5 Effective date. (a) Each financial institution subject to the...
Levesque, Deborah A; Johnson, Janet L; Welch, Carol A; Prochaska, Janice M; Paiva, Andrea L
2016-07-01
Teen dating violence is a serious public health problem. A cluster-randomized trial was conducted to assess the efficacy of Teen Choices , a 3-session online program that delivers assessments and individualized guidance matched to dating history, dating violence experiences, and stage of readiness for using healthy relationship skills. For high risk victims of dating violence, the program addresses readiness to keep oneself safe in relationships. Twenty high schools were randomly assigned to the Teen Choices condition ( n =2,000) or a Comparison condition ( n =1,901). Emotional and physical dating violence victimization and perpetration were assessed at 6 and 12 months in the subset of participants (total n =2,605) who reported a past-year history of dating violence at baseline, and/or who dated during the study. The Teen Choices program was associated with significantly reduced odds of all four types of dating violence (adjusted ORs ranging from .45 to .63 at 12 months follow-up). For three of the four violence outcomes, participants with a past-year history of that type of violence benefited significantly more from the intervention than students without a past-year history. The Teen Choices program provides an effective and practicable strategy for intervention for teen dating violence prevention.
International Nuclear Information System (INIS)
Soroa, Victoria E.; Ozker, K.
1999-01-01
Preliminary tests have been carried out to validate the use of DEC -Tc 99m labelled leukocytes as a more stable substitute for Tc 99m-HMPAO in the diagnosis of infectious and inflammatory diseases. Although in all the patients the infectious focuses have been detected and the results are promissory, further studies with different infections /inflammations are needed to validate the procedure as an alternative routine technique
Thermoluminescence dating of Indian archaeological sites
International Nuclear Information System (INIS)
Singhvi, A.K.; Sharma, Y.P.; Agrawal, D.P.
1983-01-01
In an attempt to provide a chronology for Indian archaeological sites, an extensive pottery dating programme was initiated during 1978-1979. So far we have provided a chronology for seven important Indian archaeological sites. The dated cultures include: 1) the Ochre Colour Ware culture, 2) the Pre-Harappan culture, 3) the megalithic culture and 4) the Painted Grey Ware culture. A complete survey of recently measured TL dates are presented in a model format similar to that used in Radiocarbon. (author)
Nuclear energy: strategy of public relations
Energy Technology Data Exchange (ETDEWEB)
Timell, S [Swedish Power Association, Stockholm, Sweden
1981-02-21
A referendum was held in Sweden on 23rd March 1980, stimulated by the Three Mile Island accident in USA, to determine the future nuclear power development policy. The electricity supply background is that in 1980, 65% of power was hydro, 25% nuclear and 10% coal and oil. In terms of total power consumption, the country is heavily dependent on oil, which represents about 75%. The intensive public relations activity previous to the referendum is described, and this involved fact accumulation and assimilation, dissemination through various media, including brochures, displays, films and leaflets. In the political arena three lines developed: (1) (Conservatives); continue nuclear power, building at least 12 reactors, (2) (Social democrats and liberals); similar to (1), but more cautious, with emphasis on energy conservation, (3) (Centre parties and communists); no more nuclear power, and prevention of uranium extraction in Sweden. The voting was (1) 18.9%, (2) 39.1%, (3) 38.7%, (No dec of the most topical is concerned with the inventory of risks due to each industrial energy sector. This session was in two parts, the first devoted to problems specific to each source of energy including nuclear, the second to commo The extension to longer distances may be made with caution and to the satisfaction of the regulatory authority.
Parsons, M W; Munkvold, G P
2010-05-01
Fusarium ear rot, caused by Fusarium verticillioides, is one of the most common diseases of maize, causing yield and quality reductions and contamination of grain by fumonisins and other mycotoxins. Drought stress and various insects have been implicated as factors affecting disease severity. Field studies were conducted to evaluate the interactions and relative influences of drought stress, insect infestation, and planting date upon Fusarium ear rot severity and fumonisin B1 contamination. Three hybrids varying in partial resistance to Fusarium ear rot were sown on three planting dates and subjected to four irrigation regimes to induce differing levels of drought stress. A foliar-spray insecticide treatment was imposed to induce differing levels of insect injury. Populations of thrips (Frankliniella spp.), damage by corn earworm (Helicoverpa zeae), Fusarium ear rot symptoms, and fumonisin B1 levels were assessed. There were significant effects of hybrid, planting date, insecticide treatment, and drought stress on Fusarium ear rot symptoms and fumonisin B1 contamination, and these factors also had significant interacting effects. The most influential factors were hybrid and insecticide treatment, but their effects were influenced by planting date and drought stress. The more resistant hybrids and the insecticide-treated plots consistently had lower Fusarium ear rot severity and fumonisin B1 contamination. Later planting dates typically had higher thrips populations, more Fusarium ear rot, and higher levels of fumonisin B1. Insect activity was significantly correlated with disease severity and fumonisin contamination, and the correlations were strongest for thrips. The results of this study confirm the influence of thrips on Fusarium ear rot severity in California, USA, and also establish a strong association between thrips and fumonisin B1 levels.
41 CFR 101-1.104 - Publication and distribution of FPMR.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Publication and distribution of FPMR. 101-1.104 Section 101-1.104 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS GENERAL 1-INTRODUCTION 1.1-Regulation...
International Nuclear Information System (INIS)
Renne, P.R.; Onstott, T.C.; Agrella-Filho, M.S. d'; Pacca, I.G.; Teixeira, W.
1990-01-01
Paleomagnetic poles from 1.1-1.0 Ga dyke swarms in eastern Brazil (Sao Francisco Craton) are compared with 1.0 Ga poles from granulites of the Namaqua Province in southern Africa (Kalahari Graton). The intrusive ages of dykes are estimated from 40 Ar/ 39 Ar dating of outgassed biotites from baked country rocks. The age of magnetization for the granulites is derived by combining 40 Ar/ 39 Ar hornblende and biotite dates. When restored to a Mesozoic pre-drift configuration the paleomagnetic poles are in crude spatial agreement but are temporally discordant. To satisfy both paleomagnetic and geochronologic constraints, a reconstruction involving separation of the Sao Francisco and Kalahari cratons is required, indicating that the intervening Pan-African (Brasiliano) mobile belt may record a craton-craton collision. (orig.)
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Marriage dates. 3.54..., Compensation, and Dependency and Indemnity Compensation Relationship § 3.54 Marriage dates. A surviving spouse may qualify for pension, compensation, or dependency and indemnity compensation if the marriage to the...
Synthesis and Molecular Structures of (E-non-2-enoic Acid and (E-dec-2-enoic Acid
Directory of Open Access Journals (Sweden)
Marcel Sonneck
2015-10-01
Full Text Available The molecular structures of (E-non-2-enoic acid (C9 and (E-dec-2-enoic acid (C10 are reported. The title compounds were crystallized by slow evaporation of ethanolic solutions at −30 °C. C9 crystallizes in the monoclinic space group P21/c and C10 in the triclinic space group P-1, each with 4 molecules in the unit cell. The unit cell parameters for C9 are: a = 10.6473(4 Å, b = 5.2855(2 Å, c = 17.0313(7 Å; β = 106.0985(10° and V = 920.87(6 Å3. The unit cell parameters for C10 are: a = 4.1405(2 Å, b = 15.2839(6 Å, c = 17.7089(7 Å; α = 68.3291(11°, β = 83.3850(13°, γ = 85.0779(12° and V = 1033.39(8 Å3.
Dating the humans by radiocarbon
International Nuclear Information System (INIS)
Fedi, M.E.
2011-01-01
Radiocarbon has become a very powerful tool used for dating. This paper deals with a specific application of 1 4C i.e. dating of humans. Attention is focused on those aspects that, if neglected, might lead to a misinterpretation of the results or to an unsatisfying accuracy of the measurement. After a brief description of the main principles on which the radiocarbon method is based and of Accelerator Mass Spectrometry, examples taken from the research activity of INFN-LABEC (Laboratorio di Tecniche Nucleari per I Beni Culturali) in Florence are presented. The case of the relic of St. Francis represents an example of dating not directly human remains but other objects that can be associated to them. The case of two burials from the archaeological area of Baratti-Populonia, in Tuscany, gives the possibility to show the importance of estimating the human palaeodiet when dating bone samples.
Public information circular for shipments of irradiated reactor fuel. Revision 4
International Nuclear Information System (INIS)
1984-06-01
This publication is the fifth in a series of annual publications issued by the Nuclear Regulatory Commission in response to public information requests regarding the Commission's regulation of shipments of irradiated reactor fuel. This publication contains basically three kinds of information: (1) routes recently approved (18 months) by the Commission for the shipment of irradiated reactor fuel; (2) information regarding any safeguards-significant incidents that may be (to date none have) reported during shipments along such routes; and (3) cumulative amounts of material shipped
ARC2D - EFFICIENT SOLUTION METHODS FOR THE NAVIER-STOKES EQUATIONS (DEC RISC ULTRIX VERSION)
Biyabani, S. R.
1994-01-01
computers to emulate Cray system time calls, which should be easy to modify for other machines as well. The standard distribution media for this version is a 9-track 1600 BPI ASCII Card Image format magnetic tape. The Cray version was developed in 1987. The IBM ES/3090 version is an IBM port of the Cray version. It is written in IBM VS FORTRAN and has the capability of executing in both vector and parallel modes on the MVS/XA operating system and in vector mode on the VM/XA operating system. Various options of the IBM VS FORTRAN compiler provide new features for the ES/3090 version, including 64-bit arithmetic and up to 2 GB of virtual addressability. The IBM ES/3090 version is available only as a 9-track, 1600 BPI IBM IEBCOPY format magnetic tape. The IBM ES/3090 version was developed in 1989. The DEC RISC ULTRIX version is a DEC port of the Cray version. It is written in FORTRAN 77 for RISC-based Digital Equipment platforms. The memory requirement is approximately 7Mb of main memory. It is available in UNIX tar format on TK50 tape cartridge. The port to DEC RISC ULTRIX was done in 1990. COS and UNICOS are trademarks and Cray is a registered trademark of Cray Research, Inc. IBM, ES/3090, VS FORTRAN, MVS/XA, and VM/XA are registered trademarks of International Business Machines. DEC and ULTRIX are registered trademarks of Digital Equipment Corporation.
Public Television Channels in New York City: The First Six Months.
Calhoun, Richard
The end results of the first six months of public access cable television (CATV) channels in New York City were in some ways disappointing. Franchise agreements for each of New York's two CATV systems called for two public-access channels to be in operation by July 1, 1971, one year after the date of the franchise awards. The channels were to be…
On the variation of environmental radioactivity in Dae-Jeon area (Jan. 1977-Dec. 1981)
International Nuclear Information System (INIS)
Oh, H.P.; Oh, H.J.
1982-01-01
This study concerns with gamma-ray exposure in natural background radiation and radioactivities in the air-borne dust, the fall-out, and the rain-out which had been measured in Dae-Jeon area during the period of five years from Jan. 1, 1977 to Dec. 31, 1981. The special survey results from the 22th, 23th, and 24th nuclear explosion tests carred out by Red China are included in this paper. The results of these measurements are as follows: 1. The average value of natural background radiation in the laboratory 20.69μR/hr, and it is found that the natural background was not affected by the nuclear explosion tests. 2. The average value of radioactivity in the air-borne dust is 0.11pμci/cc, and the maximum value of radioactivity during the period is 0.47pμci/cc. 3. The average value of radioactivity of the fall-out is 0.09mci/km 2 -10d, and the maximum value of radioactivity during the period is 0.84mci/km 2 -10d. 4. The average value of radioactivity in the rain-out is 0.45 x 10 -8 μci/cc, and the maximum value of radioactivity during the period is 1.97 x 10 -8 μci/cc. (Author)
Radiocarbon dating with accelerator mass spectrometry
International Nuclear Information System (INIS)
Blake, W. Jr.
1985-01-01
Radiocarbon dating by means of accelerator mass spectrometry (AMS) has two great advantages over conventional dating: 1) much smaller samples can be handled and 2) counting time is significantly shorter. Three examples are given for Holocene-age material from east-central Ellesmere Island. The results demonstrate the potential use of this technique as a powerful research tool in studies of Quaternary chronology. Individual fragments of marine shells as small as 0.1 g have been dated successfully at the IsoTrace Laboratory, University of Toronto. In the case of an aquatic moss from a lake sediment core, an increment 0.5 cm thick could be used instead of a 5 cm-thick slice, thus allowing a much more precise estimate of the onset of organic sedimentation
Hu, Shenlin; Shang, Wei; Yue, Haitao; Chen, Ruini; Dong, Zheng; Hu, Jinhua; Mao, Zhao; Yang, Jian
2015-04-01
To evaluate the DEC1 expression of periodontal ligament tissue and gingival tissue in the patients with chronic periodontitis. 20 non-smoking patients with chronic periodontitis and 20 healthy individuals were enrolled. Periodontal ligament tissue and gingival tissue samples from healthy subjects were collected during teeth extraction for orthodontic reason or the third molar extraction. The parallel samples from patients with chronic periodontitis were obtained during periodontal flap operations or teeth extraction as part of periodontal treatment. The DEC1 expression and the alkaline phosphatase (ALP) activity of both the periodontal ligament tissue and gingival tissue were determined by Western blot, Immunohistochemistry and ALP Detection Kit. The DEC1 expression of periodontal ligament tissue in the patients with chronic periodontitis decreased significantly along with the decreased ALP activity. On the contrary, the DEC1 expression of gingival tissue in the patients with chronic periodontitis increased significantly. Further study found that the DEC1 expression of gingival tissue increased mainly in the suprabasal layer of gingival epithelial cells but decreased in the gingival connective tissue of the patients with chronic periodontitis. The DEC1 expression decreases in the periodontal ligament tissue which is related to the osteogenic capacity, whereas the DEC1 expression increases in the suprabasal layer of gingival epithelial cells which are involved in immune inflammatory response in the patients with chronic periodontitis. The findings provide a new target to explore the pathology and the therapy of periodontitis. Copyright © 2014 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Hébert Martine
2014-01-01
Full Text Available Dating violence (DV is now recognized as an important public health issue. Prevention and intervention programs are being implemented in school contexts. Such initiatives aim to raise awareness among potential victims and offenders as well as among peer bystanders and offer adequate interventions following disclosure. Yet, a major challenge remains as teenagers may not disclose their victimization or may not feel self-efficient to deal with DV if they witness such violence. As such, teen DV remains largely hidden. A representative sample of 8194 students (age 14-18 in the province of Quebec, Canada was used to explore teenagers’ self-efficacy to reach out for help or to help others in a situation of DV victimization and perpetration. Analyses are conducted to identify possible correlates of self-efficacy in terms of socio-demographic variable (sex, age and a history of child sexual abuse and dating victimization. Implications for prevention and support strategies are discussed.
2009-09-01
pathology, social issues, and healthcare are also covered. Respond to questions from the community and guidance to solve individual health care... Narcissism , the new mental illness? The Journal 29 Dec 2008 C1. De Soto JA, Treating migraine headaches, The Journal 1 Dec 2008 C1‐C2. De Soto JA...Anti‐Estrogens. Doctoral Dissertation, Advisor: Donnell Bowen Ph.D., Professor of Pharmacology & Oncology. Dec 2005 Media CNN News, Rob Snyder
Program solicitation. Closing date: March 1, 1995
Energy Technology Data Exchange (ETDEWEB)
1995-01-01
This document is a solicitation for small business to participate in innovation research. The Department of Energy (DOE) invites small business concerns to submit grant applications under this thirteenth annual solicitation for the Small Business Innovation Research (SBIR) program. Firms with strong research capabilities in science or engineering in any of the topic areas described in Appendix 1 are encouraged to participate. DOE will support high-quality research or research and development (R and D) on advanced concepts concerning important energy related scientific or engineering problems and opportunities that could lead to significant public benefit if the research is successful. Objectives of this program include increasing private sector commercialization of technology developed through DOE-supported R and D, stimulating technological innovation in the private sector, strengthening the role of small business in meeting Federal research and R and D needs, and improving the return on investment from Federally funded research for economic and social benefits to the Nation.
ESR dating of tooth enamel samples
International Nuclear Information System (INIS)
Chen Tiemei; Yang quan; Wu En
1993-01-01
Five tooth samples from the palaeoanthropological site of Jinniushan were dated with both electron-spin-resonance (ESR) and uranium-series techniques. The ESR age of about 230 ka is in good agreement with the U-series dating result, which confirms the hypothesis of possible coexistence of Homo erect us and Homo sapiens in China. Problems in ESR dating are discussed such as: 1) inappropriate of simple exponential extrapolation for accumulated dose determination; 2)experimental measurement of alpha detection efficiency and radon emanation and 3)selection of U-uptake model
Integrated effect of crop sowing date and herbicide stress on fitness of Bromus diandrus Roth
Energy Technology Data Exchange (ETDEWEB)
García, A.L.; Royo-Esnal, A.; Torra, J.; Recasens, J.
