WorldWideScience

Sample records for ptx-2 sa decreased

  1. Water SA

    African Journals Online (AJOL)

    Journal Home > Vol 43, No 2 (2017) ... WaterSA publishes refereed, original work in all branches of water science, technology and engineering. ... Water SA is the WRC's accredited scientific journal which contains original research articles ... via linearized calibration method in the upstream of Huaihe River Basin, China ...

  2. Iron arsenides with three-dimensional FeAs layer networks: Can(n+1)/2(Fe1-xPtx)(2+3n)Ptn(n-1)/2As(n+1)(n+2)/2 (n=2, 3)

    Energy Technology Data Exchange (ETDEWEB)

    Katayama, Naoyuki; Onari, Seiichiro; Matsubayashi, Kazuyuki; Uwatoko, Yoshiya; Sawa, Hiroshi

    2016-12-20

    We report the comprehensive studies between synchrotron X-ray diffraction, electrical resistivity and magnetic susceptibility experiments for the iron arsenides Can(n+1)/2(Fe1-xPtx)(2+3n)Ptn(n -1)/2As(n+1)(n+2)/2 for n=2 and 3. Both structures crystallize in the monoclinic space group P21/m (#11) with three-dimensional FeAs structures. The horizontal FeAs layers are bridged by inclined FeAs planes through edge-sharing FeAs5 square pyramids, resulting in triangular tunneling structures rather than the simple layered structures found in conventional iron arsenides. n=3 system shows a sign of superconductivity with a small volume fraction. Our first-principles calculations of these systems clearly indicate that the Fermi surfaces originate from strong Fe-3d characters and the three-dimensional nature of the electric structures for both systems, thus offering the playgrounds to study the effects of dimensionality on high Tc superconductivity.

  3. Health SA Gesondheid

    African Journals Online (AJOL)

    Health SA Gesondheid - Journal of Interdisciplinary Health Sciences is an open access, .... Chokwe M. Setati, Zerish Z. Nkosi, 130-137 ... Movement as a critical concept in model generation to attain wholeness · EMAIL FREE FULL TEXT ...

  4. SalSA status

    Energy Technology Data Exchange (ETDEWEB)

    Connolly, Amy [Department of Physics and Astronomy, University College London, Gower Street, London WC1E 6BT (United Kingdom)], E-mail: amyc@hep.ucl.ac.uk

    2009-06-01

    I review the status of SalSA, a proposed antenna array in a large volume salt formation for detecting ultra-high energy neutrinos. We report on measurements taken in 2007 of attenuation lengths in the 125-900 MHz frequency range at the Cote Blanche salt mine near New Iberia, Louisiana, which is the most precise in situ measurement of attenuation lengths in salt to date. We comment on the impact of these measurements on the feasibility of SalSA.

  5. Performance Evaluation Considering Iterations per Phase and SA Temperature in WMN-SA System

    Directory of Open Access Journals (Sweden)

    Shinji Sakamoto

    2014-01-01

    Full Text Available One of the key advantages of Wireless Mesh Networks (WMNs is their importance for providing cost-efficient broadband connectivity. There are issues for achieving the network connectivity and user coverage, which are related with the node placement problem. In this work, we consider Simulated Annealing Algorithm (SA temperature and Iteration per phase for the router node placement problem in WMNs. We want to find the optimal distribution of router nodes in order to provide the best network connectivity and provide the best coverage in a set of Normal distributed clients. From simulation results, we found how to optimize both the size of Giant Component and number of covered mesh clients. When the number of iterations per phase is big, the performance is better in WMN-SA System. From for SA temperature, when SA temperature is 0 and 1, the performance is almost same. When SA temperature is 2 and 3 or more, the performance decrease because there are many kick ups.

  6. Lewis Porter, John Coltrane. Sa vie, sa musique

    OpenAIRE

    Parent, Emmanuel

    2008-01-01

    Les éditions Outre Mesure viennent de mettre à la disposition du lectorat français, avec la qualité de mise en page et en musique qu’on leur connaît, un nouveau livre de référence en musicologie du jazz. Salué à sa sortie par la critique en langue anglaise en 1998, John Coltrane. Sa vie, sa musique constitue en effet un ouvrage fort complet pour qui veut s’immerger dans le langage du heavyweight champion. L’auteur, enseignant à Rutgers (l’université du New Jersey abritant depuis les années 19...

  7. Meta Analisis sa Pagsusuri ng Maiikling Kwento sa mga Tesis at Disertasyon

    Directory of Open Access Journals (Sweden)

    Regina I. Cuizon

    2014-10-01

    Full Text Available Anumang mga pagbabago na makikita sa mundo ay bunga ng pananaliksik. Ang meta-analisis ay isa sa mga bunga ng pananaliksik na ginagamit sa kasalukuyan bilang teknik upang malaman iba pang mga nagsulputang informasyon. Ito’y pag-aaral sa mga pag-aaral. Isang kritikal at sistematikong pagsusuri sa istruktura ng mga pag-aaral. Maging gabay sa mga gradwadong paaralan sa pagpili ng paksang pagaaralan. Pangunahing layunin na matiyak ang mga pamamaraan sa pagsusuri ng maiikling kwento ng mga tesis at disertasyong nagawa mula sa mga piling SUCs. Desinyong kwalitatibo - kontent analisis sa pagsusuri ng: kaanyuan ayon sa suliranin, metodolohiya, paglalahad at interpretasyon ng mga datos, natuklasan, konklusyon, at rekomendasyon; kahinatnan ayon sa pagkatulad, pagkakaiba at kabuluhan; Emerging tema. Napag-alaman na ang karaniwang pinag-aralan ay 30% kahalagahang pangkatauhan, 20% larawangdiwa ng mga kababaihan at 10% gramatikang aspeto. Sa metodolohiyang ginamit, 80% desinyong kwalitatibo at 20% kwantitatibo-kwalitatibo. Sa paglikom ng datos 60% diretsahang pagsusuri, 30% talatanungan at 10% tseklis. Sa pag-analisa 90% kontent analisis at 10% gramatikal analisis. Batay sa natuklasan, ang pagsusuri ng maiikling kwento sa mga tesis at disertasyon mula sa iba’t ibang paaralan gamit ang meta analisis ay isang epektibo, mabisa, objektibong paraan at kagamitan na magagamit sa makatarungang paghatol; pamumuna sa kabuluhan at kagandahan; paghaham- bing sa mga kritikal na isyu; at pormulasyon ng panibagong pamantayan at batas.

  8. Planejamento em Saúde

    Directory of Open Access Journals (Sweden)

    Antonio José Costa CARDOSO

    2014-03-01

    Full Text Available Esse texto pretendeu subsidiar aula sobre Planejamento e Avaliação em Saúde para os Analistas Técnicos de Políticas Sociais lotados no Ministério da Saúde (MS, na perspectiva de promover uma maior compreensão dos antecedentes históricos do planejamento em saúde no Brasil e na América Latina, do referencial teórico metodológico do planejamento estratégico e participativo, e refletir sobre os avanços e desafios que se apresentam no atual contexto de construção do Sistema Único de Saúde (SUS. Neste sentido, foi estruturado na perspectiva de responder a três questões orientadoras: 1 Como tem se dado esse processo de coordenação do Planejamento Estratégico Nacional no âmbito do SUS, em cooperação técnica com os Estados, Municípios e Distrito Federal? 2 Quais são as tecnologias de gestão e planejamento em saúde adotadas pelo MS para conduzir esses processos de forma integrada? 3 Como se dá o gerenciamento das ações no MS? Como os planos, projetos e programas são monitorados pelas equipes responsáveis?

  9. A Robust Separation Assurance (SA) Architecture Using Integrated Airborne and Ground SA Concepts Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Intelligent Automation, Inc. proposes a robust SA architecture that uses integrated airborne and ground-based SA concepts such that SA functions are switched between...

  10. Cerditos Company S.A.

    OpenAIRE

    2010-01-01

    Esta idea de negocio consiste en la adecuación de una granja, en la cual se desarrollará el proceso de levante y comercialización de carne de cerdo en pie o en canal. Cerditos Company S.A. es una empresa que busca la calidad y el buen servicio, brindando al consumidor garantías de la carne que está consumiendo. En Colombia el mercado ha sido poco explotado comparado con otros países como Chile o Europa, donde el consumo es muy significativo, Cerditos Company S.A. busca aumentar el cons...

  11. ANALISIS DAYA SAING KEDELAI INDONESIA

    Directory of Open Access Journals (Sweden)

    Sarwono Sarwono

    2014-09-01

    Full Text Available RCA (Revealed Comparative Advantage index of soybean in Indonesia from 1983 up to 2013 is less than one, mostly. It means that the competitiveness of soybean in Indonesia is low. The purpose of this study is to analyze the factors influence the soybean competitiveness. OLS (Ordinary Least Square was used as the analysis method. Hypotheses test based on that analysis model is not bias, so that, classic divergence test is needed. It is for getting the Best Linier Unbiased Estimator (BLUE appraisal. T statistic and F statistic were also applied. The result of this research shows that production and export have positive and significant influence. In addition, exchange rate and government policy do not influence the Indonesia soybean competitiveness.Indeks RCA (Revealed Comparative Advantage kedelai Indonesia dari tahun 1983-2013 kecenderungan bernilai kurang dari satu yang berarti daya saing kedelai Indonesia rendah.Penelitian ini bertujuan untuk menganalisis faktor-faktor yang mempengaruhi daya saing kedelai Indonesia.Metode analisis yang digunakan adalah Ordinary Least Square (OLS.Pengujian hipotesis berdasarkan model analisis tersebut tidak bias maka perlu dilakukan uji penyimpangan klasik yang tujuannya agar diperoleh penaksiran yang bersifat Best Linier Unbiased Estimator (BLUE.Pengujian statistik menggunakan uji t statistikdan uji f statistik.Hasil penelitian ini menunjukkan bahwa produksi dan ekspor berpengaruh secara positif dan signifikan terhadap daya saing kedelai Indonesia. Nilai tukar rupiah dan kebijakan pemerintah tidak berpengaruh terhadap daya saing kedelai Indonesia.

  12. Saúde e desenvolvimento

    Directory of Open Access Journals (Sweden)

    Ana Luiza D'Ávila Viana

    Full Text Available Considerando que os modernos sistemas de saúde são o resultado da complexa interação de processos econômicos, políticos e sociais, o objetivo do trabalho é discutir a relação entre saúde e desenvolvimento no Brasil, mostrando que o esgotamento do modelo liberal de política econômica abre nova perspectiva para a retomada do desenvolvimento, entendido como combinação entre crescimento da economia, mudanças na estrutura produtiva e melhora das condições de vida da população. O complexo produtivo da saúde joga papel decisivo nesse processo, pois constitui um campo em que inovação tecnológica e acumulação de capital geram oportunidades de investimento, trabalho e renda, além de produzir avanços importantes para melhorar o estado de saúde das pessoas. A recente adoção de políticas públicas voltadas para articular, de forma positiva, aspectos da política econômica e da política social revela que a questão do desenvolvimento nacional ganhou nova centralidade na agenda governamental, o que abre a perspectiva de maior integração entre a lógica econômica e a lógica sanitária. Entretanto, é preciso reconhecer que o Brasil ainda não logrou alcançar uma associação virtuosa entre saúde e desenvolvimento.

