2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false May a tribe integrate Job Placement and Training funds... THE INTERIOR HUMAN SERVICES JOB PLACEMENT AND TRAINING PROGRAM General Applicability § 26.22 May a tribe integrate Job Placement and Training funds into its Public Law 102-477 Plan? Yes, Indian tribes...
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Is the Fire Administration Authorization Act of 1992 (Public Law 102-522) relevant to fire protection engineering? 102-80.90 Section 102-80.90 Public Contracts and Property Management Federal Property Management Regulations System...
2010-10-01
... presenting proposed findings and conclusions, the administrative law judge shall make findings of fact and... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Findings of fact and decision by... Grazing Districts) § 4.477 Findings of fact and decision by administrative law judge: Notice; submission...
2010-01-01
... of the People's Republic of China under Public Law 102-404. 1245.9 Section 1245.9 Aliens and Nationality EXECUTIVE OFFICE FOR IMMIGRATION REVIEW, DEPARTMENT OF JUSTICE IMMIGRATION REGULATIONS ADJUSTMENT... nationals of the People's Republic of China under Public Law 102-404. (a) Principal applicant status. All...
2010-01-01
... of the People's Republic of China under Public Law 102-404. 245.9 Section 245.9 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS TO THAT OF PERSON... of China under Public Law 102-404. (a) Principal applicant status. All nationals of the People's...
7 CFR 1900.102 - Applicable law.
2010-01-01
... 7 Agriculture 12 2010-01-01 2010-01-01 false Applicable law. 1900.102 Section 1900.102 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... GENERAL Applicability of Federal Law § 1900.102 Applicable law. Loans made by FmHA or its successor agency...
41 CFR 102-75.765 - What does the term “law enforcement” mean?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What does the term âlaw enforcementâ mean? 102-75.765 Section 102-75.765 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 75-REAL PROPERTY DISPOSAL Surplus Real Property Disposal...
41 CFR 102-75.270 - Must antitrust laws be considered when disposing of property?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Must antitrust laws be...-REAL PROPERTY DISPOSAL Surplus Real Property Disposal Applicability of Antitrust Laws § 102-75.270 Must antitrust laws be considered when disposing of property? Yes, antitrust laws must be considered in any case...
26 CFR 509.102 - Applicable provisions of law.
2010-04-01
... 26 Internal Revenue 19 2010-04-01 2010-04-01 false Applicable provisions of law. 509.102 Section... UNDER TAX CONVENTIONS SWITZERLAND General Income Tax § 509.102 Applicable provisions of law. (a) General... reason of any alteration of law in relation to internal revenue. (b) Retroactivity of regulations or...
31 CFR 800.102 - Effect on other law.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Effect on other law. 800.102 Section... TAKEOVERS BY FOREIGN PERSONS General § 800.102 Effect on other law. Nothing in this part shall be construed..., or review provided by or established under any other provision of federal law, including the...
2010-04-01
... provided by law, the Bureau nor a tribe may change eligibility criteria or levels of payment for Burial Assistance, Child Assistance, Disaster Assistance, and Emergency Assistance awarded in Public Law 93-638 contracts, Public Law 102-477 grants, or Public Law 103-413 self-governance annual funding agreements. ...
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Publication. 152.102 Section 152.102 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS PESTICIDE REGISTRATION AND CLASSIFICATION PROCEDURES Agency Review of Applications § 152.102 Publication. The Agency will...
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false May we transfer or donate canines that have been used in the performance of law enforcement duties? 102-36.365 Section 102-36.365 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL...
2010-10-01
...-269A to BIA. (b) Information regarding program and financial operations of a NEW Program administered... 45 Public Welfare 2 2010-10-01 2010-10-01 false What are the data collection and reporting... EMPLOYMENT WORKS (NEW) PROGRAM Data Collection and Reporting Requirements § 287.165 What are the data...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Public Index. 102.9 Section 102.9 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RECORD DISCLOSURE AND PRIVACY Disclosure of... latest edition of SOP 40 03 from SBA's Online Reading Room at http://www.sba.gov/library or by requesting...
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLC477 (Link to dictyBase) - - - Contig-U16260-1 SLC477Z (Link... to Original site) - - SLC477Z 326 - - - - Show SLC477 Library SL (Link to library) Clone ID SLC477 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC477Q.Seq.d/ Representative seq. ID SLC47...7Z (Link to Original site) Representative DNA sequence >SLC477 (SLC477Q) /CSM/SL/SLC4-D/SLC477Q.Seq.d/ XXXXX...hfefsnivikskkkkkkkkkkkkkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLC477 (SLC4
75 FR 24959 - Proposed Information Collection Activity: Comment Request
2010-05-06
... the Interior with a copy to the Administration for Children and Families (ACF). Respondents: All... DEPARTMENT OF HEALTH AND HUMAN SERVICES Administration for Children and Families Proposed... Department of the Interior by means of an 1151 as required by Public Law 102-477--Action. The collection of...
14 CFR 221.102 - Accessibility of tariffs to the public.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Accessibility of tariffs to the public. 221.102 Section 221.102 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION... Inspection § 221.102 Accessibility of tariffs to the public. Each file of tariffs shall be kept in complete...
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHK477 (Link to dictyBase) - - - Contig-U11536-1 VHK477P (Link... to Original site) VHK477F 685 VHK477Z 794 VHK477P 1459 - - Show VHK477 Library VH (Link to library) Clone ID VHK477 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11536-1 Original site URL http://dict...QIGTYSFEGKFIKKAIINGNRIVTINN KLLNENQLNSNSTITKEKDSSNQLSSFISIEIPHYDSNVLLDPSFSVLLDSNESYKNSEN SICTSKKSSKLTTAQIIAI...NQLSSFISIEIPHYDSNVLLDPSFSVLLDSNESYKNSEN SICTSKKSSKLTTAQIIAIVIVSVVFVIILALFIIVKFSKS
13 CFR 102.2 - Public reading rooms.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Public reading rooms. 102.2 Section 102.2 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RECORD DISCLOSURE AND PRIVACY... described in paragraph (a) of this section are available in the SBA Online Reading Room at http://www.sba...
2010-07-01
... applicability of antitrust laws? 102-75.280 Section 102-75.280 Public Contracts and Property Management Federal... PROPERTY DISPOSAL Surplus Real Property Disposal Applicability of Antitrust Laws § 102-75.280 What... the applicability of antitrust laws? The disposal agency must promptly provide the Attorney General...
41 CFR 102-37.520 - What is the authority for public airport donations?
2010-07-01
... for public airport donations? 102-37.520 Section 102-37.520 Public Contracts and Property Management... 37-DONATION OF SURPLUS PERSONAL PROPERTY Donations to Public Airports § 102-37.520 What is the authority for public airport donations? The authority for public airport donations is 49 U.S.C. 47151. 49 U...
The incorporation of public international law into municipal law and ...
African Journals Online (AJOL)
Monism and dualism represent two different approaches towards the relationship between public international law and municipal law. While the former views public international law and municipal law as a single legal system, the latter regards these two areas of law as separate and distinct legal systems that exist ...
von Bogdandy, A.; Goldmann, M.; Venzke, I.
This article argues that increasing demands in world public opinion for legitimate and effective international institutions require a paradigm shift in public international law. There is a part of public international law that should be better understood as international public law because it
41 CFR 102-38.130 - Must we publicly advertise sales of Federal personal property?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Must we publicly advertise sales of Federal personal property? 102-38.130 Section 102-38.130 Public Contracts and Property... PROPERTY 38-SALE OF PERSONAL PROPERTY Sales Process Advertising § 102-38.130 Must we publicly advertise...
41 CFR 102-37.565 - What is the authority for donations to public bodies?
2010-07-01
... for donations to public bodies? 102-37.565 Section 102-37.565 Public Contracts and Property Management... 37-DONATION OF SURPLUS PERSONAL PROPERTY Donations to Public Bodies in Lieu of Abandonment/Destruction § 102-37.565 What is the authority for donations to public bodies? Section 527 of title 40, United...
2010-07-01
... and Transfer of Case to the Board § 102.45 Administrative law judge's decision; contents; service... administrative law judge's decision and of the order transferring the case to the Board shall be complete upon... 29 Labor 2 2010-07-01 2010-07-01 false Administrative law judge's decision; contents; service...
2010-07-01
... Expenses § 102.153 Administrative law judge's decision; contents; service; transfer of case to the Board... administrative law judge's decision and of the order transferring the case to the Board shall be complete upon... 29 Labor 2 2010-07-01 2010-07-01 false Administrative law judge's decision; contents; service...
Recent publications on environmental law
International Nuclear Information System (INIS)
Lohse, S.
1991-01-01
The bibliography contains references to publications covering the following subject fields: General environmental law; environmental law in relation to constitutional law, administrative law, procedural law, revenue law, criminal law, private law, industrial law; law of regional development; nature conservation law; law on water protection; waste management law; law on protection against harmful effects on the environment; atomic energy law and radiation protection law; law of the power industry and the mining industry; laws and regulations on hazardous material and environmental hygiene. (orig.) [de
Meier, Benjamin Mason; Hodge, James G; Gebbie, Kristine M
2009-03-01
Given the public health importance of law modernization, we undertook a comparative analysis of policy efforts in 4 states (Alaska, South Carolina, Wisconsin, and Nebraska) that have considered public health law reform based on the Turning Point Model State Public Health Act. Through national legislative tracking and state case studies, we investigated how the Turning Point Act's model legal language has been considered for incorporation into state law and analyzed key facilitating and inhibiting factors for public health law reform. Our findings provide the practice community with a research base to facilitate further law reform and inform future scholarship on the role of law as a determinant of the public's health.
2010-07-01
... DISABILITIES Disability Ratings The Organs of Special Sense § 4.77 Visual fields. (a) Examination of visual... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Visual fields. 4.77... who are well adapted to intraocular lens implant or contact lens correction, visual field examinations...
Recent publications on environmental law
International Nuclear Information System (INIS)
Lohse, S.
1988-01-01
The bibliography contains 1235 references to publications covering the following subject fields: general environmental law; environmental law in relation to constitutional law, administrative law, procedural law, revenue law, criminal law, private law, industrial law; law of regional development; nature conservation law; law on water protection; waste management law; law on protection against harmful effects on the environment; atomic energy law and radiation protection law; law of the power industry and the mining industry; laws and regulations on hazardous material and environmental hygiene. (HP) [de
Recent publications on environmental law
International Nuclear Information System (INIS)
Lohse, S.
1989-01-01
The bibliography contains 1160 references to publications covering the following subject fields: General environmental law; environmental law in relation to constitutional law, administrative law, procedural law, revenue law, criminal law, private law, industrial law; law of regional development; nature conservation law; law on water protection; waste management law; law on protection against harmful effects on the environment; atomic energy law and radiation protection law; law of the power industry and the mining industry; laws and regulations on hazardous material and environmental hygiene. (orig./HP) [de
Private Arbitration of Incidental Public Law Issues
DEFF Research Database (Denmark)
Werlauff, Erik
2009-01-01
The article discusses the incidental public law issues which can arise in an arbitration case, e.g. concerning power, heating, natural gas and other public facility legislation, national or Community legal restrictive trade practices law, and rules on state administration approval of the terms...... by arbitration, and where the award is nullifiable only if its findings are in violation of public policy, the ordre public. The article relies on UNCITRAL's Model Arbitration Law, the new Danish arbitration act (DAA), national European case law, and literature and case law of the European Court....
41 CFR 102-37.560 - What is a public body?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is a public body... PROPERTY Donations to Public Bodies in Lieu of Abandonment/Destruction § 102-37.560 What is a public body? A public body is any department, agency, special purpose district, or other instrumentality of a...
NATIONAL PUBLIC LAW IS BACK, EUROPEAN LAW DISAPPEARS?
Directory of Open Access Journals (Sweden)
MARIUS VACARELU
2012-05-01
Full Text Available Analyzing the last two years main titles in daily press, we discover not only great economic problems inside the EU, but also big concerns about the future of EU, when a lot of states are victims of their public debt. For this big deficit, only national budget was good to help, at European level money are missing. In this idea, the concept: “EU with two speeds” really appears, and every government is forced today to have a position. But on this case, a good part of European laws are menaced by the national law coming back – it must be a legal system able to replace the holes, because every human situation must be regulated by a kind of law. In fact, last years discovered why a lot of political constructions are made only of “perfect papers”, not according with the reality. In this case, when integrationist plans are rejected by the reality, only the national states and the national public law are forced to intervene and to support the fury. Our text try to analyze where is the limit of EU law appliance in this case and how much national law will come back.
2010-07-01
... the Department of the Interior have if it determines that minerals in the land are unsuitable for disposition under the public land mining and mineral leasing laws? 102-75.105 Section 102-75.105 Public... Interior have if it determines that minerals in the land are unsuitable for disposition under the public...
Rediscovering Principles of Public Administration: The Neglected Foundation of Public Law.
Moe, Ronald C.; Gilmour, Robert S.
1995-01-01
Public administration is at risk of losing its theoretical distinctiveness based on public law, leaving it vulnerable to advocates of the entrepreneurial management model. Administrative principles rooted in law can accommodate useful contemporary management concepts without compromising accountable public sector management. (SK)
International health law : an emerging field of public international law
Toebes, Brigit
This article discusses the nature and scope of international health law as an emerging field of public international law. It is argued that the protection of health reflects a pressing social need that should now be spoken of in the vocabulary of international law. Furthermore, there is an urgent
49 CFR 192.477 - Internal corrosion control: Monitoring.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Internal corrosion control: Monitoring. 192.477... Control § 192.477 Internal corrosion control: Monitoring. If corrosive gas is being transported, coupons... internal corrosion. Each coupon or other means of monitoring internal corrosion must be checked two times...
Transnational Law of Public Contracts
Audit, M.; Schill, S.W.
2016-01-01
Public contracts were traditionally conceived as instruments of domestic public law and used within markets confined to the territory of the state party to the contract. Globalization, however, subjects public contracting to an increasing number of processes that take place at a transnational level
41 CFR 102-38.135 - What constitutes a public advertisement?
2010-07-01
... enough in advance of the sale to ensure adequate notice, and to target your advertising efforts toward... OF PERSONAL PROPERTY Sales Process Advertising § 102-38.135 What constitutes a public advertisement... personal property to be sold is considered public advertising. You may also distribute mailings or flyers...
2010-07-01
... restrictions on Federal agencies concerning property donations to public bodies? 102-75.1015 Section 102-75... Donation to Public Bodies Restrictions § 102-75.1015 Are there any restrictions on Federal agencies concerning property donations to public bodies? Yes, Federal agencies must obtain prior concurrence of GSA...
International law, constitutional law, and public support for torture
Directory of Open Access Journals (Sweden)
Adam S Chilton
2016-03-01
Full Text Available The human rights movement has spent considerable energy developing and promoting the adoption of both international and domestic legal prohibitions against torture. Empirical scholarship testing the effectiveness of these prohibitions using observational data, however, has produced mixed results. In this paper, we explore one possible mechanism through which these prohibitions may be effective: dampening public support for torture. Specifically, we conducted a survey experiment to explore the impact of international and constitutional law on public support for torture. We found that a bare majority of respondents in our control group support the use of torture, and that presenting respondents with arguments that this practice violates international law or constitutional law did not produce a statistically significant decrease in support. These findings are consistent with prior research suggesting, even in democracies, that legal prohibitions on torture have been ineffective.
Legislating tolerance: Spain's national public smoking law.
Muggli, Monique E; Lockhart, Nikki J; Ebbert, Jon O; Jiménez-Ruiz, Carlos A; Riesco Miranda, Juan Antonio; Hurt, Richard D
2010-02-01
While Spain's national tobacco control legislation prohibits smoking in many indoor public places, the law provides for an exception to the prohibition of smoking by allowing separate seating sections and ventilation options in certain public places such as bars and restaurants, hotels and airports. Accordingly, Spain's law is not aligned with Article 8 Guidelines of the World Health Organization's Framework Convention on Tobacco Control, which requires parties to ensure universal protection against secondhand smoke exposure in all enclosed public places, workplaces and on all means of public transport. Spain's law is currently being promoted by the tobacco companies in other countries as a model for smoke-free legislation. In order to prevent weakening of smoke-free laws in other countries through industry-supported exceptions, we investigated the tactics used by the tobacco companies before the implementation of the new law and assessed the consequences of these actions in the hospitality sector. Internal tobacco industry documents made public through US litigation settlements dating back to the 1980s were searched in 2008-9. Documents show that tobacco companies sought to protect hospitality venues from smoking restrictions by promoting separate seating for smokers and ineffective ventilation technologies, supporting an unenforceable voluntary agreement between the Madrid local government and the hospitality industry, influencing ventilation standards setting and manipulating Spanish media. The Spanish National Assembly should adopt comprehensive smoke-free legislation that does not accommodate the interests of the tobacco industry. In doing so, Spain's smoke-free public places law would be better aligned with the Framework Convention on Tobacco Control.
Double Taxation Agreements: Between EU Law and Public International Law
Hofmann, Herwig
2011-01-01
After the first drafts of the Treaty of Lisbon were available outside of the small circle of cogniscenti, specialists of the various policies tried to establish whether the new Treaty on European Union (TEU) and Treaty on the Functioning of the European Union (TFEU) contained anything relevant for their specific areas of law. People interested in tax law and those interested in the relation between EU law and public international law quickly established that one familiar yet not always well u...
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Who must the Office of Justice Programs (OJP) and the Federal Emergency Management Agency (FEMA) notify that surplus real property is available for correctional facility, law enforcement, or emergency management response purposes? 102-75.760 Section 102-75.760 Public...
2010-07-01
... sell tobacco products in vending machines in Government-owned and leased space? 102-74.75 Section 102... Services § 102-74.75 May Federal agencies sell tobacco products in vending machines in Government-owned and leased space? No. Section 636 of Public Law 104-52 prohibits the sale of tobacco products in vending...
48 CFR 30.102 - Cost Accounting Standards Board publication.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Cost Accounting Standards... REGULATION GENERAL CONTRACTING REQUIREMENTS COST ACCOUNTING STANDARDS ADMINISTRATION General 30.102 Cost Accounting Standards Board publication. Copies of the CASB Standards and Regulations are printed in title 48...
Encyclopedia of Public International Law, 7 / Henn-Jüri Uibopuu
Uibopuu, Henn-Jüri, 1929-2012
1985-01-01
Tutvustus.: Encyclopedia of Public International Law, published under the Auspices of the Max-Planck-Institute for Comparative Public Law and International Law under the Direction of Rudolf Bernhardt. (7. History of International Law. Foundations and Principles of International Law. Sources of International Law. Law of Treaties). Amsterdam, New York, Oxford: North-Holland Publishing Company, 1984
Development of an online tool for public health: the European Public Health Law Network.
Basak, P
2011-09-01
The European Public Health Law Network was established in 2007 as part of the European Union (EU) co-funded Public Health Law Flu project. The aims of the website consisted of designing an interactive network of specialist information and encouraging an exchange of expertise amongst members. The website sought to appeal to academics, public health professionals and lawyers. The Public Health Law Flu project team designed and managed the website. Registered network members were recruited through publicity, advertising and word of mouth. Details of the network were sent to health organizations and universities throughout Europe. Corresponding website links attracted many new visitors. Publications, news, events and a pandemic glossary became popular features on the site. Although the website initially focused only on pandemic diseases it has grown into a multidisciplinary website covering a range of public health law topics. The network contains over 700 publications divided into 28 public health law categories. News, events, front page content, legislation and the francophone section are updated on a regular basis. Since 2007 the website has received over 15,000 views from 156 countries. Newsletter subscribers have risen to 304. There are now 723 followers on the associated Twitter site. The European Public Health Law Network has been a successful and innovative site in the area of public health law. Interest in the site continues to grow. Future funding can contribute to a bigger site with interactive features and pages in a wider variety of languages to attract a wider global audience. Copyright © 2011 The Royal Society for Public Health. Published by Elsevier Ltd. All rights reserved.
Convergence of the European law on public notaries
Directory of Open Access Journals (Sweden)
Salma Jožef
2012-01-01
Full Text Available In this paper the author analyzes the functions of public notaries, the evolution of the institution in Europe and its legal features in contemporary European law. The basic normative solutions of the German, Austrian, French, Italian, Hungarian, Slovakian, Slovenian and Croatian law are outlined. The importance of the European law on notaries public is also stressed, which aims to further the cooperation between national chambers on notaries public on European scale, in order to facilitate the cross-border transactions within the territory of the European Union. The gist of the converging common European rules pertaining to notaries public are the principle of independence of notaries and the principle of legality, which means that the notaries are in the performance of their duties bound only by the norms of civil substantive and procedure law. Notaries public perform also a function of public service, since they provide assistance to citizens in drafting their public instruments and private deeds (juridical acts and statements, that produce the required evidentiary strength. Depending on whether a given requirement of form of juridical act can be met only by the assistance of notaries public or by other public bodies, one may distinguish exclusively notarial acts from competing forms of juridical acts.
VARIOUS HISTORICAL CONSIDERATIONS REGARDING THE PUBLIC LAW–PRIVATE LAW DICHOTOMY
Directory of Open Access Journals (Sweden)
Emilian Ciongaru
2014-11-01
Full Text Available Throughout the history of law, has been structured logically in law institutions and branches being considered in a divided or unitary manner. But legal norms have obtained general recognition either taken as a unitary system or divided into divisions or branches as maximum logical-organizational structures. The law originally intersects with the process of formation and evolution of the state. The law has been formed unconsciously as the result of a psychological process in which the individual reacts to certain external stimuli. At the beginning, the law came under the form of nonunitary chaotic customs or practices. In the second phase, the law, though yet rudimentary, became a conscious action being imposed by a public force. The difference between the public law and the private law results from the fact that private law may be attributed to the structure of society, and the public law may be attributed to the superstructure of society. Even nowadays, the delimitation between the public law and the private law is not clear, because the most numerous legal relations refer both to the general interest and the private interest and, basically, the legal norms contribute to public order as the observation thereof brings social peace.
Directory of Open Access Journals (Sweden)
Gerrit Ferreira
2014-11-01
Full Text Available Monism and dualism represent two different approaches towards the relationship between public international law and municipal law. While the former views public international law and municipal law as a single legal system, the latter regards these two areas of law as separate and distinct legal systems that exist alongside each other. However, not all legal systems are clearly either monist or dualist. The dichotomy between monism and dualism no longer only concerns the relationship between public international law and municipal law, but also increasingly affects the relationship between public international law and regional law. This contribution discusses the application of the monist and dualist approaches by the South African Constitutional Court in the Glenister case and the European Court of Justice in the Kadi and Hungary cases in order to illustrate the practical application of the dichotomy between monism and dualism in a municipal system and on a regional level.
Encyclopedia of Public International Law, 8 / Henn-Jüri Uibopuu
Uibopuu, Henn-Jüri, 1929-2012
1986-01-01
Tutvustus: Encyclopedia of Public International Law, published under the Auspices of the Max-Planck-Institute for Comparative Public Law and International Law under the Direction of Rudolf Bernhardt. (8. Human Rights and the Individual in International Law. International Economic Relations). Amsterdam, New York, Oxford: North-Holland Publishing Company, 1985
Realising social justice in public health law.
Fox, Marie; Thomson, Michael
2013-03-01
Law has played an important, but largely constitutive, role in the development of the public health enterprise. Thus, law has been central to setting up the institutions and offices of public health. The moral agenda has, however, been shaped to a much greater extent by bioethics. While social justice has been placed at the heart of this agenda, we argue that there has been little place within dominant conceptions of social justice for gender equity and women's interests which we see as crucial to a fully realised vision of social justice. We argue that, aside from particular interventions in the field of reproduction, public health practice tends to marginalise women-a claim we support by critically examining strategies to combat the HIV pandemic in sub-Saharan Africa. To counter the marginalisation of women's interests, this article argues that Amartya Sen's capabilities approach has much to contribute to the framing of public health law and policy. Sen's approach provides an evaluative and normative framework which recognises the importance of both gender and health equity to achieving social justice. We suggest that domestic law and international human rights provisions, in particular the emerging human right to health, offer mechanisms to promote capabilities, and foster a robust and inclusive conception of social justice.
MOVIMENTO ESTUDANTIL EM BELO HORIZONTE: AÇÕES E REAÇÕES DOS ESTUDANTES AO DECRETO-LEI 477 (1969-1979
Directory of Open Access Journals (Sweden)
Daniele Teles de Oliveira
2010-12-01
Full Text Available RESUMO:Embasado em uma literatura específica sobre o movimento estudantil, a ação política dos jovens e também dos movimentos sociais, este trabalho procura discutir os meios de reação dos estudantes, em Belo Horizonte, entre os anos de 1969 e 1975, contra uma legislação específica (Lei Suplicy de Lacerda, Decreto Aragão e Decreto-Lei 477. O resgate dos mecanismos de reação do movimento estudantil permite uma análise que procura ir além da tradicional ênfase dada à luta armada, como mecanismo, por excelência, da ação dos estudantes. Desse modo, pensar as articulações e a manutenção da representatividade estudantil que construíram os meios de reação desse movimento em Belo Horizonte acrescenta novas perspectivas em relação a esse objeto. Assim, a análise da imprensa estudantil se mostrou relevante, no sentido de trazer contribuições para o entendimento da organização dos estudantes em torno de suas entidades representativas. PALAVRAS-CHAVE: Movimento Estudantil em Belo Horizonte, Decreto-Lei 477, Imprensa estudantil. ABSTRACT: Based in a specific literature about the student movement, political action of the youths and also about social movements, this essay seeks to discuss the means of students reaction, in Belo Horizonte, between the years of 1969 and 1975, against a specific legislation (Law Suplicy de Lacerda, Decree Aragão and Decree-Law 477. Recovering student movements` mechanisms of reaction permits an analysis that seeks going beyond the traditional emphasis given to the armed resistance as the main mechanism of students action. Of this way, thinking about the articulations and maintenance of the student representativeness, that built the means of movement’s reaction in Belo Horizonte, provides news perspectives regarding that subject. Like this, the analysis of the student press was shown prominent, in the sense of bringing contributions for the understanding of the student’s organization
Encyclopedia of Public International Law, 9 / Henn-Jüri Uibopuu
Uibopuu, Henn-Jüri, 1929-2012
1988-01-01
Tutvustus: Encyclopedia of Public International Law / published under the Auspices of the Max-Planck-Institute for Comparative Public Law and International Law under the Direction of Rudolf Bernhardt. (9. International Relations and Legal Cooperation in General. Diplomacy and Consular Relations and 10. States. Responsibility of Sates. International Law and Municipal Law). Amsterdam, New York, Oxford : North-Holland Publishing Company, 1986-1987. Pp. XV, 425 and pp. XV, 543
25 CFR 47.7 - What are the expenditure limitations for Bureau-operated schools?
2010-04-01
... schools? 47.7 Section 47.7 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR EDUCATION UNIFORM DIRECT FUNDING AND SUPPORT FOR BUREAU-OPERATED SCHOOLS § 47.7 What are the expenditure limitations for Bureau-operated schools? Each Bureau-operated school must spend all allotted funds in accordance with...
The Public Schools Contracts Law. Focus on School Law Series.