2015-07-01
Bromus diandrus Roth is a common weed species that has increased in no-tillage dry-land cereal fields in NE Spain because of the limited control options. The fitness response of plants with different emergence times (ETs) and its influence on demography has huge implications in weed management. With this subject, three ETs (F1, F2 and F3) of B. diandrus were established through three crop-sowing dates (D1, Oct.; D2, Nov.; D3, Dec.) for each of the three years in a barley-wheat-wheat rotation. In barley, the herbicides applied were not specific for B. diandrus, whereas in wheat the specific herbicide mesosulfuron-methyl plus iodosulfuron-methyl-sodium was applied. Plant density after treatments and fitness characteristics were estimated for each weed ET. Weed density decreased for later ETs and fitness was density-dependent, showing significantly higher values when a non-specific herbicide was applied, except in number of caryopses per spikelet. The increasing fitness shown by plants with later ETs and the linear relationships of vegetative biomass vs reproductive biomass and fecundity were disrupted by the herbicide mesosulfuron-methyl plus iodosulfuron-methyl-sodium. Plants that had survived this herbicide when wheat was growing had lower values for all the characteristics analysed. After three seasons, as a consequence of decreasing seed recruitment, a practical depletion of the B. diandrus population was achieved in F2 and F3 (<2.8 and <1 plants/m2, respectively) but not in F1 (60.5 plants/m2). This study shows the importance of delayed crop sowing to optimize the control of B. diandrus in cereal fields with no tillage. (Author)
37 CFR 1.138 - Express abandonment.
2010-07-01
... before the date of issue or publication unless it is actually received by appropriate officials in time... application to avoid publication of the application (see § 1.211(a)(1)) must submit a declaration of express abandonment by way of a petition under this paragraph including the fee set forth in § 1.17(h) in sufficient...
Factors Related to Teenage Dating Violence Prevention Programming in Schools
Black, Beverly M.; Hawley, Alicia; Hoefer, Richard; Barnett, Tracey M.
2017-01-01
The Children's Safety Network has identified teenage dating violence (TDV) as a public health problem and called for effective prevention programs to address the issue. This study used resource dependence theory to examine factors that relate to domestic violence shelters' in-school efforts to prevent TDV. A national survey was sent to domestic…
48 CFR 31.205-1 - Public relations and advertising costs.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Public relations and... Organizations 31.205-1 Public relations and advertising costs. (a) Public relations means all functions and...; or (2) Maintaining or promoting reciprocal understanding and favorable relations with the public at...
2010-04-01
... partnerships, publicly traded trusts and real estate investment trusts (REITs). 1.1445-8 Section 1.1445-8... estates upon the disposition of U.S. real property interests. Except as otherwise provided in this... Bonds § 1.1445-8 Special rules regarding publicly traded partnerships, publicly traded trusts and real...
BOKO HARAM INSURGENCY IN NIGERIA: A PUBLIC ...
African Journals Online (AJOL)
DR. EMEKA IKEZUE
2015-12-01
Dec 1, 2015 ... Mgbakoigba, Journal of African Studies. ... In the case of Boko Haram insurgency, members of the sect are willing to .... considerations, absence of central authority, poverty, ignorance, state sponsored terrorism and .... Critics however, attacked Merton‟s work for neglecting the power relationships in society.
Ellis, Wendy E; Wolfe, David A
2015-10-01
The relationship between reported bullying, reported dating violence, and dating relationship quality measured through couple observations was examined. Given past research demonstrating similarity between peer and dating contexts, we expected that bullying would predict negative dating experiences. Participants with dating experience (n = 585; 238 males, M(age) = 15.06) completed self-report assessments of bullying and dating violence perpetration and victimization. One month later, 44 opposite-sex dyads (M(age) = 15.19) participated in behavioral observations. In 10-min sessions, couples were asked to rank and discuss areas of relationship conflict while being video-recorded. Qualities of the relationship were later coded by trained observers. Regression analysis revealed that bullying positively predicted dating violence perpetration and victimization. Self-reported bullying also predicted observations of lower relationship support and higher withdrawal. Age and gender interactions further qualified these findings. The bullying of boys, but not girls, was significantly related to dating violence perpetration. Age interactions showed that bullying was positively predictive of dating violence perpetration and victimization for older, but not younger adolescents. Positive affect was also negatively predicted by bullying, but only for girls. These findings add to the growing body of evidence that adolescents carry forward strategies learned in the peer context to their dating relationships. © The Author(s) 2014.
77 FR 6786 - Western Pacific Fishery Management Council; Public Meetings
2012-02-09
... Pacific Fishery Management Council; Public Meetings AGENCY: National Marine Fisheries Service (NMFS... meeting dates and times. SUMMARY: The Western Pacific Fishery Management Council (Council) announces... Merizo Community Meeting 6 p.m.-9 p.m., Wednesday, February 29, 2012 1. Introduction 2. Community Based...
DANZA EXPERIMENTAL CONTEMPORANEA. Creación de Mutanza D.E.C.
Directory of Open Access Journals (Sweden)
Claudia Mallarino Flores
2015-06-01
Full Text Available El propósito general de nuestro discurso dancístico es diseñar espacios de comunicación con el contexto; de interlocución con el "otro"; de interpretación del fenómeno vital y de construcción de procesos pedagógico-didácticos para acceder al conocimiento desde la experiencia directa de la interacción corporal con el entorno. Mutanza DEC nace en 1997, por iniciativa personal y de alumnos y egresados de la Facultad de Educación Física: de la UPN, así como de algunos enamorados de la Danza, ajenos a la Facultad, pero cercanos a nuestros intereses. El propósito fundamental de este grupo de personas, en su doble condición de futuros bailarines y maestros, es trabajar el lenguaje de la Danza, como una posibilidad de identificación de la propia dimensión corporal.
Effects of different planting dates on improving yield of Fritillaria ...
African Journals Online (AJOL)
STORAGESEVER
2008-12-17
Dec 17, 2008 ... species come from Europe and Asia (Le nard and De. Hertogh, 1993) ..... that their production is economical; however, F. persica is more ... pest activation, especially in larva stage may have started at the beginning of winter, ...
48 CFR 3001.105-1 - Publication and code arrangement.
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Publication and code arrangement. 3001.105-1 Section 3001.105-1 Federal Acquisition Regulations System DEPARTMENT OF HOMELAND... Purpose, Authority, Issuance 3001.105-1 Publication and code arrangement. (a) The HSAR is published in: (1...
The use of special stains in liver biopsy interpretation: Implications ...
African Journals Online (AJOL)
2015-12-03
Dec 3, 2015 ... Key words: Biliary disease, iron overload, liver biopsy, special stains. Date of Acceptance: 03-Dec- .... effect of cutting fresh sections after trimming. This limits ... alcohol as a significant factor in the iron deposition found in these ...
26 CFR 1.6072-3 - Income tax due dates postponed in case of China Trade Act corporations.
2010-04-01
... Trade Act corporations. 1.6072-3 Section 1.6072-3 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT... Documents § 1.6072-3 Income tax due dates postponed in case of China Trade Act corporations. (a) With... tax return of any corporation organized under the China Trade Act of 1922 (15 U.S.C. ch. 4), as...
CNA’s Integrated Ship Database, Fourth Quarter 2011 Update
2012-09-01
200 Delivery Date Age (sooce delivery). Corrvn~ssion Date: 1092ft 252ft 37 ft 77607 tons 20628tons Ships Program Manager· Water ~ne I eOOih...lnservice lil ln commission, in Reserve Stand Down commencement of inactivation availabilit 15 1 241 :~ hs,,~,.~,~tiv...inactivation availabilit Total 2 1• • • or The Directory DataTableOn inal Dec 11 DataTablecoPYl Basic PivotTable Quiklook 5030.8A Battieforce < Quiklook
International Nuclear Information System (INIS)
Osorio, A.M.; Hadler, J.C.; Iunes, P.J.; Paulo, S.R. de
1993-06-01
In order to use the fission track dating method the flux gradient was verified within the sample holder, in some irradiation positions of the IEA-R1 reactor at IPEN/CNEN, Sao Paulo. The fission track dating method considers only the thermal neutron fission tracks, to subtract the other contributions sample irradiations with a cadmium cover was performed. The neutron flux cadmium influence was studied. (author)
... Home Body Your sexuality Dating and sexual feelings Dating and sexual feelings Thinking about romance, starting to ... you learn how to stay healthy and strong. Dating older guys top If you date someone even ...
48 CFR 401.105-1 - Publication and code arrangement.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Publication and code arrangement. 401.105-1 Section 401.105-1 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL AGRICULTURE ACQUISITION REGULATION SYSTEM Purpose, Authority, Issuance 401.105-1 Publication and...
41 CFR 301-11.10 - Am I required to record departure/arrival dates and times on my travel claim?
2010-07-01
... departure/arrival dates and times on my travel claim? 301-11.10 Section 301-11.10 Public Contracts and... dates and times on my travel claim? You must record the date of departure from, and arrival at, the... visited. You do not have to record departure/arrival times, but you must annotate your travel claim when...
78 FR 7424 - Combined Notice of Filings #1
2013-02-01
.... Applicants: Public Service Company of New Mexico, Delta Person GP, LLC, BHB Power, LLC, Delta Person, Limited...-003. Applicants: Southwestern Public Service Company. Description: Supplement to June 29, 2012 Triennial Market Power Analysis of Southwestern Public Service Company. Filed Date: 1/24/13. Accession...
International Nuclear Information System (INIS)
Lee, Hee Kwon
2005-01-01
We carried out ESR dating of fault rocks collected near the nuclear reactor. The Upcheon fault zone is exposed close to the Ulzin nuclear reactor. The space-time pattern of fault activity on the Upcheon fault deduced from ESR dating of fault gouge can be summarised as follows : this fault zone was reactivated between fault breccia derived from Cretaceous sandstone and tertiary volcanic sedimentary rocks about 2 Ma, 1.5 Ma and 1 Ma ago. After those movements, the Upcheon fault was reactivated between Cretaceous sandstone and fault breccia zone about 800 ka ago. This fault zone was reactivated again between fault breccia derived form Cretaceous sandstone and Tertiary volcanic sedimentary rocks about 650 ka and after 125 ka ago. These data suggest that the long-term(200-500 k.y.) cyclic fault activity of the Upcheon fault zone continued into the Pleistocene. In the Ulzin area, ESR dates from the NW and EW trend faults range from 800 ka to 600 ka NE and EW trend faults were reactivated about between 200 ka and 300 ka ago. On the other hand, ESR date of the NS trend fault is about 400 ka and 50 ka. Results of this research suggest the fault activity near the Ulzin nuclear reactor fault activity continued into the Pleistocene. One ESR date near the Youngkwang nuclear reactor is 200 ka
U.S. tabloid magazine coverage of a celebrity dating abuse incident: Rihanna and Chris Brown.
Rothman, Emily F; Nagaswaran, Anita; Johnson, Renee M; Adams, Kelley M; Scrivens, Juliane; Baughman, Allyson
2012-01-01
Dating abuse is a prevalent adolescent health problem with substantial public health consequences. As many as 1 in 10 high school students in the United States reports being "hit, slapped, or physically hurt on purpose" by his or her boyfriend or girlfriend in the past year. The authors used the Rihanna-Chris Brown dating abuse incident of 2009 as a case study to conduct what is, to our knowledge, the first assessment of media framing of dating abuse. The authors reviewed the 20 leading U.S. single-copy sales magazines published from February to April 2009 and identified 48 relevant articles, which were all printed in 7 tabloid magazines. The authors conducted a content analysis of the media frames of the articles using 5 frame categories: (a) abuse is objectionable, (b) victim-blaming, (c) abuse is sexualized/romanticized, (d) myths about abuse perpetration, and (e) abuse is normalized. Abuse is objectionable was the dominant frame of 40% of articles, victim-blaming in 36%. Although the majority of articles reviewed (83%) made at least passing reference to the idea that abuse is wrong, a minority (40%) used a dominant frame that condemned abuse. Instead, the majority of articles communicated mixed messages about dating abuse, and many minimized the seriousness of partner abuse perpetration. Advocacy is needed to improve future tabloid media framing of dating abuse incidents.
Choi, Hye Jeong; Weston, Rebecca; Temple, Jeff R
2017-04-01
Although multiple forms (i.e., physical, threatening, psychological, sexual, and relational abuse) and patterns (i.e., perpetration and victimization) of violence can co-occur, most existing research examines these experiences individually. Thus, the purpose of this study is to investigate: (1) homogenous subgroups based on victimization and perpetration of multiple forms of teen dating violence; (2) predictors of membership in these subgroups; and (3) mental health consequences associated with membership in each subgroup. Nine hundred eighteen adolescents in the 9 th or 10 th grade at seven public high schools in Texas participated in the survey (56 % female, White: 30 %, Hispanic: 32 %, African American: 29 %, others: 9 %). A three-step latent class analysis was employed. Five latent teen dating violence classes were identified: (1) nonviolence; (2) emotional/verbal abuse; (3) forced sexual contact; (4) psychological + physical violence; and (5) psychological abuse. Females, African Americans, and youth who had higher acceptance of couple violence scores and whose parents had less education were more likely to members of dating violence classes compared with the nonviolence class. Adolescents who experienced multiple types of dating violence reported greater mental health concerns. Prevention programs may benefit by identifying the homogenous subgroups of teen dating violence and targeting adolescent teen dating violence accordingly.
U-Th Burial Dates on Ostrich Eggshell
Sharp, W. D.; Fylstra, N. D.; Tryon, C. A.; Faith, J. T.; Peppe, D. J.
2015-12-01
Obtaining precise and accurate dates at archaeological sites beyond the range of radiocarbon dating is challenging but essential for understanding human origins. Eggshells of ratites (large flightless birds including ostrich, emu and others) are common in many archaeological sequences in Africa, Australia and elsewhere. Ancient eggshells are geochemically suitable for the U-Th technique (1), which has about ten times the range of radiocarbon dating (>500 rather than 50 ka), making eggshells attractive dating targets. Moreover, C and N isotopic studies of eggshell provide insights into paleovegetation and paleoprecipitation central to assessing past human-environment interactions (2,3). But until now, U-Th dates on ratite eggshell have not accounted for the secondary origin of essentially all of their U. We report a novel approach to U-Th dating of eggshell that explicitly accounts for secondary U uptake that begins with burial. Using ostrich eggshell (OES) from Pleistocene-Holocene east African sites, we have measured U and 232Th concentration profiles across OES by laser ablation ICP-MS. U commonly peaks at 10s to 100s of ppb and varies 10-fold or more across the ~2 mm thickness of OES, with gradients modulated by the layered structure of the eggshell. Common Th is high near the shell surfaces, but low in the middle "pallisade" layer of OES, making it optimal for U-Th dating. We determine U-Th ages along the U concentration gradient by solution ICP-MS analyses of two or more fractions of the pallisade layer. We then estimate OES burial dates using a simple model for diffusive uptake of uranium. Comparing such "U-Th burial dates" with radiocarbon dates for OES calcite from the same shells, we find good agreement in 7 out of 9 cases, consistent with rapid burial and confirming the accuracy of the approach. The remaining 2 eggshells have anomalous patterns of apparent ages that reveal they are unsuitable for U-Th dating, thereby providing reliability criteria innate
48 CFR 501.105-1 - Publication and code arrangement.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Publication and code arrangement. 501.105-1 Section 501.105-1 Federal Acquisition Regulations System GENERAL SERVICES... 501.105-1 Publication and code arrangement. The GSAR is published in the following sources: (a) Daily...
77 FR 70885 - Uniform Compliance Date for Food Labeling Regulations
2012-11-28
.... FDA-2000-N-0011] Uniform Compliance Date for Food Labeling Regulations AGENCY: Food and Drug... January 1, 2016, as the uniform compliance date for food labeling regulations that are issued between... established January 1, 2014, as the uniform compliance date for food labeling regulations issued between...
International Nuclear Information System (INIS)
Al-Hakkak, Z.S.; Ali, S.R.; Ahmed, M.S.H.; Al-Maliky, S.K.
1983-01-01
The study deals with the effect of feeding irradiated dates as a whole diet on some biological parameters of the fig moth ephestia cautella. Statistical analyses of the results indicated that the differences in the undermentioned parameters were insignificant when measured and compared with insects reared wholly either on irradiated or on unirradiated dry dates fruits. 1. Average numbers of larvae and pupae produced out of 400 seeded eggs after 30 days of incubation. 2. Average percentage of adult survival and their sex-ratio. 3. Mating frequency (average number of spermatophores per female) of the survived adults. 4. Average number of eggs laid per female. 5. Average percentage of eggs hatchability. 6. Mating frequency, average number of eggs per female and average percentage of egg hatchability of F1 progeny adults produced from insect parents reared on 100% diet of irradiated as well as on unirradiated dates. Therefore it could be concluded that disinfestation of date fruits by such a range of doses (50-100 krad) of gamma radiation might not have any adverse effect on the fig moth
77 FR 74653 - Combined Notice of Filings #1
2012-12-17
.... Applicants: Public Service Company of New Mexico. Description: Public Service Company of New Mexico submits... Market-Based Rate Tariff to be effective 2/1/2013. Filed Date: 12/7/12. Accession Number: 20121207-5219...