  13. Varyasyong Leksikal sa mga Dayalektong Mandaya

    Directory of Open Access Journals (Sweden)

    Dr. Raymund M. Pasion

    2014-12-01

    Full Text Available Layuning panlahat sa pag-aaral na ito na tuklasin ang varyasyong leksikalsa Wikang Mandaya na matatagpuan sa Probinsyang Davao Oriental. Bilang lunsaran sa paglilikom ng mga datos, ginamit ang mga terminong kultural na pangkabuhayan tulad ng pagsasaka, pangangaso, pangingisda at paghahayupan nanababatay sa Indigenous Knowledge System and Practices (IKSP.Sinikap sagutin sa pagaaral ang suliraning ano-anong varyasyong liksikal ang makikita sa mga terminong kultural na pangkabuhayan ng Mandaya na makikita sa munisipalidad ng Caraga, Manay, Bagangaat Cateel? Disenyong kwalitatibo ginamit.Metodong indehinusat deskriptibo naman ang ginamit mula sa paglilikom hanggang sa pag-aanalisa ng mga datos. Samantalang, ang mga impormante ay pinilisa pamamagitan ng kombinasyong purposive at snow-ball sampling. Natuklasan, na ang wikang Mandaya ay nakitaan ng varyasyong lekisikal ayon sa magkakaiba ang anyo, may pagkakatulad ang anyo, at magkakatulad ang anyo subalit magkakaiba ang bigkas. Gayunpaman, pinaniniwalaang dahil sa paktor na heograpikal, sikolohikal at sosyolohikal na nagaganap sa kanilang kultura ay hindi rin maipagkailang nagyari ang varyasyong leksikal na aspekto nito.

  14. SA1 binds directly to DNA through its unique AT-hook to promote sister chromatid cohesion at telomeres.

    Science.gov (United States)

    Bisht, Kamlesh K; Daniloski, Zharko; Smith, Susan

    2013-08-01

    Sister chromatid cohesion relies on cohesin, a complex comprising a tri-partite ring and a peripheral subunit Scc3, which is found as two related isoforms SA1 and SA2 in vertebrates. There is a division of labor between the vertebrate cohesin complexes; SA1-cohesin is required at telomeres and SA2-cohesin at centromeres. Depletion of SA1 has dramatic consequences for telomere function and genome integrity, but the mechanism by which SA1-cohesin mediates cohesion at telomeres is not well understood. Here we dissect the individual contribution of SA1 and the ring subunits to telomere cohesion and show that telomeres rely heavily on SA1 and to a lesser extent on the ring for cohesion. Using chromatin immunoprecipitation we show that SA1 is highly enriched at telomeres, is decreased at mitosis when cohesion is resolved, and is increased when cohesion persists. Overexpression of SA1 alone was sufficient to induce cohesion at telomeres, independent of the cohesin ring and dependent on its unique (not found in SA2) N-terminal domain, which we show binds to telomeric DNA through an AT-hook motif. We suggest that a specialized cohesion mechanism may be required to accommodate the high level of DNA replication-associated repair at telomeres.

  15. Lingon sa Iskolarsyip sa Dulaan (1948-2007 Looking Back on Theater Scholarship (1948-2007

    Directory of Open Access Journals (Sweden)

    Apolonio B. Chua

    2012-12-01

    Full Text Available From 1948 to 2007, the academic community produced about a hundred titles of theses and dissertations on drama and theater, or made use of data from drama and theater for larger spheres of studies. The current article looked into identifying trends and points of emphasis, as the researches and studies progressed through roughly half a century of research production in the academic setting. Inductive in approach and tentative and exploratory in its analysis, the study identified four trends and points of emphasis in research production. In the fifties and sixties, the emphasis was more on studying the play text or drama; studies veered towards a literary reading and orientation. Eventually, this trend gave way to studying the larger phenomenon of mounting, and the mise en scéne and the spectator became additional units of concern for research. Studies began to have sections on props, costumes, and staging techniques. In the eighties, a larger concern for looking at theater as social production followed. Participant observation, field work and ethnography gave equal emphasis on the social context of theater. Marxism and other perspectives from the social sciences framed theater studies then; correlations between theater and society became useful. Towards the last decade of the century, theater studies aimed at a more conceptual approach, emphasizing core concepts like panata and other related or equivalent terms, elevating and defining the study of theater as a study of culture itself. Gamit ang mahigit sa sandaang tesis at disertasyon hinggil sa dula at dulaan o sinasangkot ang mga ito na lumabas sa akademya mula 1948 hanggang 2007, kapwa sa Unibersidad ng Pilipinas at sa iba pa, nilayon ng “Lingon sa Iskolarsyip sa Dulaan (1948-2007” na pulsuhan ang pangkalahatang daloy, tutok, tunguhin o kalakaran sa pagdadala ng mga pag-aaral. Panimula at exploratory sa inductive nitong lapat, nakatukoy ang pag-aaral ng apat na sapit o tutok sa daloy ng

  16. Simultaneous Estimation of Geophysical Parameters with Microwave Radiometer Data based on Accelerated Simulated Annealing: SA

    Directory of Open Access Journals (Sweden)

    Kohei Arai

    2012-07-01

    Full Text Available Method for geophysical parameter estimations with microwave radiometer data based on Simulated Annealing: SA is proposed. Geophysical parameters which are estimated with microwave radiometer data are closely related each other. Therefore simultaneous estimation makes constraints in accordance with the relations. On the other hand, SA requires huge computer resources for convergence. In order to accelerate convergence process, oscillated decreasing function is proposed for cool down function. Experimental results show that remarkable improvements are observed for geophysical parameter estimations.

  17. Effect of salicylic acid (SA) on delaying fruit senescence of Huang Kum pear

    Institute of Scientific and Technical Information of China (English)

    ZHANG Yuxing; DU Guoqiang; WANG Guoying; ZHANG Jianghong; Hassan Imran

    2007-01-01

    This experiment was undertaken to explore the effect of salicylic acid (SA) at different concentrations on regulating fruit senescence ofHuang Kum pear.Through dipping fruits and fruit discs for a series of hours in SA solution,enzyme activities and physiological characteristics of Huang Kum pear were determined.The results revealed that SA enhanced the activity of superoxide dismutase (SOD) and peroxidase (POD) enzymes at 0.02 mmol/L and at 0.002 mmol/L with the treatment of dipping fruit discs for 4 h and 12 h,respectively.The malondialdehyde (MDA) contents were reduced at 0.002 mmol/L for 12 h,and water loss ratio was decreased at 0.5 mmol/L after 48 h of treatment.It was concluded that SA at lower concentrations could delay the senescence of Huang Kum pear fruit.

  18. The preliminary study of autophagy induction of SA and MeSA by confocal

    Science.gov (United States)

    Yun, Lijuan; Chen, Wenli

    2010-02-01

    Autophagy appears to be a highly conserved process from unicellular to multicellular eukaryotes which contributes to the equilibrium of intracelluar environment. While it would be harmful to the cells when it is excessive by inducing programmed cell death (PCD). It is a protein degradation process in which cells recycle cytoplasmic contents when subjected to environmental stress conditions or during certain stages of development. Previous studies have demonstrated autophagy can be induced during abiotic or biotic stresses. salicylic acid (SA) and methyl salicytic (MeSA) are endogenous signal molecules. We found SA and MeSA can induce autophagy in Arabidopsis thaliana respectively. While autophagy was not induced by SA or MeSA in tobacco suspension cells under the same concentration and period. The differences in stuctures or physiological states may contribute to the results.

  19. SA3654 Component characterization. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Meir, G.W.

    1996-06-01

    AlliedSignal Inc., Federal Manufacturing & Technologies (FM&T), was provided with production capability assurance program (PCAP) funding to develop, characterize, and qualify purchased product components for use on the PRESS-A program. The SA3654, N-Channel, Power MOSFET was identified as a component needing such activity to support PRESS-A. This report presents the characterization activities and results for the SA3654.

  20. SaVi: satellite constellation visualization

    CERN Document Server

    Wood, Lloyd

    2012-01-01

    SaVi, a program for visualizing satellite orbits, movement, and coverage, is maintained at the University of Surrey. This tool has been used for research in academic papers, and by industry companies designing and intending to deploy satellite constellations. It has also proven useful for demonstrating aspects of satellite constellations and their geometry, coverage and movement for educational and teaching purposes. SaVi is introduced and described briefly here.

  1. Åsa portreed / Åsa Johannesson ; intervjueerinud Kaisa Eiche

    Index Scriptorium Estoniae

    Johannesson, Åsa

    2009-01-01

    Rootsi fotograafist Åsa Johannessonist, kelle portreefotode seeriat "Portraits of Her" eksponeeriti Riias toimunud kunstiüritusel "MOMENT". Tema õpingutest ja elust Londonis. Naiselikkusest ja mehelikkusest

  2. Åsa portreed / Åsa Johannesson ; intervjueerinud Kaisa Eiche

    Index Scriptorium Estoniae

    Johannesson, Åsa

    2009-01-01

    Rootsi fotograafist Åsa Johannessonist, kelle portreefotode seeriat "Portraits of Her" eksponeeriti Riias toimunud kunstiüritusel "MOMENT". Tema õpingutest ja elust Londonis. Naiselikkusest ja mehelikkusest

  3. A Generalized Eigensolver based on Smoothed Aggregation (GES-SA) for Initializing Smoothed Aggregation Multigrid (SA)

    Energy Technology Data Exchange (ETDEWEB)

    Brezina, M; Manteuffel, T; McCormick, S; Ruge, J; Sanders, G; Vassilevski, P S

    2007-05-31

    Consider the linear system Ax = b, where A is a large, sparse, real, symmetric, and positive definite matrix and b is a known vector. Solving this system for unknown vector x using a smoothed aggregation multigrid (SA) algorithm requires a characterization of the algebraically smooth error, meaning error that is poorly attenuated by the algorithm's relaxation process. For relaxation processes that are typically used in practice, algebraically smooth error corresponds to the near-nullspace of A. Therefore, having a good approximation to a minimal eigenvector is useful to characterize the algebraically smooth error when forming a linear SA solver. This paper discusses the details of a generalized eigensolver based on smoothed aggregation (GES-SA) that is designed to produce an approximation to a minimal eigenvector of A. GES-SA might be very useful as a standalone eigensolver for applications that desire an approximate minimal eigenvector, but the primary aim here is for GES-SA to produce an initial algebraically smooth component that may be used to either create a black-box SA solver or initiate the adaptive SA ({alpha}SA) process.