Dabreu, O. Lisa
New Jersey's Public Schools Contracts Law, enacted on June 2, 1977, places limits on the authority of local and regional boards of education to make purchases and to enter into contracts, agreements, or leases for supplies or services. This publication is designed to provide information and guidance that will assist boards of education in meeting…
Juridifying Corporate Social Responsibility Through Public Law
DEFF Research Database (Denmark)
Buhmann, Karin
2015-01-01
steps in a process of juridifying CSR through public law. It demonstrates that the formalisation of business responsibilities for human rights, which emerged with the two UN instruments, is having an impact on public regulation of CSR in a more general sense. Another current in public regulation of CSR......With a point of departure in the United Nations (UN) Guiding Principles on Business and Human Rights and the UN (‘Ruggie’) Framework on Business and Human Rights this article shows that recent developments with the UN and the OECD and some legislative EU and national State activities constitute...... that coherence in public law regulation of business impact on society warrants attention in order to ensure legal certainty and effective regulation based on alignment between the different currents of public regulation of CSR....
Encyclopedia of Public International Law, 6 / Henn-Jüri Uibopuu
Uibopuu, Henn-Jüri, 1929-2012
1984-01-01
Tutvustus: Encyclopedia of Public International Law, published under the Auspices of the Max-Planck-Institute for Comparative Public Law and International Law under the Direction of Rudolf Bernhardt. (6. regional Cooperation, Organization Problems). Amsterdam, New York, Oxford: North-Holland Publishing Company, 1983
Globalization of public health law and ethics.
Sohn, Myongsei
2012-09-01
The Constitution of the World Health Organization (1946) states that the "enjoyment of the highest attainable standard of health is one of the fundamental rights of every human being without distinction of race, religion, political belief, economic or social position." The international legal framework for this right was laid by the Universal Declaration of Human Rights (1948) and reaffirmed in the International Covenant on Economic, Social, and Cultural Rights (1966) and the Declaration of Alma-Ata (1978). In recent years, the framework has been developed on 10 key elements: national and international human rights, laws, norms, and standards; resource constraints and progressive realization; obligations of immediate effect; freedoms and entitlements; available, accessible, acceptable, and good quality; respect, protect, and fulfill; non-discrimination, equality, and vulnerability; active and informed participation; international assistance and cooperation; and monitoring and accountability. Whereas public health law plays an essential role in the protection and promotion of the right to health, the emergence of SARS (2003) highlighted the urgent need to reform national public health laws and international obligations relating to public health in order to meet the new realities of a globalized world, leading to the WHO Framework Convention on Tobacco Control (2003) and the revision of the WHO International Health Regulations (2005). The Asian Institute for Bioethics and Health Law, in conjunction with the Republic of Korea's Ministry of Health and Welfare and the WHO International Digest of Health Legislation, conducted a comparative legal analysis of national public health laws in various countries through a project entitled Domestic Profiles of Public/Population Health Legislation (2006), which underscored the importance of recognizing the political and social contexts of distinct legal cultures, including Western, Asian, Islamic, and African.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false May Executive agencies outlease space on major public access levels, courtyards and rooftops of public buildings? 102-79.65... Utilization of Space Outleasing § 102-79.65 May Executive agencies outlease space on major public access...
13 CFR 102.23 - Publication in the Federal Register-Notices of systems of records.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Publication in the Federal Register-Notices of systems of records. 102.23 Section 102.23 Business Credit and Assistance SMALL BUSINESS... Federal Register upon establishment or revision a notice of the existence and character of any new or...
Mapping the scope and opportunities for public health law in liberal democracies.
Magnusson, Roger S
2007-01-01
The two questions, "What is public health law?" and "How can law improve the public's health?" are perennial ones for public health law scholars. This paper proposes a framework for conceptualizing discussion and debate about the scope and opportunities for public health law within liberal democracies. Part 2 of the paper draws selectively on this framework in order to highlight some areas where law's potential role deserves greater acknowledgment and exploration.
2010-07-01
... requirements, such as the Debt Collection Improvement Act of 1996 (Public Law 104-134, sec. 31001, 110 Stat. 1321-358) and antitrust requirements that are discussed in § 102-38.325. Antitrust Requirements ...
Encyclopedia of Public International Law, 2 / Henn-Jüri Uibopuu
Uibopuu, Henn-Jüri, 1929-2012
1982-01-01
Tutvustus: Encyclopedia of Public International Law, published under the Auspices of the Max-Planck-Institute for Comparative Public Law and International Law under the Direction of Rudolf Bernhardt. (2. Decisions of International Courts and Tribunals and International Arbitrations). Amsterdam, New York, Oxford: North-Holland Publishing Company, 1981
Encyclopedia of Public International Law, 5 / Henn-Jüri Uibopuu
Uibopuu, Henn-Jüri, 1929-2012
1983-01-01
Tutvustus: Encyclopedia of Public International Law, published under the Auspices of the Max-Planck-Institute for Comparative Public Law and International Law under the Direction of Rudolf Bernhardt. 5. International Organizations in General. Universal International Organisazations and Cooperation. Amsterdam, New York, Oxford: North-Holland Publishing Company, 1983
45 CFR 2104.102 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2104.102 Section 2104.102 Public Welfare Regulations Relating to Public Welfare (Continued) COMMISSION OF FINE ARTS ENFORCEMENT OF....102 Application. This part applies to all programs or activities conducted by the agency. ...
45 CFR 1706.102 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 1706.102 Section 1706.102 Public Welfare Regulations Relating to Public Welfare (Continued) NATIONAL COMMISSION ON LIBRARIES AND... CONDUCTED BY NATIONAL COMMISSION ON LIBRARIES AND INFORMATION SCIENCE § 1706.102 Application. This part...
Encyclopedia of Public International Law, 3 / Henn-Jüri Uibopuu
Uibopuu, Henn-Jüri, 1929-2012
1983-01-01
Tutvustus.: Encyclopedia of Public International Law, published under the Auspices of the Max-Planck-Institute for Comparative Public Law and International Law under the Direction of Rudolf Bernhardt. 3 (A_M) and 4 (N-Z): Use of Force. War and Neutrality. Peace treaties. Amsterdam, New York, Oxford: North-Holland Publishing Company, 1982
45 CFR 1214.102 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 1214.102 Section 1214.102 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE....102 Application. This part applies to all programs or activities conducted by the agency, except for...
Law and Politics, an Emerging Epidemic: A Call for Evidence-Based Public Health Law.
Ulrich, Michael R
2016-05-01
As Jacobson v. Massachusetts recognized in 1905, the basis of public health law, and its ability to limit constitutional rights, is the use of scientific data and empirical evidence. Far too often, this important fact is lost. Fear, misinformation, and politics frequently take center stage and drive the implementation of public health law. In the recent Ebola scare, political leaders passed unnecessary and unconstitutional quarantine measures that defied scientific understanding of the disease and caused many to have their rights needlessly constrained. Looking at HIV criminalization and exemptions to childhood vaccine requirements, it becomes clear that the blame cannot be placed on the hysteria that accompanies emergencies. Indeed, these examples merely illustrate an unfortunate array of examples where empirical evidence is ignored in the hopes of quelling paranoia. These policy approaches are not only constitutionally questionable, they generate their own risk to public health. The ability of the law to jeopardize public health approaches to infectious disease control can, and should, be limited through a renewed emphasis on science as the foundation of public health, coordination through all levels and branches of government, and through a serious commitment by the judiciary to provide oversight. Infectious disease creates public anxiety, but this cannot justify unwarranted dogmatic approaches as a response. If we as a society hope to ensure efficient, constitutional control over the spread of disease, it is imperative that science take its rightful place at the forefront of governmental decision-making and judicial review. Otherwise, the law becomes its own public health threat.
45 CFR 2490.102 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2490.102 Section 2490.102 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION... MADISON MEMORIAL FELLOWSHIP FOUNDATION § 2490.102 Application. This part (§§ 2490.101-2490.170) applies to...
45 CFR 2301.102 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2301.102 Section 2301.102 Public Welfare Regulations Relating to Public Welfare (Continued) ARCTIC RESEARCH COMMISSION ENFORCEMENT OF... COMMISSION § 2301.102 Application. This part (§§ 2301.101-2301.170) applies to all programs or activities...
Public Consultation toward Ethiopia's Family Law Reform ...
African Journals Online (AJOL)
Mandefrot Belay
A comprehensive and open public consultation was conducted during the revision ... in Ethiopia which are expected to guide any legal reform process so that the ... law, the way in which public consultation forums were organized, and the ...
Energy Technology Data Exchange (ETDEWEB)
Day, Delbert E.; Brow, Richard K.; Ray, Chandra S.; Reis, Signo T. [Missouri University of Science and Technology, 1870 Miner Circle, Rolla, MO 65409 (United States); Kim, Cheol-Woon [MO-SCI Corporation, 4040 HyPoint North, Rolla, MO 65401 (United States); Vienna, John D.; Sevigny, Gary [Pacific North West National Laboratory, Battelle Blvd., Richland, WA 99352 (United States); Peeler, David; Johnson, Fabienne C.; Hansen, Eric K. [Savannah River National Laboratory, Savannah River Site, 999-W, Aiken, SC 29803 (United States); Soelberg, Nick [Idaho National Laboratory, 2525 Fremont Avenue, Idaho Falls, ID 83415 (United States); Pegg, Ian L.; Gan, Hao [Catholic University of America, 620 Michigan Avenue, N.E., Washington, DC 20064 (United States)
2012-07-01
An iron phosphate composition for vitrifying a high sulfate (∼17 wt%) and high alkali (∼80 wt%) Hanford low activity waste (LAW), known as AZ-102 LAW, has been developed for processing in a Joule Heated Melter (JHM) or a Cold Crucible Induction Melter (CCIM). This composition produced a glass waste form, designated as MS26AZ102F-2, with a waste loading of 26 wt% of the AZ-102 which corresponded to a total alkali and sulfate (represented as SO{sub 3}) content of 21 and 4.4 wt%, respectively. A slurry (7 M Na{sup +}) of MS26AZ102F-2 simulant was melted continuously at temperatures between 1030 and 1090 deg. C for 10 days in a small JHM at PNNL and for 70 hours in a CCIM at INL. The as-cast glasses produced in both melters and in trial laboratory experiments along with their canister centerline cooled (CCC) counterparts met the requirements for the Product Consistency Test (PCT) and the Vapor Hydration Test (VHT) responses in the Hanford Tank Waste Treatment and Immobilization Plant (WTP) Contract. These glass waste forms retained up to 77 % of the SO{sub 3} (3.3 wt%), 100% of the Cesium, and 33 to 44% of the rhenium (used as a surrogate for Tc) all of which either exceeded or were comparable to the retention limit for these species in borosilicate glass nuclear waste form. Analyses of commercial K-3 refractory lining and the Inconel 693 metal electrodes used in JHM indicated only minimum corrosion of these components by the iron phosphate glass. This is the first time that an iron phosphate composition was melted continuously in a slurry fed JHM and in the US, thereby, demonstrating that iron phosphate glasses can be used as alternative hosts for vitrifying nuclear waste. The following conclusions are drawn from the results of the present work. (1) An iron phosphate composition, designated as MS26AZ102F-2, containing 26 wt% of the simulated high sulfate (17 wt%), high alkali (80 wt%) Hanford AZ-102 LAW meets all the criteria for processing in a JHM and CCIM. This
Informal administrative acts in public economic law
International Nuclear Information System (INIS)
Bauer, H.
1987-01-01
The article deals with agreements between the administration and citizens, which play a considerable part in public commercial law and in atomic energy law. The legal basis can be the doctrine of administrative legal relationship, which clarifies the reciprocity and multilaterality of the legal relationship. In the future informal administrative acts will have an increasing meaning. (CW) [de
Public Policy Exceptions in European Private Law : A New Research Project
Colombi Ciacchi, Aurelia
2014-01-01
Public policy exceptions arguably exist in all fields of private and commerciallaw, not only in private international law but also in substantive law. In substantive private law, the term 'public policy exception' could be used to indicate general illegality rules that make an act of private
Exponential and power laws in public procurement markets
Czech Academy of Sciences Publication Activity Database
Krištoufek, Ladislav; Skuhrovec, J.
2012-01-01
Roč. 99, č. 2 (2012), 28005-1-28005-6 ISSN 0295-5075 R&D Projects: GA ČR GA402/09/0965 Grant - others:GA UK(CZ) 118310; SVV(CZ) 265 504; GA TA ČR(CZ) TD010133 Institutional support: RVO:67985556 Keywords : Public procurement * Scaling * Power law Subject RIV: AH - Economics Impact factor: 2.260, year: 2012 http://library.utia.cas.cz/separaty/2012/E/kristoufek-exponential and power laws in public procurement markets.pdf
2010-07-01
... SPACE Assignment and Utilization of Space Public Access Defibrillation Programs § 102-79.115 What... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What guidelines must an agency follow if it elects to establish a public access defibrillation program in a Federal facility? 102...
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What information must FAA provide to GSA on its administration of the public airport donation program? 102-37.535 Section... Donations to Public Airports § 102-37.535 What information must FAA provide to GSA on its administration of...
The Notice on the Notion of State Aid and Public Procurement Law
DEFF Research Database (Denmark)
Ølykke, Grith Skovgaard
2016-01-01
uncertainty. Then the elaborations made in the Notice on the notion of aid concerning the relation between the two areas of law are analysed and discussed, in particular, first, the question whether adhering to the procurement procedures laid down in the public procurement directives will eliminate the risk......The Commission Notice on the notion of State aid includes elaboration on the relationship between State aid law and public procurement law. To begin with, the article examines some of the reasons why the relationship between State aid law and public procurement law is surrounded by legal...... of granting State aid and, second, the issues rising from State aid control of in-house situations. It is concluded that even though the Notice on the notion of aid brings some needed clarity that fosters coherence between State aid law and public procurement law, the existing legal uncertainty is not even...
Public and Private School Principals' Knowledge of Special Education Law
Boyd, Marie Nicole
2018-01-01
The purpose of this study is to examine the knowledge of special education law held by public and private school principals as the law pertains to providing the appropriate services to students with disabilities. Numerous studies have investigated public school principals' level of preparation, training, and role within in special education law.…
Analysis of fundamental parameters for V477 Lyr
Shimansky, V. V.; Pozdnyakova, S. A.; Borisov, N. V.; Bikmaev, I. F.; Galeev, A. I.; Sakhibullin, N. A.; Spiridonova, O. I.
2008-06-01
We analyze the photometric and spectroscopic observations of the young pre-cataclysmic variable (pre-CV) V477 Lyr. The masses of both binary components have been corrected by analyzing their radial velocity curves. We show that agreement between the theoretical and observed light curves of the object is possible for several sets of its physical parameters corresponding to the chosen temperature of the primary component. The final parameters of V477 Lyr have been established by comparing observational data with evolutionary tracks for planetary nebula nuclei. The derived effective temperature of the O subdwarf is higher than that estimated by analyzing the object’s ultraviolet spectra by more than 10000 K. This is in agreement with the analogous results obtained previously for the young pre-CVs V664 Cas and UU Sge. The secondary component of V477 Lyr has been proven to have a more than 25-fold luminosity excess compared to main-sequence stars of similar mass. Comparison of the physical parameters for the cool stars in young pre-CVs indicates that their luminosities do not correlate with the masses of the objects. The observed luminosity excesses in such stars show a close correlation with the post-common-envelope lifetime of the systems and should be investigated within the framework of the theory of their relaxation to the state of main-sequence stars.
41 CFR 51-10.102 - Application.
2010-07-01
... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Application. 51-10.102 Section 51-10.102 Public Contracts and Property Management Other Provisions Relating to Public Contracts... WHO ARE BLIND OR SEVERELY DISABLED § 51-10.102 Application. This part applies to all programs or...
42 CFR 93.102 - Applicability.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Applicability. 93.102 Section 93.102 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...
Coded Statutory Data Sets for Evaluation of Public Health Law
Costich, Julia Field
2012-01-01
Background and objectives: The evaluation of public health law requires reliable accounts of underlying statutes and regulations. States often enact public health-related statutes with nonuniform provisions, and variation in the structure of state legal codes can foster inaccuracy in evaluating the impact of specific categories of law. The optimal…
Using the laws and the regularities of public administration in the state strategic planning
Directory of Open Access Journals (Sweden)
O. L. Yevmieshkina
2016-03-01
Full Text Available The article researches the use of laws of public administration in the state strategic planning; defined a methodological basis of state strategic planning. State strategic planning as a function of public administration exists in accordance with its laws and regularities. Author established the use of public administration laws as: unity socio-economic system, required diversity, system integrity, unity techniques and basic functions of social management at all levels of public administration: central, sectorial, regional. At the public administration level this laws as a rule us in working and realization of state strategy, state, region and sectorial program, which directed to improve of political, economic and social process. State strategic planning as a function of public administration exists in accordance with its laws. The law in our research is considered as objective, substantive, necessary, sustainable relationship between events. The most essential feature of law is reflecting the objective state of affairs, objective relations between things, items and phenomenon’s. The other difficult sign of law is necessity as relation, which inevitably revealed in the development process of different things. Law category with regularity category is relation. Regularity is wider category then the law. The state strategic planning is an integrated, systematic process due to the action and use laws and regularities of public administration. That improves the efficiency of public administration.
Directory of Open Access Journals (Sweden)
Ameyaw, Collins
2012-08-01
Full Text Available The purpose of this study was to identify various implementation bottlenecks to the Ghana Public Procurement Law 2003 (Act 663. The study adopted multiple research approaches, including; review of relevant literature, interviews and questionnaire survey of 49 District Assemblies and Metropolitan and Municipal Assemblies in the Ashanti and Brong Ahafo Regions of Ghana. The study identified low capacity of procurement professionals, low interaction between procurement entities and Public Procurement Authority (PPA, deliberate controlling of competition, non-compliance with provisions of the law, splitting of contracts into smaller lots, lack of funds and non-cooperativeness of suppliers, as the major challenges militating against the implementation of the Public Procurement Law.
75 FR 27855 - Certifications Pursuant to Section 609 of Public Law 101-162
2010-05-18
... DEPARTMENT OF STATE [Public Notice 7013] Certifications Pursuant to Section 609 of Public Law 101... Law 101-162 (``Section 609''), that 13 nations have adopted programs to reduce the incidental capture... 609 of Public Law 101-162 prohibits imports of certain categories of shrimp unless the President...
2011-09-14
... other commercial matters regulated by U.S. antitrust laws. A court reporter will record the proceedings... Energy Policy Act of 1992 (EPAct 1992), Public Law 102-486, established energy conservation standards for...
Nuclear law and public acceptance
International Nuclear Information System (INIS)
Muguet, Tania Mara F.
2009-01-01
After the fission of the atom and its use for military purposes, the imposition of controls and restrictions to prevent the proliferation of atomic weapons was established and led to the drafting of a series of international conventions to promote the harmonization of domestic legislation. In this context, to provide a legal framework for conducting activities related to nuclear energy and ionizing radiation, in a manner that adequately protects individuals, property and environment, the nuclear energy law was created and widely adopted. To better control the risks associated with the use of nuclear energy and in order to adapt its technological developments in constant state of evolution, a growing body of international law of nuclear energy is emerging from instruments (universal, regional, bilateral and multilateral) to impose obligation in the use of the technology. In sum, changes in technological, economic, political or social conditions created the need for legal solutions and the public understanding and confidence in the peaceful uses of nuclear energy requires extensive information to be made available on the risks and benefits to stakeholders (effected public, press, media, and legislators etc.). (author)
Nuclear law and public acceptance
Energy Technology Data Exchange (ETDEWEB)
Muguet, Tania Mara F. [Comissao Nacional de Energia Nuclear (CNEN), Rio de Janeiro, RJ (Brazil). Coordenacao Geral de Assuntos Internacionais], e-mail: tmuguet@cnen.gov.br
2009-07-01
After the fission of the atom and its use for military purposes, the imposition of controls and restrictions to prevent the proliferation of atomic weapons was established and led to the drafting of a series of international conventions to promote the harmonization of domestic legislation. In this context, to provide a legal framework for conducting activities related to nuclear energy and ionizing radiation, in a manner that adequately protects individuals, property and environment, the nuclear energy law was created and widely adopted. To better control the risks associated with the use of nuclear energy and in order to adapt its technological developments in constant state of evolution, a growing body of international law of nuclear energy is emerging from instruments (universal, regional, bilateral and multilateral) to impose obligation in the use of the technology. In sum, changes in technological, economic, political or social conditions created the need for legal solutions and the public understanding and confidence in the peaceful uses of nuclear energy requires extensive information to be made available on the risks and benefits to stakeholders (effected public, press, media, and legislators etc.). (author)
42 CFR 102.74 - Disapproval of benefits.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Disapproval of benefits. 102.74 Section 102.74 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX COMPENSATION PROGRAM Secretarial Determinations § 102.74 Disapproval of benefits. (a) If the Secretary...
29 CFR 102.147 - Contents of application; net worth exhibit; documentation of fees and expenses.
2010-07-01
... RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Awards of Fees and Other Expenses § 102.147 Contents of... it is a cooperative association as defined in section 15(a) of the Agricultural Marketing Act (12 U.S... otherwise directed by the administrative law judge, the net worth exhibit will be included in the public...
THE CITIZENS’ PUBLIC PARTICIPATION UNDER EUROPEAN UNION LAW AND ENVIRONMENTAL LAW
Directory of Open Access Journals (Sweden)
Valentine Charlotte ENE
2014-06-01
Full Text Available Convention on Access to Information, Public Participation in Decision-Making and Access to Justice in Environmental Matters, June 25, 1998 (entered into force Oct. 30, 2001 [hereinafter Aarhus Convention], negotiated under the auspices of the UN/ECE (United Nations Economic Commission for Europe, is the result of the efforts to establish international legal standards in the field of citizens’ environmental rights to date. Also, it is the first international document about public participation in environmental matters, developing the principle 10 of the Rio Declaration, which stresses the need for citizen's participation in environmental issues and for access to information on the environment held by public authorities. Public participation, one of the three main pillars provided by Aarhus Convention, could be one of the key factors in involving the citizens in the protection of the environment and strengthening compliance and enforcement of national and European environmental law. Under European Union regulations, the right to participate in environmental decision-making process could be exercise more effectively based on European Citizens’ Initiative (ECI procedure. Therefore, the European Citizens' Initiative (ECI, as introduced by the Lisbon Treaty, allows citizens to request new EU legislation once a million signatures from seven member states have been collected asking the European Commission to do so. This paper explores environmental citizenship within the framework of European Union (EU environmental law.
Public Supervision over Private Relationships : Towards European Supervision Private Law?
Cherednychenko, O.O.
2014-01-01
The rise of public supervision over private relationships in many areas of private law has led to the development of what, in the author’s view, could be called ‘European supervision private law’. This emerging body of law forms part of European regulatory private law and is made up of
Some disjointed observations on federal public-land and resources law
Energy Technology Data Exchange (ETDEWEB)
Coggins, G.C.
A review of the evolution of public-land law and policies concludes that: (1) Public-land and resources law cannot be divorced from history; in spite of recent developments, one cannot understand present problems without understanding their historical derivation. (2) Public-land management will always be as controversial as it is interesting because the perfect balance of resource uses in unattainable. (3) Multiple-use, sustained-yield management has failed; instead, like Christianity, it has never really been tried. (4) From the ecological maxim that everything is connected to everything else comes the notion that the isolation of public-land and resources law as a field of study is inherently artificial. Developments off federal lands that seem unrelated to them will heavily influence public-land policy: recreation pressures could decline in rough inverse proportion to gasoline prices; horizonal divestiture of oil companies would change the whole coal picture; mandatory recycling could lower demand for all virgin resources; and so on. Some notion of conservation is almost certainly going to be among the Nation's highest priorities in the next several decades.
Living apart together: the relationship between public and private international law
de Boer, T.M.
2010-01-01
There have been times when public and private international law were closely related. As a means to solve conflicts of sovereign jurisdiction, conflicts law used to be considered as an integral part of the law of nations. Even after Savigny shifted the focus of private international law from the
41 CFR 102-39.80 - What are the accounting requirements for exchange allowances or proceeds of sale?
2010-07-01
... the general finance and accounting rules applicable to you. Except as otherwise authorized by law, all... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the accounting... Exchange/Sale Methods and Reports § 102-39.80 What are the accounting requirements for exchange allowances...
Public Values in Water Law: A Case of Substantive Fragmentation?
Ambrus, Monika; Gilissen, Herman Kasper; van Kempen, Jasper JH
2014-01-01
Horizontal fragmentation, from a public-values perspective, is a quite well-documented phenomenon in international (water) law. However, the literature does not provide any insight into vertical or substantive fragmentation, i.e. differences in the protection of public values at the various institutional levels. This article assesses whether there is substantive fragmentation in water law at the international, the European, the sub-regional (Danube River Basin), and the Dutch domestic level. ...
Public Support for Weight-Related Antidiscrimination Laws and Policies.
Hilbert, Anja; Hübner, Claudia; Schmutzer, Gabriele; Danielsdottir, Sigrun; Brähler, Elmar; Puhl, Rebecca
2017-01-01
Weight-related discrimination is prevalent and associated with health impairments for those who are targeted, which underscores the need of antidiscrimination legislation. This study is the first to examine public support of weight-related antidiscrimination laws or policies in Germany, compared to the US and Iceland. In a representative German population sample (N = 2,513), public support for general and employment-specific weight-related antidiscrimination policies, weight-based victimization, and weight bias internalization were measured through established self-report questionnaires. Half of the German population sample agreed with antidiscrimination policies. General antidiscrimination laws received lower support than employment-specific laws. Support for policies considering obesity a physical disability was greatest in Germany, whereas support for employment-specific antidiscrimination laws was lower in Germany than in the US and Iceland. Total support for weight-related antidiscrimination policies was significantly predicted by lower age, female gender, obese weight status, residence in West Germany, church membership, and readiness to vote in elections. German support for weight-related antidiscrimination policies is moderate. Increasing awareness about weight-related discrimination and laws prohibiting this behavior may help to promote policy acceptance. © 2017 The Author(s) Published by S. Karger GmbH, Freiburg.
Community energy systems and the law of public utilities
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is given of the laws and programs of the State of Nebraska governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitiled ''Community Energy Systems and the Law of Public Utilities--Volume One: An Overview.'' This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Directory of Open Access Journals (Sweden)
Salma Jožef
2012-01-01
Full Text Available In this paper the author analyzes the effective Serbian rules of law on notaries public, in comparative perspective. The principles of law pertaining to notaries, the notarial deed and the legal nature of the notaries' liability for damages are discussed. Special emphasis is given to the principles of public confidence, legality, professionalism, formalism and independence, from which the notaries' liability for damages caused to clients and third parties derives. Although the notaries public are independent, hence they are not subordinate to any judicial or administrative organ, their liability for damages is analogous to the liability of administrative organs, whereby the condition of filing a legal remedy is construed in a fairly broad sense, that is any remark of the client disclosed to the notary is considered as filing a legal remedy. The author's standpoint is that the legal nature of notary's liability is either contractual or delictual, depending on whether the notary infringed a clause of the mandate of the client, which serves as the legal ground of his/her actions, or mandatory rules, that is the statutory requirement of acting in good faith. Besides general rules on the requirements of form of juridical acts (essential form, facultative form, the subject of analysis are also the rules on exclusive and alternative (competing forms of notarial deeds. The effective Serbian law on notaries public envisages the form of notarial deeds and private instruments predominantly as alternative forms, that is a specific kind of deed has the same legal effect, regardless whether it is drafted by a notary or concluded in court.