78 FR 51189 - Filing Dates for the Alabama Special Elections in the 1st Congressional District
2013-08-20
... 1st Congressional District AGENCY: Federal Election Commission. ACTION: Notice of filing dates for... Congressional District vacated by Representative Jo Bonner. There are three possible special elections, but only... Election, the top two vote-getters will participate in a Special Runoff Election. General Election...
Energy Technology Data Exchange (ETDEWEB)
Franzke, U.; Stangl, M.
2000-02-15
The energy consumption of buildings caused by air conditioning is high. The main reason is the using of refrigeration machines for dehumidification under the dew point. A reduction of the energy consumption is possible in case of using of desiccant dehumidification. A desiccant cooling air handling unit realizes the dehumidification by desiccants. Further more a heat recovery wheel and a humidifier are necessary. In the framework of the project the desiccant wheel and a high-pressure humidifier are investigated. A refrigeration machine was installed only for theoretical investigations. The investigation was done in the theoretical and experimental way. A new simulation model was developed. The measurement values are used for the verification of the mathematical simulation. In the framework of the project the performance characteristics of the desiccant wheel and the humidifier are optimized. As a result the regeneration temperature is now lower than at the beginning of the work. The humidifier capacity is in the same range at lower fresh water consumption. The components of the desiccant cooling air-handling unit were optimized according their performance characteristic. For the company Klingenburg the market chances will increase in case of more applications. (orig.) [German] Die Klimatisierung von Gebaeuden ist in aller Regel mit einem grossen Energieaufwand verbunden. Hauptursache dafuer ist die Verwendung der Entfeuchtung durch Taupunktunterschreitung unter Nutzung von Kaeltemaschinen. Eine Verringerung des Energieaufwandes ist nur durch Einsatz der sorptiven Luftentfeuchtung moeglich. Eine DEC-Klimaanlage realisiert die Luftentfeuchtung mit Hilfe der Sorption. Sie setzt sich aus verschiedenen Komponenten zusammen. Im Rahmen des Forschungsvorhabens wurden besonders der Sorptionsregenerator und der Kaltdampfgenerator sowohl experimentell als auch theoretisch untersucht und optimiert. Als ergaenzende Systemkomponente kommt die Kaeltemaschine hinzu, die jedoch
37 CFR 1.293 - Statutory invention registration.
2010-07-01
... the date of publication of the statutory invention registration; (2) The required fee for filing a request for publication of a statutory invention registration as provided for in § 1.17 (n) or (o); (3) A... application. (b) Any request for publication of a statutory invention registration must include the following...
A bibliography of AECL publications on environmental research
International Nuclear Information System (INIS)
Hawley, N.J.
1978-12-01
Publications in the open literature on environmental research performed by AECL personnel are listed chronologically with the first entry dated 1951. It is intended that the bibliography should be brought up to date yearly. (author)
DSU Unit
2008-01-01
The table below lists the 2009 publication dates for the paper version of the Bulletin and the corresponding deadlines for the submission of announcements. Please note that all announcements must be submitted by 12.00 midday on Tuesdays at the latest. Bulletin No. Week number Submission of announcements (before 12.00 midday) Publication date 3-4 Tuesday 6 January Monday 12 January 5-6 Tuesday 20 January Monday 26 January 7-8 Tuesday 3 February Monday 9 February 9-10 Tuesday 17 February Monday 23 February 11-12 Tuesday 3 March Monday 9 March 13-14 Tuesday 17 March Monday 23 March 15-16-17 (Easter issue) Tuesday 31 March Monday 6 April 18-19 Tuesday 21 April Monday 27 April 20-21 Tuesday 5 May Monday 11 May 22-23 Tuesday 19 May Monday 25 May 24-25 ...
45 CFR 671.15 - Publication of preliminary determination
2010-10-01
... 45 Public Welfare 3 2010-10-01 2010-10-01 false Publication of preliminary determination 671.15... Publication of preliminary determination Prior to any designation or redesignation of substances pursuant to... Environmental Protection Agency and other federal agencies, within 30 days after the date of publication of...
Public Accountability Institutions in Pakistan and their ...
International Development Research Centre (IDRC) Digital Library (Canada)
Mobile Nav Footer Links ... It is expected that the research will provide insight into the relationship between public accountability, macroeconomic ... Date de début ... Public accountability institutions of Pakistan & their macro economic impacts.
Childhood Corporal Punishment and Future Perpetration of Physical Dating Violence.
Temple, Jeff R; Choi, Hye Jeong; Reuter, Tyson; Wolfe, David; Taylor, Catherine A; Madigan, Sheri; Scott, Lauren E
2018-03-01
To test whether experiencing childhood corporal punishment is linked to later perpetration of dating violence. Young adults (n = 758; 61% female; mean age of 20 years), originally recruited for a longitudinal study as 9th- and 10th-grade Texas high school students, were asked about their childhood experiences with corporal punishment and physical abuse, as well as current experiences with dating violence. A path model was used to determine whether childhood corporal punishment was related to recent perpetration of physical dating violence, while controlling for childhood physical abuse, age, sex, ethnicity, and socioeconomic status. In all, 19% of participants (n = 134) reported physical dating violence perpetration and 68% reported experiencing corporal punishment as children (n = 498). Analysis showed a significant positive association between corporal punishment and physical perpetration of dating violence (OR 1.30, 95% CI 1.07-1.59). Even after controlling for sex, ethnicity, age, parental education, and child physical abuse, childhood corporal punishment was associated significantly with physical dating violence perpetration (aOR 1.29, 95% CI 1.02-1.62). The finding that childhood corporal punishment was associated with perpetration of young adult physical dating violence, even after controlling for several demographic variables and childhood physical abuse, adds to the growing literature demonstrating deleterious outcomes associated with corporal punishment. Copyright © 2017 Elsevier Inc. All rights reserved.
EIA Publications Directory 1993
International Nuclear Information System (INIS)
1994-01-01
This directory contains abstracts and ordering information for EIA publications released in the above time period. The abstracts are arranged by broad subject category such as coal, petroleum, natural gas, and electric power. A comprehensive subject index, a title index, and a report number index are included. Each entry gives the title, report number, publication frequency, date, number of pages, and ordering information
158_Abdulkadir et al.,_BAJOPAS PUBLICATION BAJ-17-0095
African Journals Online (AJOL)
user pc
2017-12-02
Dec 2, 2017 ... ithin this context, 'third world' countries, including Nigeria are the wo pact of climate ..... N120 billion per year, which is equivalent of 1.7% of gross domestic ..... Address, Kalvi Prize Science Forum, International. Idowu, A.A. ...
75 FR 67145 - Sunshine Act: Public Hearing
2010-11-01
... OVERSEAS PRIVATE INVESTMENT CORPORATION Sunshine Act: Public Hearing TIME AND DATE: 2 p.m... Avenue, NW., Washington, DC. STATUS: Hearing open to the Public at 2 p.m. PURPOSE: Public Hearing in... hearing orally must provide advance notice to OPIC's Corporate Secretary no later than 5 p.m. Thursday...
78 FR 5816 - Electronic Study Data Submission; Data Standard Support End Date
2013-01-28
...] Electronic Study Data Submission; Data Standard Support End Date AGENCY: Food and Drug Administration, HHS... Safety and Innovation Act (FDASIA) (Public Law 112- 144), requires electronic submission of drug and... comment, will specify the format required for such electronic submissions. The action announced in this...
Ruel, Catherine; Lavoie, Francine; Hébert, Martine; Blais, Martin
2017-05-01
Despite efforts to prevent physical teen dating violence, it remains a major public health issue with multiple negative consequences. This study aims to investigate gender differences in the relationships between exposure to interparental violence (mother-to-father violence, father-to-mother violence), acceptance of dating violence (perpetrated by boys, perpetrated by girls), and self-efficacy to disclose teen dating violence. Data were drawn from Waves 1 and 2 of the Quebec Youth Romantic Relationships Project, conducted with a representative sample of Quebec high school students. Analyses were conducted on a subsample of 2,564 teenagers who had been in a dating relationship in the past 6 months (63.8% girls, mean age of 15.3 years). Path analyses were conducted to investigate the links among exposure to interparental violence, acceptance of violence, self-efficacy to disclose teen dating violence (measured at Wave 1), and physical teen dating violence (measured at Wave 2). General exposure to interparental violence was linked, through acceptance of girl-perpetrated violence, to victimization among both genders and to girls' perpetration of physical teen dating violence. No significant difference was identified in the impact of the gender of the perpetrating parent when considering exposure to interparental violence. Self-efficacy to disclose personal experiences of violence was not linked to exposure to interparental violence or to experiences of physical teen dating violence. The findings support the intergenerational transmission of violence. Moreover, the findings underline the importance of targeting acceptance of violence, especially girl-perpetrated violence, in prevention programs and of intervening with children and adolescents who have witnessed interparental violence.
Dating Violence in Mexico College Students: A Review
Directory of Open Access Journals (Sweden)
José Luis Rojas-Solís
2013-06-01
Full Text Available Dating violence in Mexico is a serious problem because 76% of young Mexicans have suffered psychological violence, 15% have suffered physical violence and 16.5% have suffered sexual violence (Mexican Youth Institute, 2008. Therefore it has been given increasing attention to the study of this phenomenon in numerous researches. Knowing the characteristics of this production would allow to consolidate or to open up new research lines, so this narrative review discusses the main methodological characteristics of research on dating violence in Mexican university students. It was included twenty scientific researches published by Mexicans and foreigners researchers between 2002 and 2012 in scientific journals or presented at scientific conferences, with samples consisting of Mexican university students aged between 18 and 25 years. The search was conducted in specialized databases such as Dialnet, Google Scholar, Psicodoc, Psycinfo, Redalyc and Scirus. The results show that 75% of the studies were quantitative designs, 100% was cross-sectional design and 85% had nonrandom sample. 95% of the samples were formed by students from public universities and 15% used an internationally validated questionnaire and controlled social desirability of responses. It concludes the need for more studies with mixed, dyadic or longitudinal designs, but with samples randomly selected from public and private universities. The need of control of social desirability of responses and the implementation of validated questionnaires to allow comparisons between results.
Nuclear energy and public safety (Part I): a bibliography of popular literature
International Nuclear Information System (INIS)
Gabriel, M.R.
1982-01-01
The focus of Part 1 is to aid the general research (especially undergraduate students and the general public) to locate information on the safety aspects of nuclear energy. A subject index after the bibliography breaks down the entries into 11 subtopics. An author index is also provided. This part of the bibliography consists of books, periodical articles, and government publications dating from 1959 to 1980
75 FR 12544 - Filing Dates for the Hawaii Special Election In the 1st Congressional District
2010-03-16
... 1st Congressional District AGENCY: Federal Election Commission. ACTION: Notice of filing dates for special election. SUMMARY: Hawaii has scheduled a Special General Election on May 22, 2010, to fill the U.... Committees required to file reports in connection with the Special General Election on May 22, 2010, shall...
International Nuclear Information System (INIS)
Mahaney, W.C.
1984-01-01
The papers in this book cover absolute, relative and multiple dating methods, and have been written by specialists from a number of different earth sciences disciplines - their common interest being the dating of geological materials within the Quaternary. Papers on absolute dating methods discuss radiocarbon, uranium-series, potassium argon, 40 Ar/ 39 Ar, paleomagnetic, obsidian hydration, thermoluminescence, amino acid racemization, tree rings, and lichenometric techniques. Those on relative dating include discussions on various geomorphic relative age indicators such as drainage density changes, hypsometric integrals, bifurcation ratios, stream junction angles, spur morphology, hillslope geometry, and till sheet characteristics. The papers on multiple dating cite examples from the Rocky Mountains, Australia, Lake Agassiz Basin, and the Southern Andes. Also included is the panel discussion which reviews and assesses the information presented, and a field trip guide which discusses the sequences of Wisconian tills and interlayered lacustrine and fluvial sediments. (orig.)
Examining the Contemporaneous Occurrence of Bullying and Teen Dating Violence Victimization
Debnam, Katrina J.; Waasdorp, Tracy E.; Bradshaw, Catherine P.
2016-01-01
Teen dating violence (TDV) is a preventable public health issue that has been linked to other forms of aggression and violence victimization. It is also a growing concern for school psychologists who may be working to prevent TDV and related behavioral problems, like bullying. The current study examined various forms of bullying victimization…
Progress in radiocarbon dating
International Nuclear Information System (INIS)
Hedges, R.E.M.
1985-01-01
The article concerns radiocarbon dating, the most important method for dating in archaeology. The principles and practice of the dating method are described. Recent developments in radiocarbon dating due to technical advances, are discussed, and include radiometric counting of small samples and accelerator mass spectrometry. Carbon isotopes and the environment are also discussed. (U.K.)
1 CFR 15.10 - Information on drafting and publication.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Information on drafting and publication. 15.10... drafting and publication. The Director of the Federal Register may prepare, and distribute to agencies... chapter. The Director may also develop and conduct programs of technical instruction. ...
75 FR 28051 - Public Workshop: Pieces of Privacy
2010-05-19
... DEPARTMENT OF HOMELAND SECURITY Office of the Secretary Public Workshop: Pieces of Privacy AGENCY: Privacy Office, DHS. ACTION: Notice announcing public workshop. SUMMARY: The Department of Homeland Security Privacy Office will host a public workshop, ``Pieces of Privacy.'' DATES: The workshop will be...
26 CFR 801.8 - Effective/applicability dates.
2010-04-01
... 26 Internal Revenue 20 2010-04-01 2010-04-01 false Effective/applicability dates. 801.8 Section 801.8 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INTERNAL... REVENUE SERVICE § 801.8 Effective/applicability dates. The provisions of §§ 801.1 through 801.7 apply on...
(including travel dates) Proposed itinerary
Indian Academy of Sciences (India)
Ashok
31 July to 22 August 2012 (including travel dates). Proposed itinerary: Arrival in Bangalore on 1 August. 1-5 August: Bangalore, Karnataka. Suggested institutions: Indian Institute of Science, Bangalore. St Johns Medical College & Hospital, Bangalore. Jawaharlal Nehru Centre, Bangalore. 6-8 August: Chennai, TN.
Geological Survey of Canada radiocarbon dates XXIX
International Nuclear Information System (INIS)
McNeely, R.; McCuaig, S.
1991-01-01
This list presents 622 radiocarbon age determinations made by the Radiocarbon Dating Laboratory. All samples dated more than two years ago have now been reported in date lists. The total number (609) of samples from various areas are as follows: Offshore (43); Newfoundland (42); Labrador (11); Nova Scotia (39); New Brunswick (7); Champlain Sea (38); Quebec (54); Ontario (23); Manitoba (3); Saskatchewan (9); Alberta (6); British Columbia (92); Yukon Territory (71); Northwest Territories, mainland (33); Northwest Territories, Arctic Archipelago (126); U.S.A. - New York (6); Washington (1); Denmark Greenland (3). Tables 1 and 2 summarize the details of background and standard counts for the 2 L and 5 L counters during the period from December 6, 1988 to January 9, 1990. (author). Refs
Geological Survey of Canada radiocarbon dates XXIX
Energy Technology Data Exchange (ETDEWEB)
McNeely, R; McCuaig, S
1992-12-31
This list presents 622 radiocarbon age determinations made by the Radiocarbon Dating Laboratory. All samples dated more than two years ago have now been reported in date lists. The total number (609) of samples from various areas are as follows: Offshore (43); Newfoundland (42); Labrador (11); Nova Scotia (39); New Brunswick (7); Champlain Sea (38); Quebec (54); Ontario (23); Manitoba (3); Saskatchewan (9); Alberta (6); British Columbia (92); Yukon Territory (71); Northwest Territories, mainland (33); Northwest Territories, Arctic Archipelago (126); U.S.A. - New York (6); Washington (1); Denmark Greenland (3). Tables 1 and 2 summarize the details of background and standard counts for the 2 L and 5 L counters during the period from December 6, 1988 to January 9, 1990. (author). Refs.
A survey of archaeological samples dated in 1988
International Nuclear Information System (INIS)
Mejdahl, V.
1989-08-01
A survey is given of archaeological samples dated in 1988 at the Nordic Laboratory for Thermoluminescence Dating. A total of 67 samples were dated. The results were corrected for short-term fading of feldspars as measured for samples stored at room temperature for four weeks or at 100 deg. C for two weeks. The beta dose from potassium and rubidium in feldspar, and the alpha dose from uranium and thorium in quartz and feldspar were included assuming alpha efficiency factors of 0.1 for quartz and 0.2 for feldspar. (author) 22 tabs., 1 ill., 14 refs
Genetics Home Reference: 1q21.1 microdeletion
... reciprocal 1q21.1 deletions and duplications associated with microcephaly or macrocephaly and developmental and behavioral abnormalities. Nat Genet. 2008 Dec;40(12):1466-71. doi: 10.1038/ng.279. Citation on PubMed or Free article on PubMed Central Haldeman-Englert CR, Jewett T. ...