  4. Atlas mundial da saúde

    OpenAIRE

    Barrozo, Ligia Vizeu

    2009-01-01

    O Atlas é de autoria de Zoé Vaillant, mestre de conferências da Universidade Paris-Ouest-Nanterre-La Défense e membro do laboratório Espaço, Saúde e Territórios e de Gérard Salem, professor de geografia da saúde da Universidade Paris-Ouest-Nanterre-La Défense e coordenador do laboratório Espaço, Saúde e Territórios. Cécile Marin, responsável pela cartografia do Atlas, é geógrafa-cartógrafa, formada pela Universidade d’Orléans. O Atlas mondial de la santé faz parte da série Collection Atlas/M...

  5. Studies of the aggregation of RNase Sa

    DEFF Research Database (Denmark)

    Khasa, Harshit; Kramer, Ryan; Maddux, Nathan

    2014-01-01

    Thirty-eight mutants of RNase Sa (ribonuclease from Streptomyces aureofaciens) were examined for their structure, thermal sensitivity, and tendency to aggregate. Although a biphasic correlation was seen between the effect of temperature on structure and the free energy of transfer changes in many...

  6. Effect of Tri-sa-maw recipe on gastrointestinal regulation and motility. .

    Science.gov (United States)

    Wannasiri, Supaporn; Jaijoy, Kanjana; Chiranthanut, Natthakarn; Soonthornchareonnon, Noppamas; Sireeratawong, Seewaboon

    2015-03-01

    Tri-sa-maw recipe is comprised ofequal proportions of three herbal fruits, including Terminalia chebula Retz., Terminalia sp. and Terminalia bellirica Roxb. The traditional use of this recipe has been reported as a medication for fever; expectorant, relief of tightness in the stomach, laxative and antidiarrheal agent. To study the effects of Tri-sa-maw recipe extract on gastrointestinal tract in both in vitro and in vivo. Gastrointestinal effect of Tri-sa-maw recipe was studied by using two in vivo models (gastric emptying, gastrointestinal transit) and in vitro isolated guinea pig ileum experiment. Tri-sa-maw recipe showed both stimulatory and inhibitory effects on the stomach function. Not only did the extract at the dose of 1,000 mg/kg inhibit the gastric emptying time, but also stimulate the movement of the digestive tract by increasing the mobility of charcoal. In the isolated guinea pig ileum experiment, the extract at low concentration (0.1 ng/mL) induced the contraction of isolated guinea pig ileum. However the stimulation effect on contractions of isolated guineapig ileum was very much decreased at the high concentration (0.2-1 ng/mL) of the extract. The findings of this study support to traditional uses of Tri-sa-maw recipe as a laxative and antidiarrheal agent.

  7. Decreasing relative risk premium

    DEFF Research Database (Denmark)

    Hansen, Frank

    2007-01-01

    such that the corresponding relative risk premium is a decreasing function of present wealth, and we determine the set of associated utility functions. We find a new characterization of risk vulnerability and determine a large set of utility functions, closed under summation and composition, which are both risk vulnerable...... and have decreasing relative risk premium. We finally introduce the notion of partial risk neutral preferences on binary lotteries and show that partial risk neutrality is equivalent to preferences with decreasing relative risk premium...

  8. 什么是SA8000

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    20世纪末期,欧洲、美国和澳大利亚都先后出现了一些关于“企业社会责任”的多边组织,并逐步形成了一些评价体系和认证制度。SA8000(SOCIAL ACCOUT ABILTY8000的英文简称)是其中最有名的标准之

  9. DAYA SAING KAKAO INDONESIA DI PASAR INTERNASIONAL

    Directory of Open Access Journals (Sweden)

    Anggita Tresliyana

    2015-07-01

    Full Text Available Cocoa is one of the major Indonesian agricultural export products. Cocoa international market has great potential regarding world’s consumption growth, therefore Indonesia is expected to take advantage on existing opportunities. The aims of this study were to analyze the competitiveness of Indonesian cocoa beans and processed cocoa trade in the international market as well as the level of competition between cocoa exporting countries. By using Revealed Comparative Advantage (RCA and Spearman Rank Correlation, it showed that Indonesia had a comparative advantage as an cocoa exporter on the international market, the highest for cocoa beans and the lowest for cocoa paste; Indonesia also had a significant correlation to exporting countries in cocoa beans’ market (Ghana and cocoa paste’s market (Netherlands and Malaysia, the correlation suggests that there were high correlation between Indonesia and the exporting country in competing for market share.Keywords: cocoa, comparative advantage, international trade, competitiveness, market share, RCA ABSTRAKKakao merupakan salah satu komoditas pertanian unggulan ekspor Indonesia.  Pasar kakao memiliki potensi yang besar dilihat dari peningkatan konsumsi dunia, sehingga Indonesia diharapkan dapat memanfaatkan peluang yang ada.  Tujuan penelitian ini adalah menganalisis daya saing perdagangan biji kakao dan kakao olahan Indonesia di pasar internasional serta hubungan daya saing antar negara eksportir kakao. Dengan menggunakan Reavealed Comparative Advantage (RCA, dan Korelasi Rank Spearman, hasil analisis menunjukkan bahwa Indonesia memiliki keunggulan komparatif sebagai eksportir biji kakao dan kakao olahan di pasar internasional, tertinggi untuk biji kakao dan terendah untuk kakao pasta;  Indonesia juga memiliki korelasi yang signifikan di beberapa negara untuk pasar biji kakao (Ghana dan kakao pasta (Belanda dan Malaysia, korelasi tersebut menunjukkan bahwa terdapat hubungan daya saing yang cukup

  10. Atmospheric environment for ASTP (SA-210) launch

    Science.gov (United States)

    Johnson, D. L.

    1976-01-01

    A summary is presented of selected atmospheric conditions observed near ASTP/SA-210 launch time on July 15, 1975, at Kennedy Space Center, Florida. Values of ambient pressure, temperature, moisture, ground winds, visual observations (cloud), density, index of refraction, and wind/wind shear aloft are included. A final meteorological data tape for the ASTP launch, consisting of wind and thermodynamic parameters versus altitude, has been constructed.

  11. IkusaSA. Integrated Assessment for Sustainability

    CSIR Research Space (South Africa)

    Scholes, RJ

    2012-10-01

    Full Text Available , have intended and unintended consequences across a range of important issues. The IkusaSA model system comprises: ? A South African national IAM nested within one or more ?state-of-the-art? global IAMs that predict trade, climate change and human.... The desired outcome is a well-functioning interface between sectors and between technical assessments and policy action. WHAT IS AN INTEGRATED ASSESSMENT MODEL (IAM)? An IAM is a numerical simulation of the dynamic interaction between socio...

  12. Decreasing Relative Risk Premium

    DEFF Research Database (Denmark)

    Hansen, Frank

    We consider the risk premium demanded by a decision maker with wealth x in order to be indifferent between obtaining a new level of wealth y1 with certainty, or to participate in a lottery which either results in unchanged present wealth or a level of wealth y2 > y1. We define the relative risk...... premium as the quotient between the risk premium and the increase in wealth y1–x which the decision maker puts on the line by choosing the lottery in place of receiving y1 with certainty. We study preferences such that the relative risk premium is a decreasing function of present wealth, and we determine...... relative risk premium in the small implies decreasing relative risk premium in the large, and decreasing relative risk premium everywhere implies risk aversion. We finally show that preferences with decreasing relative risk premium may be equivalently expressed in terms of certain preferences on risky...

  13. CoPc(COOH)_8-SA/mCS双极膜的制备及表征%Preparation and Characterization of CoPc(COOH)_8-SA/mCS Bipolar Membranes

    Institute of Scientific and Technical Information of China (English)

    陈日耀; 陈震; 郑曦; 陈晓; 黄彩霞

    2009-01-01

    分别用Fe~(3+)离子和戊二醛作为交联剂对海藻酸钠(SA)阳膜层和壳聚糖(CS)阴膜层进行改性,制备了八羧基钴酞菁.海藻酸钠/改性壳聚糖(CoPc(COOH)_8SA/mCS)双极膜(BPM).在海藻酸钠阳膜层中添加八羧基钻酞菁以提高阳膜的离子交换容量,促进中间层水的解离.用傅立叶红外(FT-IR)光谱、扫描电镜(SEM)等方法对制备的双极膜进行了表征.实验结果表明,经八羧基钻酞菁改性后,阳离子交换膜层的离子交换容最、H+离子透过率均获得提高.与Fe~(3+)离子改性或二茂铁离子改性的mSA/mCS双极膜相比,CoPc(COOH)_8-SA/mCS双极膜的交流阻抗、电阻压降(IR降)和溶胀度降低.当电流密度高达105 mA·cm~(-2)时,CoPc(COOH)_8-SM/mCS双极膜的IR降仅为0.7V.%A sodium alginate (SA) cation layer was modified by cobalt octocarboxyphthalocyanine (CoPc(COOH)_8) to improve its ion exchange capacity and to promote water splitting at the interlayer. The CoPc(COOH)_8-SA and chitosan (CS) were then modified using Fe~(3+) and glutaraldehyde as linking reagents to prepare CoPc(COOH)_8-SA/mCS bipolar membranes (BPMs). FT-IR spectra and SEM were used to characterize CoPc(COOH)_8-SA/mCS BPMs. Experimental results showed that the ion exchange capacity and hydrogen ion transmigration rate of the CoPc(COOH)_8-SA cation exchange membrane had increased. By comparison to the mSA/mCS BPM that was modified by Fe~(3+) or ferrocene, the AC impedance, IR drop and the swelling degree of the CoPc(COOH)_8-SA/mCS BPMs all decreased. The IR drop of the CoPc(COOH)_8-SA/mCS BPM was only 0.7 V at a higher current density of 105 mA·cm~(-2).

  14. Decreasing Serial Cost Sharing

    DEFF Research Database (Denmark)

    Hougaard, Jens Leth; Østerdal, Lars Peter

    The increasing serial cost sharing rule of Moulin and Shenker [Econometrica 60 (1992) 1009] and the decreasing serial rule of de Frutos [Journal of Economic Theory 79 (1998) 245] have attracted attention due to their intuitive appeal and striking incentive properties. An axiomatic characterization...... of the increasing serial rule was provided by Moulin and Shenker [Journal of Economic Theory 64 (1994) 178]. This paper gives an axiomatic characterization of the decreasing serial rule...