41 CFR 109-27.102-1 - Applicability.
2010-07-01
...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-1 Applicability. Replenishment of inventories of... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Applicability. 109-27.102-1 Section 109-27.102-1 Public Contracts and Property Management Federal Property Management...
41 CFR 109-27.102-51 - Policy.
2010-07-01
...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-51 Policy. Systems contracting for supply... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Policy. 109-27.102-51 Section 109-27.102-51 Public Contracts and Property Management Federal Property Management Regulations...
41 CFR 101-27.102-2 - Guidelines.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Guidelines. 101-27.102-2 Section 101-27.102-2 Public Contracts and Property Management Federal Property Management Regulations... Replenishment § 101-27.102-2 Guidelines. Guidelines for implementing the EOQ principle of stock replenishment...
Development of Systematic Knowledge Management for Public Health: A Public Health Law Ontology
Keeling, Jonathan
2012-01-01
The Institute of Medicine has stated that legal structures and the authority vested in health agencies and other partners within the public health system are essential to improving the public's health. Variation between the laws of different jurisdictions within the United States allows for natural experimentation and research into their…
Discrimination in Public Employment: The Evolving Law.
McCarthy, Martha M.
This monograph reviews the current status of constitutional, statutory, and case law governing public employers' obligations to assure equal employment opportunities and employees' rights to nondiscriminatory treatment. An initial overview of the legal framework discusses federal equal protection mandates including the guarantee of equal…
42 CFR 84.102 - Man test 6; requirements.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Man test 6; requirements. 84.102 Section 84.102 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL OF RESPIRATORY PROTECTIVE DEVICES Self-Contained Breathing Apparatus § 84.102 Man test 6; requirements....
On the orbital eccentricity of V477 Cygni
International Nuclear Information System (INIS)
Scarfe, C.D.; Barlow, D.J.; Niehaus, R.J.
1976-01-01
The eclipsing binary V477 Cygni (BD+31 0 3932) is a Main-Sequence system with unequal components, a substantial orbital eccentricity and clearly detectable apsidal rotation. Recent photoelectric times of minima support the value e=0.3 obtained by O'Connell (1970). The lower value obtained by Budding (1974) is ruled out. (Auth.)
42 CFR 102.73 - Approval of benefits.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Approval of benefits. 102.73 Section 102.73 Public... PROGRAM Secretarial Determinations § 102.73 Approval of benefits. When the Secretary has determined that benefits will be paid to a requester and has calculated the type and amount of such benefits, he will...
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are FAA's... § 102-37.530 What are FAA's responsibilities in the donation of surplus property to public airports? In the donation of surplus property to public airports, the Federal Aviation Administration (FAA), acting...
The Whys and Hows of Certification. Public Librarian Certification Law.
Wisconsin State Dept. of Public Instruction, Madison. Div. of Library Services.
Under Wisconsin state law (Administrative Code P1-6.03) any librarian employed in a public library system or any municipal public library, except in a city of the first class, supported in whole or in part by public funds, must hold state certification. Qualifications are delineated for three grades of certification: grade 1, for public libraries…
41 CFR 109-27.102-50 - Systems contracting.
2010-07-01
...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-50 Systems contracting. Systems contracting may... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Systems contracting. 109-27.102-50 Section 109-27.102-50 Public Contracts and Property Management Federal Property Management...
International Nuclear Information System (INIS)
Handrlica, Jakub
2017-01-01
This article discusses the issue of mixed public and private law in the Nuclear Energy Act, in particular with regard to the legal framework governing radioactive waste management. In fact, neither the old nor the new legal arrangements are exclusively of public law nature because a number of private law items are included. This fact is illustrated on some examples including provisions on liability for nuclear damage, the legal authority of the Radioactive Waste Repository Agency, and financial compensation to municipalities affected by the preparation of a deep geological radioactive waste disposal facility. (orig.)
Need-Based Educational Aid Act of 2015 (Public Law 114-44)
US Congress, 2015
2015-01-01
The Need-Based Educational Aid Act of 2015 (Public Law 114-44) was put in place to improve and reauthorize provisions relating to the application of the antitrust laws to the award of need-based educational aid. The contents for this Act is as follows: (1) Short Title; and (2) Extension Relating to the Application of the Antitrust Laws to the…
The Committed Changes Within Public Procurement Law in Turkey (2003-2014)
Mehmet Nar
2015-01-01
It is aimed to reach international standards at procurement of goods or services and works by the state with the law no. 4734 constituted for preventing mismanagement, waste and corruption in public procurements. However, activities and payments which are carried out within this extent are open fields for corruption. Thus, this situation enables law provisions and also the power of Public Procurement Authority (PPA) to be rearranged for the purposes of interest groups when necessary. So, our ...
The Committed Changes Within Public Procurement Law in Turkey (2003-2014
Directory of Open Access Journals (Sweden)
Mehmet Nar
2015-02-01
Full Text Available It is aimed to reach international standards at procurement of goods or services and works by the state with the law no. 4734 constituted for preventing mismanagement, waste and corruption in public procurements. However, activities and payments which are carried out within this extent are open fields for corruption. Thus, this situation enables law provisions and also the power of Public Procurement Authority (PPA to be rearranged for the purposes of interest groups when necessary. So, our study is trying to question the content of arrangements which were prepared with great expectations at first during the period of current government, but since 2003, when they were put into practice, they have been changed and criticized significantly. Besides, the impressions in public opinions about the idea that the Law forms a basis for the waste of resources have become the research subject.
41 CFR 102-117.200 - What is HAZMAT?
2010-07-01
... Shipping Hazardous Material (HAZMAT) § 102-117.200 What is HAZMAT? HAZMAT is a substance or material the... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is HAZMAT? 102-117.200 Section 102-117.200 Public Contracts and Property Management Federal Property Management...
Paternalism & Its Discontents: Motorcycle Helmet Laws, Libertarian Values, and Public Health
Jones, Marian Moser; Bayer, Ronald
2007-01-01
The history of motorcycle helmet legislation in the United States reflects the extent to which concerns about individual liberties have shaped the public health debate. Despite overwhelming epidemiological evidence that motorcycle helmet laws reduce fatalities and serious injuries, only 20 states currently require all riders to wear helmets. During the past 3 decades, federal government efforts to push states toward enactment of universal helmet laws have faltered, and motorcyclists’ advocacy groups have been successful at repealing state helmet laws. This history raises questions about the possibilities for articulating an ethics of public health that would call upon government to protect citizens from their own choices that result in needless morbidity and suffering. PMID:17194856
Public Values in Water Law: A Case of Substantive Fragmentation?
Ambrus, M.; Gilissen, Herman Kasper; van Kempen, Jasper
2014-01-01
Horizontal fragmentation, from a public-values perspective, is a quite well-documented phenomenon in international (water) law. However, the literature does not provide any insight into vertical or substantive fragmentation, i.e. differences in the protection of public values at the various
Public Values in Water Law : A Case of Substantive Fragmentation?
Ambrus, Monika; Gilissen, Herman Kasper; van Kempen, Jasper JH
2014-01-01
Horizontal fragmentation, from a public-values perspective, is a quite well-documented phenomenon in international (water) law. However, the literature does not provide any insight into vertical or substantive fragmentation, i.e. differences in the protection of public values at the various
2010-07-01
... the proposed disposal would create or maintain a situation inconsistent with antitrust laws? 102-75... Real Property Disposal Applicability of Antitrust Laws § 102-75.275 Who determines whether the proposed disposal would create or maintain a situation inconsistent with antitrust laws? The Attorney General...
78 FR 22761 - Delegation of Functions Under Sections 404 and 406 of Public Law 112-208
2013-04-16
...--Delegation of Functions Under Sections 404 and 406 of Public Law 112-208 Presidential Determination No. 2013... and 406 of Public Law 112-208 Memorandum for the Secretary of State [and] the Secretary of the... conferred upon the President by sections 404 and 406 of Public Law 112-208 as follows: I hereby delegate to...
23 CFR 810.102 - Eligible projects.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Eligible projects. 810.102 Section 810.102 Highways... SPECIAL USE HIGHWAY PROJECTS Highway Public Transportation Projects and Special Use Highway Facilities § 810.102 Eligible projects. Under this subpart the Federal Highway Administrator may approve on any...
42 CFR 422.102 - Supplemental benefits.
2010-10-01
... 42 Public Health 3 2010-10-01 2010-10-01 false Supplemental benefits. 422.102 Section 422.102... (CONTINUED) MEDICARE PROGRAM MEDICARE ADVANTAGE PROGRAM Benefits and Beneficiary Protections § 422.102 Supplemental benefits. (a) Mandatory supplemental benefits. (1) Subject to CMS approval, an MA organization may...
The Public Safety Impact of Community Notification Laws: Rearrest of Convicted Sex Offenders
Freeman, Naomi J.
2012-01-01
Sex offender management is one of the highest-profile issues in public safety today. Although states have enacted community notification laws as a means to protect communities from sexual offending, limited research has been conducted to examine the impact of these laws on public safety. As such, this study used a quasi-experimental design to…
41 CFR 102-76.50 - What is sustainable development?
2010-07-01
... and Construction Sustainable Development § 102-76.50 What is sustainable development? Sustainable... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is sustainable development? 102-76.50 Section 102-76.50 Public Contracts and Property Management Federal Property Management...
41 CFR 102-117.5 - What is transportation management?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is transportation management? 102-117.5 Section 102-117.5 Public Contracts and Property Management Federal Property Management... General § 102-117.5 What is transportation management? Transportation management is agency oversight of...
41 CFR 109-27.102 - Economic order quantity principle.
2010-07-01
... PROCUREMENT 27-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102 Economic order quantity principle. ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Economic order quantity principle. 109-27.102 Section 109-27.102 Public Contracts and Property Management Federal Property...
41 CFR 101-27.102-1 - Applicability.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Applicability. 101-27.102-1 Section 101-27.102-1 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 27-INVENTORY MANAGEMENT 27.1...
Don't Shoot the Messenger: Public Relations for Law Enforcement
Baxter, David S.
2013-01-01
This communication project provides an overview of public relations as seen through the communication arts. It is specifically focused to give law enforcement officers a general review of the practice of public relations, communication basics, and an understanding of the media. This course also provides the facilitator with multiple tools for…
2010-01-01
...) PROGRAMS FOR SPECIFIC POSITIONS AND EXAMINATIONS (MISCELLANEOUS) Motor Vehicle Operators § 930.102... United States. Employee means an employee of an agency in either the competitive or excepted service or... used by an agency in the performance of investigative, law enforcement, or intelligence duties if the...
41 CFR 102-74.40 - What are concession services?
2010-07-01
... Management Concession Services § 102-74.40 What are concession services? Concession services are any food or... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are concession services? 102-74.40 Section 102-74.40 Public Contracts and Property Management Federal Property Management...
National public health law: a role for WHO in capacity-building and promoting transparency.
Marks-Sultan, Géraldine; Tsai, Feng-Jen; Anderson, Evan; Kastler, Florian; Sprumont, Dominique; Burris, Scott
2016-07-01
A robust health infrastructure in every country is the most effective long-term preparedness strategy for global health emergencies. This includes not only health systems and their human resources, but also countries' legal infrastructure for health: the laws and policies that empower, obligate and sometimes limit government and private action. The law is also an important tool in health promotion and protection. Public health professionals play important roles in health law - from the development of policies, through their enforcement, to the scientific evaluation of the health impact of laws. Member States are already mandated to communicate their national health laws and regulations to the World Health Organization (WHO). In this paper we propose that WHO has the authority and credibility to support capacity-building in the area of health law within Member States, and to make national laws easier to access, understand, monitor and evaluate. We believe a strong case can be made to donors for the funding of a public health law centre or unit, that has adequate staffing, is robustly networked with its regional counterparts and is integrated into the main work of WHO. The mission of the unit or centre would be to define and integrate scientific and legal expertise in public health law, both technical and programmatic, across the work of WHO, and to conduct and facilitate global health policy surveillance.
National public health law: a role for WHO in capacity-building and promoting transparency
Tsai, Feng-jen; Anderson, Evan; Kastler, Florian; Sprumont,, Dominique; Burris, Scott
2016-01-01
Abstract A robust health infrastructure in every country is the most effective long-term preparedness strategy for global health emergencies. This includes not only health systems and their human resources, but also countries’ legal infrastructure for health: the laws and policies that empower, obligate and sometimes limit government and private action. The law is also an important tool in health promotion and protection. Public health professionals play important roles in health law – from the development of policies, through their enforcement, to the scientific evaluation of the health impact of laws. Member States are already mandated to communicate their national health laws and regulations to the World Health Organization (WHO). In this paper we propose that WHO has the authority and credibility to support capacity-building in the area of health law within Member States, and to make national laws easier to access, understand, monitor and evaluate. We believe a strong case can be made to donors for the funding of a public health law centre or unit, that has adequate staffing, is robustly networked with its regional counterparts and is integrated into the main work of WHO. The mission of the unit or centre would be to define and integrate scientific and legal expertise in public health law, both technical and programmatic, across the work of WHO, and to conduct and facilitate global health policy surveillance. PMID:27429492
Public Smoking Bans, Youth Access Laws, and Cigarette Sales at Vending Machines
Kvasnicka, Michael
2010-01-01
Tobacco control policies have proliferated in many countries in recent years, in particular youth access laws and public smoking bans. The effectiveness of youth access laws is still disputed, however, as are the costs of public smoking bans to the hospitality industry. Using a unique data set on cigarette sales at more than 100k vending machines that provides first objective evidence on the outgoing and customer behavior of smokers, we study both outcome dimensions by investigating several r...
2011-02-03
... International Law (ACPIL): Public Meeting on Family Law The Department of State, Office of Legal Adviser, Office of Private International Law would like to give notice of a public meeting to discuss preparations for the upcoming Special Commission of the Hague Conference on Private International Law on the 1980...
Paternalism and its discontents: motorcycle helmet laws, libertarian values, and public health.
Jones, Marian Moser; Bayer, Ronald
2007-02-01
The history of motorcycle helmet legislation in the United States reflects the extent to which concerns about individual liberties have shaped the public health debate. Despite overwhelming epidemiological evidence that motorcycle helmet laws reduce fatalities and serious injuries, only 20 states currently require all riders to wear helmets. During the past 3 decades, federal government efforts to push states toward enactment of universal helmet laws have faltered, and motorcyclists' advocacy groups have been successful at repealing state helmet laws. This history raises questions about the possibilities for articulating an ethics of public health that would call upon government to protect citizens from their own choices that result in needless morbidity and suffering.
24 CFR 203.477 - Certificate by lender when loan assigned.
2010-04-01
... AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights and Obligations Rehabilitation Loans § 203.477... a good right to assign. (c) The mortgage transaction did not involve a first mortgage and the mortgage is prior to all mechanics' and materialmen's liens filed of record, regardless of when such liens...
Privatising the Public University: The Case of Law
Thornton, Margaret
2011-01-01
"Privatising the Public University: The Case of Law" is the first full-length critical study examining the impact of the dramatic reforms that have swept through universities over the last two decades. Drawing on extensive research and interviews in Australia, New Zealand, the UK and Canada, Margaret Thornton considers the impact of the…
Washington State's Lystedt law in concussion documentation in Seattle public high schools.
Bompadre, Viviana; Jinguji, Thomas M; Yanez, N David; Satchell, Emma K; Gilbert, Kaiulani; Burton, Monique; Conrad, Ernest U; Herring, Stanley A
2014-01-01
The Lystedt law requires high school athletes who have sustained a concussion to be removed from practice and play and not to be allowed to return until cleared by a medical professional. To determine the effect of the Lystedt law on injury and concussion documentation in the Seattle public high schools. Cross-sectional study. Seattle public high schools. The numbers of students, aged 13 to 19 years in the 2008-2009, 2009-2010, and 2010-2011 school years, were 4348, 4925, and 4806, respectively. All injuries documented in SportsWare by athletic trainers in Seattle public high schools. We evaluated all injuries, including concussions recorded during the 2008-2009 school year, before the Lystedt law, and during the 2 school years after the law took effect (2009-2010 and 2010-2011). Incidence rates before and after the law were estimated and compared. The concussion rate was -1.09% in 2008-2009, 2.26% in 2009-2010, and 2.26% in 2010-2011. A comparison of relative risks showed that the incidence rates of concussions were different before and 1 year after the Lystedt law (relative risk = 2.10; 95% confidence interval [CI] = 1.50, 2.93) and 2 years after the law (relative risk = 2.10; 95% CI = 1.49, 2.93). Overall, the mean number of days out of play after 2008-2009 was almost 7 days greater after the law took effect (difference = 6.9 days; 95% CI = 0.70, 13.1). For females, the mean number of days out of play after 2008-2009 was more than 17 days in 2009-2010 (difference = 17.2 days; 95% CI = 4.81, 29.5) and was more than 6 days in 2010-2011 (difference = 6.3 days; 95% CI = 1.62, 11.0). The number of documented concussions more than doubled after the institution of the Lystedt law, which may be attributed to heightened awareness and closer monitoring.
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Definitions. 811.102 Section 811... URBAN DEVELOPMENT (SECTION 8 HOUSING ASSISTANCE PROGRAMS, SECTION 202 DIRECT LOAN PROGRAM, SECTION 202... PROGRAM) TAX EXEMPTION OF OBLIGATIONS OF PUBLIC HOUSING AGENCIES AND RELATED AMENDMENTS § 811.102...
Community Energy Systems and the Law of Public Utilities. Volume Nine. Connecticut
Energy Technology Data Exchange (ETDEWEB)
Feurer, D A; Weaver, C L
1981-01-01
A detailed description of the laws and programs of the State of Connecticut governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Twelve. Georgia
Energy Technology Data Exchange (ETDEWEB)
Feurer, D A; Weaver, C L
1981-01-01
A detailed description of the laws and programs of the State of Georgia governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community energy systems and the law of public utilities. Volume 20. Louisiana
Energy Technology Data Exchange (ETDEWEB)
Feurer, D A; Weaver, C L
1981-01-01
A detailed description is given of the laws and programs of the State of Louisiana governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities--Volume One: An overview. This report also contains a summary of a strategy described in Volume One--An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enchance the likelihood of ICES implementation.
Wallinga, Marnix
2014-01-01
Legal uncertainty exists with regards to the relationship between a violation of public law conduct of business rules and private law norm setting. In the area of financial services this uncertainty has led to the question whether private law duties of care can deviate from the norms pursuant to
Krey, Volker
2009-01-01
"Analyzing the role of Germany as a law-exporting nation the essay deals with a very specific aspect of the Rule of Lawprinciple in criminal proceedings. The author describes the division of functions among police, public prosecution and criminal courts within criminal law enforcement in Germany adding some comparative law remarks. He furthermore provides an overview of structure and organization of the public prosecution in Germany. He focuses on the relationship and interacti...
41 CFR 102-72.40 - What are facility management delegations?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are facility management delegations? 102-72.40 Section 102-72.40 Public Contracts and Property Management Federal Property... AUTHORITY Delegation of Authority § 102-72.40 What are facility management delegations? Facility management...
14 CFR 47.7 - United States citizens and resident aliens.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false United States citizens and resident aliens... AIRCRAFT AIRCRAFT REGISTRATION General § 47.7 United States citizens and resident aliens. (a) U.S. citizens... the application. (b) Resident aliens. An applicant for aircraft registration under 49 U.S.C. 44102 who...
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Definitions. 102.127 Section 102.127 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Ex Parte Communications... parte communication means an oral or written communication not on the public record with respect to...
42 CFR 413.102 - Compensation of owners.
2010-10-01
...) Definitions—(1) Compensation. Compensation means the total benefit received by the owner for the services he... 42 Public Health 2 2010-10-01 2010-10-01 false Compensation of owners. 413.102 Section 413.102... § 413.102 Compensation of owners. (a) Principle. A reasonable allowance of compensation for services of...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Docket. 102.27 Section 102.27 Foreign Relations... other than the Director of the Office of Aviation and summaries of oral communications prepared in...) All comments submitted under this subpart and placed in the docket, are available for public...
41 CFR 102-192.10 - What authority governs this part?
2010-07-01
... MANAGEMENT Introduction to this Part § 102-192.10 What authority governs this part? This part is governed by... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What authority governs this part? 102-192.10 Section 102-192.10 Public Contracts and Property Management Federal Property...
2010-04-01
... USERRA relate to other laws, public and private contracts, and employer practices? (a) USERRA establishes... law (including any local law or ordinance), contract, agreement, policy, plan, practice, or other... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false How does USERRA relate to other laws, public...
Pomeranz, Jennifer L; Brownell, Kelly D
2008-09-01
Because the rate of consumption of away-from-home meals has increased dramatically, the distinction between requiring nutrition information for packaged but not restaurant products is no longer reasonable. Public health necessitates that nutrition labels must be included with restaurant menus as a strategy to educate consumers and address the escalation of obesity. Menu-labeling laws are being considered at the local, state, and federal levels, but the restaurant industry opposes such action. We discuss the public health rationale and set forth the government's legal authority for the enactment of menu-labeling laws. We further aim to educate the public health community of the potential legal challenges to such laws, and we set forth methods for governments to survive these challenges by drafting laws according to current legal standards.
45 CFR 96.102 - Carryover of unobligated funds.
2010-10-01
... reason or if the State has determined that program objectives would be better served by deferring... 45 Public Welfare 1 2010-10-01 2010-10-01 false Carryover of unobligated funds. 96.102 Section 96.102 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION BLOCK GRANTS Primary...
International Nuclear Information System (INIS)
Lohse, S.; Doerner, E.
1992-01-01
The bibliography contains 1685 references to publications covering the following subject fields: General environmental law; environmental law in relation to constitutional law, administrative law, procedural law, revenue law, criminal law, private law, industrial law; law of regional development; nature conservation law; law on water protection; waste management law; law on protection against harmful effects on the environment; atomic energy law and radiation protection law; law of the power industry and the mining industry; laws and regulations on hazardous material and environmental hygiene. (orig.) [de
Community Energy Systems and the Law of Public Utilities. Volume Eighteen. Kansas
Energy Technology Data Exchange (ETDEWEB)
Feurer, D A; Weaver, C L
1981-01-01
A detailed description is given of the laws and programs of the State of Kansas governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Eleven. Florida
Energy Technology Data Exchange (ETDEWEB)
Feurer, D A; Weaver, C L
1981-01-01
A detailed description is given of the laws and programs of the State of Florida governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Eight. Colorado
Energy Technology Data Exchange (ETDEWEB)
Feurer, D A; Weaver, C L
1981-01-01
A detailed description is given of the laws and programs of the State of Colorado governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Seventeen. Iowa
Energy Technology Data Exchange (ETDEWEB)
Feurer, D A; Weaver, C L
1981-01-01
A detailed description is given of the laws and programs of the State of Iowa governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Nineteen. Kentucky
Energy Technology Data Exchange (ETDEWEB)
Feurer, D A; Weaver, C L
1981-01-01
A detailed description is given of the laws and programs of the State of Kentucky governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Six. Arkansas
Energy Technology Data Exchange (ETDEWEB)
Feurer, D A; Weaver, C L
1981-01-01
A detailed description is given of the laws and programs of the State of Arkansas governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Five. Arizona
Energy Technology Data Exchange (ETDEWEB)
Feurer, D A; Weaver, C L
1981-01-01
A detailed description is given of the laws and programs of the State of Arizona governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Three. Alabama
Energy Technology Data Exchange (ETDEWEB)
Feurer, D A; Weaver, C L
1981-01-01
A detailed description is given of the laws and programs of the State of Alabama governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Sixteen. Indiana
Energy Technology Data Exchange (ETDEWEB)
Feurer, D A; Weaver, C L
1981-01-01
A detailed description is given of the laws and programs of the State of Indiana governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Thirty. Nevada
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is given of the laws and programs of the State of Nevada governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Thirteen. Hawaii
Energy Technology Data Exchange (ETDEWEB)
Feurer, D A; Weaver, C L
1981-01-01
A detailed description is given of the laws and programs of the State of Hawaii governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Seven. California
Energy Technology Data Exchange (ETDEWEB)
Feurer, D A; Weaver, C L
1981-01-01
A detailed description is given of the laws and programs of the State of California governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Ten. Delaware
Energy Technology Data Exchange (ETDEWEB)
Feurer, D A; Weaver, C L
1981-01-01
A detailed description is given of the laws and programs of the State of Delaware governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Fifteen. Illinois
Energy Technology Data Exchange (ETDEWEB)
Feurer, D A; Weaver, C L
1981-01-01
A detailed description is given of the laws and programs of the State of Illinois governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Consequences of the Public Contract Law for Purchase of Scientific Appliances in the Czech Republic
Directory of Open Access Journals (Sweden)
Martin Vyklický
2015-01-01
Full Text Available This article essentially covers in more detail the consequences of the present wording of the Public Contract Law for purchase of scientific appliances in the Czech Republic. The beginning of the article deals with increasing public expenses in research; then, the problem is defined concerning unsuitable wording of certain provisions of the Public Contract Law; while subsequently, the solution for the problem is searched together with the final comments. Investing of public funds into science and research is probably the most efficient in a long-term horizon. However, the flow of funds for acquisition of scientific and research equipment should be supported by appropriate legislation with such wording and form not to prevent purchases of that equipment. Availability of public funds for something which in fact cannot be, due to wrongly set legislation, acquired by a contracting authority is the problem which must be eliminated through timely implementation of the above proposed changes in the Public Contract Law.
Radziwill-Bienkowska, Joanna Maria; Robert, Véronique; Drabot, Karolina; Chain, Florian; Cherbuy, Claire; Langella, Philippe; Thomas, Muriel; Bardowski, Jacek Karol; Mercier-Bonin, Muriel; Kowalczyk, Magdalena
2017-07-01
The ability of Lactococcus lactis to adhere to the intestinal mucosa can potentially prolong the contact with the host, and therefore favour its persistence in the gut. In the present study, the contribution of plasmid-encoded factors to the adhesive and transit properties of the L. lactis subsp. cremoris IBB477 strain was investigated. Plasmid-cured derivatives as well as deletion mutants were obtained and analysed. Adhesion tests were performed using non-coated polystyrene plates, plates coated with mucin or fibronectin and mucus-secreting HT29-MTX intestinal epithelial cells. The results indicate that two plasmids, pIBB477a and b, are involved in adhesion of the IBB477 strain. One of the genes localised on plasmid pIBB477b (AJ89_14230), which encodes cell wall-associated peptidase S8 (PrtP), mediates adhesion of the IBB477 strain to bare, mucin- and fibronectin-coated polystyrene, as well as to HT29-MTX cells. Interactions between bacteria and mucus secreted by HT29-MTX cells were further investigated by fluorescent staining and confocal microscopy. Confocal images showed that IBB477 forms dense clusters embedded in secreted mucus. Finally, the ability of IBB477 strain and its ΔprtP deletion mutant to colonise the gastrointestinal tract of conventional C57Bl/6 mice was determined. Both strains were present in the gut for up to 72 h. In summary, adhesion and persistence of IBB477 were analysed by in vitro and in vivo approaches, respectively. Our studies revealed that plasmidic genes encoding cell surface proteins are more involved in the adhesion of IBB477 strain than in the ability to confer a selective advantage in the gut.