76 FR 51366 - Filing Dates for the Oregon Special Election in the 1st Congressional District
2011-08-18
... 1st Congressional District AGENCY: Federal Election Commission. ACTION: Notice of filing dates for... Special Primary and Special General Election on January 31, 2012, shall file a 12-day Pre-Primary Report... Primary and Special General Elections shall file a 12-day Pre-Primary Report on October 27, 2011; a...
Harnessing Vehicle Automation for Public Mobility -- An Overview of Ongoing Efforts
Energy Technology Data Exchange (ETDEWEB)
Young, Stanley E.
2015-11-05
This presentation takes a look at the efforts to harness automated vehicle technology for public transport. The European CityMobil2 is the leading demonstration project in which automated shuttles were, or are planned to be, demonstrated in several cities and regions. The presentation provides a brief overview of the demonstrations at Oristano, Italy (July 2014), LaRochelle, France (Dec 2014), Lausanne, Switzerland (Apr 2015), Vantaa, Finland (July 2015), and Trikala, Greece (Sept 2015). In addition to technology exposition, the objectives included generating a legal framework for operation in each location and gaging the reaction of the public to unmanned shuttles, both of which were successfully achieved. Several such demonstrations are planned throughout the world, including efforts in North America in conjunction with the GoMentum Station in California. These early demonstration with low-speed automated shuttles provide a glimpse of the possible with a fully automated fleet of driverless vehicle providing a public transit service.
47 CFR 61.32 - Method of filing publications.
2010-10-01
... 47 Telecommunication 3 2010-10-01 2010-10-01 false Method of filing publications. 61.32 Section 61...) TARIFFS General Rules for Dominant Carriers § 61.32 Method of filing publications. (a) Publications sent....” The date on which the publication is received by the Secretary of the Commission (or the Mail Room...
47 CFR 61.20 - Method of filing publications.
2010-10-01
... 47 Telecommunication 3 2010-10-01 2010-10-01 false Method of filing publications. 61.20 Section 61...) TARIFFS General Rules for Nondominant Carriers § 61.20 Method of filing publications. (a) Publications... 20554.“ The date on which the publication is received by the Secretary of the Commission (or the Mail...
Hays, Danica G.; Michel, Rebecca E.; Cole, Rebekah F.; Emelianchik, Kelly; Forman, Julia; Lorelle, Sonya; McBride, Rebecca; Sikes, April
2011-01-01
Despite the prevalence of dating violence, incidences often go unreported due to a lack of awareness among students as to appropriate dating behaviors. This phenomenology investigated how adolescents conceptualize and experience dating relationships. We explored adolescent females' definitions of healthy and abusive relationships, experiences with…
Cyber dating abuse among teens using school-based health centers.
Dick, Rebecca N; McCauley, Heather L; Jones, Kelley A; Tancredi, Daniel J; Goldstein, Sandi; Blackburn, Samantha; Monasterio, Erica; James, Lisa; Silverman, Jay G; Miller, Elizabeth
2014-12-01
To estimate the prevalence of cyber dating abuse among youth aged 14 to 19 years seeking care at school-based health centers and associations with other forms of adolescent relationship abuse (ARA), sexual violence, and reproductive and sexual health indicators. A cross-sectional survey was conducted during the 2012-2013 school year (participant n = 1008). Associations between cyber dating abuse and study outcomes were assessed via logistic regression models for clustered survey data. Past 3-month cyber dating abuse was reported by 41.4% of this clinic-based sample. More female than male participants reported cyber dating abuse victimization (44.6% vs 31.0%). Compared with no exposure, low- ("a few times") and high-frequency ("once or twice a month" or more) cyber dating abuse were significantly associated with physical or sexual ARA (low: adjusted odds ratio [aOR] 2.8, 95% confidence interval [CI] 1.8-4.4; high: aOR 5.4, 95% CI 4.0-7.5) and nonpartner sexual assault (low: aOR 2.7, 95% CI 1.3-5.5; high: aOR 4.1, 95% CI 2.8-5.9). Analysis with female participants found an association between cyber dating abuse exposure and contraceptive nonuse (low: aOR 1.8, 95% CI 1.2-2.7; high: aOR 4.1, 95% CI 2.0-8.4) and reproductive coercion (low: aOR 3.0, 95% CI 1.4-6.2; high: aOR 5.7, 95% CI 2.8-11.6). Cyber dating abuse is common and associated with ARA and sexual assault in an adolescent clinic-based sample. The associations of cyber dating abuse with sexual behavior and pregnancy risk behaviors suggest a need to integrate ARA education and harm reduction counseling into sexual health assessments in clinical settings. Copyright © 2014 by the American Academy of Pediatrics.
Mold-Ripened Soft Cheeses Fortified with Date Palm Fruit Product as Functional Dairy Products.
Al-Otaibi, Mutlag M; Haddadin, Jamal S; Haddadin, Malik S Y
2016-01-01
Date fruit based products are gaining popularity among the consumers in almost all date growing countries due to its added nutritional value. Therefore, novel products were developed by combining two types of foods i.e., soft ripened cheeses and date fruit syrups or date powder. This study is the first to report the surface mold-ripened cheese production with date syrup and date powder. Model cheeses were prepared from pasteurized milk inoculated with Streptococcus thermophilus, Penicillium camemberti and Geotrichum candidum. Date syrup-1, date syrup-2, date powder or the date mixture were added at the stage of curdling. Based on the kinetic growth of the microbial groups in all the treatments, there was no change in the growth of these in various date palm product. On the contrary It may be said that addition of the date fruit product supports their growth. After 35 days, the amounts of total poly phenols were 128.3 ± 1.01, 81.8 ± 1.11, 33.5 ± 2.19, 156.23 ± 1.27 mg GAE/100 g in the cheeses support with date syrup-1, date syrup-2, date powder or the date mixture, respectively. Antioxidant activity of date fruits ranged from 80.13 IC50 (date syrup-2) to 82.23 IC50 (date syrup-1). Based on the chemical characteristics and sensory analysis, the study results showed the potential for innovative application of date products for developing new functional dairy products as an ideal medium for the delivery of biological active compounds with beneficial health effects over.
HUBUNGAN PENGGUNAAN JENIS MEDIA MASSA DENGAN KEJADIAN DATING VIOLENCE
Directory of Open Access Journals (Sweden)
Yekti Satriyandari
2017-03-01
Full Text Available Abstrack: The study aimed to determine the correlation between the use of mass media and dating violence occurrence at State Senior High School 1 Pajangan Bantul Yogyakarta. The correlation study used cross sectional approach. Samples were 108 students (total sampling. The measuring instruments were checklists and questionnaires. The data were analyzed using Chi Square. That was indicated by the value x 2 (12.531 with the significant value (p = 0.002 <0.05, and the contingency coefficient (0,322. There was a correlation between the use of mass media and dating violence occurrence at State Senior High School 1 Pajangan Bantul Yogyakarta. It is expected that teenagers do not date in order to avoid the incidence of dating violence and are able to use information technology properly and appropriately.Keywords: the use of mass media, dating violence
African Journals Online (AJOL)
USER
2014-12-02
Dec 2, 2014 ... This study aimed to assess financial feasibility of traditional small-scale ... enterprises that received microcredit from local commercial bank could repay fully principal and ..... accounting for 96.1% of the total investment.
26 CFR 301.6106-1 - Publicity of unemployment tax returns.
2010-04-01
... 26 Internal Revenue 18 2010-04-01 2010-04-01 false Publicity of unemployment tax returns. 301.6106... Records § 301.6106-1 Publicity of unemployment tax returns. For provisions relating to publicity of returns made in respect of unemployment tax imposed by chapter 23 of the Code, see §§ 301.6103(a)-1, 301...
Energy Technology Data Exchange (ETDEWEB)
Rothgeb, Stacey K [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2017-06-08
Fact sheet showing the metrics from calendar year 2016 from Building America's various outreach activities, including website, webinars, publications, etc. Metrics report on data for outreach and stakeholder engagement.
Energy Technology Data Exchange (ETDEWEB)
Stacey Rothgeb
2017-05-01
Fact sheet showing the metrics from calendar year 2016 from Building America's various outreach activities, including website, webinars, publications, etc. Metrics report on data for outreach and stakeholder engagement.
International Nuclear Information System (INIS)
Bourdon, B.
2003-01-01
The general principle of isotope dating methods is based on the presence of radioactive isotopes in the geologic or archaeological object to be dated. The decay with time of these isotopes is used to determine the 'zero' time corresponding to the event to be dated. This paper recalls the general principle of isotope dating methods (bases, analytical methods, validation of results and uncertainties) and presents the methods based on natural radioactivity (Rb-Sr, Sm-Nd, U-Pb, Re-Os, K-Ar (Ar-Ar), U-Th-Ra- 210 Pb, U-Pa, 14 C, 36 Cl, 10 Be) and the methods based on artificial radioactivity with their applications. Finally, the methods based on irradiation damages (thermoluminescence, fission tracks, electron spin resonance) are briefly evoked. (J.S.)
78 FR 41914 - South Atlantic Fishery Management Council (Council); Public Meetings
2013-07-12
... Atlantic Fishery Management Council (Council); Public Meetings AGENCY: National Marine Fisheries Service... as well as Framework actions to the Coastal Migratory Pelagics FMP. DATES: The meetings will be held... and Framework Actions to the Coastal Migratory Pelagics (CMP) FMP 1. Amendment 19 is a joint Gulf of...
45 CFR 164.534 - Compliance dates for initial implementation of the privacy standards.
2010-10-01
... privacy standards. 164.534 Section 164.534 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES ADMINISTRATIVE DATA STANDARDS AND RELATED REQUIREMENTS SECURITY AND PRIVACY Privacy of Individually Identifiable Health Information § 164.534 Compliance dates for initial implementation of the privacy standards. (a...
Report : public transportation in Washington State, 1984
1984-10-01
This report is an update of the Public Transportation in Washington State publication, dated December 1981. In order to reflect the changes that have occurred since that time, this report contains the most current data obtainable. Chapter One of this...
Li, Jessica C M; Cheung, Chau-Kiu; Jia, Cindy X S; Yu, Yolanda M Y; Nguyen, Ping
2018-02-01
This article presents public discourses on compensated dating of adolescent girls in Chinese society. Data are obtained from eight focus groups comprising 50 guardians at private, parochial, and public levels (i.e., social workers, police officers, parents of students, and community representatives). Qualitative data are used to demonstrate how the guardians conceptualize and contextualize compensated dating as an outcome of the dynamics of societal features. Social features such as contemporary ideologies, Internet technology advancement, commercialization of human relationships, and ambiguity between "right" and "wrong" motivate the service providers and customers of compensated dating, and accelerate their convergence and weakened levels of guardianship in society. This study is the first to connect the features of compensated dating of adolescent girls with recent societal changes using the routine activity approach. The findings confirm the application of the routine activity approach in the phenomenon of girls' compensated dating, and also offer theoretical and practical implications.
77 FR 22574 - Filing Dates for the Washington Special Election In the 1st Congressional District
2012-04-16
... the 1st Congressional District AGENCY: Federal Election Commission. ACTION: Notice of filing dates for... Special Primary and Special General Election on November 6, 2012, shall file a 12-day Pre-Primary Report... Elections shall file a 12-day Pre-Primary Report on July 26, 2012; a 12-day Pre-General Report on October 25...
26 CFR 1.1273-2 - Determination of issue price and issue date.
2010-04-01
... (a), money includes functional currency and, in certain circumstances, nonfunctional currency. See § 1.988-2(b)(2) for circumstances when nonfunctional currency is treated as money rather than as... debt instruments in the issue is sold for money. (b) Publicly traded debt instruments issued for...
2004-06-01
ecommerce architecture is the business—it is the company’s competitive advantage. (Morgan, 1998:40) Morgan goes on to illustrate this point by...396 JONES APPAREL GROUP INC 896 NATIONAL RURAL UTILITIES COOPERATIVE 397 COX COMMUNICATIONS INC 897 TRANS WORLD ENTERTAINMENT 398 MELLON FINANCIAL...It Can Work in the Public Sector,” MIS Quarterly, Dec:435-448, 1990. Morgan, T.P. “ Ecommerce Options,” Global Technology Business, Sept:40-42
37 CFR 1.291 - Protests by the public against pending applications.
2010-07-01
... against pending applications. 1.291 Section 1.291 Patents, Trademarks, and Copyrights UNITED STATES PATENT... Processing Provisions Protests and Public Use Proceedings § 1.291 Protests by the public against pending applications. (a) A protest may be filed by a member of the public against a pending application, and it will...
Understanding Teen Dating Violence
Understanding Teen Dating Violence Fact Sheet 2014 Dating violence is a type of intimate partner violence. It occurs between two people in a close relationship. The nature of dating violence can be physical, emotional, or sexual. • Physical— This ...
Environmental epidemiology, Volume 1: Public health and hazardous wastes
International Nuclear Information System (INIS)
Anon.
1991-01-01
Environmental Epidemiology, Volume 1, represents the first of several planned volumes on the uses of epidemiologic techniques to study environmental public health issues. This text focuses on environmental epidemiology as it relates to hazardous waste in the United States. This study was commissioned by the Agency for Toxic Substances and Disease Registry to examine available data for evidence of adverse health effects on human populations exposed to hazardous waste. The committee was also asked to identify data gaps which were impediments to analyzing hazardous waste health effects and to suggest ways that such environmental health assessments might be improved. The committee's solution to the paucity of data on this issue was to concentrate in this volume on identifying the available, peer-reviewed data and, consequently, the major data gaps. The study opens with a recapitulation of the context of hazardous waste sites in the United States, the approaches currently used by state and federal epidemiologists in analyzing hazardous waste exposure and effects, and candid assessment of the problems associated with environmental exposure assessment. From that context, the committee then presents the data currently available to assess human exposures through air, domestic water consumption, soil, and the food chain. The general focus here is on biomarker data as the date of choice. As with all NAS reports, this one closes with general conclusions and recommendations. Environmental health risk assessors will find this volume a valuable resource
International Nuclear Information System (INIS)
Lengauer, C.
1975-01-01
The described software serves for the control of CAMAC-systems by a PDP-11 Computer with one DEC CA11-A Branch-Driver, respectively up to ten BORER Type 1533A Single-Crate-Controllers under the Operating System DOS V08. The software consists of three parts: 1) a subroutine library for programming in FORTRAN, 2) a macro library for programming in Assembler (for time-critical problems), 3) a loadable CAMAC-Driver for controlling the system by input of single CAMAC-commands at the terminal. Programs which apply the first two parts can be written independently of the CAMAC-Controller used at runtime. (orig.) [de
Presley, Cara; Watson, Jennifer; Williams, Audrey R.
This poster presentation addresses the issue of date rape, specifically in the college environment. Highlighted are date rape statistics, demographics, and date rape drugs. Also discussed are date rape warnings and prevention strategies. It is concluded that college and university administrators must place the issue of date rape and acquaintance…
Absolute dating of the Aegean Late Bronze Age
International Nuclear Information System (INIS)
Warren, P.M.
1987-01-01
A recent argument for raising the absolute date of the beginning of the Aegean Late Bronze (LB) Age to about 1700 B.C. is critically examined. It is argued here that: (1) the alabaster lid from Knossos did have the stratigraphical context assigned to it by Evans, in all probability Middle Minoan IIIA, c. 1650 B.C.; (2) the attempt to date the alabastron found in an early Eighteenth Dynasty context at Aniba to Late Minoan IIIA:1 is open to objections; (3) radiocarbon dates from Aegean LB I contexts are too wide in their calibrated ranges and too inconsistent both within and between site sets to offer any reliable grounds at present for raising Aegean LB I absolute chronology to 1700 B.C. Other evidence, however, suggests this period began about 1600 B.C., i.e. some fifty years earlier than the conventional date of 1550 B.C. (author)
Dating by fission tracks in archaeology. 1. Principles and experimental methods
International Nuclear Information System (INIS)
Poupeau, G.; Zuleta, E.
1984-01-01
The principles of dating method by uranium fission tracks are shortly exposed. The conditions of application to the archaeology are discussed, in particular for the volcanic glasses, where the fossil fission tracks are often affected of a beginning of effacement. (L.C.) [pt
75 FR 27843 - June 10, 2010 Public Hearing
2010-05-18
... OVERSEAS PRIVATE INVESTMENT CORPORATION June 10, 2010 Public Hearing Time and Date: 2 p.m..., NW., Washington, DC. Status: Hearing open to the Public at 2 p.m. Purpose: Public Hearing in... hearing orally must provide advance notice to OPIC's Corporate Secretary no later than 5 p.m. Thursday...
12 CFR 41.28 - Effective date, compliance date, and prospective application.
2010-01-01
... TREASURY FAIR CREDIT REPORTING Affiliate Marketing § 41.28 Effective date, compliance date, and prospective... an affiliate to make solicitations to a consumer if the bank receives such information prior to...