  15. Decreasing strabismus surgery

    Science.gov (United States)

    Arora, A; Williams, B; Arora, A K; McNamara, R; Yates, J; Fielder, A

    2005-01-01

    Aim: To determine whether there has been a consistent change across countries and healthcare systems in the frequency of strabismus surgery in children over the past decade. Methods: Retrospective analysis of data on all strabismus surgery performed in NHS hospitals in England and Wales, on children aged 0–16 years between 1989 and 2000, and between 1994 and 2000 in Ontario (Canada) hospitals. These were compared with published data for Scotland, 1989–2000. Results: Between 1989 and 1999–2000 the number of strabismus procedures performed on children, 0–16 years, in England decreased by 41.2% from 15 083 to 8869. Combined medial rectus recession with lateral rectus resection decreased from 5538 to 3013 (45.6%) in the same period. Bimedial recessions increased from 489 to 762, oblique tenotomies from 43 to 121, and the use of adjustable sutures from 29 to 44, in 2000. In Ontario, operations for squint decreased from 2280 to 1685 (26.1%) among 0–16 year olds between 1994 and 2000. Conclusion: The clinical impression of decrease in the frequency of paediatric strabismus surgery is confirmed. In the authors’ opinion this cannot be fully explained by a decrease in births or by the method of healthcare funding. Two factors that might have contributed are better conservative strabismus management and increased subspecialisation that has improved the quality of surgery and the need for re-operation. This finding has a significant impact upon surgical services and also on the training of ophthalmologists. PMID:15774914

  16. Decreasing relative risk premium

    DEFF Research Database (Denmark)

    Hansen, Frank

    2007-01-01

    We consider the risk premium demanded by a decision maker in order to be indifferent between obtaining a new level of wealth with certainty, or to participate in a lottery which either results in unchanged wealth or an even higher level than what can be obtained with certainty. We study preferences...... such that the corresponding relative risk premium is a decreasing function of present wealth, and we determine the set of associated utility functions. We find a new characterization of risk vulnerability and determine a large set of utility functions, closed under summation and composition, which are both risk vulnerable...... and have decreasing relative risk premium. We finally introduce the notion of partial risk neutral preferences on binary lotteries and show that partial risk neutrality is equivalent to preferences with decreasing relative risk premium...

  17. DAYA SAING TEH INDONESIA DI PASAR INTERNASIONAL

    Directory of Open Access Journals (Sweden)

    Fadhilah Ramadhani

    2013-11-01

    Full Text Available Abstrak ___________________________________________________________________ Teh merupakan komoditas sub sektor perkebunan yang pernah mengalami kejayaan selama dua puluh tahun terakhir. Namun dari tahun ke tahun peringkat teh Indonesia di pasar internasional terus mengalami penurunan. Penurunan tersebut dari peringkat ke dua dunia menjadi peringkat ke enam dunia. Hal ini diduga karena lemahnya daya saing produk teh Indonesia di pasar internasional. Adapun tujuan penelitian ini untuk mengkaji perkembangan daya saing teh Indonesia di pasar internasional serta faktor yang mempengaruhi posisi daya saing tesebut. Metode analisis data yang digunakan dalam penelitian ini adalah analisis deskriptif untuk hasil uji Import Dependency Ratio (IDR, Self Sufficiency Ratio (SSR, dan  Revealed Comparative Advantage (RCA. Selanjutnya hasil nilai Revealed Comparative Advantage (RCA akan diregresi dengan metode Ordinary Least Square (OLS.  Berdasarkan hasil uji Import Dependency Ratio (IDR mendapatkan nilai 0 persen hingga 16 persen yang menunjukkan Indonesia tidak mempunyai ketergantungan terhadap produk impor teh. Sedangkan nilai Self Sufficiency Ratio (SSR menunjukkan nilai 280,015 persen, artinya produksi teh Indonesia cukup untuk memenuhi kebutuhan dalam negeri dan ekspor. Dengan nilai daya saing yang cukup kuat, dilihat dari nilai Revealed Comparative Advantage (RCA sebesar 6,790. Hasil uji regresi Ordinary Least Square (OLS terdahap Revealed Comparative Advantage (RCA, menunjukkan kurs rill dan harga riil berpengaruh secara signifikan terhadap posisi daya saing teh indonesia di pasar internasional pada α = 5%. Produksi teh Indonesia tidak berpengaruh terhadap posisi daya saing dengan α = 5%. Abstract ______________________________________________________________ Tea is plantation commodity has been experienced triumph over the last twenty years. But every years ratings Indonesia tea in international markets continues to decline. The decline Indonesia

  18. Manufacturing of JT-60SA Cryostat Base

    Energy Technology Data Exchange (ETDEWEB)

    Medrano, Mercedes, E-mail: mercedes.medrano@ciemat.es [Association EURATOM – CIEMAT, Avda. Complutense 40, 28040 Madrid (Spain); Alonso, Javier; Botija, José; Fernández, Pilar; Ramos, Francisco; Rincon, Esther; Soleto, Alfonso [Association EURATOM – CIEMAT, Avda. Complutense 40, 28040 Madrid (Spain); Davis, Sam; Di Pietro, Enrico [Fusion for Energy, JT-60SA European Home Team, 85748 Garching bei Munchen (Germany); Masaki, Kei; Sakasai, Akira [JAEA, Japan Atomic Energy Agency, Naka Fusion Institute, Ibaraki 311-0193 (Japan)

    2013-10-15

    Highlights: ► JT-60SA Cryostat Base has been fabricated in seven structures fastened by bolts. ► The pieces are fully welded structures further machined to get required tolerances. ► The pre-assembly of the Cryostat Base will be done at the factory to check final tolerances as well as to anticipate problems which could be encountered during final assembly. -- Abstract: JT-60SA is a superconducting tokamak to be assembled and operated at the JAEA laboratories in Naka (Japan) [1]. The tokamak has been designed to prepare, support and complement the ITER experimental programme and will be manufactured and operated under the funding of the Broader Approach Agreement (between the government of Japan and the European Commission) and of the Japan Fusion National Programme. Within the European contribution to JT-60SA, Spain has to provide the cryostat. Due to functional purposes, the cryostat has been divided in two large assemblies: the Cryostat Base (CB) and the Cryostat Vessel Body the latter subdivided into Cryostat Vessel Body Cylindrical Section (CVBCS) and the Top Lid. Spain is committed to provide the design and subsequent manufacturing of the CB and CVBCS (excluding the Top Lid) through the National Laboratory of Fusion at Ciemat. The design of both components has been concluded and the CB is currently being manufactured by a Spanish company, IDESA. This paper aims to present the status of the manufacturing and pre-assembly at the factory of the CB that has to be delivered in November 2012.

  19. Decreasing serial cost sharing

    DEFF Research Database (Denmark)

    Hougaard, Jens Leth; Østerdal, Lars Peter Raahave

    2009-01-01

    The increasing serial cost sharing rule of Moulin and Shenker (Econometrica 60:1009-1037, 1992) and the decreasing serial rule of de Frutos (J Econ Theory 79:245-275, 1998) are known by their intuitive appeal and striking incentive properties. An axiomatic characterization of the increasing serial...

  20. Decreasing Serial Cost Sharing

    DEFF Research Database (Denmark)

    Hougaard, Jens Leth; Østerdal, Lars Peter

    The increasing serial cost sharing rule of Moulin and Shenker [Econometrica 60 (1992) 1009] and the decreasing serial rule of de Frutos [Journal of Economic Theory 79 (1998) 245] have attracted attention due to their intuitive appeal and striking incentive properties. An axiomatic characterization...

  1. AGREEMENT BETWEEN CERN AND UBS SA

    CERN Multimedia

    2002-01-01

    We wish to inform you that the agreement between CERN and UBS SA has been renewed for a period of five years with effect from 1st July 2002. This represents the culmination of work carried out since 1999 by a group consisting of representatives of the Finance Division, the SPL Division, the Staff Association and the Users Office. After analysis of the results of a market survey, it emerged that OVERALL the UBS offered the best conditions and guarantees for the CERN personnel. Owing to developments in the banking market, new conditions have had to be negotiated, which will be presented to you by the UBS (see article).

  2. An investigation on SA 213-Tube to SA 387-Tube plate using friction welding process

    Energy Technology Data Exchange (ETDEWEB)

    Rajan, S. Pandia; Kumaraswamidhas, L. A. [Indian Institute of Technology, Jharkhand (India); Kumaran, S. Senthil [RVS School of Engineering and Technology, Tamil Nadu (India); Muthukumaran, S. [National Institute of Technology, Tamil Nadu (India)

    2016-01-15

    Friction welding of tube to tube plate using an external tool (FWTPET) is a relatively newer solid state welding process used for joining tube to tube plate of either similar or dissimilar materials with enhanced mechanical and metallurgical properties. In the present study, FWTPET has been used to weld SA 213 (Grade T12) tube with SA 387 (Grade 22) tube plate. The welded samples are found to have satisfactory joint strength and the Energy dispersive X-ray analysis (EDX), X-ray diffraction (XRD) study showed that inter metallic compound is absent in the weld zone. The different weld joints have been identified and the phase composition is found using EDX and XRD. Microstructures have been analyzed using optical and Scanning electron microscopy (SEM). The mechanical properties such as hardness, compressive shear strength and peel test for different weld conditions are studied and the hardness survey revealed that there is increase in hardness at the weld interface due to grain refinement. The corrosion behavior for different weld conditions have been analyzed and the weld zone is found to have better corrosion resistance due to the influence of the grain refinement after FWTPET welding process. Hence, the present investigation is carried out to study the behavior of friction welded dissimilar joints of SA 213 tube and SA 387 tube plate joints and the results are presented. The present study confirms that a high quality tube to tube plate joint can be achieved using FWTPET process at 1120 rpm.

  3. Perfil de saúde dos trabalhadores de um Centro de Saúde-Escola

    Directory of Open Access Journals (Sweden)

    Nascimento Lucila Castanheira

    2002-01-01

    Full Text Available O estudo buscou descrever o perfil de saúde dos trabalhadores (184 de um Centro de Saúde-Escola de Ribeirão Preto, sob a perspectiva da Promoção de Saúde, modelo epidemiológico de Blum e fatores de risco para doenças crônico-degenerativas. Foi realizado estudo descritivo utilizando-se entrevista estruturada. Concluiu-se que os trabalhadores eram predominantemente do sexo feminino, faixa etária de 35 a 39 anos e escolaridade "superior completo". Dentre os achados, constatou-se que 61,9% tinham sobrepeso e obesidade; a hipertensão foi detectada em 33,1%; 41 (22,3% apresentaram pressão arterial acima do nível da normalidade e a obesidade mostrou-se presente em mais da metade dos indivíduos com pressão arterial alterada. Os dados possibilitaram explorar riscos autocriados para as doenças crônico-degenerativas; identificar fatores relacionados à promoção de saúde e prevenção de doenças e refletir sobre o autocuidado e auto-responsabilidade, visando à qualidade de vida que desfrutarão, em decorrência da transição demográfica e epidemiológica que vivenciamos.