RECENT CJEU CASE LAW TRENDS IN COMPETITION LAW
Directory of Open Access Journals (Sweden)
Virgilijus Valančius
2017-12-01
Full Text Available The objective of this article is to present the most significant recent case law of the Court of Justice of the European Union (CJEU related to the competition law. Firstly, focus is given to some recent CJEU case law in the antitrust area, i.e. the judgments dealing with the application of Articles 101 and 102 of the Treaty on the Functioning of the European Union (TFEU. A special attention is paid to the most recent CJEU case law analyzing the distinction between the object and effect of the prevention, restriction or distortion of competition. Secondly, some significant State aid cases are dealt with, i.e. the cases related to the application of Article 107 TFEU. Although the CJEU case law has not recently undergone major changes in the competition law field, the article reflects the main trends towards the current jurisprudence and what challenges may be expected in the future.
Removal of Public Officers from Office: Law and Justice in a Flux ...
African Journals Online (AJOL)
The courts have striven with changing trends in ensuring balance and justice for both the workers and the industries. The author's appraisal of case law puts in view the state of both substantive and procedural law on the discipline of public officers as expounded by judges in the exercise of their power of judicial review.
24 CFR 984.102 - Program objectives.
2010-04-01
... education, employment, and business and social skills necessary to achieve self-sufficiency, as defined in... 984.102 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued... SECTION 8 AND PUBLIC HOUSING FAMILY SELF-SUFFICIENCY PROGRAM General § 984.102 Program objectives. The...
Directory of Open Access Journals (Sweden)
Aurelian Virgil BĂLUŢĂ
2012-06-01
Full Text Available The following issues are being adressed in this paper: the relationship of accounting and accounting law with the local economy, the relationship of accounting and accounting law with macroeconomics, establishing public policies for certain categories of enterprises based on information provided by accounting and accounting law, the relationship of accounting and accounting law with macroeconomics foresight and forecast, the relationship of accounting and accounting law with the labor economy, the impact the wage regulations has on public economic policies under firm ownership change.
Howse, Genevieve
2012-09-01
Pacific countries are sovereign nations with distinctive histories, ethnicity, customs, primary resources, economies, and health systems. Despite these and other acknowledged differences, similarities exist in many areas such as geography, legal history, and culture. Many share the experience of colonization, with imported British laws and the subsequent experience of independence. Most Pacific countries are also developing countries. This article broadly describes approaches to legislating in public health in Papua New Guinea, Fiji, Vanuatu, and the Solomon Islands and notes common elements in their public health laws, in particular, in relation to administration, allocation of powers and responsibilities, interaction with local government, communicable disease control, and nuisance. The article concludes that many Pacific public health laws could deliver better support for current health policy, more sensitivity to the culture and customs of the region, and better management of public health risk through laws that are better suited to their Pacific environment, easier to understand, more flexible, and more relevant to current health policy.
The Impact of the Law on the Practice of Public Relations Discourse.
Pohl, Gayle M.
A review of the literature useful for public relations researchers and students explored the primary legal concerns that public relations practitioners face, including first amendment rights, insider trading, regulations when working with foreign organizations, disclosure, privacy, copyright/trademark law, advertising, and defamation. Public…
A Critical Review of the Proposed Palestinian Public Debt Law
International Development Research Centre (IDRC) Digital Library (Canada)
JIHAD
borrow from external or domestic resources to finance the gap between revenues and ... the Bir Zeit University Institute of Law, who evaluated the study. I would ... service its public debt is shaped by the capital market constraints it faces,.
41 CFR 101-1.102 - Federal Property Management Regulations.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Federal Property Management Regulations. 101-1.102 Section 101-1.102 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS GENERAL 1-INTRODUCTION 1.1-Regulation...
42 CFR 102.80 - Calculation of medical benefits.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Calculation of medical benefits. 102.80 Section 102... COMPENSATION PROGRAM Calculation and Payment of Benefits § 102.80 Calculation of medical benefits. In calculating medical benefits, the Secretary will take into consideration all reasonable costs for those...
Regulatory Powers in Public Procurement Law of Peruvian Administrative Agencies
Directory of Open Access Journals (Sweden)
Juan Carlos Morón Urbina
2017-12-01
Full Text Available Peruvian law has explicitly recognized regulatory powers to administrative agencies, which allows them to have a preponderant role in the production of rules in public procurement. Although these delegations of legislative authority are positively defined, distortions in the system of legal sources arise when agencies exceed delegated powers or when measures issued by administrative entities are mistaken for regulations. This paper aims to identify regulatory powers of Peruvian administrative agencies, as well as the regulatory measures they issue, and their relation with other sources of law.
41 CFR 102-35.25 - What management reports must we provide?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What management reports must we provide? 102-35.25 Section 102-35.25 Public Contracts and Property Management Federal Property... PERSONAL PROPERTY § 102-35.25 What management reports must we provide? (a) There are three reports that...
41 CFR 102-83.85 - What is a central business area?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is a central business area? 102-83.85 Section 102-83.85 Public Contracts and Property Management Federal Property... Location of Space Urban Areas § 102-83.85 What is a central business area? Central business area (CBA...
41 CFR 102-85.95 - Who pays for the TI allowance?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Who pays for the TI allowance? 102-85.95 Section 102-85.95 Public Contracts and Property Management Federal Property Management... GSA SPACE Tenant Improvement Allowance § 102-85.95 Who pays for the TI allowance? The customer agency...
THE INTERFERENCE OF EUROPEAN UNION LAW WITH PUBLIC INTERNATIONAL LAW
Directory of Open Access Journals (Sweden)
ROXANA-MARIANA POPESCU
2011-04-01
Full Text Available The European Union Law is an unique legal phenomenon developed in the process of European integration within the framework of the European Communities and the European Union; a result of the implementation of the supranational authority of the European institutions. The European Union law is a specific legal system having independent sources and principles that developed at the border-line of international law and domestic law of the EU’s Member States. The authonomy of the European Union law is affirmed by a case-law of the Court of Justice of the European Union.The European Union has its own legal order which is separate from international law and forms an integral part of the legal systems of the Member States. The legal order of the Union is founded on various different sources of law. The different nature of these sources has imposed a hierarchy among them. At the pinnacle of this hierarchy we find primary law, represented by the Treaties and general legal principles, followed by international treaties concluded by the Union and secondary law founded on the Treaties.
41 CFR 102-117.110 - What is satisfactory service?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is satisfactory service? 102-117.110 Section 102-117.110 Public Contracts and Property Management Federal Property... satisfactory service? You should consider the following factors in assessing whether a TSP offers satisfactory...
42 CFR 102.33 - Death benefits.
2010-10-01
... PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX COMPENSATION PROGRAM... are described in § 102.82. As provided in § 102.84, the Secretary retains the right to recover death... secondary to disability benefits under the PSOB Program. Any death benefit paid under the standard...
Evaluation of poultry processing practices, related public health laws ...
African Journals Online (AJOL)
Evaluation of poultry processing practices, related public health laws and diseases of chickens at slaughter: A pilot study in Kaduna state. ... The PDF file you selected should load here if your Web browser has a PDF reader plug-in installed (for example, a recent version of Adobe Acrobat Reader). If you would like more ...
42 CFR 102.82 - Calculation of death benefits.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Calculation of death benefits. 102.82 Section 102... COMPENSATION PROGRAM Calculation and Payment of Benefits § 102.82 Calculation of death benefits. (a... paragraph (d) of this section for the death benefit available to dependents. (2) Deceased person means an...
The modernization of American public law: health care reform and popular constitutionalism.
Super, David A
2014-04-01
The Patient Protection and Affordable Care Act (ACA) transformed U.S. public law in crucial ways extending far beyond health care. As important as were the doctrinal shifts wrought by National Federation of Independent Business v. Sebelius, the ACA's structural changes to public law likely will prove far more important should they become entrenched. The struggle over the ACA has triggered the kind of "constitutional moment" that has largely replaced Article V's formal amendment procedure since the Prohibition fiasco. The Court participates in this process, but the definitive and enduring character of these constitutional moments' outcomes springs from broad popular engagement. Despite the Court's ruling and the outcome of the 2012 elections, the battle over whether to implement or shelve the ACA will continue unabated, both federally and in the states, until We the People render a clear decision. Whether the ACA survives or fails will determine the basic principles that guide the development of federalism, social insurance, tax policy, and privatization for decades to come. In each of these areas, the New Deal bequeathed us a delicate accommodation between traditionalist social values and modernizing norms of economic efficiency and interest group liberalism. This balance has come under increasing stress, with individual laws rejecting tradition far more emphatically than the New Deal did. But absent broad popular engagement, no definitive new principles could be established. The ACA's entrenchment would elevate technocratic norms across public law, the first change of our fundamental law since the civil rights revolution. The ACA's failure would rejuvenate individualistic, moralistic, pre-New Deal norms and allow opponents to attempt a counterrevolution against technocracy.
The administrative agreement as a legal form for public services in comparative and roman law
Directory of Open Access Journals (Sweden)
Cristina IONAŞ
2012-01-01
Full Text Available Doctrinal discussions on the administrative agreement have arisen along with the economic, social and industrial development of European countries. The principle of separation of powers adopted in France after the Revolution of 1789, the need to protect private law subjects, has become increasingly necessary as private subjects may be affected by the exercise of public power. Gradually, given the need to protect the interest of both public and private sectors, it has been proceeded to create a system of administrative law, separate from the common law system.
41 CFR 102-192.25 - Does this part apply to me?
2010-07-01
... MANAGEMENT Introduction to this Part § 102-192.25 Does this part apply to me? Yes, this part applies to you... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Does this part apply to me? 102-192.25 Section 102-192.25 Public Contracts and Property Management Federal Property...
41 CFR 102-33.65 - What is the process for acquiring Government aircraft?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is the process for acquiring Government aircraft? 102-33.65 Section 102-33.65 Public Contracts and Property Management Federal... process; planning, budgeting, and contracting, as described in §§ 102-33.70 through 102-33.105. Planning...
42 CFR 102.32 - Benefits for lost employment income.
2010-10-01
... 102.32 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX... pay for lost employment income or to provide disability or retirement benefits to the requester. As provided in § 102.84, the Secretary retains the right to recover benefits for lost employment income paid...
Stevens, Leslie Anne
2017-01-01
Due to legal uncertainty surrounding the application of key provisions of European and UK data protection law, the public interest in protecting individuals’ informational privacy is routinely neglected, as are the public interests in certain uses of data. Consent or anonymisation are often treated as the paradigmatic example of compliance with data protection law, even though both are unable to attend to the full range of rights and interests at stake in data processing. Curre...
42 CFR 102.83 - Payment of all benefits.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Payment of all benefits. 102.83 Section 102.83... COMPENSATION PROGRAM Calculation and Payment of Benefits § 102.83 Payment of all benefits. (a) The Secretary may pay any benefits under this Program through lump-sum payments. If the Secretary determines that...
International Nuclear Information System (INIS)
Ali, A. M.; Abd El-Moniem, A. E.
2012-12-01
This paper deals with the Nuclear Facilities Licensing Regime and the public Opinion participation. It discusses the general conceptual framework such as the importance of public opinion in the licensing process for nuclear facilities. It deals with the transparency principle and the nuclear safety. It also an analysis the Egyptian nuclear law for regulating the nuclear and radiological activities(law No.7) and its provisions that regulate the participation of the public in the licensing process (Article No.12 paragraph No.7 and 16 ) that staled that the regulatory body will set the regulation to involve the public in the licensing and it will also issues publicly a garrulity report about the nuclear safety situation in the state. It also deals with the legal rules for licensing and the participation of public in it many states such as Japan, France and Germany. The paper concluded that the lunch of a nuclear programme should lunch, in parallel, a programme for the public communications because in the absent of such a public programme, the political decisions of nuclear programme might be lose its effectiveness and the programme might be slow dow. (Author)
Energy Technology Data Exchange (ETDEWEB)
NSTec Environmental Restoration
2010-03-15
This Corrective Action Decision Document (CADD)/Closure Report (CR) was prepared by the Defense Threat Reduction Agency (DTRA) for Corrective Action Unit (CAU) 477, N-Tunnel Muckpile. This CADD/CR is consistent with the requirements of the Federal Facility Agreement and Consent Order (FFACO) agreed to by the State of Nevada, the U.S. Department of Energy, and the U.S. Department of Defense. Corrective Action Unit 477 is comprised of one Corrective Action Site (CAS): • 12-06-03, Muckpile The purpose of this CADD/CR is to provide justification and documentation supporting the recommendation for closure with no further action, by placing use restrictions on CAU 477.
41 CFR 102-192.170 - What are GSA's responsibilities in mail management?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are GSA's responsibilities in mail management? 102-192.170 Section 102-192.170 Public Contracts and Property Management... PROGRAMS 192-MAIL MANAGEMENT GSA's Responsibilities and Services § 102-192.170 What are GSA's...
Community Energy Systems and the Law of Public Utilities. Volume Twenty-one. Maine
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is given of the laws and programs of the State of Maine governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Forty-eight. Virginia
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is presented of the laws and programs of the State of Virginia governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Twenty-three. Massachusetts
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is given of the laws and programs of the State of Massachusetts governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Fifty. West Virginia
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is presented of the laws and programs of the State of West Virginia governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Forty-four. Tennessee
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is presented of the laws and programs of the State of Tennessee governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Thirty-seven. Ohio
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is presented of the laws and programs of the State of Ohio governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Thirty-nine. Oregon
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is presented of the laws and programs of the State of Oregon governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Twenty-eight. Montana
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is presented of the laws and programs of the State of Montana governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Twenty-five. Minnesota
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is given of the laws and programs of the State of Minnesota governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Forty-five. Texas
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is presented of the laws and programs of the State of Texas governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Forty-six. Utah
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is presented of the laws and programs of the State of Utah governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilites, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Fifty-two. Wyoming
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is presented of the laws and programs of the State of Wyoming governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Forty-nine. Washington
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is presented of the laws and programs of the State of Washington governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Fifty-one. Wisconsin
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is presented of the laws and programs of the State of Wisconsin governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Twenty-two. Maryland
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is given of the laws and programs of the State of Maryland governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Twenty-seven. Missouri
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is given of the laws and programs of the State of Missouri governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
41 CFR 102-118.10 - What is a transportation audit?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is a transportation audit? 102-118.10 Section 102-118.10 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION TRANSPORTATION 118-TRANSPORTATION...
41 CFR 102-118.15 - What is a transportation payment?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is a transportation payment? 102-118.15 Section 102-118.15 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION TRANSPORTATION 118-TRANSPORTATION...
41 CFR 102-2.5 - What is the Federal Management Regulation (FMR)?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is the Federal Management Regulation (FMR)? 102-2.5 Section 102-2.5 Public Contracts and Property Management Federal... MANAGEMENT REGULATION SYSTEM Regulation System General § 102-2.5 What is the Federal Management Regulation...
41 CFR 102-37.580 - Who is responsible for costs associated with the donation?
2010-07-01
... costs associated with the donation? 102-37.580 Section 102-37.580 Public Contracts and Property... PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY Donations to Public Bodies in Lieu of Abandonment/Destruction § 102-37.580 Who is responsible for costs associated with the donation? The recipient public body...
Workers safety in public psychiatric services: problems, laws and protections.
Carabellese, F; Urbano, M; Coluccia, A; Gualtieri, G
2017-01-01
The dramatic case of murder of a psychiatrist during her service in her public office (Centro di Salute Mentale of Bari-Libertà) has led the authors to reflect on the safety of workplaces, in detail of public psychiatric services. It is in the light of current legislation, represented by the Legislative Decree of April 9th, 2008 no. 81, which states the implementing rules of Law 123/2007. In particular, the Authors analyzed the criticalities of the application of this Law, with the aim of safeguarding the health and safety of the workers in all psychiatric services (nursing departments, outpatient clinics, community centers, day care centers, etc.). The Authors suggest the need to set up an articulated specific organizational system of risk assessment of psychiatric services, that can prevent and protect the workers from identified risks, and finally to ensure their active participation in prevention and protection activities, in absence of which specific profiles of responsibility would be opened up to the employers.
2010-01-01
... under Public Law 103-354 securities-issuance and redemption of certificate by Reserve bank. 1901.506... applied to such FmHA or its successor agency under Public Law 103-354 securities, the Reserve bank is... successor agency under Public Law 103-354 securities. (3) A Reserve bank as fiscal agent of the United...
41 CFR 102-192.5 - What does this part cover?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What does this part cover? 102-192.5 Section 102-192.5 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT...
41 CFR 102-34.345 - What records do we need to keep?
2010-07-01
... MANAGEMENT Federal Fleet Report § 102-34.345 What records do we need to keep? You are responsible for... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What records do we need to keep? 102-34.345 Section 102-34.345 Public Contracts and Property Management Federal Property...
2010-10-01
... kg of non-fissile or fissile-excepted uranium hexafluoride. 173.477 Section 173.477 Transportation... non-fissile or fissile-excepted uranium hexafluoride. (a) Each offeror of a package containing more than 0.1 kg of uranium hexafluoride must maintain on file for at least one year after the latest...
Public opinion about laws to prohibit weight discrimination in the United States.
Puhl, Rebecca M; Heuer, Chelsea A
2011-01-01
Weight discrimination is pervasive in American society and impairs quality of life for obese persons. With approximately two-thirds of Americans now overweight or obese, vast numbers of people are vulnerable to weight prejudice and its consequences. Currently, no laws exist to prohibit weight discrimination. This study conducted an online survey with a national sample of 1,001 adults (representing demographics of the United States) to examine public support for six potential legislative measures to prohibit weight discrimination in the United States. Results indicated substantial support (65% of men, 81% of women) for laws to prohibit weight discrimination in the workplace, especially for legal measures that would prohibit employers from refusing to hire, terminate, or deny promotion based on a person's body weight. Laws that proposed extending the same protections to obese persons as people with physical disabilities received the least support, suggesting that Americans may not be in favor of considering obesity as a disability. Findings also highlight specific predictors of support (related to sex, age, education, income, body weight, and political ideology). These findings can be used to inform policy makers in efforts to develop antidiscrimination laws. Such measures will rectify health disparities for overweight Americans and facilitate public health efforts to address obesity.
Public participation in nuclear licensing procedures from the viewpoint of constitutional law
International Nuclear Information System (INIS)
Mutschler, Ulrich
1981-10-01
This paper reviews public participation in the licensing procedure for nuclear installations, in particular in the Federal Republic of Germany. Examples are given of practical experience acquired to date, also in the field of case-law. Finally, the paper stresses the importance of public information in nuclear procedures in view of the growing concerns for the environment. (NEA) [fr
Directory of Open Access Journals (Sweden)
Liber Martin
2015-04-01
Full Text Available This work analyzed the informal mechanisms of public water allocation and reallocation in western Argentina from a holistic conception of law. The paper refers to informal uses, its logical but ineffective repression and the continuous regularization processes from a non experimental observational method based on the use of qualitative strategies. The research work focused on the operation of water allocation mechanisms and management practices developed in the absence of law and against the law, at both the delivery and regulatory levels. The findings highlight the tensions and contradictions of these mechanisms under the formal legal system, demonstrating the crisis of both effectiveness and legitimacy of the law and the State in managing public waters.
41 CFR 105-1.102 - Relationship of GSPMR to FPMR.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Relationship of GSPMR to FPMR. 105-1.102 Section 105-1.102 Public Contracts and Property Management Federal Property Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION 1-INTRODUCTION 1.1-Regulations System § 105-1...
The association of state law to physical education time allocation in US public schools.
Perna, Frank M; Oh, April; Chriqui, Jamie F; Mâsse, Louise C; Atienza, Audie A; Nebeling, Linda; Agurs-Collins, Tanya; Moser, Richard P; Dodd, Kevin W
2012-08-01
We examined whether public schools in states with specific and stringent physical education (PE) laws, as assessed by the Physical Education-Related State Policy Classification System (PERSPCS), available on the Classification of Laws Associated with School Students (C.L.A.S.S.) Web site, reported more weekly PE time in the most recent School Health Policies and Programs Survey (SHPPS). Schools (n=410) were grouped by their state's PERSPCS time requirement scores (none, nonspecific requirement, or specific requirement). Average weekly school-level PE was calculated using the SHPPS-reported PE minutes. Weighted analyses determined if PE minutes/week differed by PERSPCS group. Schools in states with specific requirement laws averaged over 27 and 60 more PE minutes/week at the elementary and middle school levels, respectively, compared with schools within states with nonspecific laws and over 40 and 60 more PE minutes per week, respectively, compared with elementary and middle schools in states with no laws. High school results were nonsignificant. Public health guidelines recommend at least 60 minutes of daily physical activity for children, and PE may further this goal. Strong codified law with specific time requirements for PE may be an important tool contributing toward adequate PE time and daily physical activity recommendations.
Theoretical Reflections on the Public-Private Distinction and their Traces in European Union Law
Directory of Open Access Journals (Sweden)
Constanze Semmelmann
2012-06-01
Full Text Available From its inception, EU law has been organised with (economic integration as its guiding paradigm. A public-private distinction as it is known in many civil law countries has never been a characterising feature of EU law. In the absence of such a divide in EU law, the public and the private sphere interact differently. First, the attempt to strike a balance between the state and the market reflects the struggle for a delineation between public and private power. Second, the evolution of the personal scope of EU internal market law and fundamental rights increasingly involves private parties at both sides. Third, the emergence of European contract law has led to conceptual clashes between the international trade law paradigm and the public-private distinction in the tradition of civil law countries. It will be argued that EU law scholarship and legal practice will have to re-conceptualise the role of the individual and private parties as subjects of the law, bearers of rights and addressees of obligations in order to flesh out what is known as the private law element in many national legal cultures. Desde su creación, la legislación de la Unión Europea (UE se ha organizado en base al paradigma orientador de la integración (económica. La legislación comunitaria nunca se ha caracterizado por una distinción público-privada como la existente en el derecho civil de numerosos países. Ante la ausencia de esta división en la legislación de la UE, la esfera pública y la privada interactúan de forma indiferente. En primer lugar, el intento de lograr un equilibrio entre el Estado y el mercado refleja la lucha por una delimitación entre el poder público y el privado. En segundo lugar, la evolución del alcance privado de la legislación sobre el mercado interno europeo y los derechos fundamentales hace que se impliquen cada vez más poderes privados en ambas partes. En tercer lugar, el surgimiento del derecho contractual europeo ha dado lugar a
Electronic Signatures in Global and National Commerce Act. Public Law.
Congress of the U.S., Washington, DC.
This document presents the text of Public Law 106-229, the "Electronic Signatures in Global and National Commerce Act." The act states that, with respect to any transaction in or affecting interstate or foreign commerce: a signature, contract, or other record relating to such transaction may not be denied legal effect, validity, or…
19 CFR 102.22 - Rules of origin for textile and apparel products of Israel.
2010-04-01
... of Israel. 102.22 Section 102.22 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF... textile and apparel products of Israel. (a) Applicability. The provisions of this section will control for... product of Israel for purposes of the customs laws and the administration of quantitative limitations. A...
41 CFR 102-33.40 - What are GSA's responsibilities for Federal aviation management?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are GSA's responsibilities for Federal aviation management? 102-33.40 Section 102-33.40 Public Contracts and Property... PROPERTY 33-MANAGEMENT OF GOVERNMENT AIRCRAFT How These Rules Apply Responsibilities § 102-33.40 What are...
41 CFR 102-83.80 - What is an urban area?
2010-07-01
... defined by the Office of Management and Budget (OMB) in OMB Bulletin No. 99-04, or succeeding OMB Bulletin... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is an urban area? 102-83.80 Section 102-83.80 Public Contracts and Property Management Federal Property Management...
41 CFR 102-118.20 - Who is subject to this part?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Who is subject to this part? 102-118.20 Section 102-118.20 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION TRANSPORTATION 118-TRANSPORTATION...
41 CFR 102-41.235 - May we sell forfeited drug paraphernalia?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false May we sell forfeited drug paraphernalia? 102-41.235 Section 102-41.235 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY 41...
41 CFR 102-79.105 - What is the Integrated Workplace?
2010-07-01
... changing needs of the occupants and the organization. Integrated Workplace concepts support the objectives... Workplace? 102-79.105 Section 102-79.105 Public Contracts and Property Management Federal Property... UTILIZATION OF SPACE Assignment and Utilization of Space Integrated Workplace § 102-79.105 What is the...
42 CFR 489.102 - Requirements for providers.
2010-10-01
..., nursing facilities, home health agencies, providers of home health care (and for Medicaid purposes... individual's admission as a resident. (3)(i) In the case of a home health agency, in advance of the... 42 Public Health 5 2010-10-01 2010-10-01 false Requirements for providers. 489.102 Section 489.102...
22 CFR 102.25 - Submission of comments.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Submission of comments. 102.25 Section 102.25 Foreign Relations DEPARTMENT OF STATE ECONOMIC AND OTHER FUNCTIONS CIVIL AVIATION Recommendations to the... confidential in the interest of national defense or foreign policy, are to be placed in a public docket and...
Community Energy Systems and the Law of Public Utilities. Volume Thirty-two. New Jersey
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is presented of the laws and programs of the State of New Jersey governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Forty-two. South Carolina
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is given of the laws and programs of the State of South Carolina governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Forty-three. South Dakota
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is presented of the laws and programs of the State of South Dakota governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Forty-one. Rhode Island
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is presented of the laws and programs of the State of Rhode Island governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Thirty-one. New Hampshire
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is presented of the laws and programs of the State of New Hampshire governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One. An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community Energy Systems and the Law of Public Utilities. Volume Thirty-six. North Dakota
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is presented of the laws and programs of the State of North Dakota governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Community energy systems and the law of public utilities. Volume thirty-four. New York
Energy Technology Data Exchange (ETDEWEB)
Feurer, D.A.; Weaver, C.L.
1981-01-01
A detailed description is presented of the laws and programs of the State of New York governing the regulation of public energy utilities, the siting of energy generating and transmission facilities, the municipal franchising of public energy utilities, and the prescription of rates to be charged by utilities including attendant problems of cost allocations, rate base and operating expense determinations, and rate of return allowances. These laws and programs are analyzed to identify impediments which they may present to the implementation of Integrated Community Energy Systems (ICES). This report is one of fifty-one separate volumes which describe such regulatory programs at the Federal level and in each state as background to the report entitled Community Energy Systems and the Law of Public Utilities - Volume One: An Overview. This report also contains a summary of a strategy described in Volume One - An Overview for overcoming these impediments by working within the existing regulatory framework and by making changes in the regulatory programs to enhance the likelihood of ICES implementation.
Soft law in public international law : a pragmatic or a principled choice?
Brus, Marcel M.T.