16 CFR 680.28 - Effective date, compliance date, and prospective application.
2010-01-01
... REPORTING ACT AFFILIATE MARKETING § 680.28 Effective date, compliance date, and prospective application. (a... part shall not prohibit you from using eligibility information that you receive from an affiliate to...
Reflections on Public Health: Captain Hart and Malaria
Centers for Disease Control (CDC) Podcasts
2006-10-01
This podcast consists of segments of an interview conducted by Capt. Kathleen McDuffie, CDC, with Capt. Russell Hart, a 100 year old retired sanitary engineer of the U.S. Public Health Service Commissioned Corps as he reflects on his work in malaria control. The interview was conducted in 2006. Created: 10/1/2006 by Coordinating Center for Health Information and Service (CCHIS), National Center for Health Marketing (NCHM). Date Released: 1/7/2009.
28 CFR 302.1 - Public and private sector comment procedures.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Public and private sector comment procedures. 302.1 Section 302.1 Judicial Administration FEDERAL PRISON INDUSTRIES, INC., DEPARTMENT OF JUSTICE COMMENTS ON UNICOR BUSINESS OPERATIONS § 302.1 Public and private sector comment procedures. (a...
A survey of archaeological samples dated in 1984
International Nuclear Information System (INIS)
Mejdahl, V.
1985-10-01
A survey is given of archaeological samples dated in 1984 at the Nordic Laboratory for Thermoluminescence Dating. A total of 79 samples were dated, 49 of which were burnt stones. All results were corrected for fading as measured for samples stored for four weeks at room temperature. The alpha dose contribution from uranium in the quartz and feldspar grains was included assuming an alpha efficiency facotr of 0.1 for quartz and 0.2 for feldspars. (author)
12 CFR 571.28 - Effective date, compliance date, and prospective application.
2010-01-01
... THE TREASURY FAIR CREDIT REPORTING Affiliate Marketing § 571.28 Effective date, compliance date, and... receive from an affiliate to make solicitations to a consumer if you receive such information prior to...
44 CFR 19.100 - Purpose and effective date.
2010-10-01
... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 19.100 Purpose and effective date. The... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Purpose and effective date. 19.100 Section 19.100 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY...
Up-Dating: Ratings of Perceived Dating Success Are Better Online than Offline.
Fullwood, Chris; Attrill-Smith, Alison
2018-01-01
The primary aims of this study were to test whether perceived dating success would differ between offline and online zero-acquaintance dating contexts and to investigate the role that self-esteem might play in these evaluations. Participants were presented with the same photos of targets in either an offline or online dating scenario and rated their chances of dating success along with their perceptions of how attractive they thought the target would consider them. Higher self-esteem individuals believed they would be rated as more attractive. There was an overall perception that, irrespective of self-esteem level, meeting online would lead to better chances of dating success. These findings are considered in relation to an increased ability to more precisely manage impressions and develop an image of the self which would be evaluated more positively online.
Sabina, Chiara; Cuevas, Carlos A; Cotignola-Pickens, Heather M
2016-02-01
This study uses data from two waves of the Dating Violence Among Latino Adolescents (DAVILA) study and focuses on the 1) rates of dating violence victimization by gender, 2) risk of experiencing dating violence victimization over time, 3) association of dating violence victimization with other forms of victimization, and 4) association of immigrant status, acculturation, and familial support with dating violence victimization over time. A total of 547 Latino adolescents, from across the USA, aged 12-18 at Wave 1 participated in both waves of the study. Rates of dating violence were around 19% across waves. Dating violence at Wave 1 and non-dating violence victimization were associated with an elevated risk of dating violence during Wave 2. Cultural factors did not distinguish between dating violence trajectories, except for immigrant status and familial support being associated with no dating violence victimization. Overall, dating violence affects a large number of Latino teens and tends to continue over time. Copyright © 2015 The Foundation for Professionals in Services for Adolescents. Published by Elsevier Ltd. All rights reserved.
Ethnic differences in susceptibilities to A(H1N1) flu: An epidemic ...
African Journals Online (AJOL)
STORAGESEVER
2009-12-29
Dec 29, 2009 ... ... Center, the Second Affiliated Hospital of Soochow University, Suzhou 215004, Jiangsu, .... countries including Mexico, the country of the A (H1N1) outbreak origin. The ... precious resources used more effectively for specific.
77 FR 9912 - Combined Notice of Filings #1
2012-02-21
.... Docket Numbers: ER12-75-003. Applicants: Public Power, LLC. Description: Compliance Filing for MBR Tariff... Energy MBR Tariff to be effective 2/1/2012. Filed Date: 2/10/12. Accession Number: 20120210-5132... Cancellation of MBR Tariff to be effective 2/10/2012. Filed Date: 2/10/12. Accession Number: 20120210-5153...
Bullying as a longitudinal predictor of adolescent dating violence.
Foshee, Vangie A; McNaughton Reyes, Heath Luz; Vivolo-Kantor, Alana M; Basile, Kathleen C; Chang, Ling-Yin; Faris, Robert; Ennett, Susan T
2014-09-01
One suggested approach to preventing adolescent dating violence is to prevent behavioral precursors to dating violence, such as bullying. However, no longitudinal study has examined bullying as a behavioral precursor to dating violence. In this study, longitudinal data were used to examine (1) whether direct and indirect bullying perpetration in the sixth grade predicted the onset of physical dating violence perpetration by the eighth grade and (2) whether the associations varied by sex and race/ethnicity of the adolescent. Data were collected in school from sixth graders in three primarily rural counties and then again when students were in the eighth grade. Analyses were conducted with 1,154 adolescents who had not perpetrated dating violence at the sixth-grade assessment. The sample was 47% male, 29% black, and 10% of another race/ethnicity than black or white. Direct bullying, defined as hitting, slapping, or picking on another kid in the sixth grade, predicted the onset of physical dating violence perpetration by the eighth grade, controlling for indirect bullying and potential confounders. Although indirect bullying, defined as spreading false rumors and excluding students from friendship groups, was associated with the onset of physical dating violence perpetration in bivariate analyses, it did not predict the onset of physical dating violence when controlling for direct bullying. None of the associations examined varied by sex or race/ethnicity of the adolescents. Our findings suggest that efforts targeted at preventing direct bullying may also prevent the onset of physical dating violence. Copyright © 2014 Society for Adolescent Health and Medicine. All rights reserved.
Bullying as a Longitudinal Predictor of Adolescent Dating Violence
Foshee, Vangie A.; Reyes, Heath Luz McNaughton; Vivolo-Kantor, Alana M.; Basile, Kathleen C.; Chang, Ling-Yin; Faris, Robert; Ennett, Susan T.
2015-01-01
Purpose One suggested approach to preventing adolescent dating violence is to prevent behavioral precursors to dating violence, such as bullying. However, no longitudinal study has examined bullying as a behavioral precursor to dating violence. In this study, longitudinal data were used to examine (1) whether direct and indirect bullying perpetration in the sixth grade predicted the onset of physical dating violence perpetration by the eighth grade and (2) whether the associations varied by sex and race/ethnicity of the adolescent. Methods Data were collected in school from sixth graders in three primarily rural counties and then again when students were in the eighth grade. Analyses were conducted with 1,154 adolescents who had not perpetrated dating violence at the sixth-grade assessment. The sample was 47% male, 29% black, and 10% of another race/ethnicity than black or white. Results Direct bullying, defined as hitting, slapping, or picking on another kid in the sixth grade, predicted the onset of physical dating violence perpetration by the eighth grade, controlling for indirect bullying and potential confounders. Although indirect bullying, defined as spreading false rumors and excluding students from friendship groups, was associated with the onset of physical dating violence perpetration in bivariate analyses, it did not predict the onset of physical dating violence when controlling for direct bullying. None of the associations examined varied by sex or race/ethnicity of the adolescents. Conclusions Our findings suggest that efforts targeted at preventing direct bullying may also prevent the onset of physical dating violence. PMID:24768162
75 FR 78155 - Uniform Compliance Date for Food Labeling Regulations
2010-12-15
.... FDA-2000-N-0011] Uniform Compliance Date for Food Labeling Regulations AGENCY: Food and Drug... 1, 2014, as the uniform compliance date for food labeling regulations that are issued between... established January 2, 2012, as the uniform compliance date for food labeling regulations issued between...
Dates fruits classification using SVM
Alzu'bi, Reem; Anushya, A.; Hamed, Ebtisam; Al Sha'ar, Eng. Abdelnour; Vincy, B. S. Angela
2018-04-01
In this paper, we used SVM in classifying various types of dates using their images. Dates have interesting different characteristics that can be valuable to distinguish and determine a particular date type. These characteristics include shape, texture, and color. A system that achieves 100% accuracy was built to classify the dates which can be eatable and cannot be eatable. The built system helps the food industry and customer in classifying dates depending on specific quality measures giving best performance with specific type of dates.
DEFF Research Database (Denmark)
Pederson, Joel L.; Chapot, Melissa S.; Simms, Steven R.
2014-01-01
Rock art compels interest from both researchers and a broader public, inspiring many hypotheses about its cultural origin and meaning, but it is notoriously difficult to date numerically. Barrier Canyon-style (BCS) pictographs of the Colorado Plateau are among the most debated examples; hypotheses......, the type section of BCS art in Canyon-lands National Park, southeastern Utah. Alluvial chronostratigraphy constrains the burial and exhumation of the alcove containing the panel, and limits are also set by our related research dating both a rockfall that removed some figures and the rock's exposure...... duration before that time. Results provide a maximum possible age, a minimum age, and an exposure time window for the creation of the Great Gallery panel, respectively. The only prior hypothesis not disproven is a late Archaic origin for BCS rock art, although our age result of A. D. similar to 1...
78 FR 7781 - Filing Dates for the South Carolina Special Elections in the 1st Congressional District
2013-02-04
... in the 1st Congressional District AGENCY: Federal Election Commission. ACTION: Notice of filing dates... Primary Election, the top two vote-getters will participate in a Special Runoff Election. General Election... participating in the South Carolina Special Primary and Special General Elections shall file a 12-day Pre...
Crustáceos decápodos asociados a comunidades algales en la región de Santa Marta, Caribe colombiano
Directory of Open Access Journals (Sweden)
Campos C. Néstor Hernando
1995-11-01
Full Text Available Bimonthly sampling during a one year period was carried out on three biotopes in the Santa Marta region (Bahía de Gayraca: Lithothamnion; Bahía de Chengue: Halimeda; Bahra de Concha: Sargassum in order to determine the crustacean population associated with to them. A total of 1309 individuals of 58 species were collected. Only two species appeared at the three habitats, Mithraculus forceps y Pagurus brevidactylus. Some species were found to characterize the habitat sampled in the Santa Marta región. Lysmata wurdemanni has been found in Santa Marta only in Halimeda; some galatheids are frequently found in the Lithothamnion habitat; the spider crabs Acanthonix petiveri and Epialtus brasiliensis were found exclusively in the Sargassum habitat.Con el fin de evaluar las poblaciones de crustáceos decápodos asociadas a comunidades algales, se adelantaron muestreos bimensuales durante un año en tres comunidades de la región de Santa Marta, (Bahía de Gayraca: algas coralinácea del género Uthothamnion; Bahra de Chengue: algas del género Halimeda; Bahía de Concha: algas del género Sargassum. Se recolectaron 1.309 individuos pertenecientes a 58 especies de crustáceos decápodos. Del total de especies, sólo dos estuvieron presentes en los tres hábitats (Mithraculus forceps y Pagurus brevidactylus. Para cada una de las tres comunidades se pudieron identificar algunas especies que las caracterizan en la región de Santa Marta: Lysmata wurdemanni en el área de estudio no ha sido capturada en otro hábitat diferente a Halimeda; miembros de la familia Galatheidae son frecuentes en Uthothamnion; los cangrejos araña Acanthonix Petiveri y Epialtus brasiliensisse encontraron únicamente en Sargassum.
Annual Progress Report Fiscal Year 1982.
1982-09-30
255 Work Jnit No. 82/43 (FY82,O) A\\dolescent Immunity to Varicella and Cytomegalovirus .............. 256 Work Unit No. 82/45 (FY82,O) V!1-26 In...with technetium-99m bone agent(Infarct avid) radiopharmaceuticals. Presented at the New Mexico Society of Internal Medicine, Albuquerque NM, 11-12 Dec...No: 82/43 Status: Ongoing Title: Adolescent Immunity to Varicella and Cytomegalovirus Start Date: Est Comp Date: Principal Investigator: Facility: LTC
Jagielski, J. M.
1994-01-01
The DET/MPS programs model and simulate the Direct Energy Transfer and Multimission Spacecraft Modular Power System in order to aid both in design and in analysis of orbital energy balance. Typically, the DET power system has the solar array directly to the spacecraft bus, and the central building block of MPS is the Standard Power Regulator Unit. DET/MPS allows a minute-by-minute simulation of the power system's performance as it responds to various orbital parameters, focusing its output on solar array output and battery characteristics. While this package is limited in terms of orbital mechanics, it is sufficient to calculate eclipse and solar array data for circular or non-circular orbits. DET/MPS can be adjusted to run one or sequential orbits up to about one week, simulated time. These programs have been used on a variety of Goddard Space Flight Center spacecraft projects. DET/MPS is written in FORTRAN 77 with some VAX-type extensions. Any FORTRAN 77 compiler that includes VAX extensions should be able to compile and run the program with little or no modifications. The compiler must at least support free-form (or tab-delineated) source format and 'do do-while end-do' control structures. DET/MPS is available for three platforms: GSC-13374, for DEC VAX series computers running VMS, is available in DEC VAX Backup format on a 9-track 1600 BPI tape (standard distribution) or TK50 tape cartridge; GSC-13443, for UNIX-based computers, is available on a .25 inch streaming magnetic tape cartridge in UNIX tar format; and GSC-13444, for Macintosh computers running AU/X with either the NKR FORTRAN or AbSoft MacFORTRAN II compilers, is available on a 3.5 inch 800K Macintosh format diskette. Source code and test data are supplied. The UNIX version of DET requires 90K of main memory for execution. DET/MPS was developed in 1990. A/UX and Macintosh are registered trademarks of Apple Computer, Inc. VMS, DEC VAX and TK50 are trademarks of Digital Equipment Corporation. UNIX is a
2012-05-30
.... (Eastern Time). ADDRESSES: The Perchlorate Advisory Panel face-to-face public meeting will be held at The...-face meeting or follow-up teleconference to give EPA as much time as possible to process your request.... DATES: The Perchlorate Advisory Panel face-to-face public meeting will be held on Wednesday July 18...
Gambling and the Health of the Public: Adopting a Public Health Perspective.
Korn, David A.; Shaffer, Howard J.
1999-01-01
During the last decade there has been an unprecedented expansion of legalized gambling throughout North America. Three primary forces appear to be motivating this growth: (1) the desire of governments to identify new sources of revenue without invoking new or higher taxes; (2) tourism entrepreneurs developing new destinations for entertainment and leisure; and (3) the rise of new technologies and forms of gambling (e.g., video lottery terminals, powerball mega-lotteries, and computer offshore gambling). Associated with this phenomenon, there has been an increase in the prevalence of problem and pathological gambling among the general adult population, as well as a sustained high level of gambling-related problems among youth. To date there has been little dialogue within the public health sector in particular, or among health care practitioners in general, about the potential health impact of gambling or gambling-related problems. This article encourages the adoption of a public health perspective towards gambling. More specifically, this discussion has four primary objectives:1. Create awareness among health professionals about gambling, its rapid expansion and its relationship with the health care system;2. Place gambling within a public health framework by examining it from several perspectives, including population health, human ecology and addictive behaviors;3. Outline the major public health issues about how gambling can affect individuals, families and communities;4. Propose an agenda for strengthening policy, prevention and treatment practices through greater public health involvement, using the framework of The Ottawa Charter for Health Promotion as a guide.By understanding gambling and its potential impacts on the public's health, policy makers and health practitioners can minimize gambling's negative impacts and appreciate its potential benefits.
Brown, Adrienne; Cosgrave, Elizabeth; Killackey, Eoin; Purcell, Rosemary; Buckby, Joe; Yung, Alison R.
2009-01-01
While the prevalence, correlates and mental health impacts of intimate partner violence are well documented in adolescents and young adults, fewer studies have considered physical dating violence among clinical samples of help-seeking young people. In a sample of 98 young people aged 15-24 years (54% females) referred to a specialist public youth…
Pasting, rheological, and retrogradation properties of low-amylose rice starch with date syrup.
Mohamed, Ibrahim O; Babucurr, Jobe
2017-09-01
Effects of date syrup on pasting, rheological, and retrogradation properties of low-amylose rice starch were investigated using three levels of date syrup (starch:syrup 1:1, 1:2, or 1:3). Measurements were carried out using HR-2 Discovery Rheometer equipped with a pasting cell and parallel plate geometry. The pasting measurements showed that the peak viscosity of the control is significantly higher than the samples with date syrup (p date syrup levels. Addition of date syrup increases the solid-like behavior of the gel in reverse order with increased date syrup levels. Low-amylose starch gel used in this study showed minor changes in elastic modulus (G') during one week cold storage indicting that low-amylose rice starch is resistant to retrogradation. Addition of date syrup slightly resulted in increased retrogradation compared to the control.