  4. SANS study of the structural evolution in NIPA/SA gel on dehydration

    CERN Document Server

    Sugiyama, M; Maeda, Y; Hara, K

    2002-01-01

    Mesoscopic structures of N-isopropylacryl-amide/sodium acrylate (NIPA/SA) gels with several water contents were investigated with a small-angle neutron scattering (SANS) method in order to make clear their structural evolution on dehydration. The evolution of the SANS profile with a decrease in the water content in the gel could be classified into three stages. In the beginning, there was no peak in the SANS profile except for the central part, which steadily intensified. With the further water dissipation, a side peak appeared at around 0.02 A sup - sup 1 , the intensity of which increased up to a certain water content and then decreased. These results indicate that the water dissipation in the NIPA/SA gel occurs inhomogeneously. (orig.)

  5. North America and South America (NA-SA) neuropathy project.

    Science.gov (United States)

    Pasnoor, Mamatha; Nascimento, Osvaldo J M; Trivedi, Jaya; Wolfe, Gil I; Nations, Sharon; Herbelin, Laura; de Freitas, M G; Quintanilha, Giseli; Khan, Saud; Dimachkie, Mazen; Barohn, Richard

    2013-08-01

    Peripheral neuropathy is a common neurological disorder. There may be important differences and similarities in the diagnosis of peripheral neuropathy between North America (NA) and South America (SA). Neuromuscular databases were searched for neuropathy diagnosis at two North American sites, University of Kansas Medical Center and University of Texas Southwestern Medical Center, and one South American site, Federal Fluminense University in Brazil. All patients were included into one of the six major categories: immune-mediated, diabetic, hereditary, infectious/inflammatory, systemic/metabolic/toxic (not diabetic) and cryptogenic. A comparison of the number of patients in each category was made between North America and South America databases. Total number of cases in North America was 1090 and in South America was 1034 [immune-mediated: NA 215 (19.7%), SA 191 (18%); diabetic: NA 148 (13.5%), SA 236 (23%); hereditary: NA 292 (26.7%), SA 103 (10%); infectious/inflammatory: NA 53 (4.8%), SA 141 (14%); systemic/metabolic/toxic: NA 71 (6.5%), SA 124 (12%); cryptogenic: NA 311 (28.5%), SA 239 (23%)]. Some specific neuropathy comparisons were hereditary neuropathies [Charcot-Marie-Tooth (CMT) cases] in NA 246/292 (84.2%) and SA 60/103 (58%); familial amyloid neuropathy in SA 31/103 (30%) and none in NA. Among infectious neuropathies, cases of human T-lymphotropic virus type 1 (HTLV-1) neuropathy in SA were 36/141(25%), Chagas disease in SA were 13/141(9%) and none for either in NA; cases of neuropathy due to leprosy in NA were 26/53 (49%) and in SA were 39/141(28%). South American tertiary care centers are more likely to see patients with infectious, diabetic and hereditary disorders such as familial amyloid neuropathies. North American tertiary centers are more likely to see patients with CMT. Immune neuropathies and cryptogenic neuropathies were seen equally in North America and South America.

  6. 百里醌对人骨肉瘤SaOS-2细胞生长的抑制作用%Effects of thymoquinone on growth and apoptosis of osteosarcoma SaOS-2 cell line in vitro

    Institute of Scientific and Technical Information of China (English)

    沈为栋; 尚雷; 刘岸; 沈跃; 廖维; 胡丽萍; 黄莉莉

    2011-01-01

    Objective To investigate the inhibitory effect of thymoquinone on the growth of human osteosarcoma cell line SaOS-2 in vitro.Methods After human osteosarcoma SaOS-2 cells were treated with different concentrations of thymoquinone, the proliferation was measured by Cell Counting Kit-8 (CCK-8) assay. The flowcytometry (FCM) was used to determine apoptosis of SaOS-2 cells. The morphological changes of SaOS-2 cells were observed under the fluorescence microscopy after DAPI staining. Western blotting was used to detect the protein expression of Caspase-3, X-linked inhibitor of apoptosis protein (XIAP) and Smac.Results Thymoquinone obviously suppressed proliferation of SaOS-2 cells in a dose-dependent manner, and the apoptosis rate was (8.1±0.7)%, (13.2±1.1)% and (20.2±1.7)% respectively when the concentrations of thymoquinone exposed were 20, 40 and 80 μmol/L. After treatment with thymoquinone, the expression of Caspase-3 and Smac was up-regulated in SaOS-2 cells, and thymoquinone treatment significantly decreased the XIAP levels in SaOS-2 cells.Conclusion Thymoquinone has the anti-tumor effect on the human osteosarcoma SaOS-2 cells in vitroprobably by up-regulating the expression of Caspase-3 and Smac and down-regulating the expression of XIAP.%目的 探讨百里醌对体外人骨肉瘤SaOS-2细胞生长的影响及其机制.方法 百里醌作用人骨肉瘤SaOS-2细胞24h后,细胞计数CCK-8法检测细胞增殖;流式细胞仪检测细胞凋亡;DAPI染色后荧光显微镜下观察细胞形态学变化;Western blot检测SaOS-2细胞中Caspase-3、X连锁凋亡抑制蛋白(XIAP)和Smac的表达.结果 不同浓度(20、40、80μmol/L)百里醌作用人骨肉瘤SaOS-2细胞24h后,细胞存活率分别为(75.5±4.2)%、(62.1±6.7)%和(52.5±4.9)%;细胞早期凋亡率分别为(8.1±0.7)%、(13.2±1.1)%和(20.2±1.7)%;百里醌作用后,SaOS-2细胞出现典型凋亡的形态学改变;百里醌可明显上调Caspase-3和Smac在SaOS-2细胞中的表达,而

  7. Saúde Coletiva: um desafio para a enfermagem

    Directory of Open Access Journals (Sweden)

    Matumoto Silvia

    2001-01-01

    Full Text Available O texto parte da saúde pública para discutir o que é saúde coletiva, seu objeto e campo de atuação, dando ênfase à concepção de homem, à discussão a respeito do âmbito individual e coletivo e ao conceito de saúde-doença, passando pelo debate da construção interdisciplinar da saúde coletiva. Em seguida, busca situar a enfermagem nesse campo, destacando aquilo que parece ser um grande desafio, compreender a enfermagem como prática de relações.

  8. Biodiversidade, biotecnologia e saúde

    Directory of Open Access Journals (Sweden)

    Garcia Eloi S.

    1995-01-01

    Full Text Available Este artigo apresenta a importância da biodiversidade, da biotecnologia a da saúde e discute vários aspectos dos problemas biológicos, ambientais e o dilema ético, relacionados com a expansão e a exploração dos recursos naturais em razão das quais espécies de plantas e animais têm sido extintas. Por outro lado, o conhecimento da biodiversidade tem possibilitado a identificação e a utilização de novos recursos naturais para a melhoria da vida do homem neste planeta. É importante que nossos pesquisadores se envolvam na luta pela preservação do ecossistema tropical. Os programas de exploração da biodiversidade devem estar baseados em sólidos conhecimentos científicos e favorecer ecológica e economicamente a sociedade.

  9. Biodiversidade, biotecnologia e saúde

    Directory of Open Access Journals (Sweden)

    Eloi S. Garcia

    1995-09-01

    Full Text Available Este artigo apresenta a importância da biodiversidade, da biotecnologia a da saúde e discute vários aspectos dos problemas biológicos, ambientais e o dilema ético, relacionados com a expansão e a exploração dos recursos naturais em razão das quais espécies de plantas e animais têm sido extintas. Por outro lado, o conhecimento da biodiversidade tem possibilitado a identificação e a utilização de novos recursos naturais para a melhoria da vida do homem neste planeta. É importante que nossos pesquisadores se envolvam na luta pela preservação do ecossistema tropical. Os programas de exploração da biodiversidade devem estar baseados em sólidos conhecimentos científicos e favorecer ecológica e economicamente a sociedade.

  10. Novas Tecnologias e Saúde

    OpenAIRE

    2013-01-01

    Introdução Comecemos por algo simples: lidar e combater doenças sempre pressupõe alguma forma de domínio técnico, mesmo quando as práticas para obtenção da saúde estão culturalmente associadas a meios mágicos. Um aspecto importante da magia, seu sentido ritualístico estrito, a observância de fórmulas rigorosas, constitui uma forma de racionalização da experiência empírica, que resulta em conhecimento sobre propriedades alucinógenas ou curativas de certos vegetais, por exemplo. A esse resp...

  11. Saúde oral: um desafio para a equipe de saúde

    Directory of Open Access Journals (Sweden)

    Vera Lúcia de Oliveira Gomes

    2001-03-01

    Full Text Available Esta pesquisa teve como objetivo desvelar o conhecimento dos formandos dos cursos de Enfermagem e Medicina de uma Universidade do Rio Grande do Sul acerca da promoção da Saúde Oral. Participaram do estudo 58 acadêmicos, sendo 26 do Curso de Enfermagem e 32 do Curso de Medicina, estes responderam a um questionário com três perguntas semi-estruturadas. Através da triangulação constatamos que esse conhecimento entre os formandos dos referidos cursos é deficitário. Sabemos que é grande a dificuldade de acesso da população infantil carente aos gabinetes dentários, por esse motivo, acreditamos ser indispensável que os profissionais de Enfermagem e Medicina tenham conhecimentos referentes à promoção de saúde oral em crianças.

  12. Rheumatoid arthritis specific anti-Sa antibodies target citrullinated vimentin

    NARCIS (Netherlands)

    Vossenaar, E.R.; Despres, N.; Lapointe, E.; Heijden, A.G. van der; Lora, M.; Senshu, T.; Venrooij, W.J.W. van; Menard, H.A.