2017-01-01
This paper discusses the role of soft law in international law, in particular in the field of sustainable development law. Soft law is often regarded as non-law. However this qualification increasingly does not match the realities of the development of international law in which many legally
2010-01-01
... ownership in FmHA or its successor agency under Public Law 103-354 loans. (a) Special trust of loans—(1) Establishment of special trusts. From time to time FmHA or its successor agency under Public Law 103-354 will... successor agency under Public Law 103-354 will own an interest in special trusts equal to the amount by...
Measuring up to the Model: A Ranking of State Public Charter School Laws. Ninth Annual Edition
Ziebarth, Todd; Palmer, Louann Bierlein
2018-01-01
This ninth edition of "Measuring up to the Model: A Ranking of State Charter School Laws" presents the latest activity in charter public school legislation across the country. For the second year in a row, the 2018 rankings measure each state's charter school law against the National Alliance's updated model charter school law, "New…
41 CFR 102-74.15 - What are the facility management responsibilities of occupant agencies?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the facility management responsibilities of occupant agencies? 102-74.15 Section 102-74.15 Public Contracts and Property... PROPERTY 74-FACILITY MANAGEMENT Facility Management § 102-74.15 What are the facility management...
Aurelian Virgil BĂLUŢĂ
2012-01-01
The following issues are being adressed in this paper: the relationship of accounting and accounting law with the local economy, the relationship of accounting and accounting law with macroeconomics, establishing public policies for certain categories of enterprises based on information provided by accounting and accounting law, the relationship of accounting and accounting law with macroeconomics foresight and forecast, the relationship of accounting and accounting law with the labor economy...
Mańko, R.; Sitek, B.; Szczerbowski, J.J.; Bauknecht, A.W.; Szpanowska, M.; Wasyliszyn, K.
2015-01-01
In line with Lenin’s famous quote that Bolsheviks "do not recognise anything private" and that private law must be permeated with public interest, the private (civil) law of the USSR and other countries of the Soviet bloc, including Poland underwent reform aimed at furthering the public interest at
Labor law violations in Japanese public hospitals from March 2002 to March 2011.
Ehara, Akira
2013-02-01
According to the Japan Pediatric Society, the mean extra work hours of hospital pediatricians in 2010 was approximately 80 h per month, which is the certification criterion for Karoshi (death from overwork), but there is no precise picture of personnel management at hospitals because the labor authorities do not disclose detailed statistics concerning labor law violations to the public. Most local governments have a disclosure system, and the local governments that operate public hospitals were requested to disclose warning documents issued by the labor authorities from March 2002 to March 2011. A total of 208/369 public hospitals (56.4%) with ≥200 beds in Japan were warned of labor law violations. Offenses included exceeding the limit of working hours (177 hospitals) and non-payment of increased wages for night and holiday work (98 hospitals). Many public hospitals in Japan did not always pay workers including physicians for increased workload because they do not regard night and holiday duties as work hours. © 2012 The Author. Pediatrics International © 2012 Japan Pediatric Society.
48 CFR 52.250-1 - Indemnification Under Public Law 85-804.
2010-10-01
... caused by willful misconduct or lack of good faith on the part of any of the Contractor's principal... Public Law 85-804. 52.250-1 Section 52.250-1 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and...
41 CFR 102-33.130 - If we hire CAS, what are our management responsibilities?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false If we hire CAS, what are our management responsibilities? 102-33.130 Section 102-33.130 Public Contracts and Property... § 102-33.130 If we hire CAS, what are our management responsibilities? If you hire CAS, you are...
41 CFR 102-194.5 - What is the Standard and Optional Forms Management Program?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is the Standard and Optional Forms Management Program? 102-194.5 Section 102-194.5 Public Contracts and Property Management... PROGRAMS 194-STANDARD AND OPTIONAL FORMS MANAGEMENT PROGRAM § 102-194.5 What is the Standard and Optional...
41 CFR 102-42.25 - Who retains custody of gifts and decorations pending disposal?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Who retains custody of gifts and decorations pending disposal? 102-42.25 Section 102-42.25 Public Contracts and Property..., Handling and Disposition § 102-42.25 Who retains custody of gifts and decorations pending disposal? (a) The...
41 CFR 102-2.140 - What elements of plain language appear in the FMR?
2010-07-01
... MANAGEMENT REGULATION SYSTEM Plain Language Regulatory Style § 102-2.140 What elements of plain language... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What elements of plain language appear in the FMR? 102-2.140 Section 102-2.140 Public Contracts and Property Management Federal...
Monitoring Manual for Determining Compliance with Public Law 94-142. Revised.
South Carolina State Dept. of Education, Columbia.
Designed to assist service providers as they strive to provide a full service goal for all handicapped pupils, this manual consists of checklists for monitoring compliance with Public Law 94-142 (Education for All Handicapped Children Act). Checklists of components in general policy areas are: (1) policy requirements (LEAs - Local Educational…
Henderson, Ana; Fry, Christine R
2011-01-01
Improving parks in low income and minority neighborhoods may be a key way to increase physical activity and decrease overweight and obesity prevalence among children at the greatest risk. To advocate effectively for improved recreation infrastructure, public health advocates must understand the legal and policy landscape in which public recreation decisions are made. In this descriptive legal analysis, we reviewed federal, state, and local laws to determine the authority of each level of government over parks. We then examined current practices and state laws regarding park administration in urban California and rural Texas. We identified several themes through the analysis: (1) multiple levels of governments are often involved in parks offerings in a municipality, (2) state laws governing parks vary, (3) local authority may vary substantially within a state, and (4) state law may offer greater authority than local jurisdictions use. Public health advocates who want to improve parks need to (1) think strategically about which levels of government to engage; (2) identify parks law and funding from all levels of government, including those not typically associated with local parks; and (3) partner with advocates with similar interests, including those from active living and school communities.
41 CFR 102-118.30 - Are Government corporations bound by this part?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Are Government corporations bound by this part? 102-118.30 Section 102-118.30 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION TRANSPORTATION 118...
41 CFR 102-118.5 - What is the purpose of this part?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is the purpose of this part? 102-118.5 Section 102-118.5 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION TRANSPORTATION 118-TRANSPORTATION...
41 CFR 102-41.210 - What are some examples of drug paraphernalia?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are some examples of drug paraphernalia? 102-41.210 Section 102-41.210 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY 41...
41 CFR 102-34.85 - What motor vehicles require motor vehicle identification?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What motor vehicles require motor vehicle identification? 102-34.85 Section 102-34.85 Public Contracts and Property Management... 34-MOTOR VEHICLE MANAGEMENT Identifying and Registering Motor Vehicles Motor Vehicle Identification...
Directory of Open Access Journals (Sweden)
Fabio Espitia Garzón
2016-12-01
Full Text Available The secular and detailed study of Roman Private Law institutions has, for centuries, diverted the attention to institutions pertaining to the Public Law sphere. Such studies were a consequence of the triumph of bourgeois ideas from the Enlightenment, which were structured on a set of principles (separation of powers, the principle of legality both considered absolute truths, even though today they seem more like myths. This understanding shifted during the second half of the twentieth century, when scholars of Roman Law began to more comprehensively analyze Rome’s constitutional institutions as well as its criminal repression. This paper begins with a review of some of the most important works and articles produced since the fifties until present day about the so called ‘general ’and ´special’ Criminal Law, and the Law of Criminal Procedure, it then focuses on how useful those texts are in order to solve actual problems, taking as an example the subject of crimes against public administration, given the actual need to pursue the assets obtained from such activities, despite the perpetrator’s death, which means going beyond the principle of the individual nature of penalties.
41 CFR Appendix A to Part 102 - 37-Miscellaneous Donation Statutes
2010-07-01
... Donation Statutes A Appendix A to Part 102 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY Pt. 102-37, App. A Appendix A to Part 102-37—Miscellaneous Donation Statutes The...
Materialities of Law: Celebrity Production and the Public Domain
Directory of Open Access Journals (Sweden)
Esther Milne
2009-12-01
Full Text Available Celebrity production and consumption are powerful socio-economic forces. The celebrity functions as a significant economic resource for the commercial sector and plays a fundamental symbolic role within culture by providing a shared ‘vocabulary’ through which to understand contemporary social relations. A pivotal element of this allure is the process by which the celebrity figure is able to forge an intimate link with its audience, often producing public expressions of profound compassion, respect or revulsion. This process, however, is complicated by emerging participatory media forms whose impact is experienced as new conditions of possibility for celebrity production and consumption. As Marshall argues, video mash-ups of celebrity interviews, such as those of Christian Bale or Tom Cruise, are dramatically changing the relation between celebrity and audience (Marshall, 2006: 640. Meanings produced by these audience remixes challenge the extent to which a celebrity might control her image. So is the celebrity personality, therefore, a public or private commodity? Who owns the celebrity image within remix culture? Although the celebrity figure has been thoroughly researched in relation to its patterns of consumption; semiotic power; and industry construction; less attention has been focused on the forms of celebrity governance enabled by legislative and case law settings. How might the law deal with the significant economic and cultural power exercised within celebrity culture?
41 CFR 102-192.30 - What types of mail does this part apply to?
2010-07-01
... 192-MAIL MANAGEMENT Introduction to this Part § 102-192.30 What types of mail does this part apply to... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What types of mail does this part apply to? 102-192.30 Section 102-192.30 Public Contracts and Property Management Federal...
41 CFR 102-192.155 - What should our agency-wide mail management policy statement cover?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What should our agency-wide mail management policy statement cover? 102-192.155 Section 102-192.155 Public Contracts and... REGULATION ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT Other Agency Responsibilities § 102-192.155 What...
41 CFR 102-192.120 - Must we have an agency mail manager?
2010-07-01
... mail manager? 102-192.120 Section 102-192.120 Public Contracts and Property Management Federal Property... MANAGEMENT Agency Mail Manager Requirements § 102-192.120 Must we have an agency mail manager? Yes, every Federal agency as defined in § 102-192.35 must have an agency mail manager. Agencies that are not “large...
41 CFR 102-34.330 - What is the Federal Fleet Report?
2010-07-01
... Fleet Report? 102-34.330 Section 102-34.330 Public Contracts and Property Management Federal Property... MANAGEMENT Federal Fleet Report § 102-34.330 What is the Federal Fleet Report? The Federal Fleet Report (FFR..., in evaluating the effectiveness of the operation and management of individual fleets to determine...
Janssen, Willem A.|info:eu-repo/dai/nl/374662819
2014-01-01
From a EU public procurement law perspective, contracting authorities have a discretionary power to decide upon who is allowed and best suited to provide public services to the public. When public authorities deem the in-house performance of a service to be the most suitable, the Court of Justice of
41 CFR 102-85.20 - What does an Occupancy Agreement (OA) do?
2010-07-01
... defines GSA's relationship with each customer agency and: (a) Establishes specific financial terms... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What does an Occupancy Agreement (OA) do? 102-85.20 Section 102-85.20 Public Contracts and Property Management Federal Property...
41 CFR 102-74.395 - What is the policy concerning gambling?
2010-07-01
... concerning gambling? 102-74.395 Section 102-74.395 Public Contracts and Property Management Federal Property... Conduct on Federal Property Gambling § 102-74.395 What is the policy concerning gambling? (a) Except for... games for money or other personal property; (2) Operating gambling devices; (3) Conducting a lottery or...
41 CFR 102-80.30 - What are Federal agencies' responsibilities concerning lead?
2010-07-01
... agencies' responsibilities concerning lead? 102-80.30 Section 102-80.30 Public Contracts and Property... PROPERTY 80-SAFETY AND ENVIRONMENTAL MANAGEMENT Safety and Environmental Management Lead § 102-80.30 What are Federal agencies' responsibilities concerning lead? Federal agencies have the following...
41 CFR 102-33.125 - If we use Federal aircraft, what are our management responsibilities?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false If we use Federal aircraft, what are our management responsibilities? 102-33.125 Section 102-33.125 Public Contracts and... Parts Overview § 102-33.125 If we use Federal aircraft, what are our management responsibilities? If you...
Governance in genomics: a conceptual challenge for public health genomics law
Directory of Open Access Journals (Sweden)
Tobias Schulte in den Bäumen
2006-12-01
Full Text Available Increasing levels of genomic knowledge has led to awareness that new governance issues need to be taken into consideration. While some countries have created new statutory laws in the last 10 years, science supports the idea that genomic data should be treated like other medical data. In this article we discuss the three core models of governance in medical law on a conceptual level. The three models, the Medical, Public Health and Fundamental Rights Model stress different values, or in legal terms serve different principles. The Medical Model stands for expert knowledge and the standardisation of quality in healthcare. The Public Health Model fosters a social point of view as it advocates distribution justice in healthcare and an awareness of healthcare as a broader concept. The Fundamental Rights Model focuses on individual rights such as the right to privacy and autonomy. We argue that none of the models can be used in a purist fashion as governance in genomics should enable society and individuals to protect individual rights, to strive for a distribution justice and to ensure the quality of genomic services in one coherent process. Thus, genomic governance in genomics requires procedural law and a set of applicable principles. The principle which underlies all three models is the principle of medical beneficence. Therefore genomic governance should refer to it as a key principle when conflicting rights of individuals or communities need to be balanced.
41 CFR 102-2.145 - To what do pronouns refer when used in the FMR?
2010-07-01
... MANAGEMENT REGULATION SYSTEM Plain Language Regulatory Style § 102-2.145 To what do pronouns refer when used... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false To what do pronouns refer when used in the FMR? 102-2.145 Section 102-2.145 Public Contracts and Property Management Federal...
41 CFR 102-74.10 - What is the basic facility management policy?
2010-07-01
... facility management policy? 102-74.10 Section 102-74.10 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 74-FACILITY MANAGEMENT General Provisions § 102-74.10 What is the basic facility management policy? Executive agencies...
2010-01-01
... of Nicaragua and Cuba under Public Law 105-100. 1245.13 Section 1245.13 Aliens and Nationality... nationals of Nicaragua and Cuba under Public Law 105-100. (a) Aliens eligible to apply for adjustment. An... Nicaragua or Cuba; (2) Except as provided in paragraph (o) of this section, has been physically present in...
41 CFR 102-74.330 - What smoking restrictions apply to outside areas under Executive branch control?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What smoking restrictions apply to outside areas under Executive branch control? 102-74.330 Section 102-74.330 Public... MANAGEMENT REGULATION REAL PROPERTY 74-FACILITY MANAGEMENT Facility Management Smoking § 102-74.330 What...
Significant differences between the Nordic laws on public access to documents
DEFF Research Database (Denmark)
Jørgensen, Oluf
2017-01-01
Transparency and public access to information work as a check on the exercise of power and the existence of corruption. In Sweden the constitutional right of access to documents is justified precisely by its contribution to democracy, the rule of law and efficiency in the public administration....... The wide access to information in today’s world also makes possible the publication of personal information about individuals’ private life in an unprecedented way. Does this mean that the relative importance of the protection of privacy has to be strengthened at the cost of access to information? What...... will be the impact of the developing information and communication technology on access to information? The right of access to documents has traditionally been discussed on the level of domestic administration but when public administration is internationalised the issue of access to documents makes itself felt also...
41 CFR 102-41.170 - Is unclaimed personal property available for donation?
2010-07-01
... property available for donation? 102-41.170 Section 102-41.170 Public Contracts and Property Management... Personal Property § 102-41.170 Is unclaimed personal property available for donation? No, unclaimed personal property is not available for donation because reimbursement at fair market value is required. ...
41 CFR 102-37.30 - When does property become available for donation?
2010-07-01
... become available for donation? 102-37.30 Section 102-37.30 Public Contracts and Property Management... 37-DONATION OF SURPLUS PERSONAL PROPERTY General Provisions Donation Overview § 102-37.30 When does property become available for donation? Excess personal property becomes available for donation the day...
41 CFR 102-77.15 - Who funds the Art-in-Architecture efforts?
2010-07-01
...-Architecture efforts? 102-77.15 Section 102-77.15 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 77-ART-IN-ARCHITECTURE Art-in-Architecture § 102-77.15 Who funds the Art-in-Architecture efforts? To the extent not...
2010-01-01
... Global and National Commerce Act (Public Law 106-229) (E-SIGN). 609.910 Section 609.910 Banks and Banking... with the Electronic Signatures in Global and National Commerce Act (Public Law 106-229) (E-SIGN). (a) General. E-SIGN makes it easier to conduct E-commerce. With some exceptions, E-SIGN permits the use and...
The public principle of the EC environmental law. Das Oeffentlichkeitsprinzip des EG-Umweltrechts
Energy Technology Data Exchange (ETDEWEB)
Schwanenfluegel, M von
1991-01-15
The author discusses questions concerning the significance of the Directive on Free Access to Information Concerning the Environment approved by the European Council of Ministers on 7 June 1990 and first considers the relative importance of free access to information. Further sections deal with the right to information in the member states, EC environmental law and the information of the public. The essential regulations of the directive are presented in detail: the prehistory of the directive, aims, definition of 'information concerning the environment' and public authority, exceptions and procedures. In an outlook consequences for individual regulations of the Law on Administrative Procedures and the Rules of the Administrative Courts are addressed and the urgency of a corresponding ruling for the institutions of the Community themselves is pointed out; the Commission has already announced such a proposal. (RST).
41 CFR 102-37.575 - Is there a special form for holding agencies to process donations?
2010-07-01
... for holding agencies to process donations? 102-37.575 Section 102-37.575 Public Contracts and Property... PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY Donations to Public Bodies in Lieu of Abandonment/Destruction § 102-37.575 Is there a special form for holding agencies to process donations? There is no...
29 CFR 102.132 - Reporting of prohibited communications; penalties.
2010-07-01
... communication shall place or cause to be placed on the public record of the proceeding: (1) The communication... 29 Labor 2 2010-07-01 2010-07-01 false Reporting of prohibited communications; penalties. 102.132 Section 102.132 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS...
13 CFR 102.36 - Privacy Act standards of conduct.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Privacy Act standards of conduct. 102.36 Section 102.36 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RECORD DISCLOSURE... existence or development of any system of records that is not the subject of a current or planned public...
22 CFR 102.15 - Protection and preservation of wreckage.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Protection and preservation of wreckage. 102.15 Section 102.15 Foreign Relations DEPARTMENT OF STATE ECONOMIC AND OTHER FUNCTIONS CIVIL AVIATION United... constitutes a public hazard. When under the latter conditions the wreckage and contents of the aircraft must...
Directory of Open Access Journals (Sweden)
Cícero Júnior Siqueira dos Santos
2016-04-01
Full Text Available The present work aims at to promote a debate between the General Law of Administrative Contracts and Tenders (Law 8.666/93 and the Law Differentiated Scheme Public Contracting (Law 12.462/2011 Act regarding the observance of the Constitutional Principles of Public Administration in elaboration phase public bidding and execution of these instruments. This required from an initial study on Public Management which had as background rag and the Principles Bidding with emphasis on rol of the Chapeau of article 37 the Federal Constitution of 1988. Bidding procedures retro mentioned laws were also compared. The statement of reasons was made by literature search. As a result of the investigation, it was found that although there is a formal compliance with principled norm with regard respect the principles of public administration in both competitions governed by laws, not an application in hand and visible interest of the Public Power of the DRC in cases of greater relevance and urgency, which deconstructs the reason for this exceptional regime and calls into question the substantive norm of access to potential beneficiaries with full compliance.
Directory of Open Access Journals (Sweden)
T Murombo
2008-10-01
Full Text Available One of the key strategies for achieving sustainable development is the use of the process of evaluating the potential environmental impacts of development activities. The procedure of environmental impact assessment (EIA implements the principle of integration which lies at the core of the concept of sustainable development by providing a process through which potential social, economic and environmental impacts of activities are scrutinised and planned for. Sustainable development may not be achieved without sustained and legally mandated efforts to ensure that development planning is participatory. The processes of public participation play a crucial role in ensuring the integration of the socio-economic impacts of a project into the environmental decision-making processes. Public participation is not the only process, nor does the process always ensure the achievement of sustainable development. Nevertheless, decisions that engage the public have the propensity to lead to sustainable development. The public participation provisions in South Africa’s EIA regulations promulgated under the National Environmental Management Act 107 of 1998 show a disjuncture between the idea of public participation and the notion of sustainable development. The provisions do not create a framework for informed participation and leave a wide discretion to environmental assessment practitioners (EAPs regarding the form which participation should assume. In order for environmental law, specifically EIA laws, to be effective as tools to promote sustainable development the laws must, among other things, provide for effective public participation. The judiciary must also aid in the process by giving content to the legal provisions on public participation in the EIA process.
41 CFR 102-36.45 - What are our responsibilities in the management of excess personal property?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are our responsibilities in the management of excess personal property? 102-36.45 Section 102-36.45 Public Contracts and... § 102-36.45 What are our responsibilities in the management of excess personal property? (a) Agency...
41 CFR 102-33.70 - What directives must we follow when planning to acquire Government aircraft?
2010-07-01
... Parts Planning to Acquire Government Aircraft § 102-33.70 What directives must we follow when planning... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What directives must we follow when planning to acquire Government aircraft? 102-33.70 Section 102-33.70 Public Contracts and...
Directory of Open Access Journals (Sweden)
Mariya Riekkinen
2016-01-01
Full Text Available This article deals with the much debated issue of children’s public participation from the perspective of legal practices in the Russian Federation. Having emerged at the level of national jurisdictions, the practice of engaging minors in decision-making processes on issues of public significance – or the practice of public participation of children – is stipulated by the UN Committee on the Rights of the Child, based on Article 12 of the UN Convention on the Rights of the Child. Public participation of minors implies that children have clearly defined opportunities to take part in decision-making processes concerning those political and public matters affecting their interests.Albeit limited by the clause “regarding the issues concerning them,” the claims for such participation are dictated by emerging standards of international law. The author has examined the process of devising these standards in Russian public law. Moreover, an analysis of the evolution of academic views on public participation of children in Russian legal scholarship is also included in this article.Relying extensively on the method of legal analysis and the comparative analysis of the conformity of national public law standards with respect to international law, the author proposes several legal amendments to the Federal law “On the Basic Guarantees of the Rights of the Child in the Russian Federation,” which would lead to anchoring more solidly the participatory right of minors in the legal system of the Russian Federation.
Legal rights during pandemics: federalism, rights and public health laws--a view from Australia.
Bennett, B
2009-03-01
Pandemic influenza will cause significant social and economic disruption. Legal frameworks can play an important role in clarifying the rights and duties of individuals, communities and governments for times of crisis. In addressing legal frameworks, there is a need for jurisdictional clarity between different levels of government in responding to public health emergencies. Public health laws are also informed by our understandings of rights and responsibilities for individuals and communities, and the balancing of public health and public freedoms. Consideration of these issues is an essential part of planning for pandemic influenza.
41 CFR 102-36.450 - Do we report excess shelf-life items?
2010-07-01
... shelf-life items? 102-36.450 Section 102-36.450 Public Contracts and Property Management Federal...-DISPOSITION OF EXCESS PERSONAL PROPERTY Personal Property Whose Disposal Requires Special Handling Shelf-Life Items § 102-36.450 Do we report excess shelf-life items? (a) When there are quantities on hand, that...
41 CFR 102-193.20 - What are the specific agency responsibilities for records management?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the specific agency responsibilities for records management? 102-193.20 Section 102-193.20 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT...
Directory of Open Access Journals (Sweden)
Willem A. Janssen
2014-12-01
Full Text Available From a EU public procurement law perspective, contracting authorities have a discretionary power to decide upon who is allowed and best suited to provide public services to the public. When public authorities deem the in-house performance of a service to be the most suitable, the Court of Justice of the EU has allowed these authorities to rely on the institutionalised and non-institutionalised exemptions, which exempt a possible duty to contract out a public contract. The first part of this contribution discusses the recent codification of these exemptions in Article 12 Directive 2014/24/EU on public procurement. It concludes that this codification creates some legal certainty, but it mostly expands the scope of these exemptions from public procurement law. The second part of this contribution proposes a more coherent approach for these exemptions by discussing the challenges of regulating and enforcing the pre-procurement phase (the make-or-buy decision in which a public authority decides to favour the internal or external performance of a service. It concludes by providing legal perspectives to regulate and enforce this decision-making phase.
41 CFR 102-192.40 - Where can we obtain more information about the classes of mail?
2010-07-01
... PROGRAMS 192-MAIL MANAGEMENT Introduction to this Part § 102-192.40 Where can we obtain more information... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Where can we obtain more information about the classes of mail? 102-192.40 Section 102-192.40 Public Contracts and Property Management...
41 CFR 102-75.320 - Does appraisal information need to be kept confidential?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Does appraisal information need to be kept confidential? 102-75.320 Section 102-75.320 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 75-REAL PROPERTY DISPOSAL Surplus Real...
DEFF Research Database (Denmark)
of participants keen to work together to promote research and policy development in such a lively forum." - Professor Steve Saxby PhD, Cert Ed., MBCS Professor of IT Law and Public Policy, Solicitor, Deputy Head of School (Research), Faculty of Business and Law, University of Southampton, Editor...... not only the original themes of Legal, Security and Privacy Issues in IT Law and International Law and Trade but more recently two new conferences on International Public and Private Law. The papers in this volume then represent the contributions to all these fields and reflect the strong desire......-in-Chief, The Computer Law & Security Review - The International Journal of Technology Law and Practice (Elsevier), www.elsevier.com/locate/clsr, Editor, The Encyclopedia of Information Technology Law (Sweet & Maxwell), Director ILAWS - Institute for Law and the Web - School of Law, Southampton University, www...
2012-10-22
... DEPARTMENT OF DEFENSE Department of the Air Force Office of the Secretary of the Air Force Acceptance of Group Application Under Public Law 95-202 and Department of Defense Directive (DODD) 1000.20..., Public Law 95-202 and DoD Directive 1000.20, the Department of Defense Civilian/Military Service Review...
THE MAN CATEGORY IN PUBLIC POLICIES AND BRAZILIAN LAWS
Directory of Open Access Journals (Sweden)
Samantha Alflen Banin
2016-11-01
Full Text Available This article discusses the view of man as a gender category in public policies and national laws, especially those focused on violence against women. With this objective, it contextualizes the studies of feminisms and masculinities as theories and epistemology that guide the analysis of 17 official Brazilian documents selected for this study. This analysis seeks to clarify how the gendered man has been understood in various documents over the years. It discusses how the formulation of laws can provide a new accountability approach beyond the punishment of these men. It also investigates the regulation of some of the existing groups of men who have used violence against women in the country. It finalizes claiming the importance of these reflections for the debate on gender and masculinities in pursuit of a more effective system of prevention and eradication of violence against women. It discusses and argues in favor of both changing the way this category is addressed in official documents, and formalizing spaces for reflection for men who have used violence against women.
2010-07-01
..., the judge (or the Board) will decide the case or make other disposition of it. (10) To make and file... 29 Labor 2 2010-07-01 2010-07-01 false Duties and powers of administrative law judges; stipulations of cases to administrative law judges or to the Board; assignment and powers of settlement judges...
41 CFR 302-9.102 - How many POV's may I transport to a post of duty?
2010-07-01
... 41 Public Contracts and Property Management 4 2010-07-01 2010-07-01 false How many POV's may I transport to a post of duty? 302-9.102 Section 302-9.102 Public Contracts and Property Management Federal... TRANSPORTATION AND EMERGENCY STORAGE OF A PRIVATELY OWNED VEHICLE Transportation General § 302-9.102 How many POV...