Internet dating as a project: the commodification and rationalisation of online dating
Directory of Open Access Journals (Sweden)
Tjaša Žakelj
2015-04-01
Full Text Available Based on qualitative empirical data from two studies on Internet dating in Slovenia, this paper discusses the social contexts of the Internet dating of heterosexual men and women and homosexual men. Special attention is given to different aspects of the commodification and rationalisation of dating in the process of forming potential (romantic partnerships. First, we discuss our respondents’ reasons for using the Internet to get in touch with potential (romantic partners. Second, we focus on the demands and strategies of targeted market- ing in personal profile writing and, finally, on the process of selecting potential partners. Our study shows that the primary understanding of Internet dating among people who engage in it is its economic nature. Together with targeted marketing and the predeter- mined criteria for choosing interesting others, Internet dating can thus be understood as a market that encourages rationalisation and commodification in the process of forming intimate relationships.
An Evaluation of Two Dating Violence Prevention Programs on a College Campus.
Peterson, Kerry; Sharps, Phyllis; Banyard, Victoria; Powers, Ráchael A; Kaukinen, Catherine; Gross, Deborah; Decker, Michele R; Baatz, Carrie; Campbell, Jacquelyn
2016-03-13
Dating violence is a serious and prevalent public health problem that is associated with numerous negative physical and psychological health outcomes, and yet there has been limited evaluation of prevention programs on college campuses. A recent innovation in campus prevention focuses on mobilizing bystanders to take action. To date, bystander programs have mainly been compared with no treatment control groups raising questions about what value is added to dating violence prevention by focusing on bystanders. This study compared a single 90-min bystander education program for dating violence prevention with a traditional awareness education program, as well as with a no education control group. Using a quasi-experimental pre-test/post-test design with follow-up at 2 months, a sample of predominately freshmen college students was randomized to either the bystander (n = 369) or traditional awareness (n = 376) dating violence education program. A non-randomized control group of freshmen students who did not receive any education were also surveyed (n = 224). Students completed measures of attitudes, including rape myth acceptance, bystander efficacy, and intent to help as well as behavioral measures related to bystander action and victimization. Results showed that the bystander education program was more effective at changing attitudes, beliefs, efficacy, intentions, and self-reported behaviors compared with the traditional awareness education program. Both programs were significantly more effective than no education. The findings of this study have important implications for future dating violence prevention educational programming, emphasizing the value of bystander education programs for primary dating violence prevention among college students. © The Author(s) 2016.
Energy Technology Data Exchange (ETDEWEB)
NONE
2011-03-15
This report is a kind of audit report on a research laboratory, the DEC (Departement d'Etudes des Combustibles, Fuel Study Department) which comprises four departments: a department of analysis and characterization of fuel behaviour (SA3C) which comprises four laboratories, a Plutonium, Uranium and Minor Actinides department (SPUA) which comprises four laboratories, a department for the investigation and simulation of fuel behaviour (four laboratories) and the Leca-Star department (3 laboratories and a project group). The authors discuss an assessment of the whole unit activities in terms of strengths and opportunities, aspects to be improved, risks and recommendations, productions and publications on different themes (fundamental research on fuels, fuel design, fabrications, characterizations and property measurements, experimental irradiations, characterization of irradiated fuels and chemical and radio-chemical analysis, modelling and simulation). A more detailed assessment is presented for each theme in terms of scientific quality, influence and attractiveness (awards, recruitment capacity, capacity to obtain financing and to tender, participation to international programs), strategy and governance, and project
77 FR 31371 - Public Workshop: Privacy Compliance Workshop
2012-05-25
... presentations, including the privacy compliance fundamentals, privacy and data security, and the privacy... DEPARTMENT OF HOMELAND SECURITY Office of the Secretary Public Workshop: Privacy Compliance... Homeland Security Privacy Office will host a public workshop, ``Privacy Compliance Workshop.'' DATES: The...
Dating Violence among College Students
Iconis, Rosemary
2013-01-01
Dating violence is a significant problem on college campuses. More than one-fifth of the undergraduate dating population are physically abused by their dating partners and an even greater percentage are psychologically abused. Researchers have identified risk factors for college student dating violence. Preventive interventions are strongly…
Substance Use as a Longitudinal Predictor of the Perpetration of Teen Dating Violence
Temple, Jeff R.; Shorey, Ryan C.; Fite, Paula; Stuart, Gregory L.; Le, Vi Donna
2013-01-01
The prevention of teen dating violence is a major public health priority. However, the dearth of longitudinal studies makes it difficult to develop programs that effectively target salient risk factors. Using a school-based sample of ethnically diverse adolescents, this longitudinal study examined whether substance use (alcohol, marijuana, and…
20 CFR 404.630 - Use of date of written statement as filing date.
2010-04-01
... data on the Internet Social Security Benefit Application to us, we will use the date of the... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Use of date of written statement as filing date. 404.630 Section 404.630 Employees' Benefits SOCIAL SECURITY ADMINISTRATION FEDERAL OLD-AGE...
International Nuclear Information System (INIS)
Lowdon, J.A.; Blake, W. Jr.
1981-01-01
This list includes 105 radiocarbon age determinations on 104 geological samples made by the Radiocarbon Dating Laboratory. They are on samples from various areas as follows: Labrador Shelf (2); Newfoundland (12); Nova Scotia (2); New Brunswick (1); Quebec (3); Ontario (1); Manitoba (1); Alberta (2); British Columbia (15); Yukon Territory (35); Northwest Territories, Mainland (10); Northwest Territories, Arctic Archipelago (21). Details of background and standard for the 2 L and 5 L counters during the period from November 4, 1980 to October 31, 1981 are summarized in Tables 1 and 2; Table 3 gives the number of counts used to determine the average background and standard counting rates; and Table 4 lists the number of different background and standard gas preparations used for counting
Directory of Open Access Journals (Sweden)
Ana Flávia Granville-Garcia
2008-12-01
Full Text Available Este estudo retrospectivo determinou a prevalência da perda precoce de molares decíduos em pacientes atendidos na clínica de Odontopediatria da Universidade Estadual da Paraíba. Foram examinados 515 prontuários, sendo os dados registrados em um formulário. Foram analisadas as variáveis: gênero, idade, tipo de molar decíduo perdido, arcada dentária (maxilar ou mandibular e lado (direito e esquerdo. Observou-se que a prevalência de perda precoce foi de 15,1%, existindo uma distribuição similar entre os gêneros. Em relação à idade da criança, a maior freqüência de perda acometeu pacientes com sete anos (32,1%. Houve distribuição equitativa da perda dentária entre as arcadas superior e inferior, com 43,6% cada uma, sendo o lado esquerdo o mais acometido (41%. O segundo molar superior esquerdo foi o mais acometido (17,9%, seguido do primeiro molar decíduo superior direito (16,1%. Pode-se concluir que a prevalência de perda precoce foi baixa e que os molares decíduos superiores foram os dentes mais comumente perdidos.This retrospective study determined the prevalence of early loss of deciduous molars in patients enrolled at the Pediatric Dentistry clinic at the State University of Paraíba. A review of 515 patient records were analyzed, registered in a form. The following variables were analyzed: gender, age, type of deciduous molar loss, region (maxilla or mandible and side (right and left. It was observed that the prevalence of early tooth loss was 15.1% and there was a similar distribution between the genders. In regard to age, the greatest frequency of tooth loss involved patients at 7 years old (32.1%. There was a similar distribution of tooth loss between the maxilla and mandible regions, at 43.6% each, with the left side being the most involved (41%. The second upper left deciduous molar was the most commonly missing tooth (17.9%, followed by the first upper right deciduous molar (16.1%. It can be concluded that the
Energy Technology Data Exchange (ETDEWEB)
Gatty, B
1986-04-01
Scientific methods of dating, born less than thirty years ago, have recently improved tremendously. First the dating principles will be given; then it will be explained how, through natural radioactivity, we can have access to the age of an event or an object; the case of radiocarbon will be especially emphasized. The principle of relative methods such as thermoluminescence or paleomagnetism will also be shortly given. What is the use for dating. The fields of its application are numerous; through these methods, relatively precise ages can be given to the major events which have been keys in the history of universe, life and man; thus, dating is a useful scientific tool in astrophysics, geology, biology, anthropology and archeology. Even if certain ages are still subject to controversies, we can say that these methods have confirmed evolution's continuity, be it on a cosmic, biologic or human scale, where ages are measured in billions, millions or thousands of years respectively.
International Nuclear Information System (INIS)
Cottrell, W.B.; Klein, A.
1977-01-01
This index to Nuclear Safety covers articles in Nuclear Safety Vol. 11, No. 1 (Jan.-Feb. 1970), through Vol. 17, No. 6 (Nov.-Dec. 1976). The index includes a chronological list of articles (including abstract) followed by KWIC and Author Indexes. Nuclear Safety, a bimonthly technical progress review prepared by the Nuclear Safety Information Center, covers all safety aspects of nuclear power reactors and associated facilities. The index lists over 350 technical articles in the last six years of publication
Energy Technology Data Exchange (ETDEWEB)
Cottrell, W.B.; Klein, A.
1977-02-23
This index to Nuclear Safety covers articles in Nuclear Safety Vol. 11, No. 1 (Jan.-Feb. 1970), through Vol. 17, No. 6 (Nov.-Dec. 1976). The index includes a chronological list of articles (including abstract) followed by KWIC and Author Indexes. Nuclear Safety, a bimonthly technical progress review prepared by the Nuclear Safety Information Center, covers all safety aspects of nuclear power reactors and associated facilities. The index lists over 350 technical articles in the last six years of publication.
78 FR 21708 - Proposed Collection; Comment Request for Publication 1345
2013-04-11
... Publication 1345 AGENCY: Internal Revenue Service (IRS), Treasury. ACTION: Notice and request for comments... Publication 1345, Handbook for Authorized IRS e-file Providers. DATES: Written comments should be received on... [email protected] . SUPPLEMENTARY INFORMATION: Title: Publication 1345, Handbook for Authorized...
Test Specification of A1-1 Test for OECD-ATLAS Project
International Nuclear Information System (INIS)
Kang, Kyoung-Ho; Moon, Sang-Ki; Lee, Seung-Wook; Choi, Ki-Yong; Song, Chul-Hwa
2014-01-01
In the OECD-ATLAS project, design extension conditions (DECs) such as a station blackout (SBO) and a total loss of feed water (TLOFW) will be experimentally investigated to meet the international interests in the multiple high-risk DECs raised after the Fukushima accident. The proposed test matrix for the OECD-ATLAS project is summarized in Table 1.. In this study, detailed specification of the first test named as A1-1 in the OECD-ATLAS project was described. The target scenario of the A1-1 test is a prolonged SBO with delayed supply of turbine-driven auxiliary feedwater to only SG number 2 (SG-2). A SBO is one of the most important DECs in that without any proper operator actions, a total loss of heat sink leads to core uncover, to core damage, and ultimately a core melt-down scenario under high pressure. Due to this safety importance, a SBO is considered to be a base test item of the OECD-ATLAS project. A detailed specification of the first test named as A1-1 in the OECD-ATLAS project was described. The target scenario of the A1-1 test is a prolonged SBO with delayed supply of turbine-driven auxiliary feedwater to only SG-2 in order to consider an accident mitigation measure. The pre-test analysis using MARS code was performed with an aim of setting up the detailed test procedures for A1-1 test and also gaining the physical insights for a prolonged SBO transient. In the A1-1 test, a prolonged SBO transient will be simulated with two temporal phases: Phase (I) for conservative SBO transient without supply of turbine-driven auxiliary feedwater and Phase (II) for asymmetric cooling via single trained supply of turbine-driven auxiliary feedwater
32 CFR 48.502 - Effective date of annuity.
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false Effective date of annuity. 48.502 Section 48.502... RETIRED SERVICEMAN'S FAMILY PROTECTION PLAN Annuity § 48.502 Effective date of annuity. All annuities..., except that no annuity shall accrue or be paid for the month in which entitlement to that annuity...
17 CFR 9.13 - Publication of notice.
2010-04-01
... REVIEW OF EXCHANGE DISCIPLINARY, ACCESS DENIAL OR OTHER ADVERSE ACTIONS Notice and Effective Date of Disciplinary Action or Access Denial Action § 9.13 Publication of notice. Whenever an exchange suspends, expels... must make such findings public as soon as the disciplinary action or access denial action becomes...
Luminescence dating in archaeology
International Nuclear Information System (INIS)
Wintle, A.G.
2001-01-01
Thermoluminescence (TL) dating is routinely applied to burnt lithic material. Simple fires are capable of enabling stones weighing a few hundred grams to reach 450 o C, thus zeroing the TL signal. TL dates have been obtained for Upper and Lower Paleolithic sites in Europe and the Near East. TL dating continues to be used for dating pottery and for authentification of ceramic works of art. Some recent studies report the use of optically stimulated luminescence (OSL) (also know as photoluminescence) for dating very small samples of quartz, e.g. from small pieces of pottery or frm metallurgical slag The major recent advance has been in the development of a reliable laboratory procedure for using the OSL signal from quartz to obtain the past radiation exposure. The quartz OSL signal is extremely sensitive to light and is reduced to a negligible level on exposure to direct sunlight for radionuclides during burial, signal to date san.sized quartz grains extracted from sediments, The OSL signal is stimulated by 470 nm light from emitting diodes and the detected using flirters centred on 340 nm A similar signal can be obtained from feldspar grain when are exposed to infrared wavelengths around 880 nm. The infrared stimulated luminescence (IRSL) signals is also rapidly depleted by exposure to sunlight, and dating of colluvial deposits from archaeological sites has been reported
International Nuclear Information System (INIS)
2011-03-01
This report is a kind of audit report on a research laboratory, the DEC (Departement d'Etudes des Combustibles, Fuel Study Department) which comprises four departments: a department of analysis and characterization of fuel behaviour (SA3C) which comprises four laboratories, a Plutonium, Uranium and Minor Actinides department (SPUA) which comprises four laboratories, a department for the investigation and simulation of fuel behaviour (four laboratories) and the Leca-Star department (3 laboratories and a project group). The authors discuss an assessment of the whole unit activities in terms of strengths and opportunities, aspects to be improved, risks and recommendations, productions and publications on different themes (fundamental research on fuels, fuel design, fabrications, characterizations and property measurements, experimental irradiations, characterization of irradiated fuels and chemical and radio-chemical analysis, modelling and simulation). A more detailed assessment is presented for each theme in terms of scientific quality, influence and attractiveness (awards, recruitment capacity, capacity to obtain financing and to tender, participation to international programs), strategy and governance, and project
37 CFR 1.417 - Submission of translation of international publication.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Submission of translation of... Provisions General Information § 1.417 Submission of translation of international publication. The submission of an English language translation of the publication of an international application pursuant to 35...
48 CFR 231.205-1 - Public relations and advertising costs.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Public relations and... PROCEDURES Contracts With Commercial Organizations 231.205-1 Public relations and advertising costs. (e) See... public relations and advertising costs also include monies paid to the Government associated with the...
A survey of archaeological samples dated in 1987
International Nuclear Information System (INIS)
Mejdahl, V.
1988-10-01
A survey is given of archaeological samples dated in 1987 at the Nordic Laboratory for Thermoluminescence Dating. A total of 74 samples were dated. The results were corrected for short-term fading of feldspars as measured for samples stored at room temperature for four weeks or at 100 deg. C for two weeks. The beta dose from potassium and rubidium in feldspar, and the alpha dose from uranium and thorium in quartz and feldspar were included, assuming alpha efficiency factors of 0.1 for quartz and 0.2 for feldspar. (author) 20 tabs., 29 refs
A survey of archaeological samples dated in 1985
International Nuclear Information System (INIS)
Mejdahl, V.
1986-11-01
A survey is given of archaeological samples received for dating in 1985 at the Nordic Laboratory for Thermoluminescence Dating. A total of 66 samples were dated, 42 of which were burnt stones. All results were corrected for short- term fading as measured for samples stored at room temperature for four weeks. The beta dose from potassium and rubidium in feldspar and the alpha dose from uranium and thorium in quarts and feldspar were included assuming alpha efficiency factors of 0.1 for quartz and 0.2 for feldspar. (author)
A survey of archaeological samples dated in 1986
International Nuclear Information System (INIS)
Mejdahl, V.