    2004-01-01

    Antibodies directed to the Sa antigen are highly specific for rheumatoid arthritis ( RA) and can be detected in approximately 40% of RA sera. The antigen, a doublet of protein bands of about 50 kDa, is present in placenta and in RA synovial tissue. Although it has been stated that the Sa antigen is

  13. Projetos PET-Saúde e Educando para a Saúde: construindo saberes e práticas

    Directory of Open Access Journals (Sweden)

    Pâmela Leites de Souza

    Full Text Available Buscando alcançar ações intersetoriais efetivas e inovadoras, o projeto Educando para a Saúde, vem envolvendo as escolas, academia e serviços de saúde locais no desafio de construir uma sólida relação entre saúde-escola. O presente relato de experiência socializa a trajetória do projeto Educando para a Saúde, uma parceria entre a Equipe de Saúde da Família (ESF de um bairro de Pelotas - RS, a comunidade docente de duas escolas do território e acadêmicos do Programa de Educação pelo Trabalho para a Saúde - PET-Saúde. O objetivo é refletir o papel da ESF e dos acadêmicos do Projeto PET-Saúde na integração saúde-educação. Os temas discutidos são relacionados à educação em sexualidade, direitos sexuais e reprodutivos com ênfase nas DSTs e métodos contraceptivos, prevenção, promoção e recuperação da saúde. A participação do acadêmico nas atividades de integração saúde-educação veio a acrescentar ideias, valores e conceitos, possibilitando a (reconstrução das relações interpessoais, promovendo a reciclagem do processo de trabalho. Pelos laços multiprofissionais e interdisciplinares, essa parceria consiste em aprendizado mútuo, cujos frutos refletem diretamente na melhoria da assistência prestada à comunidade.

  14. Gasto privado com saúde por classes de renda

    Directory of Open Access Journals (Sweden)

    KILSZTAJN SAMUEL

    2002-01-01

    Full Text Available OBJETIVO: O artigo analisa a participação do gasto privado com saúde das famílias no PIB e no total da renda familiar per capita e a distribuição do gasto privado com saúde das famílias por classes de renda. MÉTODOS: A pesquisa utilizou os microdados da Pesquisa Nacional por Amostra de Domicílios de 1998, com a divisão da população em quatro classes de renda familiar per capita e a distribuição dos gastos em planos de saúde, consultas médicas, consultas com outros profissionais de saúde, exames, medicamentos, artigos ortopédicos e aparelhos médicos, óculos e lentes, odontologia, hospitais, enfermagem domiciliar e outros gastos com saúde. RESULTADOS: Apenas 7,2% da população com renda familiar per capita até 1 salário mínimo em 1998 tinha direito a algum plano de saúde, e o gasto privado com saúde das famílias desta classe, que representava 52,5% da população, era em média de R$ 5,36 por pessoa. Para as pessoas com renda familiar per capita acima de 9 salários mínimos, os planos de saúde atingiam 83,2% da população e o gasto privado com saúde das famílias R$ 133,04. CONCLUSÕES: A implantação do Sistema Único de Saúde foi acompanhada pelo crescimento expressivo dos planos de saúde nos anos 90. Mesmo se todo o gasto público com saúde fosse destinado à população sem planos de saúde, ainda assim o gasto destas pessoas em 1998 só alcançaria R$ 352,62, ou seja, 43% do gasto com saúde das pessoas com planos, R$ 819,08.

  15. Saúde mental e trabalho: os problemas que persistem

    Directory of Open Access Journals (Sweden)

    Leny Sato

    Full Text Available Este artigo toma por objeto a Saúde Mental e Trabalho como uma subárea do campo da Saúde do Trabalhador. Parte da constatação de que os problemas de saúde mental e trabalho, já identificados em meados da década de 1980, persistem. Após retomar a taxonomia de tais problemas, busca evidenciar algumas de suas expressões atuais a partir da assistência e da vigilância em saúde do trabalhador, bem como pela perspectiva de alguns sindicatos mais atentos à questão. Para tal, toma como ponto de partida o Centro de Referência em Saúde do Trabalhador (CRST de Campinas. Por fim, pontua algumas características do trabalho no contexto atual para compreender as motivações dessa persistência.

  16. Em busca de uma Teologia Pública da Saúde

    Directory of Open Access Journals (Sweden)

    Alex Villas Boas

    2016-03-01

    Full Text Available A proposta de uma teologia pública da saúde visa o diálogo entre antropologia teológica e antropologias médicas e da saúde de modo a ampliar a percepção da saúde, não somente como fato, mas como valor. Mesmo um Estado Laico, suas tradições religiosas possuem hermenêuticas de saúde, ao interpretar a doença e a morte com razões religiosas distintas, ora conflitantes, ora cooperativas com as ciências da saúde. Ampliar essas hermenêuticas religiosas compondo a sabedoria de vida presente nas expressões religiosas e o conhecimento científico da área de saúde visa uma cooperação para interesses de bem comum da sociedade civil, como é a questão da saúde. Para essa reflexão, a escola de Cós combina a sabedoria mítica asclepíade e a ciência jônia. Os mitos de saúde nomeados no juramento hipocrático pertencem à tradição da teologia poética grega e indica uma espécie de credo no qual a medicina hipocrática professa, no qual o médico além de profissional também possui fé na vida e exerce o ofício de sacerdote da esperança. Interessa ainda o modo como o a teologia da saúde grega foi recebida pela teologia cristã, e como ambas desconstruíram suas teodiceias. Nessa recepção há um caminho para pensar uma teologia pública da saúde. 

  17. On SA, CA, and GA numbers

    CERN Document Server

    Caveney, Geoffrey; Sondow, Jonathan

    2011-01-01

    Gronwall's function $G$ is defined for $n>1$ by $G(n)=\\frac{\\sigma(n)}{n \\log\\log n}$ where $\\sigma(n)$ is the sum of the divisors of $n$. We call an integer $N>1$ a \\emph{GA1 number} if $N$ is composite and $G(N) \\ge G(N/p)$ for all prime factors $p$ of $N$. We say that $N$ is a \\emph{GA2 number} if $G(N) \\ge G(aN)$ for all multiples $aN$ of $N$. In arXiv 1110.5078, we used Robin's and Gronwall's theorems on $G$ to prove that the Riemann Hypothesis (RH) is true if and only if 4 is the only number that is both GA1 and GA2. Here, we study GA1 numbers and GA2 numbers separately. We compare them with superabundant (SA) and colossally abundant (CA) numbers (first studied by Ramanujan). We give algorithms for computing GA1 numbers; the smallest one with more than two prime factors is 183783600, while the smallest odd one is 1058462574572984015114271643676625. We find nineteen GA2 numbers $\\le 5040$, and prove that a GA2 number $N>5040$ exists if and only if RH is false, in which case $N$ is even and $>10^{8576}$.

  18. Triagem em saúde mental infantil

    Directory of Open Access Journals (Sweden)

    Fabiana Vieira Gauy

    Full Text Available Este estudo foi conduzido para comparar os resultados de um procedimento grupal aberto e um procedimento individual estruturado para avaliação do comportamento da criança conforme o relato materno. Participaram deste estudo 29 mães que buscavam atendimento para seus filhos em uma unidade de saúde mental infanto-juvenil. As primeiras 15 mães que procuraram o serviço foram entrevistadas individualmente conforme um roteiro estruturado desenvolvido a partir do CBCL e depois foram entrevistadas em grupo, em formato aberto. As outras 14 mães participaram da entrevista grupal aberta e em seguida participaram da entrevista individual estruturada. Os resultados das entrevistas foram comparados tomando como referência as 67 categorias comportamentais identificadas a partir do roteiro individual e quatro variáveis contextuais relatadas nos dois procedimentos. Os resultados mostram que um número substancialmente maior de comportamentos-problema foi identificado através de entrevista individual estruturada do que através de entrevista grupal aberta realizada com os mesmos informantes. É possível que o uso de um roteiro estruturado em entrevistas grupais possa oferecer mais informações com otimização do tempo de avaliação.

  19. Monocyte development inhibitor PRM-151 decreases corneal myofibroblast generation in rabbits.

    Science.gov (United States)

    Santhiago, M R; Singh, V; Barbosa, F L; Agrawal, V; Wilson, S E

    2011-11-01

    This study investigated whether PRM-151 (Promedior, Inc., Malvern, PA), a recombinant form of human pentraxin-2 (PTX-2, also referred to as serum amyloid P, hSAP), that inhibits differentiation of circulating monocytes into fibrocytes and profibrotic macrophages, could modulate generation of myofibroblasts after opacity-producing corneal injury in rabbits, and, therefore, have potential to reduce or prevent haze after PRK. Nine diopter PRK for myopia was performed with the VISX S4 IR laser. Four groups of 6 animals were treated in masked fashion: Group 1: 30 μl of topical PRM-151 (20 mg/ml) 6 times a day for 5 days; Group 2: 30 μl topical vehicle 6 times a day for 5 days; Group 3: 200 μl sub-conjunctival PRM-151 (total injection of 4 mg) immediately after surgery and every other day until day 8; Group 4: 200 μl sub-conjunctival injections of vehicle according to the same schedule as group 3. At one month after PRK, the animals were euthanized and immunohistochemistry was performed for the myofibroblast marker α-smooth muscle actin (SMA). The density of SMA+ cells/400× field in the central stroma was determined in each cornea. Myofibroblast density at one month after surgery was significantly lower (p = 0.006) after sub-conjunctival PRM-151 treatment (5.8 ± 2.8 cells/400× stromal field) compared to sub-conjunctival vehicle treatment (15.3 ± 2.9 cells/400× stromal field). There was no significant (p = 0.27) decrease in stromal myofibroblasts triggered by topical PRM-151 treatment (11.8 ± 6.6 cells/400× stromal field) compared to the topical vehicle treatment (14.2.8 ± 6.2 cells/400× stromal field). PRM-151 inhibits myofibroblast generation when administered by sub-conjunctival injection, but not when administered topically, after opacity-producing corneal injury. This study provides additional confirmation that bone marrow-derived cells contribute to corneal myofibroblast generation.

  20. Saúde e meio ambiente nas cidades: os desafios da saúde ambiental

    Directory of Open Access Journals (Sweden)

    Nelson Gouveia

    1999-02-01

    Full Text Available Dentro de alguns poucos anos, nosso planeta contará com mais habitantes em áreas urbanas do que em áreas rurais. A urbanização desenfreada, sem mecanismos regulatórios e de controle, típica dos países periféricos, trouxe consigo enormes repercussões na saúde da população. Problemas como a insuficiência dos serviços básicos de saneamento, coleta e destinação adequada do lixo e condições precárias de moradia, tradicionalmente relacionados com a pobreza e o subdesenvolvimento, somam-se agora à poluição química e física do ar, da água e da terra, problemas ambientais antes considerados "modernos". Novamente, é sobre as populações mais carentes que recai a maior parte dos efeitos negativos da urbanização, gerando uma situação de extrema desigualdade e iniqüidade ambiental e em saúde. Para reverter esse quadro é preciso que haja uma reincorporação das questões do meio ambiente nas políticas de saúde, e a integração dos objetivos da saúde ambiental numa ampla estratégia de desenvolvimento sustentável. Uma abordagem mais integrada, com mecanismos intersetoriais que possibilitem um diálogo amplo entre as partes, trará enormes benefícios na conquista de melhores condições de vida nas cidades. A saúde ambiental hoje tem o desafio de promover uma melhor qualidade de vida e saúde nas cidades e a oportunidade de enfrentar o absurdo quadro de exclusão social, sob a perspectiva da eqüidade.In a matter of few years there will be more urban than rural dwellers worldwide. The rapid urbanisation lacking adequate control and regulatory mechanisms typical of developing countries, brought along huge effects to the health of the population Environmental problems traditionally related to poverty and underdevelopment such as insufficient provision of sanitation services, waste collection and disposal, and precarious housing conditions, are now added to environmental problems considered of "modern life" such as the

  1. A saúde mental em cuidados de saúde primários

    OpenAIRE

    Santos, Ana Isabel Monteiro dos

    2009-01-01

    As perturbações psiquiátricas no contexto da Clínica Geral / Medicina Geral e Familiar constituem um tema que tem vindo a ser estudado desde a década de 1960, sendo uma matéria complexa e com múltiplas implicações. Os estudos epidemiológicos mais recentes demonstram que as perturbações psiquiátricas e os problemas de saúde mental se tornaram a principal causa de incapacidade e uma das principais causas de morbilidade nas sociedades modernas. E, para além dos indivíduos que apresentam uma ...