41 CFR 102-192.100 - How do we submit our annual mail management report to GSA?
2010-07-01
... management report to GSA? If your agency is a large agency, as defined in § 102-192.35, you must submit... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false How do we submit our annual mail management report to GSA? 102-192.100 Section 102-192.100 Public Contracts and Property...
41 CFR 102-75.900 - What is a negotiated sale for economic development purposes?
2010-07-01
... sale for economic development purposes? 102-75.900 Section 102-75.900 Public Contracts and Property... negotiated sale for economic development purposes? A negotiated sale for economic development purposes means... community's economic benefit. This type of negotiated sale is acceptable where the expected public benefits...
2013-02-07
... DEPARTMENT OF DEFENSE Department of the Air Force Office of the Secretary of the Air Force Acceptance of Group Application Under Public Law 95-202 and Department of Defense Directive (DODD) 1000.20: U.S. and Foreign Employees of Air America, Inc. Under the provisions of Section 401, Public Law 95-202...
2013-10-28
... International Law (ACPIL): Public Meeting on Cross-Border Insolvency The Office of the Assistant Legal Adviser... potential future work related to cross-border insolvency issues under consideration in the United Nations... has developed a number of instruments related to cross- border insolvency law, including the UNCITRAL...
2010-07-01
... Management Risks and Risk Reduction Strategies § 102-80.55 Are Federal agencies responsible for managing the... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Are Federal agencies responsible for managing the execution of risk reduction projects? 102-80.55 Section 102-80.55 Public...
Directory of Open Access Journals (Sweden)
Ionel BOSTAN
2016-02-01
Full Text Available The activity to prevent embrittlement sustainability of public finances should manifest itself permanently, regardless of economic circumstances - national or European. This, more so as it was set by the Stability and Growth Pact (SGP, which introduces new rules on fiscal policy. Regulations and exercise adequate of financial control and public audit are intended to give certain guarantees on landing approach this topic (most on enhancing sustainability of public finances. Therefore, our approach aims to reveal some aspects of fiscal consolidation by means of financial law focused on exercise fiscal control and public audit. Our references aim the current regulatory of this important organization and functioning rule of law activities and results reported.
41 CFR 102-37.45 - How long is property available for donation screening?
2010-07-01
... available for donation screening? 102-37.45 Section 102-37.45 Public Contracts and Property Management... 37-DONATION OF SURPLUS PERSONAL PROPERTY General Provisions Donation Overview § 102-37.45 How long is property available for donation screening? Entities authorized to participate in the donation program may...
International Nuclear Information System (INIS)
Ketteler, G.; Kippels, K.
1988-01-01
In section I 'Basic principles' the following topics are considered: Constitutional-legal aspects of environmental protection, e.g. nuclear hazards and the remaining risk; European environmental law; international environmental law; administrative law, private law and criminal law relating to the environment; basic principles of environmental law, the instruments of public environmental law. Section II 'Special areas of law' is concerned with the law on water and waste, prevention of air pollution, nature conservation and care of the countryside. Legal decisions and literature up to June 1988 have been taken into consideration. (orig./RST) [de
41 CFR 102-33.30 - What are the duties of an agency's Senior Aviation Management Official (SAMO)?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the duties of an agency's Senior Aviation Management Official (SAMO)? 102-33.30 Section 102-33.30 Public Contracts... § 102-33.30 What are the duties of an agency's Senior Aviation Management Official (SAMO)? The SAMO's...
41 CFR 102-192.20 - How are “must” and “should” used in this part?
2010-07-01
... 192-MAIL MANAGEMENT Introduction to this Part § 102-192.20 How are “must” and “should” used in this... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false How are âmustâ and âshouldâ used in this part? 102-192.20 Section 102-192.20 Public Contracts and Property Management Federal...
2010-01-01
... INFORMATION MEDIA § 1213.102 Policy. (a) NASA, a scientific and technical Agency, is committed to a culture of... culture of openness, NASA employees may, consistent with this policy, speak to the press and the public... Policy Directives). Examples of information not releasable under this policy include, without limitation...
41 CFR 102-117.105 - What does best value mean when routing a shipment?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What does best value mean when routing a shipment? 102-117.105 Section 102-117.105 Public Contracts and Property Management... 117-TRANSPORTATION MANAGEMENT Business Rules To Consider Before Shipping Freight or Household Goods...
41 CFR 102-79.20 - What standard must Executive agencies promote when assigning space?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What standard must Executive agencies promote when assigning space? 102-79.20 Section 102-79.20 Public Contracts and Property... PROPERTY 79-ASSIGNMENT AND UTILIZATION OF SPACE Assignment and Utilization of Space Assignment of Space...
[Surveillance in Spain 3 years since the enactment of the Public Health Law].
Pousa, Anxela; Godoy, Pere; Aragonés, Nuria; Cano, Rosa; Sierra, María José; González, Francisco; Mayoral, José María
2016-01-01
In 2014, the Epidemiological Surveillance Working Group of the Sociedad Española de Epidemiología (Spanish Society of Epidemiology), carried out a descriptive study in order to evaluate the level of development of the Spanish Public Health Law since its enactment in 2011. A survey collecting data on the existence of information systems and other aspects pertaining to each surveillance section included in the law was sent to all 19 autonomous communities and cities. All regional authorities reported the presence of an information system for communicable diseases, and six also reported an information system for social factors. 18 reported that at least one chronic disease was subject to surveillance and 14 confirmed surveillance of some of its determinants. They all systematically analysed the data derived from the communicable diseases. There is room for improvement in Public Health surveillance in Spain, and action should be aimed at the main health problems. Copyright © 2016 SESPAS. Published by Elsevier Espana. All rights reserved.
41 CFR 102-33.95 - What is the process for budgeting to acquire commercial aviation services (CAS)?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is the process for budgeting to acquire commercial aviation services (CAS)? 102-33.95 Section 102-33.95 Public Contracts and... Parts The Process for Budgeting to Acquire Government Aircraft § 102-33.95 What is the process for...
Energy Technology Data Exchange (ETDEWEB)
Sautter, John A.
2010-10-15
In many states environmental statutes provide the authority for public utility commissioners to make decisions to reduce greenhouse gases from electricity generation. This article looks at six such laws and how the presence of these laws affected CO{sub 2} emissions during a nine-year period from 1997 to 2005. (author)
41 CFR 102-34.340 - Do we need a fleet management information system?
2010-07-01
... management information system? 102-34.340 Section 102-34.340 Public Contracts and Property Management Federal... VEHICLE MANAGEMENT Federal Fleet Report § 102-34.340 Do we need a fleet management information system? Yes, you must have a fleet management information system at the department or agency level that — (a...
41 CFR 102-36.455 - How do we report excess shelf-life items?
2010-07-01
... shelf-life items? 102-36.455 Section 102-36.455 Public Contracts and Property Management Federal...-DISPOSITION OF EXCESS PERSONAL PROPERTY Personal Property Whose Disposal Requires Special Handling Shelf-Life Items § 102-36.455 How do we report excess shelf-life items? You must identify the property as shelf...
Mańko, R.; Sitek, B.; Szczerbowski, J.J.; Bauknecht, A.W.; Szpanowska, M.; Wasyliszyn, K.
2015-01-01
In line with Lenin’s famous quote that Bolsheviks "do not recognise anything private" and that private law must be permeated with public interest, the private (civil) law of the USSR and other countries of the Soviet bloc, including Poland underwent reform aimed at furthering the public interest at the expense of the private one. Specific legal institutions were introduced for this purpose, in the form of legal innovations, loosely, if at all, based on pre-existing Western models. In the Poli...
Bray, Ira, Ed.
2009-01-01
Each year the State Library sends annual report forms to California's public, academic, special, state agency, and county law libraries. Statistical data from those reports are tabulated in this publication, with directory listings published in the companion volume, "California Library Directory." For this fiscal year, 389 libraries of…
Bray, Ira, Ed.
2005-01-01
Each year the State Library sends annual report forms to California's academic, public, special, state agency, and county law libraries. Statistical data from those reports are tabulated in this publication, with directory listings published in the companion volume, California Library Directory. For this fiscal year four hundred and eight…
41 CFR 301-75.102 - What pre-employment interview travel expenses are not payable?
2010-07-01
... interview travel expenses are not payable? 301-75.102 Section 301-75.102 Public Contracts and Property Management Federal Travel Regulation System TEMPORARY DUTY (TDY) TRAVEL ALLOWANCES AGENCY RESPONSIBILITIES 75-PRE-EMPLOYMENT INTERVIEW TRAVEL Travel Expenses § 301-75.102 What pre-employment interview travel...
41 CFR 102-193.10 - What are the goals of the Federal Records Management Program?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the goals of the Federal Records Management Program? 102-193.10 Section 102-193.10 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION...
42 CFR 102.2 - Summary of available benefits.
2010-10-01
... Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX... benefits paid under § 102.82(c) are secondary to death and disability benefits under the PSOB Program. The... potential third-party payor makes a determination on the availability of similar benefits and has the right...
Population risk and subjective public law in atomic energy law
International Nuclear Information System (INIS)
Winter, G.
1979-01-01
On the basis of jurisdiction in atomic law and in other planning and immission laws, the author deals with the question whether a plaintiff can base his action against a nuclear licence on the fact that the general population risk is very high around the chosen site or because of the type of reactors. Even if jurisdiction negates this question because of the function of the administrative-judicial legal protection (individual involvement), it nevertheless regards it as neccessary with the increasing number and size of NPPs, to make the general population risk accessable to actions. The author critically deals with the protection norm theory of the legal dogmatics and that of the practical jurisdiction. He suggests to replace the 'Nachbarklagen' model in atomic laws by a model of 'Eingriffsverwaltung' and to regard the licences primarily as tolerance declarations to the neighbourhood and secondarily as favouring administrative actions. (UN) [de
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the responsibilities and functions of an agency Committee Management Officer (CMO)? 102-3.115 Section 102-3.115 Public...? § 102-3.115 What are the responsibilities and functions of an agency Committee Management Officer (CMO...
[Evidence-based medicine and public health law: statutory health insurance].
Dreher, Wolfgang
2004-09-01
Beyond all differences in terminology and legal principles between the laws governing private health insurance, the governmental financial support for civil, servants and statutory health insurance the fundamental issues to be solved by the courts in case of litigation are quite similar. But only a part of these refer to the quality of medical services, which is the main concern of Evidence-based Medicine (EbM); EbM, though, is not able to contribute towards answering the equally important question of how to distinguish between "treatment" and "(health-relevant) lifestyle". The respective definitions that have been developed in the particular fields of law are only seemingly divergent from each other and basically unsuitable to aid the physician in his clinical decision-making because the common blanket clauses of public health law are regularly interpreted as rules for the exclusion of certain claims and not as a confirmatory paraphrase of what is clinically necessary. If on the other hand medical quality is what lies at the core of litigation, reference to EbM may become necessary. In fact, it is already common practice in the statutory health insurance system that decision-making processes in the Federal Committee being responsible for quality assurance (Bundesausschuss) are based on EbM principles and that in exceptional cases only the courts have to medically review the Federal Committee's decisions.
41 CFR 102-37.40 - What type of surplus property is available for donation?
2010-07-01
... property is available for donation? 102-37.40 Section 102-37.40 Public Contracts and Property Management... 37-DONATION OF SURPLUS PERSONAL PROPERTY General Provisions Donation Overview § 102-37.40 What type of surplus property is available for donation? All surplus property (including property held by...
41 CFR 102-34.300 - How do we dispose of a domestic fleet motor vehicle?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false How do we dispose of a domestic fleet motor vehicle? 102-34.300 Section 102-34.300 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY...
41 CFR 102-117.280 - What aspects of the TSP's performance are important to measure?
2010-07-01
...'s performance are important to measure? 102-117.280 Section 102-117.280 Public Contracts and... § 102-117.280 What aspects of the TSP's performance are important to measure? Important TSP performance...) Percentage of customer satisfaction reports on carrier performance. ...
2010-01-01
... or Its Successor Agency Under Public Law 103-354 Financed Contract To: Area Director, Office of... 7 Agriculture 12 2010-01-01 2010-01-01 false FmHA or Its Successor Agency Under Public Law 103-354 Financed Contract C Exhibit C to Subpart E of Part 1901 Agriculture Regulations of the Department of...
2010-07-01
... Parts Planning to Acquire Government Aircraft § 102-33.75 What other guidance is available to us in... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What other guidance is available to us in planning to acquire Government aircraft? 102-33.75 Section 102-33.75 Public Contracts and...
PRINCIPLE OF PROPORTIONALITY, CRITERION OF LEGITIMACY IN THE PUBLIC LAW
Directory of Open Access Journals (Sweden)
MARIUS ANDREESCU
2011-04-01
Full Text Available A problem of essence of the state is the one to delimit the discretionary power, respectively the power abuse in the activity of the state’s institutions. The legal behavior of the state’s institutions consists in their right to appreciate them and the power excess generates the violation of a subjective right or of the right that is of legitimate interest to the citizen. The application and nonobservance of the principle of lawfulness in the activities of the state is a complex problem because the exercise of the state’s functions assumes the discretionary powers with which the states authorities are invested, or otherwise said the ‘right of appreciation” of the authorities regarding the moment of adopting the contents of the measures proposed. The discretionary power cannot be opposed to the principle of lawfulness, as a dimension of the state de jure. In this study we propose to analyze the concept of discretionary power, respectively the power excess, having as a guidance the legislation, jurisprudence and doctrine in the matter. At the same time we would like to identify the most important criterions that will allow the user, regardless that he is or not an administrator, a public clerk or a judge, to delimit the legal behavior of the state’s institutions from the power excess. Within this context, we appreciate that the principle of proportionality represents such a criterion. The proportionality is a legal principle of the law, but at the same time it is a principle of the constitutional law and of other law branches. It expresses clearly the idea of balance, reasonability but also of adjusting the measures ordered by the state’s authorities to the situation in fact, respectively to the purpose for which they have been conceived. In our study we choose theoretical and jurisprudence arguments according to which the principle of proportionality can procedurally be determined and used to delimit the discretionary power and
41 CFR 102-76.60 - To which facilities does the Architectural Barriers Act apply?
2010-07-01
... PROPERTY 76-DESIGN AND CONSTRUCTION Architectural Barriers Act § 102-76.60 To which facilities does the Architectural Barriers Act apply? (a) The Architectural Barriers Act applies to any facility that is intended... the Architectural Barriers Act apply? 102-76.60 Section 102-76.60 Public Contracts and Property...
41 CFR 102-34.230 - How am I responsible for protecting Government motor vehicles?
2010-07-01
... theft or damage; and (b) Lock the unattended Government motor vehicle. (The only exception to this... protecting Government motor vehicles? 102-34.230 Section 102-34.230 Public Contracts and Property Management... 34-MOTOR VEHICLE MANAGEMENT Official Use of Government Motor Vehicles § 102-34.230 How am I...
41 CFR 102-74.500 - Can Federal agencies disapprove permit applications or cancel issued permits?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Can Federal agencies disapprove permit applications or cancel issued permits? 102-74.500 Section 102-74.500 Public Contracts and... cancel issued permits? Yes, Federal agencies may disapprove any permit application or cancel an issued...
Challenges imposed by International Environmental Law to Classical International Law
Directory of Open Access Journals (Sweden)
Fabian Augusto Cárdenas Castañeda
2010-05-01
Full Text Available The emergence of international environmental law has produced important challenges to the very foundations of public international law. Traditional concepts such as state sovereignty, subjects of international law, and the early perspectives of national security are being transformed. The needs of the contemporary international society differ from the ones of the Wesphalian conception, situations which clearly explains the raise of alternative views for the understanding of the current dynamics of international law, where concepts like res communis, common concerns and simply “commons” take a privileged place in the study of international law. The foregoing has been strengthened by the international development of the so called erga ommnes obligations, label which is being used by international environmental law as the perfect explanation of its own existence. This academic article presents and studies the abovementioned concepts trying to compare what international law used to be before the emergence of international environmental law and what it is and what it should be in order to attend the developments and challenges imposed by the contemporary international society, particularly by international environmental law, a new fi eld of the corpus juris of public international law.
2013-03-28
... International Law (ACPIL): Public Meeting on Electronic Commerce The Office of the Assistant Legal Adviser for... UNCITRAL's Working Group IV (electronic commerce), the UNCITRAL Secretariat has prepared draft provisions... on electronic transferable records. The public meeting will take place on Tuesday, April 30, 2013...
41 CFR 102-118.60 - To what extent must my agency use electronic commerce?
2010-07-01
... agency use electronic commerce? 102-118.60 Section 102-118.60 Public Contracts and Property Management... Services § 102-118.60 To what extent must my agency use electronic commerce? Your agency must use electronic commerce in all areas of your transportation program. This includes the use of electronic systems...
41 CFR 102-73.70 - Are Executive agencies required to acquire leased space by negotiation?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Are Executive agencies required to acquire leased space by negotiation? 102-73.70 Section 102-73.70 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 73-REAL ESTATE ACQUISITION...
Hesselink, M.W.
2015-01-01
This article discusses the normative relationship between contract law and democracy. In particular, it argues that in order to be legitimate contract law needs to have a democratic basis. Private law is not different in this respect from public law. Thus, the first claim made in this article will
Wibowo, R.A.
2017-01-01
The aim of this book is to make recommendations concerning the improvement of public procurement law in Indonesia. The author identifies five fundamental problems commonly arising in the pre-contractual phase in Indonesia: the procurement document may be prepared in a way that favours certain
Nicholson, Lisa; Turner, Lindsey; Schneider, Linda; Chriqui, Jamie; Chaloupka, Frank
2014-05-01
State laws and farm-to-school programs (FTSPs) have the potential to increase fruit and vegetable (FV) availability in school meals. This study examined whether FV were more available in public elementary school lunches in states with a law requiring/encouraging FTSPs or with a locally grown-related law, and whether the relationship between state laws and FV availability could be explained by schools opting for FTSPs. A pooled, cross-sectional analysis linked a nationally representative sample of public elementary schools with state laws. A series of multivariate logistic regressions, controlling for school-level demographics were performed according to mediation analysis procedures for dichotomous outcomes. Roughly 50% of schools reported FV availability in school lunches on most days of the week. Schools with the highest FV availability (70.6%) were in states with laws and schools with FTSPs. State laws requiring/encouraging FTSPs were significantly associated with increased FV availability in schools and a significant percentage (13%) of this relationship was mediated by schools having FTSPs. Because state farm-to-school laws are associated with significantly higher FV availability in schools-through FTSPs, as well as independently-enacting more state legislation may facilitate increased FTSP participation by schools and increased FV availability in school meals. © 2014, American School Health Association.
41 CFR 102-79.110 - What Integrated Workplace policy must Federal agencies strive to promote?
2010-07-01
... capital costs over a substantial time period; and (i) Support alternative workplace arrangements... Workplace policy must Federal agencies strive to promote? 102-79.110 Section 102-79.110 Public Contracts and... Integrated Workplace § 102-79.110 What Integrated Workplace policy must Federal agencies strive to promote...
41 CFR 102-85.40 - What are the major components of the pricing policy?
2010-07-01
... components of the pricing policy? 102-85.40 Section 102-85.40 Public Contracts and Property Management...-PRICING POLICY FOR OCCUPANCY IN GSA SPACE Pricing Policy-General § 102-85.40 What are the major components of the pricing policy? The major components of the pricing policy are: (a) An OA between a customer...
Directory of Open Access Journals (Sweden)
María del Mar Navas Sánchez
2017-12-01
which the legislator lays down very specific guidelines as to how such conflicts should be resolved; the intensity with which this Law has conditioned the case law of judges and courts of ordinary jurisdiction, particularly the Supreme Court; and finally, the important role played by the case law of the Constitutional Court, which, regardless of the legislative requirements and taking constitutional categories as references, has finally established, in a process that we have differentiated in two stages, the public interest of the images (or, in other words, the contribution made by photos to a debate of general interest in the decisive element to solve this type of conflicts. But on the other hand, special attention is also paid to the reciprocal relations that have been established over these decades among the case law of the Constitutional, Supreme and Strasbourg Courts. On this regard, we have found particularly interesting to look not only at the way in which the Constitutional Court has used the jurisprudence of the European Court of Human Rights (Article 10.2 Spanish Constitution to establish its own doctrine on the fundamental right to their image of public figures, but also, especially, in the way in which this doctrine of the Constitutional Court has been followed or not by the Supreme Court and therefore if the latter has fulfilled its constitutional obligation (Article 5.1 Organic Law of the Judiciary.
41 CFR 102-72.45 - What are the different types of delegations related to facility management?
2010-07-01
... different types of delegations related to facility management? The principal types of delegations involved... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the different types of delegations related to facility management? 102-72.45 Section 102-72.45 Public Contracts and...
41 CFR 102-80.135 - Who is a qualified fire protection engineer?
2010-07-01
... protection engineer? 102-80.135 Section 102-80.135 Public Contracts and Property Management Federal Property... qualified fire protection engineer? A qualified fire protection engineer is defined as an individual with a thorough knowledge and understanding of the principles of physics and chemistry governing fire growth...
42 CFR 482.102 - Condition of participation: Patient and living donor rights.
2010-10-01
... health, disability, or life insurance may be affected; (8) The donor's right to opt out of donation at... donor rights. 482.102 Section 482.102 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) STANDARDS AND CERTIFICATION CONDITIONS OF PARTICIPATION FOR...
Directory of Open Access Journals (Sweden)
Damir Aviani
2008-01-01
Full Text Available Every economic activity of public legal bodies, and similarly with the activities of public-legal bodies in awarding public contracts to business partners, is subject to the rules of market competition. In order to secure free market competition, and market oriented activity of public legal bodies, the European Union, with its rules, limits the activity of public power and forces it to act in a market oriented way in its economic activities. The legal inheritance of the Union which is related to the awarding of public contracts (on public procurement, concessions and public-private partnership is based on general principles which arise from the Agreement on the Establishment of the European Union, and from the court practice of the European Court of Justice such as transparency, equal treatment and non-discrimination. The demands which are placed on legal protection within the area of awarding certain public contracts are regulated by two, in important points confl ictive directives of the EU on legal remedies: Directive 89/665/EEC, which is related to legal protection in the so called classic sector and by Directive 92/13/EEC which is related to the legal protection in the services sector. The aforementioned with directives set certain demands which the member states must satisfy during the regulation of legal protection in their national legislative. The Croatian system of legal remedies is not unique in the questions of legal protection in procedures of awarding public contracts. That is, the system of legal protection in the procedure of public procurement is different from legal protection in the procedure of awarding contracts of concession and contracts of public-private partnership. Court control of public administration is recognisable as the fundamental element of the rule of law. However, there exists signifi cant room for improvement of legal, and in particular, court protection in the Republic of Croatia for breach of law during
Directory of Open Access Journals (Sweden)
Harold J. Berman
1999-03-01
Full Text Available In the third millennium of the Christian era, which is characterised by the emergence of a world economy and eventually a world society, the concept of world law is needed to embrace not only the traditional disciplines of public international law, and comparative law, but also the common underlying legal principles applicable in world trade, world finance, transnational transfer of technology and other fields of world economic law, as well as in such emerging fields as the protection of the world's environment and the protection of universal human rights. World law combines inter-state law with the common law of humanity and the customary law of various world communities.
Directory of Open Access Journals (Sweden)
Sezen Tarakçı
2015-08-01
Full Text Available Throughout history, cities have offered a place for freedom and accommodated differences. Ideological and social developments have taken place in urban spaces where differences, different cultures and ideologies gathered together. Therefore, significant attention should be paid to public-oriented planning and design of urban spaces in the face of social segregation and disintegration experienced in cities. However, cities inTurkeyare mostly transformed under the pressure of international and national capital. The most recent legal instrument governing urban redevelopment, the Law no. 6306 on Transformation of Areas under Disaster Risk contains quite controversial provisions relating to many paradigms. Its uncertainty over public property and public spaces, and the Ministry of Environment and Urban Planning as the sole authority in this field leave all the public spaces at “risk”.GeziPark, a ‘saved’ public space in the backdrop of protests, is still exposed to risks of being stripped off its public nature. This study browses through the literature on public spaces and urban redevelopment, while evaluating the Law no. 6306 on Transformation of Areas under Disaster Risk. It goes on to evaluateGeziParkevents, from the perspective of these experiences and the interviews conducted thereafter. The study concludes how actually the aforementioned Law may itself pose risks for our public spaces.
Environmental law and nuclear law: a growing symbiosis
International Nuclear Information System (INIS)
Ennerechts, S.
2008-01-01
This article is divided in two parts. The first part deals with the interrelationship between environmental law and nuclear law. It specifically addresses selective topics which the author considers as substantial proof that environmental law is in evidence in the nuclear field. These topics are access to nuclear information, public participation in nuclear decision-making and prevention and compensation of environmental damage caused by nuclear incidents. Environmental law will be considered in its narrow sense, meaning the law that seeks to protect nature such as soil, water, air and biodiversity. The position of the author is that the importance of environmental law for nuclear activities is increasing and may lead to a growing symbiosis with nuclear law. Environmental law and nuclear law share the same objectives: protection against mitigation of and compensation for damage to the environment. In the second part a specific problem that touches upon the extra-territorial effect of environmental legislation in the nuclear field will be examined. At the beginning of the 21. century, it can be expected that vendors of nuclear facilities will spare no efforts in trying to enter new markets all over the world. Countries with more developed environmental requirements on the construction of nuclear facilities by their national vendors in customer countries. This part of the article will analyse whether public international laws to the construction of nuclear facilities abroad. The author believes that there may well be a legal basis under customary international law justifying the application of national environmental law to the construction of nuclear facilities and the performance of work on nuclear facilities in foreign countries, but there would appear to be none permitting the enforcement of these laws in the absence of an agreement with the foreign country. (N.C.)
Directory of Open Access Journals (Sweden)
Ewa Lotko
2016-06-01
Full Text Available In the Polish and the EU public finances law there are serious terminological difficulties concerning the deficit and the debt. They arise first from the terminological chaos in this field and second from the parallel application of the EU and the Polish methodology of calculating of deficit and debt. Thus, the paper aims to explain the terminological and definitional problems of deficit and debt in the public finances law using unobtrusive research consisting of the detailed analysis of the Polish and EU legislation. Although there is no doubt that it would be desirable to order the applied terms, in the current legal situation, it would be extremely difficult, as it would require the changes to the Constitution, laws, and modification of translations of UE acts. The solution to the problem, presenting additional advantages, could consist of full transition to the EU methodology by the renouncement from the Polish methodology.
2012-08-10
... Orange Act of 1991, Public Law 102-4 (codified in part at 38 U.S.C. 1116), directed the Secretary to seek.... Section 2 of Public Law 102-4, codified in pertinent part at 38 U.S.C. 1116(b) and (c), provides that... endometriosis and Parkinson's disease. As in its prior reports, NAS placed each health outcome it reviewed in...
Politics or law: what is more in the approaches of public expert monopoly?