1987-10-01
A survey is given of archaeological samples dated in 1986 at the Nordic Laboratory for Thermoluminescence Dating. A total of 56 samples were dated. The results were corrected for shortterm fading measured for samples stored for four weeks at room temperature or at 100 deg. C. The beta dose from potassium and rubidium in feldspar and the alpha dose from uranium and thorium in quartz and feldspar grain were included assuming alpha efficiency factors of 0.1 and 0.2 for quartz and feldspar, respectively. 21 refs. (author)
41 CFR 50-201.1 - The Walsh-Healey Public Contracts Act.
2010-07-01
... Contracts Act. 50-201.1 Section 50-201.1 Public Contracts and Property Management Other Provisions Relating... Walsh-Healey Public Contracts Act. The Walsh-Healey Public Contracts Act, as amended (41 U.S.C. 35-45... making of contracts by the United States.” It is not an act of general applicability to industry. The...
The Middle to Upper Paleolithic transition: dating, stratigraphy, and isochronous markers.
Blockley, S P E; Ramsey, C Bronk; Higham, T F G
2008-11-01
Accurate and precise dating is vital to our understanding of the Middle to Upper Paleolithic transition. There are, however, a number of uncertainties in the chronologies currently available for this period. We attempt to examine these uncertainties by utilizing a number of recent developments in the field. These include: the precise dating of the Campanian Ignimbrite (CI) tephra by 40Ar/39Ar; the tracing of this tephra to a number of deposits that are radiocarbon dated; the publication of revised radiocarbon calibration data for the period, showing a much better convergence with other available data than during the recent IntCal comparison; and a layer-counted ice-core chronology extending beyond 40,000cal BP. Our data comparisons suggest that a reasonable overall convergence between calibrated radiocarbon ages and calendar dates is possible using the new curves. Additionally, we suggest that charcoal-based radiocarbon ages, as well as bone-based radiocarbon determinations, require cautious interpretation in this period. Potentially, these issues extend far beyond the sites in this study and should be of serious concern to archaeologists studying the Middle to Upper Paleolithic. We conclude by outlining a strategy for moving the science forward by a closer integration of archaeology, chronology, and stratigraphy.
International Nuclear Information System (INIS)
Lentfer, C.; Boyd, B.; Torrence, R.
1999-01-01
Full text: Opal phytoliths are microscopic silica bodies formed by the precipitation of hydrated silica dioxide (SiO 2 nH 2 0) in, around and between cell walls. They are relatively resistant to degradation in most environments and thus, can occur in large quantities in palaeosediments. Consequently, they are valuable tools for environmental reconstruction. Furthermore, phytoliths are often the only recoverable organic material in well oxidised sediments, the occluded carbon provides the opportunity for dating sediment whose ages have previously been difficult to determine, and thus, increase the potential for fine resolution determination of environmental change. This poster describes the results of an investigation assessing the viability of AMS radiocarbon dating of fossil phytolith inclusions using samples from Garua Island, West New Britain, PNG. Thirteen phytolith samples, isolated from sediments previously dated using tephrastratigraphy and C14 dating of macroremains of nutshells and wood charcoal, were used in the analysis. As a control measure, thirteen parallel samples of microscopic charcoal were also dated using AMS. The results show that the AMS dates for the microscopic charcoal samples are consistent with ages anticipated from the other dating methods, for all but one sample. However, the dates for eight of the thirteen phytolith samples are considerably younger than expected. This bias could be explained by several factors, including downwashing of phytolith through soils, bioturbation, carbon exchange through the siliceous matrix of the phytolith bodies, and contamination from extraneous sources of modern carbon retained in the samples. Research is currently focusing on the investigation of these issues and selected samples are in the process of being retreated with strong oxidising agents to clear contaminants prior to re-dating. Further to this, a full investigation of one profile with a long sequence is underway. High concentrations of
48 CFR 2131.205-1 - Public relations and advertising costs.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Public relations and... REQUIREMENTS CONTRACT COST PRINCIPLES AND PROCEDURES Contracts With Commercial Organizations 2131.205-1 Public relations and advertising costs. The provisions of FAR 31.205-1 shall be modified to include the following...
75 FR 29817 - Proposed Collection; Comment Request for Publication 1345
2010-05-27
... Publication 1345 AGENCY: Internal Revenue Service (IRS), Treasury. ACTION: Notice and request for comments... Publication 1345, Handbook for Authorized IRS e-file Providers. DATES: Written comments should be received on....gov . SUPPLEMENTARY INFORMATION: Title: Publication 1345, Handbook for Authorized IRS e-file Providers...
Ye, Jing; Niu, Xiaojun; Yang, Yaolong; Wang, Shan; Xu, Qun; Yuan, Xiaoping; Yu, Hanyong; Wang, Yiping; Wang, Shu; Feng, Yue; Wei, Xinghua
2018-01-01
The heading date is a vital factor in achieving a full rice yield. Cultivars with particular flowering behaviors have been artificially selected to survive in the long-day and low-temperature conditions of Northeast China. To dissect the genetic mechanism responsible for heading date in rice populations from Northeast China, association mapping was performed to identify major controlling loci. A genome-wide association study (GWAS) identified three genetic loci, Hd1 , Ghd7 , and DTH7 , using general and mixed linear models. The three genes were sequenced to analyze natural variations and identify their functions. Loss-of-function alleles of these genes contributed to early rice heading dates in the northern regions of Northeast China, while functional alleles promoted late rice heading dates in the southern regions of Northeast China. Selecting environmentally appropriate allele combinations in new varieties is recommended during breeding. Introducing the early indica rice's genetic background into Northeast japonica rice is a reasonable strategy for improving genetic diversity.
Mass spectrometric detection of radiocarbon for dating applications
Energy Technology Data Exchange (ETDEWEB)
Synal, H.-A., E-mail: synal@phys.ethz.ch [ETH Zurich, Laboratory of Ion Beam Physics, Building HPK, 8093 Zurich (Switzerland); Schulze-Koenig, T.; Seiler, M.; Suter, M.; Wacker, L. [ETH Zurich, Laboratory of Ion Beam Physics, Building HPK, 8093 Zurich (Switzerland)
2013-01-15
Radiocarbon is still the most important nuclide measured by accelerator mass spectrometry (AMS). The related capabilities for dating and tracer studies are eminent not only in archaeology but also drive important applications in the earth and environmental sciences as well as in biomedical research. So far, standard mass spectrometric systems have not been capable of radiocarbon dating because of interfering molecular isobars which, however, can be completely eliminated in charge changing processes at high ion beam energies (MeV) [1,2]. Here, we present a novel type mass spectrometry system for radiocarbon analyses. Radiocarbon dating was performed using 45 keV {sup 14}C ions from the ion source and a molecule dissociation unit kept at ground potential. This proof-of-principle experiment demonstrates for the first time the feasibility of mass spectrometric radiocarbon dating without an accelerator. The results obtained will be the basis of an optimized design for a radiocarbon dating instrument comparable in size, complexity and cost to standard mass spectrometers.
Mass spectrometric detection of radiocarbon for dating applications
International Nuclear Information System (INIS)
Synal, H.-A.; Schulze-König, T.; Seiler, M.; Suter, M.; Wacker, L.
2013-01-01
Radiocarbon is still the most important nuclide measured by accelerator mass spectrometry (AMS). The related capabilities for dating and tracer studies are eminent not only in archaeology but also drive important applications in the earth and environmental sciences as well as in biomedical research. So far, standard mass spectrometric systems have not been capable of radiocarbon dating because of interfering molecular isobars which, however, can be completely eliminated in charge changing processes at high ion beam energies (MeV) [1,2]. Here, we present a novel type mass spectrometry system for radiocarbon analyses. Radiocarbon dating was performed using 45 keV 14 C ions from the ion source and a molecule dissociation unit kept at ground potential. This proof-of-principle experiment demonstrates for the first time the feasibility of mass spectrometric radiocarbon dating without an accelerator. The results obtained will be the basis of an optimized design for a radiocarbon dating instrument comparable in size, complexity and cost to standard mass spectrometers.
Mass spectrometric detection of radiocarbon for dating applications
Synal, H.-A.; Schulze-König, T.; Seiler, M.; Suter, M.; Wacker, L.
2013-01-01
Radiocarbon is still the most important nuclide measured by accelerator mass spectrometry (AMS). The related capabilities for dating and tracer studies are eminent not only in archaeology but also drive important applications in the earth and environmental sciences as well as in biomedical research. So far, standard mass spectrometric systems have not been capable of radiocarbon dating because of interfering molecular isobars which, however, can be completely eliminated in charge changing processes at high ion beam energies (MeV) [1,2]. Here, we present a novel type mass spectrometry system for radiocarbon analyses. Radiocarbon dating was performed using 45 keV 14C ions from the ion source and a molecule dissociation unit kept at ground potential. This proof-of-principle experiment demonstrates for the first time the feasibility of mass spectrometric radiocarbon dating without an accelerator. The results obtained will be the basis of an optimized design for a radiocarbon dating instrument comparable in size, complexity and cost to standard mass spectrometers.
Directory of Open Access Journals (Sweden)
Daniel Ferreira da Cunha
2000-06-01
Full Text Available Pressure sores are common among bedridden, elderly, or malnourished patients, and may occur in terminal ill patients because of impaired mobility, fecal or urinary incontinence, and decreased healing capacity. The aim of this study was to compare frequency of pressure sores between malnourished and non-malnourished necropsied adults. METHOD: All (n = 201 adults (age ³ 18 years autopsied between 1986 and 1996 at the Teaching Hospital of Triangulo Mineiro Medical School (Uberaba were eligible for the study. Gender, race, weight, height and main diagnoses were recorded. Ninety-six cases were excluded because of probable body water retention (congestive heart failure, hepatic insufficiency, nephrotic syndrome or pressure sores secondary to peripheral vascular ischemia. Body mass index (BMI was used to define malnourished (BMI 18.5kg/m² groups. RESULTS: Except for weight (42.5kg; range: 28-57 vs. 60; 36-134.5kg and BMI (16.9; range: 12.4-18.5 vs. 22.7; range: 18.5-54.6kg/m², respectively, there were no statistical differences among 43 malnourished and 62 non-malnourished cases in relation to age (54.9 ± 20.4 vs. 52.9 ± 17.9 years, percentage of white persons (74.4 vs. 64.5%, male gender (76.7 vs. 69.3% and main diagnoses. Five malnourished (11.6% and 7 (11.5% non-malnourished cases had pressure sores (p=0.89. CONCLUSION: Pressure sores were equally common findings in necropsied persons with protein-energy malnutrition, as assessed by body mass index.Escaras de decúbito são comuns em pacientes acamados, idosos e subnutridos e podem ocorrer em pacientes terminais devido à imobilidade, incontinência fecal e urinária e imunodepressão. Além disso, a contaminação das Escaras de decúbito aumentam o risco de sepsis e podem piorar o estado nutricional. O objetivo deste estudo foi comparar a freqüência de Escaras de decúbito entre adultos necropsiados com ou sem subnutrição. MÉTODO: Adultos (n=201 necropsiados no Hospital Escola da FMTM
Lawson, Andrew; Cogger, Craig; Bary, Andy; Fortuna, Ann-Marie
2015-01-01
Cover crop benefits include nitrogen accumulation and retention, weed suppression, organic matter maintenance, and reduced erosion. Organic farmers need region-specific information on winter cover crop performance to effectively integrate cover crops into their crop rotations. Our research objective was to compare cover crop seeding mixtures, planting dates, and termination dates on performance of rye (Secale cereale L.) and hairy vetch (Vicia villosa Roth) monocultures and mixtures in the maritime Pacific Northwest USA. The study included four seed mixtures (100% hairy vetch, 25% rye-75% hairy vetch, 50% rye-50% hairy vetch, and 100% rye by seed weight), two planting dates, and two termination dates, using a split-split plot design with four replications over six years. Measurements included winter ground cover; stand composition; cover crop biomass, N concentration, and N uptake; and June soil NO3(-)-N. Rye planted in mid-September and terminated in late April averaged 5.1 Mg ha(-1) biomass, whereas mixtures averaged 4.1 Mg ha(-1) and hairy vetch 2.3 Mg ha(-1). Delaying planting by 2.5 weeks reduced average winter ground cover by 65%, biomass by 50%, and cover crop N accumulation by 40%. Similar reductions in biomass and N accumulation occurred for late March termination, compared with late April termination. Mixtures had less annual biomass variability than rye. Mixtures accumulated 103 kg ha(-1) N and had mean C:N ratio rye, 97 kg ha(-1) for the mixtures, and 119 kg ha(-1) for hairy vetch. Weeds comprised less of the mixtures biomass (20% weeds by weight at termination) compared with the monocultures (29%). Cover crop mixtures provided a balance between biomass accumulation and N concentration, more consistent biomass over the six-year study, and were more effective at reducing winter weeds compared with monocultures.
2017-09-29
The Health Resources and Services Administration (HRSA) administers section 340B of the Public Health Service Act (PHSA), known as the "340B Drug Pricing Program" or the "340B Program." HRSA published a final rule on January 5, 2017, that set forth the calculation of the ceiling price and application of civil monetary penalties. The final rule applied to all drug manufacturers that are required to make their drugs available to covered entities under the 340B Program. On August 21, 2017, HHS solicited comments on further delaying the effective date of the January 5, 2017, final rule to July 1, 2018 (82 FR 39553). HHS proposed this action to allow a more deliberate process of considering alternative and supplemental regulatory provisions and to allow for sufficient time for additional rulemaking. After consideration of the comments received on the proposed rule, HHS is delaying the effective date of the January 5, 2017, final rule, to July 1, 2018.
From mice to men: the evolution of the large, complex human brain
Indian Academy of Sciences (India)
2004-12-15
Dec 15, 2004 ... https://www.ias.ac.in/article/fulltext/jbsc/030/02/0155-0165. Keywords. Galagos; neocortex; primates; somatosensory; vision. Author Affiliations. Jon H Kaas1. Department of Psychology, Vanderbilt University, 301 Wilson Hall, 111, 21st Ave. S, Nashville, TN 37240, USA. Dates. Early published: 15 December ...
From mice to men: the evolution of the large, complex human brain
Indian Academy of Sciences (India)
2004-12-15
Dec 15, 2004 ... http://www.ias.ac.in/article/fulltext/jbsc/030/02/0155-0165. Keywords. Galagos; neocortex; primates; somatosensory; vision. Author Affiliations. Jon H Kaas1. Department of Psychology, Vanderbilt University, 301 Wilson Hall, 111, 21st Ave. S, Nashville, TN 37240, USA. Dates. Early published: 15 December ...
Reflections on Public Health: Captain Hart and Sanitation
Centers for Disease Control (CDC) Podcasts
2006-10-01
This podcast consists of segments of an interview conducted by Capt. Kathleen McDuffie, CDC, with Capt. Russell Hart, a 100 year old retired sanitary engineer of the U.S. Public Health Service Commissioned Corps as he reflects on his work in environmental sanitation and the development of local health departments. The interview was conducted in 2006. Created: 10/1/2006 by Coordinating Center for Health Information and Service (CCHIS), National Center for Health Marketing (NCHM). Date Released: 1/7/2009.
Development of BASIC program for radiocarbon dating
International Nuclear Information System (INIS)
Omoto, Kunio
1982-01-01
The continuous improvement of the system and the needs have produced the successful radiocarbon dating system of today to detect very low energy β-radioactivity. However, it still takes longer than 1,000 minutes for a sample counting. In a gas counting system, it is very difficult to keep the drift of impressed high voltage for a proportional counter less than 5 volts throughout the counting time. The temperature and the characteristics of gas itself also change during experiment. The accumulation of the above drift and errors are closely concerned with the accuracy and reliability of the radiocarbon date. The detection and reduction of the errors are only possible by using a ''fully automatic radiocarbon dating system'' linked to a personal computer system. In this paper, the author presents the BASIC (Beginners All-purpose Symbolic Instruction Code) program for a fully automatic radiocarbon dating system. In this paper, the outline of the system and software development are described. The details of the program include the description for gas-collection, gas-enclosing, plateau counting, β-ray counting, age calculation and data file maintenance. The author wrote numerous remark statements into the program so that it can be understood by users without detailed knowledge of the operation of a personal computer system or of the radiocarbon dating. Using this system, the author found that the radiocarbon dating has greatly progressed in speed and labour-saving, and that the accuracy and reliability of the date itself has also improved much than former manual systems. (Wakatsuki, Y.)
K121Q ENPP1/PC-1 gene polymorphism is associated with insulin ...
Indian Academy of Sciences (India)
2013-12-04
Dec 4, 2013 ... ciation of ENPP1/PC-1 K121Q polymorphism with obesity ... vided history of previously diagnosed diabetes or the fasting blood glucose was ≥ 126 ... Mean values of continuous traits were compared using the. Student's t-test ...
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. S K Date. Articles written in Bulletin of Materials Science. Volume 23 Issue 2 April 2000 pp 97-101 Magnetic Materials. Comparison of the irreversible thermomagnetic behaviour of some ferro- and ferrimagnetic systems · P S Anil Kumar P A Joy S K Date · More Details Abstract ...