  2. Educação em saúde como principal alternativa para promover a saúde do idoso

    Directory of Open Access Journals (Sweden)

    Danielli Gavião Mallmann

    2015-06-01

    Full Text Available Trata-se de uma revisão integrativa que objetivou identificar as evidências científicas sobre as ações educativas em saúde voltadas à promoção da saúde do idoso. A busca dos artigos foi realizada nas bases de dados Medline, Lilacs, BDENF, CINAHL e biblioteca virtual SciELO, por meio do cruzamento dos descritores Educação em Saúde, Idoso, Envelhecimento, Saúde do Idoso, Promoção da Saúde e Qualidade de vida, incluindo-se artigos publicados no período de 2003 a 2013, nos idiomas inglês, espanhol e português, realizados com idosos. Foram selecionados oito artigos, dos quais percebeu-se a qualidade de vida e a promoção do envelhecimento saudável como fatores resultantes das estratégias de educação em saúde. As ações de educação em saúde para idosos necessitam de metodologias que atentem para a complexidade do processo de envelhecimento e relacionem os fatores que cercam o indivíduo, como as crenças, os valores, as normas e os modos de vida.

  3. A interdisciplinaridade vivenciada no PET-Saúde = The interdisciplinarity experienced in the PET- Saúde program

    Directory of Open Access Journals (Sweden)

    Assega, Mariana Lieka

    2010-01-01

    Full Text Available Introdução: A incorporação da equipe de saúde bucal na Estratégia de Saúde da Família (ESF, em 2000, possibilitou a adoção de uma postura mais ativa de atenção primária nesta área, visto que a saúde bucal consiste em parte integrante e inseparável da saúde do indivíduo. A interação dos profissionais da saúde torna-se possível por meio de iniciativas como o PET-Saúde, o qual fomenta a formação profissional articulada com os profissionais da ESF, bem como, o processo de integração ensino-serviço-comunidade na perspectiva da interdisciplinaridade. Objetivo: Relatar a vivência de estudantes ao realizar uma pesquisa interdisciplinar. Descrição da experiência: Esse relato foi vivenciado no projeto PET-Saúde da Faculdade de Medicina de Marília, no sub projeto Saúde do Homem, visando construir e validar um instrumento de coleta de dados por meio da Técnica Delphi, para auxiliar a equipe de saúde detectar precocemente agravos odontológicos, visto que no Brasil, o perfil de saúde bucal, na faixa etária de 35 a 44 anos, está comprometido. Os participantes, deste estudo, são discentes de enfermagem e medicina, preceptora cirurgiã-dentista e tutora docente enfermeira. Para as atividades educacionais utilizou-se a metodologia ativa de ensino-aprendizagem. Conclusão: Os movimentos reflexivos, os espaços de diálogos propiciaram o desenvolvimento da investigação científica. Além disso, a aproximação do processo de validação pela Técnica Delphi, também permitiu ampliação do conhecimento multidisciplinar sobre saúde bucal. Esta vivência possibilitou qualificar a formação acadêmico-profissional na linha da interdisciplinaridade, sendo importante sua multiplicação para o fortalecimento da interação entre os profissionais e a articulação das ações de saúde

  4. Cumulative Production Per Township - SaMiRa

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This dataset contains a selected township grid within the Sagebrush Mineral Resource Assessment project (SaMiRa) study area attributed with cumulative oil and gas...

  5. Desenvolvimento econômico, desigualdade e saúde

    Directory of Open Access Journals (Sweden)

    Pedro Reginaldo Prata

    1994-09-01

    Full Text Available O autor se refere a dimensão socioeconômica, individual e coletiva do fenômeno saúde-doença. Refere-se também ao fato das populações estarem sobre a influência desigual de fatores de risco e de proteção à saúde. Discute as desigualdades no desenvolvimento e a relação entre desenvolvimento, riqueza, saúde e justiça social. Questiona as teorias de desenvolvimento econômico, diferenciando desenvolvimento de crescimento. Cunha os conceitos de armadilha do desenvolvimento e refugiados sociais. Define uma comunidade saudável. Propõe a necessidade de mudança no modelo de desenvolvimento. Baliza o papel e as limitações do setor saúde no que diz respeito a iniqüidade social.

  6. Discussion of CoSA: Clustering of Sparse Approximations

    Energy Technology Data Exchange (ETDEWEB)

    Armstrong, Derek Elswick [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-03-07

    The purpose of this talk is to discuss the possible applications of CoSA (Clustering of Sparse Approximations) to the exploitation of HSI (HyperSpectral Imagery) data. CoSA is presented by Moody et al. in the Journal of Applied Remote Sensing (“Land cover classification in multispectral imagery using clustering of sparse approximations over learned feature dictionaries”, Vol. 8, 2014) and is based on machine learning techniques.

  7. Desigualdade social e saúde no Brasil

    Directory of Open Access Journals (Sweden)

    Neri Marcelo

    2002-01-01

    Full Text Available Esse artigo estuda a relação entre desigualdade social e saúde no Brasil. A estratégia usada foi avaliar as necessidades e o consumo dos serviços de saúde, bem como o acesso a seguro saúde ao longo da distribuição de renda. Adicionalmente, por meio da estimação de uma regressão logística, foram avaliados outros determinantes do consumo dos serviços de saúde, com o intuito de se conhecer aonde e quem utiliza esses serviços no país. Os dados foram extraídos da Pesquisas Nacional de Amostra por Domicilio da Fundação Instituto Brasileiro de Geografia e Estatística levada a campo em 1998. Em geral, observou-se que os indivíduos nos primeiros décimos da distribuição de renda têm pior acesso a seguro saúde, necessitam de maiores cuidados médicos, mas consomem menos os serviços de saúde. As outras características extra rendimento indicam que os principais determinantes para o consumo dos serviços de saúde estariam fortemente associados aos grupos sociais mais privilegiados (de maior escolaridade, acesso a seguro saúde, água, esgoto, luz, coleta de lixo e a fatores que apontam para capacidade de geração de oferta desses serviços no país.

  8. Review of underground salt attenuation measurements for SalSA

    Energy Technology Data Exchange (ETDEWEB)

    Connolly, Amy, E-mail: connolly@mps.ohio-state.edu [1040 Physics Research Building, 191 West Woodruff Avenue, Columbus, OH 43210-1117 (United States)

    2012-01-11

    We report on the status of the Salt Sensor Array (SalSA), a proposed experiment for detecting ultra-high energy neutrinos through the radio Cherenkov technique with an array of radio-microwave antennas embedded in a large, naturally occurring salt formation. We review the measurements to date aimed at assessing SalSA's feasibility, including a return visit of the Hockley Salt Mine in Hockley, Texas, and discuss the current status of the project.

  9. Apoio social e saúde entre idosos

    Directory of Open Access Journals (Sweden)

    Ramos Marília P.

    2002-01-01

    Full Text Available O presente artigo trata da relação entre a saúde dos idosos e relacionamentos sociais, bem como na interpretação e entendimento desta problemática sob a luz de dois enfoques teóricos: um macro, centrado na Teoria da Integração Social de Emile Durkheim e outro micro, centrado na Teoria das Trocas, de Peter Blau, com ênfase na Teoria da Eqüidade. A integração social (freqüência de contatos pode ter efeitos negativos na saúde, mas isto tem de ser medido pela qualidade dos contatos. Algumas conclusões apresentadas indicam que as relações sociais têm um efeito na saúde, no sentido de que as pessoas, nas sociedades modernas, esperam a reciprocidade, e, quando isto não é possível, principalmente na fase do envelhecimento, as pessoas sentem-se dependentes, e isso pode afetar a saúde de diferentes maneiras. Por outro lado, quando as pessoas têm problemas de saúde, elas experienciam uma falta de relações sociais balanceadas devido à incapacidade para trocar em bases iguais. Sendo assim, conclui-se que a relação entre relações sociais e saúde na população idosa pode ser uma relação recíproca.

  10. SA improvement of hyperhydricity reversion in Thymus daenensis shoots culture may be associated with polyamines changes.

    Science.gov (United States)

    Hassannejad, Sahar; Bernard, Françoise; Mirzajani, Fateme; Gholami, Morteza

    2012-02-01

    In shoot cultures of Thymus daenensis, hyperhydricity syndrome promoted by benzyladenine (BA) is characterised by the development of chlorophyll-deficient shoots with a high water content and reduced growth that is less differentiated. By removing the BA from the culture medium, the hyperhydricity was reversed, and the reversion toward a normal growth in vitro was more efficient in shoots treated with 5 μM of salicylic acid (SA), showing a significant increase in chlorophyll b after 4 weeks of culture. In the present study, the effect of salicylic acid on the reversion of shoot hyperhydricity was investigated at the level of the free, soluble and insoluble conjugated polyamine content. In T. daenensis micropropagated shoots, the level of polyamines was high, with a predominance of putrescine. BA, which triggered hyperhydricity, caused a reduction of the polyamine (PA) content by one-half due to a decrease in the putrescine content and insoluble conjugated PAs that were not detected in the hyperhydric shoots. In the reverted shoots, changes of the free polyamines, spermidine and, more notably, spermine, were shown. The spermine content doubled after 4 weeks of culture, and its amount was the same as that found in normal shoots, suggesting that free spermine could be particularly involved in the reversion of hyperhydricity. In the SA-reverted tissues, the PA pattern was marked with a transient increase of free putrescine, spermidine and spermine and an enhancement of soluble conjugated spermine. This transitory SA-dependent amplification of PAs was concomitant with a remarkable transient increase of H(2)O(2), suggesting that SA may be implicated in PA signalling pathways for tissue differentiation during the reversion of hyperhydricity in T. daenensis.