Directory of Open Access Journals (Sweden)
Оксана Михайлівна Калужна
2018-03-01
It is concluded that the model of judicial expert support of legal proceedings in Ukraine, that is established by «judicial reform» (Law No. 2147-VIII in the wording that will come into force on March 18, 2018 is a milestone in its historical development, which certainly should be modified depending on its effectiveness and the demand of the society, public, professional and state institutions. So public forensic expert monopoly is not an ideal model of forensic expert support of justice because of corporate and political interests, corruption component, abuse of forensic experts etc. Therefore, it will undergo a review and transformation.
42 CFR 102.31 - Medical benefits.
2010-10-01
... Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX COMPENSATION... covered injury, or to give relief, reduce the degree or the period of disability, or aid in lessening the... provided in § 102.84, the Secretary retains the right to recover medical benefits paid to requesters by...
Directory of Open Access Journals (Sweden)
Jörg Pudelka
2017-12-01
Full Text Available According to German legislation, which complies with the legislation of a large number of European and post-Soviet countries, the administrative procedure can be concluded with two different results. In most of cases, administrative actions will be aimed at adopting an administrative act. This is a centralized form of public administration, with which direct rights are justified, modified or discontinued. So, for example, the abstract right to a constitutionally protected property guarantees that a person is allowed to build on the territory that belongs to him (so-called "freedom of construction" is made by a way of passing an administrative act, named a building permit. Only this building permit gives concrete right for the construction of a particular building (according to the submitted architectural documents. Thus, the law on construction can be applied only by issuing a building permit, as well as can be canceled by canceling the construction permit or changing its contents. The second form of administration that can be used to conclude an administrative procedure in accordance with Article 9 of the law is a public contract. In practice, this is much less common in comparison with an administrative act and is not indisputable in general as a tool of government action.
41 CFR 101-29.102 - Use of metric system of measurement in Federal product descriptions.
2010-07-01
... PROCUREMENT 29-FEDERAL PRODUCT DESCRIPTIONS 29.1-General § 101-29.102 Use of metric system of measurement in... measurement in Federal product descriptions. 101-29.102 Section 101-29.102 Public Contracts and Property... Federal agencies to: (a) Maintain close liaison with other Federal agencies, State and local governments...
41 CFR 102-118.65 - Can my agency receive electronic billing for payment of transportation services?
2010-07-01
... electronic billing for payment of transportation services? 102-118.65 Section 102-118.65 Public Contracts and... Transportation Services § 102-118.65 Can my agency receive electronic billing for payment of transportation... to use electronic billing for the procurement and billing of transportation services. ...
2010-07-01
... environmental issues in Federal construction and lease construction projects? 102-80.75 Section 102-80.75 Public... Management Assessment of Environmental Issues § 102-80.75 Who assesses environmental issues in Federal construction and lease construction projects? Federal agencies must assess required environmental issues...
African Journals Online (AJOL)
Author Guidelines. SUBMISSION GUIDELINES The following submissions are acceptable for publication upon approval by the Editorial Board. Publication of an ... and development of laws; Comments: Case comments that highlight and analyze issues, laws and their interpretation and application in case decisions or fact ...
41 CFR 102-38.105 - Under what conditions may we negotiate sales of personal property?
2010-07-01
... property when— (a) The personal property has an estimated fair market value that does not exceed $15,000... may we negotiate sales of personal property? 102-38.105 Section 102-38.105 Public Contracts and... REGULATION PERSONAL PROPERTY 38-SALE OF PERSONAL PROPERTY Sales Process Negotiated Sales § 102-38.105 Under...
41 CFR 102-192.130 - What are your general responsibilities as an agency mail manager?
2010-07-01
... responsibilities as an agency mail manager? 102-192.130 Section 102-192.130 Public Contracts and Property... ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT Agency Mail Manager Requirements § 102-192.130 What are your general responsibilities as an agency mail manager? In addition to carrying out the responsibilities in Subparts B, C, D...
41 CFR 102-192.135 - Must we have a mail center manager at our facility?
2010-07-01
... center manager at our facility? 102-192.135 Section 102-192.135 Public Contracts and Property Management... PROGRAMS 192-MAIL MANAGEMENT Mail Center Manager Requirements § 102-192.135 Must we have a mail center manager at our facility? Yes, every facility that has more than two full time people dedicated to...
41 CFR 102-34.70 - What do we do with completed calculations of our fleet vehicle acquisitions?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What do we do with completed calculations of our fleet vehicle acquisitions? 102-34.70 Section 102-34.70 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT...
In the Public Interest: Law, Government, and Media. Maryland Women's History Resource Packet--1986.
Maryland State Commission for Women, Baltimore.
Designed to be used for National Women's History Week (March 2-8), this 1986 Maryland women's history resource packet centers around Maryland women who have made significant volunteer and career contributions in the areas of government, law, and the public interest media. The packet begins with suggested student activity lists and activity sheets…
41 CFR 102-117.285 - What are my choices if a TSP's performance is not satisfactory?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are my choices if a TSP's performance is not satisfactory? 102-117.285 Section 102-117.285 Public Contracts and Property... are my choices if a TSP's performance is not satisfactory? You may choose to place a TSP in temporary...
2010-07-01
... estimated fair market value. Where hazardous substance activity is identified, see §§ 102-75.340 and 102-75... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are disposal....255 Public Contracts and Property Management Federal Property Management Regulations System (Continued...
The private – public law divide
DEFF Research Database (Denmark)
Gyldenløve Jeppesen-de Boer, Christina; Kronborg, Annette; Svendsen, Idamarie Leth
2013-01-01
. The inconsistencies stemming from it are demonstrated and it is shown how they imply a legal design more preoccupied with traditional divisions of power and positions than with an interest in the reality of the people it is aimed at. In the article it is argued from within the best ingerest principle...... that the historical development neccessitates a re-thinking of the distinction between child welfare law and family law. It shows how the distinction is nationally and institutionally embedded. Further, that the distinction has only been superficially adressed by the CRC Committee....
41 CFR 102-37.55 - Who pays for transportation and other costs associated with a donation?
2010-07-01
... transportation and other costs associated with a donation? 102-37.55 Section 102-37.55 Public Contracts and... REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY General Provisions Donation Overview § 102-37.55 Who pays for transportation and other costs associated with a donation? The receiving...
41 CFR 102-37.80 - What happens to surplus property that isn't transferred for donation?
2010-07-01
... property that isn't transferred for donation? 102-37.80 Section 102-37.80 Public Contracts and Property... PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY General Provisions Donation Overview § 102-37.80 What happens to surplus property that isn't transferred for donation? Surplus property not transferred for...
41 CFR 102-37.50 - What is the general process for requesting surplus property for donation?
2010-07-01
... process for requesting surplus property for donation? 102-37.50 Section 102-37.50 Public Contracts and... REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY General Provisions Donation Overview § 102-37.50 What is the general process for requesting surplus property for donation? The process for...
Rüefli, Christian; Sager, Fritz
2004-01-01
In 1996, the new Swiss law on health care insurance (KVG) introduced the coverage of certain preventive measures. This provided an opportunity to include research-based public health issues in federal health policy. The present article examines the problems with which the realization of those goals in a Federalist health care system with strong cantonal autonomy as it is found in Switzerland was confronted. Comparative qualitative case studies design (vaccination of school age children and screening-mammography). Switzerland's federalist health care system strongly hinders the realisation of the Confederation's public health goals. Prevention falls into the cantons' autonomy and the federal KVG (Krankenversicherungsgesetz; Health insurance law) only regulates the coverage of the services provided, but does not contain any instruments to assure implementation in consistency with the policy goals. Under those circumstances, conflicts of interest between the implementing actors, varying cantonal preferences, and scarce resources block the implementation of public health goals. The results imply stronger leadership of the Confederation in prevention policy and an improved consideration of implementation aspects in approving new measures to obligatory insurance coverage.
43 CFR 422.3 - Reclamation law enforcement policy.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Reclamation law enforcement policy. 422.3 Section 422.3 Public Lands: Interior Regulations Relating to Public Lands BUREAU OF RECLAMATION, DEPARTMENT OF THE INTERIOR LAW ENFORCEMENT AUTHORITY AT BUREAU OF RECLAMATION PROJECTS § 422.3 Reclamation law enforcement policy. The law enforcement...
Transitory provisions on public gas distribution in the light of the Marzano law
International Nuclear Information System (INIS)
Vedaschi, Arianna
2005-01-01
The article begins by describing community law on public gas distribution service, then it examines legislative decree 164/2000( also called Letta Decree), which implements directive no. 98/30/CE. This directive reforms the gas sector and in particular it reforms the way gas is distributed. Art. 14 of the Letta Decree states that the distribution of natural gas shall be a public service, contractors shall be selected through a public tender and contracts shall be stipulate for a maximum of 12 years. Thus it is evident that the new model is radically different from the previous one. Before, the service was provided by the local authorities (either directly or through a long-term lease); now the new model aims at liberalizing the market by out sourcing gas distribution. Out sourcing is carried out through a public tender and for short periods of time. In order to allow a gradual transition from the old model to the new one, the Letta Decree provides for a transitory period articulated in various phases. This has the aim of guaranteeing a balance between the interest of local authorities, on one hand and the firms that distributed gas before the reform came into effect, on the other. The first part of the article focuses on interpretative problems that arose after law no. 239/2004 (so called Marzano law) was passed. In the second half it compares the different judicial interpretations concerning: a) duration of the transitory period; b) possibility of increasing duration as provided for by art. 15, par.7 of legislative decree 164/2000; c) efficacy of the abrogation of art. 15, par.8 of legislative decree 164/2000 and finally d) whether advanced redemption of the gas distribution service is still possible. With regards to the transitory period, the article compares judgement no. 111/2005 by the Administrative Tribunal of Lombardia, with judgement no. 6187/2005 delivered by the Sixth Section of the State Council. It then argues that the prohibition of concentration has
The familiar strangeness of ancient names and the Law of the public use of Slovene
Directory of Open Access Journals (Sweden)
Maja Sunčič
2004-12-01
Full Text Available The paper discusses the alien or familiar quality of ancient names in the naming of Slovene enterprises in view of the Law of the Public Use of Slovene (LPUS and a detailed study by Alenka Gložančev. While the law tries to banish all non-Slovene elements from public use with a special focus on the naming of enterprises, it surprisingly overlooks the issue of ancient names in public use, focusing primarily on English ones. Gložančev rightly points out that foreign names represent the key issue for the language-conscious public, whereas other, more important language questions are largely ignored. The LPUS and the study by Gložančev focus on English words and names, which are considered to be highly undesirable despite globalisation and Slovenia's accession to the European Union in May 2004. The use of ancient names, which are by definition foreign, in the naming of enterprises and venues proves to be a much more difficult issue, since ancient names are often dissociated from the context or signify nothing familiar to the consumer. Can it be expected that, in the name of defending the Slovene language and cultural heritage, the restrictions enforced by the LPUS on the use of foreign names will contribute to the disappearance of antiquity from contemporary everyday life?
41 CFR 102-84.15 - Why must I provide information for the Annual Real Property Inventory?
2010-07-01
...; and (2) Establish information systems, implement inventory controls and conduct surveys, in accordance... information for the Annual Real Property Inventory? 102-84.15 Section 102-84.15 Public Contracts and Property... PROPERTY 84-ANNUAL REAL PROPERTY INVENTORIES § 102-84.15 Why must I provide information for the Annual Real...
41 CFR 102-192.125 - What is the appropriate managerial level for an agency mail manager?
2010-07-01
... managerial level for an agency mail manager? 102-192.125 Section 102-192.125 Public Contracts and Property... ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT Agency Mail Manager Requirements § 102-192.125 What is the appropriate managerial level for an agency mail manager? The agency mail manager should be at a managerial...
National Research Council Canada - National Science Library
Simeone, Jr, Matthew J
2007-01-01
.... Virtual public-private partnerships (VP3s) offer local law enforcement agencies an effective and efficient way to leverage a vast and resourceful private sector for the purpose of enhancing ILP...
A 'Scottish Poor Law of Lunacy'? Poor Law, Lunacy Law and Scotland's parochial asylums.
Farquharson, Lauren
2017-03-01
Scotland's parochial asylums are unfamiliar institutional spaces. Representing the concrete manifestation of the collision between two spheres of legislation, the Poor Law and the Lunacy Law, six such asylums were constructed in the latter half of the nineteenth century. These sites expressed the enduring mandate of the Scottish Poor Law 1845 over the domain of 'madness'. They were institutions whose very existence was fashioned at the directive of the local arm of the Poor Law, the parochial board, and they constituted a continuing 'Scottish Poor Law of Lunacy'. Their origins and operation significantly subverted the intentions and objectives of the Lunacy Act 1857, the aim of which had been to institute a public district asylum network with nationwide coverage.
2013-12-20
... DEPARTMENT OF TRANSPORTATION Maritime Administration [Docket No. MARAD-2013-0151] Requested Administrative Waiver of the Coastwise Trade Laws: Vessel AFFAIR; Invitation for Public Comments AGENCY: Maritime... AFFAIR is: Intended Commercial Use of Vessel: ``Charter Fishing (sport) & sightseeing tours.'' Geographic...
International Nuclear Information System (INIS)
Baur, J.F.
1994-01-01
The papers presented at the meeting discuss the following subjects: The public utilities and their scope of exemptions from provisions of the antitrust laws as established by court rulings; reimbursement for electricity supplied to the grid and the phasing out of franchise agreements; the competition policy of the Federal Cartel Office towards the public utilities; legal and economic implications of the competition policy adopted by the Federal Cartel Office for the structures of the public sector of the power supply industry; ensuring safe and priceworthy power supply in Europe. The five papers can be separately retrieved from the database. (HSCH) [de
Directory of Open Access Journals (Sweden)
Rosa Urbanos
2010-01-01
Full Text Available La nueva ley estatal de salud pública ha de sustanciar la reforma de la salud pública. El texto legal debería abrir paso a la modernización y a la adaptación de las estructuras de salud pública a las nuevas necesidades. Se precisa un concepto más amplio de salud pública y una redefinición de sus funciones y servicios básicos. La creación de una Agencia Española de Salud Pública y de un Consejo de Salud Pública, la elaboración de una Estrategia Española de Salud Pública y la reforma de la formación de los profesionales, son algunas de las principales recomendaciones para la futura ley.The upcoming public health law must serve as the basis for public health reform. The text of the law should allow public health structures to be modernized and adapted to the country's new needs. A broader concept of public health and a redefinition of its functions and basic services are required. Some of the main suggestions for the upcoming law are the establishment of a Spanish Agency for Public Health and a Public Health Council, the design of a Spanish Strategy of Public Health, and reform of professional training.
41 CFR 102-117.255 - What actions may I take if the TSP's performance is not satisfactory?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What actions may I take if the TSP's performance is not satisfactory? 102-117.255 Section 102-117.255 Public Contracts and... may I take if the TSP's performance is not satisfactory? If the TSP's performance is not satisfactory...
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false May SASPs pick up or store donated drug paraphernalia in their distribution centers? 102-41.230 Section 102-41.230 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL...
41 CFR 109-27.102-52 - Implementation.
2010-07-01
... contracting, and shall approve its implementation. In those instances where a cost benefit study has... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Implementation. 109-27...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-52 Implementation. (a) DOE OPMOs shall establish...
Contradictions of labor law during elections
Directory of Open Access Journals (Sweden)
Jorge Márquez
2015-10-01
Full Text Available Our article is part of a research to understand Uruguayan labour law through an analysis of the contradictions that arise between the rights and obligations derived from public law rules in the current stage where labour law is dispersed within the voluminous set of rules that conforms Uruguayan law. Our argument focuses particularly on the topic of the working hours that officers and public notaries invest whenever citizenship is convened to vote in the electoral polls, the most important act in a democracy. We hope this publication may arise a debate that contributes to the construction of new rules helping in the creation of a better labour law.
The growing interrelationship between nuclear law and environmental law
International Nuclear Information System (INIS)
Bourdon, Pierre
2015-01-01
With the recent United Nations Climate Change Conference (COP21) in Paris, a great deal of attention is being given to low-carbon energy technologies and policies that could help the world limit the global temperature increase to 2 deg. Celsius. Among these technologies, nuclear energy, which remains the largest source of low-carbon electricity in OECD countries and the second largest source of electricity at the global level after hydropower, can play a key role. The 2011 Fukushima Daiichi accident heightened public concern over the safety of nuclear energy in many countries. Because of the potentially far-reaching consequences of the use of nuclear energy on the environment in the case of an accident, it is commonly thought that nuclear law and environmental law are not entirely compatible or do not necessarily share the same objectives. Nuclear law may be defined as 'the body of special legal norms created to regulate the conduct of legal or natural persons engaged in activities related to fissionable materials, ionizing radiation and exposure to natural sources of radiation', while environmental law can be defined as 'the body of law that contains elements to control the human impact on the Earth and on public health'. These two areas of law were considered independently in the past, since the initial focus of nuclear law, which was developed before environmental law, was to protect people and property, without explicitly referring to the environment. However, the 1986 Chernobyl accident and increasing environmental concerns during that same decade led to a growing emphasis on environmental protection in the field of nuclear activities. On the one hand, nuclear law, as 'lex specialis', aims to ensure that nuclear activities are carried out in a manner that is safe for both the public and the environment. On the other hand, the expansion of the realm of environmental law has given rise to the application of environmentally focused
41 CFR 102-85.5 - By what authority is the pricing policy in this part prescribed?
2010-07-01
... pricing policy in this part prescribed? 102-85.5 Section 102-85.5 Public Contracts and Property Management...-PRICING POLICY FOR OCCUPANCY IN GSA SPACE Pricing Policy-General § 102-85.5 By what authority is the pricing policy in this part prescribed? (a) General authority is granted in the Federal Property and...
41 CFR 102-192.140 - What are your general responsibilities as a Federal mail center manager?
2010-07-01
... responsibilities as a Federal mail center manager? 102-192.140 Section 102-192.140 Public Contracts and Property... ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT Mail Center Manager Requirements § 102-192.140 What are your general responsibilities as a Federal mail center manager? A Federal mail center manager should— (a) Implement policies and...
41 CFR 301-11.102 - What is the applicable M&IE rate?
2010-07-01
... 24 hours or more, and you are traveling to a new TDY site or stopover point at midnight The M&IE rate applicable to the new TDY site or stopover point. Travel is 24 hours or more, and you are returning to your...&IE rate? 301-11.102 Section 301-11.102 Public Contracts and Property Management Federal Travel...
2010-07-01
... concerning photographs for news, advertising or commercial purposes? 102-74.420 Section 102-74.420 Public..., Advertising Or Commercial Purposes § 102-74.420 What is the policy concerning photographs for news, advertising or commercial purposes? Except where security regulations, rules, orders, or directives apply or a...
2010-07-01
... safety and environmental management policies for real property? 102-80.10 Section 102-80.10 Public... MANAGEMENT REGULATION REAL PROPERTY 80-SAFETY AND ENVIRONMENTAL MANAGEMENT General Provisions § 102-80.10 What are the basic safety and environmental management policies for real property? The basic safety and...
Constitutional Law and International Law at the Turn of the Century ...
African Journals Online (AJOL)
Administrator
Prof Dr Jochen Abr. Frowein, Director of the Max-Planck-Institute for Comparative Public. Law and ... To consider how Constitutional Law or International Law were understood in 1900 means to notice the immense .... In the relationship between the political organs of a state the role of the Constitutional Court should be seen ...
Melot, Romain
2015-01-01
In this publication, the editors present the first comparative overview of expropriation law in Europe covering 15 different jurisdictions. For many of the countries represented, this publication is the first English-language description of their national expropriation law. This survey provides a lot of information for all practitioners in the field of expropriation of land.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Are there special provisions to reporting and transferring drug paraphernalia forfeited under 21 U.S.C. 863? 102-41.225 Section 102-41.225 Public Contracts and Property Management Federal Property Management Regulations System...
2010-07-01
... in mail management and mail operations; (b) Identifying better business practices and sharing them... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What types of support does GSA offer to Federal agency mail management programs? 102-192.175 Section 102-192.175 Public...
41 CFR 102-192.145 - Which program levels should have a mail manager?
2010-07-01
... should have a mail manager? 102-192.145 Section 102-192.145 Public Contracts and Property Management... have a mail manager? Every program level within a Federal agency that generates a significant quantity of outgoing mail should have its own mail manager. Each agency must decide which programs will have a...
Faunce, Thomas A
2007-01-01
This paper considers how best to approach dilemmas posed to global health and biosecurity policy by increasing advances in practical applications of nanotechnology. The type of nano-technology policy dilemmas discussed include: (1) expenditure of public funds, (2) public-funded research priorities, (3) public confidence in government and science and, finally, (4) public safety. The article examines the value in this context of a legal obligation that the development of relevant public health law be calibrated against less corporate-influenced norms issuing from bioethics and international human rights.
2013-02-28
... DEPARTMENT OF TRANSPORTATION Maritime Administration [Docket No. MARAD-2013 0013] Requested Administrative Waiver of the Coastwise Trade Laws: Vessel SPIRIT; Invitation for Public Comments AGENCY: Maritime... . SUPPLEMENTARY INFORMATION: As described by the applicant the intended service of the vessel SPIRIT is: Intended...
2012-04-16
... DEPARTMENT OF TRANSPORTATION Maritime Administration [Docket No. MARAD 2012 0049] Requested Administrative Waiver of the Coastwise Trade Laws: Vessel SPIRIT; Invitation for Public Comments AGENCY: Maritime... . SUPPLEMENTARY INFORMATION: As described by the applicant the intended service of the vessel SPIRIT is: Intended...
lawstat: An R Package for Law, Public Policy and Biostatistics
Directory of Open Access Journals (Sweden)
Wallace Hui
2008-01-01
Full Text Available We present a new R software package lawstat that contains statistical tests and procedures that are utilized in various litigations on securities law, antitrust law, equal employment and discrimination as well as in public policy and biostatistics. Along with the well known tests such as the Bartels test, runs test, tests of homogeneity of several sample proportions, the Brunner-Munzel tests, the Lorenz curve, the Cochran-Mantel-Haenszel test and others, the package contains new distribution-free robust tests for symmetry, robust tests for normality that are more sensitive to heavy-tailed departures, measures of relative variability, Levene-type tests against trends in variances etc. All implemented tests and methods are illustrated by simulations and real-life examples from legal cases, economics and biostatistics. Although the package is called lawstat, it presents implementation and discussion of statistical procedures and tests that are also employed in a variety of other applications, e.g., biostatistics, environmental studies, social sciences and others, in other words, all applications utilizing statistical data analysis. Hence, name of the package should not be considered as a restriction to legal statistics. The package will be useful to applied statisticians and "quantitatively alert practitioners" of other subjects as well as an asset in teaching statistical courses.
French law on Muslim veil wearing in public schools
Directory of Open Access Journals (Sweden)
Božić Marko
2012-01-01
Full Text Available Combining normative analysis of a legal text with a study of a wider social and historical context, this paper tries to prove that the French Law of 15th March 2004, which forbids displaying of religious symbols, and most of all, the Muslim veil in public schools, does not represent a continuation, but a break up with a liberal-democratic tradition of protection of religious rights of the Fifth Republic. The aforementioned legislation radically changes the idea of profane, which is, religiously neutral country, as there is a value itself that is being created out of laicité - an instrumental principle of protection of the freedom of religion, whose protection requires a limitation of the religious freedom. In order to understand the motives of the French legislator, it is necessary to accompany the normative analysis of laws with an observation of a wider social context in which the mentioned problem occurs. Therefore, this paper takes into account the need for a multidisciplinary approach, that is, the need to consider both the historical perspective and the social analysis of the context of the legal prohibition. We are of belief that from a methodological aspect this paper represents a contribution to those positions in legal science which insist on the necessity of studying a wider social background of normative solutions as a prerequisite for a successful analysis of a legal text.
Issues Associated with the Conveyance and Transfer of DOE Lands under Public Law 105-119
International Nuclear Information System (INIS)
Ladino, A.G.
1999-01-01
Public Law 105-119 (Law) was enacted in November 1997 as part of the Defense Authorization Act of 1998 (Act). The Law specifically requires the US Department of Energy (DOE) to identify lands that are suitable for conveyance or transfer at Los Alamos National Laboratory (LANL) within 90 days after enactment of the Act. In general, suitable lands include those parcels that are not required to meet the national security missions assigned to DOE at LANL within a ten year period beginning on the date of enactment of the Act. Additional suitability criteria are addressed below and include the need to establish clear title to the land and to restore areas contaminated with hazardous wastes. This proposed change in future land ownership is intended to serve as the final settlement of DOE community assistance obligations with respect to LANL and Los Alamos County and to stimulate economic development
40 CFR 282.102 - Puerto Rico State-Administered Program.
2010-07-01
... include: (1) Public Policy Environmental Act of 1970, Act Number 9, June 18, 1970, as amended, 12 Laws of... include: (1) Public Policy Environmental Act of 1970, Act Number 9, June 18, 1970, as amended, 12 Laws of... 603(A)(5) requires owners and operators to obtain permits or franchises for drilling and installation...
de la Garza, Rodolfo; Moghadam, Sepehr Hejazi
2008-01-01
The purpose of this Tomas Rivera Policy Institute (TRPI) report is twofold: to provide an analysis of the enrollment trends for African American and Latino students among graduate professional programs in the fields of medicine, business, law, and public affairs, and to present other relevant data pertaining to African American and Latino students…
41 CFR 102-72.30 - What are the different types of delegations related to real estate leasing?
2010-07-01
... types of delegations related to real estate leasing? 102-72.30 Section 102-72.30 Public Contracts and... REGULATION REAL PROPERTY 72-DELEGATION OF AUTHORITY Delegation of Authority § 102-72.30 What are the different types of delegations related to real estate leasing? Delegations related to real estate leasing...
2010-07-01
... Hazardous Substances Pollution Contingency Plan and initiating or cooperating with others in the actions... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Who must perform the... disposal? 102-75.965 Section 102-75.965 Public Contracts and Property Management Federal Property...
Unjust enrichment in business law
Vydrová, Zuzana
2016-01-01
This thesis analyses the concept of unjust enrichment under the business law. First of all the thesis explains the term of business law. Business law is a complex of legal rules concerning the contractual relationships between entrepreneurs arising from their business activities. Business law is a comprehensive field of law which extends into many other fields of law, both private and public law. Equally the regulation of unjust enrichment within the business law expands into many other laws ...
41 CFR 102-73.170 - What types of special purpose space may the Department of Agriculture lease?
2010-07-01
... purpose space may the Department of Agriculture lease? 102-73.170 Section 102-73.170 Public Contracts and... § 102-73.170 What types of special purpose space may the Department of Agriculture lease? The Department of Agriculture is delegated the authority to lease the following types of special purpose space: (a...
41 CFR 102-37.540 - What is the authority for donations to the American National Red Cross?
2010-07-01
... for donations to the American National Red Cross? 102-37.540 Section 102-37.540 Public Contracts and... REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY Donations to the American National Red Cross § 102-37.540 What is the authority for donations to the American National Red Cross? Section 551...
41 CFR 102-74.425 - What is the policy concerning dogs and other animals on Federal property?
2010-07-01
... concerning dogs and other animals on Federal property? 102-74.425 Section 102-74.425 Public Contracts and... REGULATION REAL PROPERTY 74-FACILITY MANAGEMENT Conduct on Federal Property Dogs and Other Animals § 102-74.425 What is the policy concerning dogs and other animals on Federal property? No person may bring dogs...