History of dating violence and the association with late adolescent health
2013-01-01
Background The present investigation expands upon prior studies by examining the relationship between health in late adolescence and the experience of physical/sexual and non-physical dating violence victimization, including dating violence types that are relevant to today’s adolescents (e.g., harassment via email and text messaging). We examined the relationship between physical/sexual and non-physical dating violence victimization from age 13 to 19 and health in late adolescence/early adulthood. Methods The sample comprised 585 subjects (ages 18 to 21; mean age, 19.8, SD = 1.0) recruited from The Ohio State University who completed an online survey to assess: 1) current health (depression, disordered eating, binge drinking, smoking, and frequent sexual behavior); and 2) dating violence victimization from age 13 to 19 (retrospectively assessed using eight questions covering physical, sexual, and non-physical abuse, including technology-related abuse involving stalking/harassment via text messaging and email). Multivariable models compared health indicators in never-exposed subjects to those exposed to physical/sexual or non-physical dating violence only. The multivariable models were adjusted for age and other non-dating abuse victimization (bullying; punched, kicked, choked by a parent/guardian; touched in a sexual place, forced to touch someone sexually). Results In adjusted analyses, compared to non-exposed females, females with physical/sexual dating violence victimization were at increased risk of smoking (prevalence ratio = 3.95); depressive symptoms (down/hopeless, PR = 2.00; lost interest, PR = 1.79); eating disorders (using diet aids, PR = 1.98; fasting, PR = 4.71; vomiting to lose weight, PR = 4.33); and frequent sexual behavior (5+ intercourse and oral sex partners, PR = 2.49, PR = 2.02; having anal sex, PR = 2.82). Compared to non-exposed females, females with non-physical dating violence only were at increased risk of smoking (PR = 3
78 FR 68431 - Combined Notice of Filings #1
2013-11-14
... Company's Petition for Limited Waiver. Filed Date: 11/4/13. Accession Number: 20131104-5152. Comments Due.... ET 11/26/13. Docket Numbers: ER14-313-000. Applicants: Public Service Company of New Hampshire. Description: Public Service Company of New Hampshire submits Cancellation of LCRA with CMEEC to be effective 1...
78 FR 23980 - Proposed Collection; Comment Request for Publication 1075
2013-04-23
... Publication 1075 AGENCY: Internal Revenue Service (IRS), Treasury. ACTION: Notice and request for comments... Publication 1075, Tax Information Security Guidelines for Federal, State, and Local Agencies. DATES: Written... copies of the publication should be directed to Allan Hopkins at Internal Revenue Service, Room 6129...
76 FR 44660 - Proposed Collection; Comment Request for Publication 3319
2011-07-26
... Publication 3319 AGENCY: Internal Revenue Service (IRS), Treasury. ACTION: Notice and request for comments... Publication 3319, Low-Income Taxpayer Clinics 2012 Grant Application Package and Guidelines. DATES: Written... or copies of publication should be directed to Joel Goldberger, at (202) 927-9368, or at Internal...
Functional studies of heading date-related gene TaPRR73, a paralog of Ppd1 in common wheat
Directory of Open Access Journals (Sweden)
Wenping eZhang
2016-06-01
Full Text Available Photoperiod response-related genes play a crucial role in duration of the plant growth. In this study, we focused on TaPRR73, a paralog of Green Revolution gene Ppd1 (TaPRR37. We found that overexpression of the truncated TaPRR73 form lacking part of the N-terminal PR domain in transgenic rice promoted heading under long day conditions. Association analysis in common wheat verified that TaPRR73 was an important agronomic photoperiod response gene that significantly affected heading date and plant height; expression analysis proved that specific alleles of TaPRR73-A1 had highly expressed levels in earlier heading lines; the distribution of haplotypes indicated that one of these alleles had been selected in breeding programs. Our results demonstrated that TaPRR73 contributed to regulation of heading date in wheat and could be useful in wheat breeding and in broadening adaptation of the crop to new regions.
Dating ancient monuments by nuclear radiation
International Nuclear Information System (INIS)
Goedicke, C.
2000-01-01
In the fifties and sixties several disciplines dealing with chronologies but lacking precise methods of measurements (geology, biology, archaeology and art history) became aware of the radioactive decay as a tool of measuring elapsed time. Among the disciplines that benefit most from physical methods archaeology has to be named first. So was archaeological work revolutionised by the introduction of the C-14 dating method. A wider selection of material became datable after the introduction of luminescence techniques using the effect of nuclear radiation on semiconductors. These minerals are widespread among archaeological materials. In ancient monuments, the objective of this paper, semiconductors almost exclusively form the material basis. Over the last four millennia wood, stone, mortar and fired bricks have been used for the construction of buildings. After discussing methods taking wood as a dating material, a broader view will be given on the results achieved by luminescence dating of fired bricks, mortar and stone. For many years brick dating was performed by thermoluminescence, the recipes followed those of ceramic dating. Preferably multiple aliquot additive dose protocols were used on polymineral fine grain fractions (1-10 μm). It was expected that the error in dating monuments would be smaller compared to ceramic dating, because of the constancy of the environmental conditions which a brick experiences during its lifetime. However, the variability of firing temperatures in brick kilns overthrows this advantage. Therefore, the demands of art historians to fall short of an error margin of 5% could generally not be fulfilled. Especially in medieval or renaissance times the temporal resolution of thermoluminescence is inferior to traditional stylistic dating as long as specific stylistic forms are present. New optical luminescence techniques and a new philosophy of dose evaluation, based on single aliquot regeneration protocols, produce less scatter, and in
Inflorescence rot disease of date palm is caused by Fusarium ...
African Journals Online (AJOL)
Zulfiqar-Ali
2012-05-01
May 1, 2012 ... Key words: Fusarium proliferatum, ITS1, ITS4, pathogenecity, PCR, isolates, phylogeny. INTRODUCTION. Date palm (Phoenix dactylifera L.) is one of the important income sources for many farmers in different parts of. Iraq, Iran and North Africa. Date palm trees are infected by several pathogens like fungi, ...
Teen Dating Violence and Substance Use Following a Natural Disaster: Does Evacuation Status Matter?
Temple, Jeff R.; van den Berg, Patricia; Thomas, John F. “Fred”; Northcutt, James; Thomas, Christopher; Freeman, Daniel H.
2012-01-01
Objectives In September of 2008 the Texas coast was directly hit by Hurricane Ike. Galveston was flooded by 14 feet of storm surge, affecting most of the Island’s housing and infrastructure. The purpose of the present study is to examine whether youth who did not evacuate (11%), and subsequently were exposed to Hurricane Ike, exhibit higher rates of substance use and physical and sexual teen dating violence (both perpetration and victimization), relative to adolescents who did evacuate. Setting Public high school in southeast Texas that was in the direct path of Hurricane Ike. Participants An anonymous survey was administered in March 2009 to 1,048 high-school students who returned to Galveston post-storm (41% Hispanic, 23% African-American, 27% White). Main Outcome Measures Teen dating violence and substance use. Results Mantel-Haenszel odds ratios, adjusting for age and ethnicity, were computed. Compared to boys who evacuated, non-evacuating boys were more likely to perpetrate physical dating violence and sexual assault, and to be a victim of sexual assault. Non-evacuating boys and girls were more likely than those who did evacuate to report recent use of excessive alcohol, marijuana, and cocaine. Conclusions School personnel, medical personnel, and mental health service providers should consider screening for evacuation status in seeking to identify those adolescents who most need services after a natural disaster. Further, in addition to addressing internalized emotions and psychological symptoms associated with experiencing trauma, intervention programs should focus on reducing externalized behavior such as substance use and teen dating violence. PMID:22010597
Optimization of oil extraction from waste “Date pits” for biodiesel production
International Nuclear Information System (INIS)
Jamil, Farrukh; Al-Muhtaseb, Ala’a H.; Al-Haj, Lamya; Al-Hinai, Mohab A.; Hellier, Paul; Rashid, Umer
2016-01-01
Highlights: • Oil extraction from “Date pits” has been optimized first time by using RSM. • Optimized conditions for oil extraction gave oil yield of 16.5%. • “Date pits” oil as non-edible feedstock was transformed to biodiesel. • Biodiesel from “Date pits” oil posses potential fuel properties. - Abstract: Biodiesel produced from non-edible feedstocks is increasingly attractive alternative to both fossil diesels and renewable fuels derived from food crops. Date pits are one such lipid containing feedstock, and are widely available in Oman as a waste stream. This study analyses the effects of soxhlet process parameters (temperature, solvent to seed ratio and time) on the extraction of oils from waste Date pits and the subsequent production of biodiesel from it. The highest yield of oil extracted from the Date pits was 16.5 wt% obtained at a temperature of 70 °C, solvent to seed ratio of 4:1 and extraction duration of 7 h. Gas Chromatography analysis showed that Date pits oil consisted of 54.85% unsaturated fatty acids (UFA). Transesterification of the oil extracted was undertaken at 65 °C, a methanol to oil ratio of 6:1 and a reaction time of 1 h for biodiesel production. Biodiesel produced from the Date pits oil was found to have a cetane number of 58.23, density 870 of kg m"−"3, cloud point of 4 °C, pour point of −1 °C, CFPP of −0.5 °C and kinematic viscosity of 3.97 mm"2 s"−"1 (40 °C). In general, Date pit oil appears to be a potential alternative feedstock for biodiesel production.
QTLs for heading date and plant height under multiple environments in rice.
Han, Zhongmin; Hu, Wei; Tan, Cong; Xing, Yongzhong
2017-02-01
Both heading date and plant height are important traits related to grain yield in rice. In this study, a recombinant inbred lines (RILs) population was used to map quantitative trait loci (QTLs) for both traits under 3 long-day (LD) environments and 1 short-day (SD) environment. A total of eight QTLs for heading date and three QTLs for plant height were detected by composite interval mapping under LD conditions. Additional one QTL for heading date and three QTLs for plant height were identified by Two-QTL model under LD conditions. Among them, major QTLs qHd7.1, qHd7.2 and qHd8 for heading date, and qPh1 and qPh7.1 for plant height were commonly detected. qHd7.1 and qHd7.2 were mapped to small regions of less than 1 cM. Genome position comparison of previously cloned genes with QTLs detected in this study revealed that qHd5 and qPh3.1 were two novel QTLs. The alleles of these QTLs increasing trait values were dispersed in both parents, which well explained the transgressive segregation observed in this population. In addition, the interaction between qHd7.1 and qHd8 was detected under all LD conditions. Multiple-QTL model analysis revealed that all QTLs and their interactions explained over 80% of heading date variation and 50% of plant height variation. Two heading date QTLs were detected under SD condition. Of them, qHd10 were commonly identified under LD condition. The difference in QTL detection between LD and SD conditions indicated most heading date QTLs are sensitive to photoperiod. These findings will benefit breeding design for heading date and plant height in rice.
Fiscal Year 2006 Salary Report for the Illinois Public Community Colleges
Illinois Community College Board, 2006
2006-01-01
Data about compensation received by employees in Illinois' 48 Illinois public community colleges are gathered by the Illinois Community College Board (ICCB). Data in the Fiscal Year 2006 Salary Report reflect the census date of October 1, 2005. Data are presented by peer groups with statewide totals. Most of the 25 tables in this report contain…
76 FR 24959 - Notification of Citizens Coinage Advisory Committee, Public Meeting
2011-05-03
... scheduled for May 25, 2011. Date: May 25, 2011. Time: 9 a.m. to 1 p.m. Location: Conference Room A, United States Mint, 801 9th Street, NW., Washington, DC 20220. Subject: Review and consideration of candidate... 9th Street, NW.; Washington, DC 20220; or call 202-354-7200. Any member of the public interested in...
Bravo-Ayala, Manuel; Camps, Pierre; Alva-Valdivia, Luis; Poidras, Thierry; Nicol, Patrick
2014-05-01
The Xitle volcano, located south of Mexico City, is a monogenic volcano that has provided seven lava flows in a time interval of a few years. The age of these eruptions, estimated by means of radiocarbon dates on charcoal from beneath the flows, is still very poorly known, ranging from 4765±90 BC to 520±200 AD (see Siebe, JVGR, 2000 for a review). This lava field was emplaced over the archaeological city of Cuicuilco whose occupation is estimated between 700 BC and 150 AD. Thus a question is still pending: Is the downfall of Cuicuilco directly attributable to the eruption of Xitle? It seems that the answer is negative if we consider the latest radiocarbon dating by Siebe (2000), which sets the age of the eruption to 280±35 AD, that is significantly younger to the abandon of the city. Because this new age has direct implications on the history of the movements of ancient populations in the Central Valley of Mexico, we propose in the present study to check this estimate by archaeomagnetic dating. Xitle lava have been investigated several times for paleomagnetism, including directional analyses and absolute paleointensity determinations (see Alva, EPS, 57, 839-853, 2005 for a review). The characteristic Remanence direction is precisely determined. It is much more difficult to estimate precisely the paleointensity with the Thellier method: values scatter between 40 and 90 μT in a single flow (Alva, 2005). We propose here to estimate the paleointensity by means of the MSP-DSC protocol (Fabian and Leonhardt, 2010) with the new ultra-fast heating furnace FUReMAG developed in Montpellier (France). The sampling was performed along four profiles, one vertical through the entire thickness of the flow and three horizontal (at the top, middle and the bottom of the flow). Our preliminary results show that there is no difference between the values found in the different profiles, all providing a value around 62 μT. The comparison of our results (Dec = 359.0°, Inc = 35.2
2013-01-07
.... to 4:00 p.m. (Eastern Time). ADDRESSES: The CASAC Lead Review Panel face-to-face public meeting will... Quality Standards (First External Review Draft--January 2013). DATES: The CASAC Lead Review Panel face-to-face public meeting will be held on Tuesday, February 5, 2013, from 8:30 a.m. to 5:30 p.m. (Eastern...
42 CFR 456.128 - Initial continued stay review date.
2010-10-01
... norms to assign the initial continued stay review date, the number of days between the individual's... and criteria required to be described under § 456.129; (2) The individual's condition; and (3) The individual's projected discharge date; (c)(1) The committee uses any available appropriate regional medical...
2013-02-15
... for relevant studies published between the application deadline and the public meeting date, in which... include but are not limited to, alcoholic beverages, illegal narcotics, explosives, firearms or other...
Direct and indirect dating of gypsum occurrences in deserts using luminescence methods
International Nuclear Information System (INIS)
Nagar, Y.C.; Juyal, N.; Singhyi, A.K.; Kocurek, G.; Wadhawan, S.K.
2005-01-01
In the present study we have made an attempt to directly date gypsum or provide indirect age estimate for gypsum formation through dating the associated sediments (quartz) using the luminescence dating technique. In the direct dating of gypsum, we explored the Optically Stimulated Luminescence (OSL) and Thermally Stimulated Luminescence (TL) behaviour of gypsum. The associated sediments (indirect dating) were dated using the traces of quartz extract from gypsum (concentration 0.1% ) and the underlying and overlying quartz sand in playa
Lanting, JN; Aerts-Bijma, AT; van der Plicht, J; Boaretto, E.; Carmi, I.
2001-01-01
When dating unburnt bone, bone collagen, the organic fraction of the bone, is used. Collagen does not survive the heat of the cremation pyre, so dating of cremated bone has been considered impossible. Structural carbonate in the mineral fraction of the bone, however, survives the cremation process. We developed a method of dating cremated bone by accelerator mass spectrometry (AMS), using this carbonate fraction. Here we present results for a variety of prehistoric sites and ages, showing a r...
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Definitions. 172.1 Section 172.1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS EXPERIMENTAL USE... efficacious action on a pest. [73 FR 75599, Dec. 12, 2008] ...
Using microwaves in Disinsection of dates
International Nuclear Information System (INIS)
Zouba, Anis
2008-01-01
The date palm plays a very significant role in Tunisia in term of culture as well as social, economic and ecological aspects. The production of the dates which is estimated to 120.000 tons/year ensures the principal income for the majority of the oasis population of the South of Tunisia and constitutes the basis for agricultural, industrial, commercial and tourist activities, offering million of working days. The date palm is cultivated mainly for the production of dates which are consumed locally or also exported abroad but for its by-products (food of the cattle, wind breaks, fuel, construction) which are marketed and/ or used in the everyday life thus taking part in the sedentarisation of the populations and the maintenance of a fragile socio-economic balance. The date moth, Ectomyelois ceratoniae Zell. ( L will epidoptera, Pyralidae) is without question the most significant problem of the Tunisian date palm. The infestation of dates in the field and in the storage and packing houses enormously depreciates the marketable quality of dates and risk to compromise exports in particular those of the variety Deglet Nour. rates of infestations of about 20% are often recorded in Tunisia where as the European standards require rates lower than 5%. In Tunisia the desinsectisation of dates is done until now by the use of methyl bromide, its high toxicity substantially reduces the duration of date treatment, and consequently the treated volumes. The replacement of this product becomes an urgent need its use will not be authorized by 2015. Within the framework of a agreement between the Regional Research Center in Oasis Agriculture (CRRAO), The Interprofessional Grouping of Fruits (GIF), and the Italian Company IMETEC, the use one of micro-waves as a desinsectisation method of dates was evaluated. The results of this present work showed that total desinsectisation of dates by microwaves can be obtained only with homogeneous dates in term of water content. Total