Directory of Open Access Journals (Sweden)
Mihai Cristian Apostolache
2017-06-01
Full Text Available Since its entry into force and to date, Law no. 215/2001 on local public administration has undergone many amendments and completions. One of the questionable additions to this act is done by GEO (OUG no. 41/2015, a regulation which brought two new articles to the body of the framework-law on local public administration, i.e. Article 55¹ and Article 99¹. These two articles regulate a unique way of establishing the local or county council, namely by reconstituting these autonomous collegial bodies. This article examines the legislative intervention made by GEO no. 41/2015 and highlights the unconstitutionality aspects of this legislative intervention, recommending the legislature to urgently repeal the regulations governing the reconstitution of the local and county councils.
2010-07-01
... responsibilities to provide national visibility for Art-in-Architecture? 102-77.25 Section 102-77.25 Public... MANAGEMENT REGULATION REAL PROPERTY 77-ART-IN-ARCHITECTURE Art-in-Architecture § 102-77.25 Do Federal agencies have responsibilities to provide national visibility for Art-in-Architecture? Yes, Federal...
2010-07-01
... policy must Federal agencies follow in the management of facilities? 102-74.155 Section 102-74.155 Public... MANAGEMENT REGULATION REAL PROPERTY 74-FACILITY MANAGEMENT Facility Management Energy Conservation § 102-74.155 What energy conservation policy must Federal agencies follow in the management of facilities...
41 CFR 102-2.30 - Where and in what formats is the FMR published?
2010-07-01
... formats is the FMR published? 102-2.30 Section 102-2.30 Public Contracts and Property Management Federal... published? Proposed rules are published in the Federal Register. FMR bulletins are published in looseleaf format. FMR interim and final rules are published in the following formats— (a) Federal Register under...
Military Child Education DSN: (315) 477-9422 COMM: (808) 477-9422 Individual Contacts Branch Chief, Quality Directory Media Inquiries Home : Resources : Quality of Life J102 Quality of Life and Military Child Education Branch PACOM Quality of Life and Education Facebook Page | USPACOM SAPR 24/7 Emergency Lines and
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Do we report to GSA all forfeited, voluntarily abandoned, or unclaimed drug paraphernalia not required for official use? 102-41.215 Section 102-41.215 Public Contracts and Property Management Federal Property Management Regulations System...
International Nuclear Information System (INIS)
Kloepfer, M.
1989-01-01
This comprehensive reference book on environmental law and practice also is a valuable textbook for students specializing in the field. The entire law on pollution control and environmental protection is presented in an intelligent system, covering the latest developments in the Federal and Land legislation, public environmental law, and the related provisions in the fields of civil law and criminal law. The national survey is rounded up by information concerning the international environmental law, environmental law of the European Communities, and of other foreign countries as e.g. Austria and Switzerland. The author also reviews conditions in neighbouring fields such as technology and labour law, environmental economy, environmental policy. Special attention is given to current topics, as e.g. relating to genetic engineering, disused landfills or industrial sites, soil protection, transport of hazardous goods, liability for damage to forests, atomic energy law, and radiation protection law. The latest publishing dates of literature and court decisions considered in the book are in the first months of 1989. (RST) [de
2010-07-01
... being offered for sale be withdrawn and approved for donation? 102-37.85 Section 102-37.85 Public... MANAGEMENT REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY General Provisions Donation Overview § 102-37.85 Can surplus property being offered for sale be withdrawn and approved for donation...
41 CFR 105-64.102 - What is GSA's policy on disclosure of information in a system of records?
2010-07-01
... disclosure of information in a system of records? 105-64.102 Section 105-64.102 Public Contracts and Property Management Federal Property Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION... Responsibilities § 105-64.102 What is GSA's policy on disclosure of information in a system of records? No...
2010-07-01
... consideration should be given to designating items having possible historical or artistic value as personal... related personal property in a structure scheduled for demolition? 102-75.170 Section 102-75.170 Public... As Personal Property § 102-75.170 What happens to the related personal property in a structure...
41 CFR 102-118.130 - Must my agency use a GBL for express, courier, or small package shipments?
2010-07-01
... package express delivery, the terms and conditions of that contract are binding. ... for express, courier, or small package shipments? 102-118.130 Section 102-118.130 Public Contracts and... Transportation Services § 102-118.130 Must my agency use a GBL for express, courier, or small package shipments...
Éric Darmon; Thomas Le Texier
2014-01-01
In the case of digital piracy should rights be publicly or privately enforced? The emergence of large-scale anti-piracy laws and the existence of non-monitored illegal channels raise important issues for the design of digital anti-piracy policies. In this paper, we study the impact of these two enforcement settings (public vs. private) in the presence of an illegal non-monitored outside option for users. Taking account of market outcomes, we show that in both cases, the optimal strategies of ...
Manitoba Dept. of Education, Winnipeg.
This publication outlines a law course intended as part of a business education program in the secondary schools of Manitoba, Canada. The one credit course of study should be taught over a period of 110-120 hours of instruction. It provides students with an introduction to the principles, practices, and consequences of law with regard to torts,…
41 CFR 102-37.465 - May a SASP modify or release any of the terms and conditions of donation?
2010-07-01
... release any of the terms and conditions of donation? 102-37.465 Section 102-37.465 Public Contracts and... REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY Donations to Public Agencies, Service... SASP modify or release any of the terms and conditions of donation? You may alter or grant releases...
41 CFR 102-75.145 - Is GSA required to review each report of excess?
2010-07-01
... landholding agency, in writing, whether the report is acceptable or other information is needed within 15... review each report of excess? 102-75.145 Section 102-75.145 Public Contracts and Property Management... Is GSA required to review each report of excess? Yes, GSA must review each report of excess to...
2013-11-22
... Administrative Waiver of the Coastwise Trade Laws: Vessel BEE; Invitation for Public Comments AGENCY: Maritime... entered into this docket is available on the World Wide Web at http://www.regulations.gov . FOR FURTHER....gov . SUPPLEMENTARY INFORMATION: As described by the applicant the intended service of the vessel BEE...
45 CFR 164.412 - Law enforcement delay.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Law enforcement delay. 164.412 Section 164.412 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES ADMINISTRATIVE DATA STANDARDS AND RELATED... § 164.412 Law enforcement delay. If a law enforcement official states to a covered entity or business...
2010-07-01
... medical shelf-life items held for national emergency purposes? 102-36.460 Section 102-36.460 Public... Disposal Requires Special Handling Shelf-Life Items § 102-36.460 Do we report excess medical shelf-life items held for national emergency purposes? When the remaining shelf life of any medical materials or...
2010-07-01
... assignments. However, provisions are necessary to cover the GSA and customer relationship if an OA expires... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What happens if a customer agency continues occupancy after the expiration of an OA? 102-85.205 Section 102-85.205 Public...
2010-07-01
... What role does my agency play in the Standard and Optional Forms Management Program? Your agency head... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What role does my agency play in the Standard and Optional Forms Management Program? 102-194.30 Section 102-194.30 Public...
29 CFR 102.143 - “Adversary adjudication” defined; entitlement to award; eligibility for award.
2010-07-01
...; eligibility for award. 102.143 Section 102.143 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS... Marketing Act (12 U.S.C. 1141j(a)) with not more than 500 employees; and (5) Any other partnership, corporation, association, unit of local government, or public or private organization with a net worth of not...
41 CFR 102-74.135 - Who selects construction and alteration projects that are to be performed?
2010-07-01
... and alteration projects that are to be performed? 102-74.135 Section 102-74.135 Public Contracts and... construction and alteration projects that are to be performed? The Administrator of General Services selects construction and alteration projects to be performed. ...
2013-11-18
... International Law (ACPIL): Public Meeting on Electronic Commerce The Office of the Assistant Legal Adviser for... IV (electronic commerce), the UNCITRAL Secretariat has prepared draft provisions on electronic...://www.uncitral.org/uncitral/en/commission/working_groups/4Electronic_Commerce.html . This Working Paper...
41 CFR 102-37.115 - May a holding agency be reimbursed for costs incurred incident to a donation?
2010-07-01
... reimbursed for costs incurred incident to a donation? 102-37.115 Section 102-37.115 Public Contracts and... REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY Holding Agency § 102-37.115 May a holding agency be reimbursed for costs incurred incident to a donation? Yes, you, as a holding agency, may...
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Is there any additional personal property sales information that we must submit to the General Services Administration? 102-38.335 Section 102-38.335 Public Contracts and Property Management Federal Property Management Regulations System...
41 CFR 102-34.290 - What forms do I use to report a crash involving a domestic fleet motor vehicle?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What forms do I use to report a crash involving a domestic fleet motor vehicle? 102-34.290 Section 102-34.290 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT...
2010-01-01
... of Nicaragua and Cuba under Public Law 105-100. 245.13 Section 245.13 Aliens and Nationality... PERMANENT RESIDENCE § 245.13 Adjustment of status of certain nationals of Nicaragua and Cuba under Public... section 241(a)(5) of the Act, if the alien: (1) Is a national of Nicaragua or Cuba; (2) Except as provided...
Legal financial institutions in the Water Law Act
Directory of Open Access Journals (Sweden)
Andrzej Borodo
2015-12-01
Full Text Available Some fees and payments are connected with obligatory participation in the cost of public projects and public investment. In the framework of the Water Law Act there are diverse public payments and fees. In this law there is the drainage fee and the investment fee. There are also contributions and other payments to the water companies. In the regulations of the Water Law Act there are also legal financial solutions for sharing the public costs, the use of budget subsidies, fixing and allocation of public expenditure.
2010-07-01
... FSCAP on non-military FAA-type certificated Government aircraft? 102-33.230 Section 102-33.230 Public... Aircraft Parts Managing Aircraft Parts § 102-33.230 May we use military FSCAP on non-military FAA-type... installation by the FAA. See detailed guidance in FAA Advisory Circular 20-142, “Eligibility and Evaluation of...
41 CFR 102-33.190 - What are the aircraft operations and ownership costs for which we must account?
2010-07-01
... operations and ownership costs for which we must account? 102-33.190 Section 102-33.190 Public Contracts and... Parts Accounting for the Cost of Government Aircraft § 102-33.190 What are the aircraft operations and ownership costs for which we must account? You must account for the operations and ownership costs of your...
2011-12-13
... International Law (ACPIL): Public Meeting on Electronic Commerce The Department of State, Office of Legal... electronic transferable records. Working Group IV (international electronic commerce) of the United Nations... electronic transferable records. A report from that meeting, once it is published, should be available at...
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Can the Administrator of General Services waive the postpayment auditing provisions of this subpart? 102-118.420 Section 102-118... Transportation Audits § 102-118.420 Can the Administrator of General Services waive the postpayment auditing...
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What information must a Federal agency submit to GSA after the agency has identified a need for construction or alteration of a public building? 102-74.145 Section 102-74.145 Public Contracts and Property Management Federal Property Management Regulations System (Continued...
Downs, Philip G.
2012-01-01
This study examines the impact of the school accountability laws "No Child Left Behind" and Indiana's Public Law 221 on Superintendents' perception of their relationship with the Teachers' Union Leader in their mandatory discussion meetings. Both school accountability laws contain provisions for the Indiana's Department of Education to…
International Nuclear Information System (INIS)
Unterpertinger, L.
2015-01-01
This study examines the conflict between the public interests in the use of renewable energy on the one hand and environmental protection on the other hand. Considering the current legal situation, the first part of the thesis elaborates on what theses concrete public interests are, and how they are regulated by law. Likewise, it shall be asked to what extent the legislator defines overriding public interests, and its impact on balance of interests. The second part focuses on balance of interests from an administrative law perspective. It overviews the current debates on whether balance of interests is meant to have discretion. In this context, the recent establishment of a two-level administrative jurisdiction has posed new questions. It is, therefore, necessary to conduct a profound analysis of the administrative control. With reference to the case law of the Administrative Court, it will also be shown that balance of interests is based on a proportional assessment. Moreover, with respect to the administrative procedures for hydropower projects, there is a relevant provision in the Austrian Water Act, which has specific characteristics, yet was interpreted inconsistently up to this point. Thus, this provision will be examined in detail. The relevant administrative body does not only use legal provisions, but also criteria documents which are internal administrative regulations. Those documents will be further discussed as well. (author) [de
2010-07-01
... exchange excess medical shelf-life items with other federal agencies? 102-36.465 Section 102-36.465 Public... Disposal Requires Special Handling Shelf-Life Items § 102-36.465 May we transfer or exchange excess medical shelf-life items with other federal agencies? Yes, you may transfer or exchange excess medical shelf...
41 CFR 102-118.260 - Must my agency send all quotations, tenders, or contracts with a TSP to GSA?
2010-07-01
... quotations, tenders, or contracts with a TSP to GSA? 102-118.260 Section 102-118.260 Public Contracts and... REGULATION TRANSPORTATION 118-TRANSPORTATION PAYMENT AND AUDIT Use of Government Billing Documents Quotations, Tenders Or Contracts § 102-118.260 Must my agency send all quotations, tenders, or contracts with a TSP to...
41 CFR 102-38.315 - Are we required to use Alternative Disputes Resolution for sales contracts?
2010-07-01
... Alternative Disputes Resolution for sales contracts? 102-38.315 Section 102-38.315 Public Contracts and... required to use Alternative Disputes Resolution for sales contracts? No, you are not required to use Alternative Disputes Resolution (ADR) for sales contracts. However, you are encouraged to use ADR procedures...
41 CFR 102-34.65 - How may we request an exemption from the fuel economy standards?
2010-07-01
... exemption from the fuel economy standards? 102-34.65 Section 102-34.65 Public Contracts and Property... an exemption from the fuel economy standards? You must submit a written request for an exemption from the fuel economy standards to: Administrator, General Services Administration, ATTN: Deputy Associate...
41 CFR 102-75.1155 - May an acceptable gift of property be converted to money?
2010-07-01
... of property be converted to money? 102-75.1155 Section 102-75.1155 Public Contracts and Property...-75.1155 May an acceptable gift of property be converted to money? GSA can determine whether or not a gift of property can and should be converted to money. After conversion, GSA must deposit the funds...
29 CFR 4.102 - Administration of the Act.
2010-07-01
...'Hara Service Contract Act Introductory § 4.102 Administration of the Act. As provided by section 4 of the Act and under provisions of sections 4 and 5 of the Walsh-Healey Public Contracts Act (49 Stat... authorized and directed to administer and enforce the provisions of the McNamara-O'Hara Service Contract Act...
2011-09-14
... International Law (ACPIL): Public Meeting on Electronic Commerce The Department of State, Office of Legal... future work of Working Group IV (international electronic commerce) of the United Nations Commission on... electronic commerce. The report of the Forty-fourth session of UNCITRAL describes the future work of Group IV...
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What source of information can my agency use to identify materials that describe how to do business with GSA? 102-2.125 Section 102-2.125 Public Contracts and Property Management Federal Property Management Regulations System...
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is the scope and philosophy of the General Services Administration's (GSA) real property policies? 102-71.5 Section 102-71.5...) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 71-GENERAL § 102-71.5 What is the scope and philosophy of the...
41 CFR 102-192.150 - What are your general responsibilities as a program level mail manager?
2010-07-01
... responsibilities as a program level mail manager? 102-192.150 Section 102-192.150 Public Contracts and Property... general responsibilities as a program level mail manager? Your responsibilities at the program level include— (a) Working closely with the agency mail manager and mail center managers who handle significant...
41 CFR 101-27.102 - Economic order quantity principle.
2010-07-01
... MANAGEMENT 27.1-Stock Replenishment § 101-27.102 Economic order quantity principle. The economic order quantity (EOQ) principle is a means for achieving economical inventory management. Application of the EOQ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Economic order quantity...
2013-07-23
... TENNESSEE VALLEY AUTHORITY Paperwork Reduction Act of 1995, as Amended by Public Law 104-13; Proposed Collection, Comment Request AGENCY: Tennessee Valley Authority. ACTION: Proposed Collection... preference. The information is used to make comparative appraisals and to assist in selections. The affected...
2010-05-18
... TENNESSEE VALLEY AUTHORITY Paperwork Reduction Act of 1995, as Amended by Public Law 104-13; Proposed Collection, Comment Request AGENCY: Tennessee Valley Authority. ACTION: Proposed collection... preference. The information is used to make comparative appraisals and to assist in selections. The affected...
2010-01-01
... of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE SERVICE, RURAL UTILITIES... its successor agency under Public Law 103-354 employee will, while conducting official business...-354 State and County Offices. (g) Racial and ethnic data. Recipients should maintain, for review by Fm...
Energy Technology Data Exchange (ETDEWEB)
Mitto, L.
2007-07-01
The liberalization of the electric power market and gas market has released a comprehensive reorganisation of the energy branch. Under this aspect, the author of the book under consideration reports on power network operators, their improper behaviour as well as the use of the instruments of energy economy act, public order law, and criminal law in order to sanction power network operators.
2010-07-01
... forfeited distilled spirits, wine, and beer to GSA for disposal? 102-41.205 Section 102-41.205 Public..., and Beer § 102-41.205 Do we report all forfeited distilled spirits, wine, and beer to GSA for disposal? (a) Yes, except do not report distilled spirits, wine, and beer not fit for human consumption or for...
Health Law 2015: Individuals and Populations.
Jacobson, Peter D; Dahlen, Rachel
2016-12-01
In this article, we assess two particular trends in judicial doctrine that are likely to emerge in the post-ACA era. The first trend is the inevitable emergence of enterprise medical liability (EML) that will supplant tort law's unstable attempt to apportion liability between physicians and institutions. Arguments favoring EML in health law date back to the early 1980s. But health care's ongoing consolidation suggests that the time has arrived for courts or state legislatures to develop legal doctrine that more closely resembles the ways in which health care is now delivered. This would result in a more appropriate allocation of liability to the institutional level. The second judicial trend will be the convergence of health law and public health law concepts. Because the ACA arguably stimulates closer engagement between health systems and public health departments, health systems will have greater responsibility for keeping their communities healthy along with obligations for individual patient care (i.e., individuals and populations). If so, courts will need to incorporate elements from health law and public health law in resolving disputes. Copyright © 2016 by Duke University Press.
22 CFR 231.16 - Governing law.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Governing law. 231.16 Section 231.16 Foreign... EMERGENCY WARTIME SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUBLIC LAW 108-11-STANDARD TERMS AND CONDITIONS § 231.16 Governing law. This Guarantee shall be governed by and construed in accordance with the laws of...
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Is there any other information that needs to accompany (or be submitted with) the Report of Excess Real Property (Standard Form 118)? 102-75.120 Section 102-75.120 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL...
45 CFR 98.3 - Effect on State law.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Effect on State law. 98.3 Section 98.3 Public... Goals, Purposes and Definitions § 98.3 Effect on State law. (a) Nothing in the Act or this part shall be construed to supersede or modify any provision of a State constitution or State law that prohibits the...
2010-10-01
... requirements; (c) Government contract quality assurance is conducted before acceptance (except as otherwise... tender for acceptance unless customary market practices for the commercial item being acquired permit in-process inspection (Section 8002 of Public Law 103-355). Any in-process inspection by the Government shall...
2010-07-01
... a SASP make when requesting surplus property for donation? 102-37.200 Section 102-37.200 Public... MANAGEMENT REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY State Agency for Surplus... requesting surplus property for donation? When requesting or applying for property, you must certify that: (a...
Publications | Page 102 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Through books, articles, research publications, and studies, we aim to widen the ... Mainstreaming climate change in state development planning : an analysis of ... cash transfers help Ghana address the widening gap between rich and poor ...
Zadruga as a basis of certain institutes of public law according to Valtazar Bogišić
Directory of Open Access Journals (Sweden)
Kulauzov Maša
2011-01-01
Full Text Available The rules of customary law concerning the relation between the chieftain and council in so - called zadruga (extended family, common among South Slavs were examined in this paper. In that relation, in Branislav Nedeljković's opinion, Valtazar Bogišić finds similarities with the one between the government and national assembly in parliamentary monarchy. The customary law provisions regarding zadruga's chieftain, his qualities, manner of election and authorities, as well as the rules concerning zadruga's council were presented and critically analised. It is also pointed out how the principles of zadruga's life served Bogišić as a model for introduction of parliamentary regime in Serbia. On the occasion of passing the Constitution of the Principality of Serbia of 1869, Bogišić namely suggested that the State should, to some extent, be organized after the model of zadruga. His idea of application of a private law institute such as zadruga in sphere of public law has its logical explanation. As a follower of the Historic school of law, Bogišić believed that customs are the most direct expression of national spirit without which it is impossible to become truly acquainted with characteristics and particularities of a nation. Therefore, the constitution should mostly represent codification of customary law. Naturally, in course of drafting the constitution, other nations' experiences as well as achievements of contemporary science should be taken into consideration.
Khoury, B S; Khoury, J N
2017-09-01
Criminal law in dentistry, as shaped and moulded by the prevailing views of society, defines what is or is not socially acceptable. It applies in both personal and professional contexts with the intended consequence of protecting the public from unacceptable conduct and potential imbalances of power. At its centre, a patient's consent plays a pivotal role in transforming unlawful conduct into lawful conduct. This literature review considers the current law and the trend of utilizing criminal law in addition to non-criminal law alternatives of reprimanding clinicians for failure to achieve consent in the course of dental practice. Dentists must appreciate this change and the prosecuting authority's increasing willingness to resort to criminal law. © 2017 Australian Dental Association.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Is there a general hierarchy of consideration that agencies must follow in their utilization of space? 102-79.55 Section 102-79... Utilization of Space Utilization of Space § 102-79.55 Is there a general hierarchy of consideration that...
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Is the Competition in Contracting Act of 1984, as amended (CICA), applicable to lease acquisition? 102-73.100 Section 102-73.100... Contracting Act of 1984 § 102-73.100 Is the Competition in Contracting Act of 1984, as amended (CICA...
International Nuclear Information System (INIS)
Rest, A.
1982-01-01
The author analyses the current provisions in international law and international private law for their suitability to establish liability for damages due to transfrontier pollution, also taking into account damage occurred through the operation of nuclear power plants. As a result the author suggests that the national goverments should jointly set up standards and catalogues of environmentally detrimental effects and impacts, and of the seriousness thereof, and to make these form part of international conventions and agreements which also should unambigiously state liability for compensation for damages. For activities involving special hazards, liability for risks should be introduced in such a body of international regulations. (CB) [de
HSIP Law Enforcement Locations in New Mexico
Earth Data Analysis Center, University of New Mexico — Law Enforcement Locations Any location where sworn officers of a law enforcement agency are regularly based or stationed. Law Enforcement agencies "are publicly...
The Ne Bis in Idem Principle in the Enforcement of EU Competition Law
Nguyen, Linda
2013-01-01
The current EU competition law enforcement regime was created by Regulation 1/2003 which entered into force on 1 May 2004. In essence, the system is based on a decentralised model where the European Commission and national competition authorities have parallel competences to apply EU competition provisions. National competition authorities and courts are obliged to apply Articles 101 and 102 TFEU whenever they apply national competition law to anti-competitive conduct which may affect trade b...
41 CFR 109-45.310 - Antitrust laws.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Antitrust laws. 109-45.310 Section 109-45.310 Public Contracts and Property Management Federal Property Management... Antitrust laws. DOE offices shall submit to the Deputy Assistant Secretary for Procurement and Assistance...
2010-07-01
... responsible party with respect to the hazardous substance activity? 102-75.345 Section 102-75.345 Public... Relating to Hazardous Substance Activity § 102-75.345 What is different about the statements in the offer... the hazardous substance activity? In the case where the purchaser or grantee is a potentially...
14 CFR 1260.102 - Definitions.
2010-01-01
... agreement not exceeding the small purchase threshold. Subaward means an award of financial assistance in the... or cooperative agreement that provides support or stimulation to accomplish a public purpose. Awards... individuals; and, contracts which are required to be entered into and administered under procurement laws and...
2010-07-01
... other hanging materials that are made of non-combustible or flame-resistant fabric; (f) Use only... resistant; (g) Cooperate with GSA to develop and maintain fire prevention programs that provide the maximum... accident and fire prevention responsibilities of occupant agencies? 102-74.360 Section 102-74.360 Public...
Suh, Young; Puhl, Rebecca; Liu, Sai; Milici, Frances Fleming
2014-08-01
Public attitudes about three proposed laws prohibiting weight discrimination in the US, from 2011 to 2013 were examined. An online survey using a diverse national sample of US adults to assess their level of support for three specific laws against weight discrimination was conducted. Data collection occurred between June and July in 2011 (n = 1,098), 2012 (n = 1,202), and 2013 (n = 1,202). Between 2011 and 2013, support for laws prohibiting weight discrimination remained consistent, and in some cases became increasingly supportive, primarily in 2012-2013. At least 75% of participants consistently favored laws prohibiting weight discrimination in the workplace. Individuals became increasingly supportive of extending disability protections for individuals with obesity (62% in 2011 to 69% in 2013) and adding body weight as a protected class in Civil Rights statutes (70% in 2011 to 76% in 2013). Analyses highlight specific predictors of support (gender, race, education, and political affiliation). There is strong, consistent support for policies prohibiting weight discrimination. These findings have important implications for developing specific antidiscrimination legislation to protect Americans with obesity and improve their quality of life. Copyright © 2014 The Obesity Society.
41 CFR 102-117.55 - What are the advantages and disadvantages of using a rate tender?
2010-07-01
... and disadvantages of using a rate tender? 102-117.55 Section 102-117.55 Public Contracts and Property... the advantages and disadvantages of using a rate tender? (a) Using a rate tender is an advantage when... volume to obtain favorable rates. (b) Using a rate tender may be a disadvantage when: (1) You have...
The Empty Fortress or the Poverty of Islamic Public Discourse: The Role of Law in Arab State Failure
DEFF Research Database (Denmark)
Afsah, Ebrahim
triad of Qur’an, sunna, and shari’a (read: fiqh). This body of norms is contrasted with the relatively shallow dogmatic effort to systematise public law under the dogmatic headings of ta’zir, siyasa shar’ia and siyar. This presentation argues that whatever the philosophical value of this century...
7 CFR 1980.495 - FmHA or its successor agency under Public Law 103-354 forms and guides.
2010-01-01
... for Drought and Disaster Relief” and Forms FmHA or its successor agency under Public Law 103-354 1980-68, “Lender's Agreement—Drought and Disaster Guaranteed Loans,” 1980-69, “Loan Note Guarantee—Drought... (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE SERVICE, RURAL UTILITIES SERVICE, AND FARM...
Directory of Open Access Journals (Sweden)
Esther Engelhard
2014-07-01
Full Text Available This contribution focuses on the égalité principle as the leading ground for liability after lawful acts by the State, local authorities and public authorities. Two Dutch legislative initiatives are dealt with in particular, that seek to codify, improve and expand égalité liability in administrative law, private law and criminal law. This will make the artificial égalité construction used in private law cases no longer necessary and legal reasoning more transparent. Further, the authors claim that Article 4:126 BW may open the possibility for new types of private law claims to be developed under this umbrella. However, their concerns are that the égalité principle is too vague to create the certainty and uniformity that the legislator aspires towards.