  11. Synthesis and evaluation of fluorine-18-labeled SA4503 as a selective sigma{sub 1} receptor ligand for positron emission tomography

    Energy Technology Data Exchange (ETDEWEB)

    Kawamura, Kazunori [Positron Medical Center, Tokyo Metropolitan Institute of Gerontology, Itabashi-ku, Tokyo 173-0022 (Japan) and Center for Integrated Human Brain Science, Brain Research Institute, University of Niigata, Niigata, Niigata 951-8585 (Japan)]. E-mail: kawamurak@bri.niigata-u.ac.jp; Tsukada, Hideo [Central Research Laboratory, Hamamatsu Photonics, K.K., Hamamatsu, Shizuoka 434-8601 (Japan); Shiba, Kazuhiro [Advanced Science Research Center, Kanazawa University, Kanazawa, Ishikawa 920-8640 (Japan); Tsuji, Chieko [NARD Institute, Ltd., Amagasaki, Hyogo 660-0805 (Japan); Harada, Norihiro [Central Research Laboratory, Hamamatsu Photonics, K.K., Hamamatsu, Shizuoka 434-8601 (Japan); Kimura, Yuichi [Positron Medical Center, Tokyo Metropolitan Institute of Gerontology, Itabashi-ku, Tokyo 173-0022 (Japan); Ishiwata, Kiichi [Positron Medical Center, Tokyo Metropolitan Institute of Gerontology, Itabashi-ku, Tokyo 173-0022 (Japan)

    2007-07-15

    The [{sup 18}F]fluoromethyl analog of the sigma{sub 1} selective ligand 1-(3,4-dimethoxyphenethyl)-4-(3-phenylpropyl)piperazine dihydrochloride (SA4503) ([{sup 18}F]FM-SA4503) was prepared and its potential evaluated for the in vivo measurement of sigma{sub 1} receptors with positron emission tomography (PET). FM-SA4503 had selective affinity for the sigma{sub 1} receptor ( K {sub i} for sigma{sub 1} receptor, 6.4 nM; K {sub i} for sigma{sub 2} receptor, 250 nM) that was compatible with the affinity of SA4503 ( K {sub i} for sigma{sub 1} receptor, 4.4 nM; K {sub i} for sigma{sub 2} receptor, 242 nM). [{sup 18}F]FM-SA4503 was synthesized by {sup 18}F-fluoromethylation of O-demethyl SA4503 in the radiochemical yield of 2.9-16.6% at the end of bombardment with a specific activity of 37.8-283 TBq/mmol at the end of synthesis. In mice, the uptake of [{sup 18}F]FM-SA4503 in the brain was gradually increased for 30 min after injection, and then decreased. In the blocking study, brain uptake was significantly decreased by co-injection of haloperidol to 32% of control, and FM-SA4503 to 52% of control. In PET study of the monkey brain, high uptake was found in the cerebral cortex, thalamus and striatum. The radioactivity level of [{sup 18}F]FM-SA4503 in the brain regions gradually increased over a period of 120 min after injection, followed by a stable plateau phase until 180 min after injection. In pretreatment with haloperidol measurement of the monkey brain, the radioactivity level was 22-32% and 11-25% of the baseline at 60 and 180 min, respectively, after injection, suggesting high receptor-specific binding. [{sup 18}F]FM-SA4503 showed specific binding to sigma{sub 1} receptors in mice and monkeys; therefore, [{sup 18}F]FM-SA4503 has the potential for mapping sigma{sub 1} receptors in the brain.

  12. Saúde, direito à saúde e justiça sanitária

    Directory of Open Access Journals (Sweden)

    João Arriscado Nunes

    2012-10-01

    Full Text Available Propõe‑se uma abordagem preliminar dos processos heterogéneos e contingentes através dos quais se definem e constituem mutuamente a saúde e o direito à saúde. São apresentadas e discutidas duas manifestações recentes dessa dinâmica. A primeira situa‑se na linha das transformações associadas às orientações de inspiração neoliberal no campo da saúde, apontando para a passagem da saúde como direito à saúde como imperativo, centrado na responsabilização individual e na centralidade da vigilância e da prevenção. A segunda, designada justiça sanitária, é exemplificada através de situações em que cidadãos, através da acção colectiva e mobilizando os vocabulários dos direitos e da justiça, procuram o reconhecimento como portadores de uma doença, os direitos associados a essa condição e a acção pública sobre situações que afectam a sua saúde.

  13. Ang Demokratikong Sistema at ang mga Modelo ng Pamumuno sa Pilipinas

    Directory of Open Access Journals (Sweden)

    F. P. A. Demeterio

    2010-06-01

    Full Text Available Maraming paraan ang pagsusuri sa problema ng pulitika sa Pilipinas.Para sa mga moralista at ideyalista, halimbawa, maaari itong tingnangamit ang perspektibo ng sistema ng pagpapahalaga (values at moralidad; para sa mga materyalista naman, maaari din itong himayin gamit ang perspektibo ng pagka-di-pantay-pantay ng kayamanan at kapangyarihan(unequal wealth and power ng ating mga mamamayan; o hindi kaya para sa mga eksperto sa sistema at istraktura, maaari din itong dalumatin gamit ang perspektibo ng ating marupok na burukrasya. Susubukan ng papel na ito na pag-aralan ang paksa sa pamamagitan ng pagsusuri sa konsepto ng pamumuno na hinihiling ng ating demokratikong sistema at sa kaparehong konseptong umiiiral naman sa kamalayan ng ating mga kababayan. Gagamitin ng pagsusuring ito, bilang teoretikal na balangkas, ang isang uri ng antropolohikalna teorya at pamamaraan na kilala bilang “kognitibong antropolohiya”(cognitive anthropology.

  14. MimoSA: a system for minimotif annotation

    Directory of Open Access Journals (Sweden)

    Kundeti Vamsi

    2010-06-01

    Full Text Available Abstract Background Minimotifs are short peptide sequences within one protein, which are recognized by other proteins or molecules. While there are now several minimotif databases, they are incomplete. There are reports of many minimotifs in the primary literature, which have yet to be annotated, while entirely novel minimotifs continue to be published on a weekly basis. Our recently proposed function and sequence syntax for minimotifs enables us to build a general tool that will facilitate structured annotation and management of minimotif data from the biomedical literature. Results We have built the MimoSA application for minimotif annotation. The application supports management of the Minimotif Miner database, literature tracking, and annotation of new minimotifs. MimoSA enables the visualization, organization, selection and editing functions of minimotifs and their attributes in the MnM database. For the literature components, Mimosa provides paper status tracking and scoring of papers for annotation through a freely available machine learning approach, which is based on word correlation. The paper scoring algorithm is also available as a separate program, TextMine. Form-driven annotation of minimotif attributes enables entry of new minimotifs into the MnM database. Several supporting features increase the efficiency of annotation. The layered architecture of MimoSA allows for extensibility by separating the functions of paper scoring, minimotif visualization, and database management. MimoSA is readily adaptable to other annotation efforts that manually curate literature into a MySQL database. Conclusions MimoSA is an extensible application that facilitates minimotif annotation and integrates with the Minimotif Miner database. We have built MimoSA as an application that integrates dynamic abstract scoring with a high performance relational model of minimotif syntax. MimoSA's TextMine, an efficient paper-scoring algorithm, can be used to

  15. A mobile diabetes management and educational system for type-2 diabetics in Saudi Arabia (SAED).

    Science.gov (United States)

    Alotaibi, Mohammed M; Istepanian, Robert; Philip, Nada

    2016-01-01

    Diabetes is a chronic disease, with high prevalence across many nations, which is characterized by elevated level of blood glucose and risk of acute and chronic complication. The Kingdom of Saudi Arabia (KSA) has one of the highest levels of diabetes prevalence globally. It is well-known that the treatment of diabetes is complex process and requires both lifestyle change and clear pharmacologic treatment plan. To avoid the complication from diabetes, the effective behavioural change and extensive education and self-management is one of the key approaches to alleviate such complications. However, this process is lengthy and expensive. The recent studies on the user of smart phone technologies for diabetes self-management have proven to be an effective tool in controlling hemoglobin (HbA1c) levels especially in type-2 diabetic (T2D) patients. However, to date no reported study addressed the effectiveness of this approach in the in Saudi patients. This study investigates the impact of using mobile health technologies for the self-management of diabetes in Saudi Arabia. In this study, an intelligent mobile diabetes management system (SAED), tailored for T2D patients in KSA was developed. A pilot study of the SAED system was conducted in Saudi Arabia with 20 diabetic patients for 6 months duration. The patients were randomly categorized into a control group who did not use the SAED system and an intervention group whom used the SAED system for their diabetes management during this period. At the end of the follow-up period, the HbA1c levels in the patients in both groups were measure together with a diabetes knowledge test was also conducted to test the diabetes awareness of the patients. The results of SAED pilot study showed that the patients in the intervention group were able to significantly decrease their HbA1c levels compared to the control group. The SAED system also enhanced the diabetes awareness amongst the patients in the intervention group during the trial

  16. Hot Deformation Behavior of SA508Gr.4N Steel for Reactor Pressure Vessels

    Directory of Open Access Journals (Sweden)

    YANG Zhi-qiang

    2017-08-01

    Full Text Available The high-temperature plastic deformation and dynamic recrystallization behavior of SA508Gr.4N steel were investigated through hot deformation tests in a Gleeble1500D thermal mechanical simulator. The compression tests were performed in the temperature range of 1050-1250℃ and the strain rate range of 0.001-0.1s-1 with true strain of 0.16. The results show that from the high-temperature true stress-strain curves of the SA508Gr.4N steel, the main feature is dynamic recrystallization,and the peak stress increases with the decrease of deformation temperature or the increase of strain rate, indicating the experimental steel is temperature and strain rate sensitive material. The constitutive equation for SA508Gr.4N steel is established on the basis of the true stress-strain curves, and exhibits the characteristics of the high-temperature flow behavior quite well, while the activation energy of the steel is determined to be 383.862kJ/mol. Furthermore, an inflection point is found in the θ-σ curve, while the -dθ/dσ-σ curve shows a minimum value. The critical strain increases with increasing strain rate and decreasing deformation temperature. A linear relationship between critical strain (εc and peak strain (εp is found and could be expressed as εc/εp=0.517. The predicted model of critical strain could be described as εc=8.57×10-4Z0.148.

  17. Tungo sa Hardin ng Tao: “Si Bonifacio ang pinakauna, hindi lamang sa Pilipinas, kundi sa buong Indonesia, oo, sa buong Asia na nanggaling sa, at edukado bilang, proletaryado, na nag-organisa ng mga proletaryo.” ni Tan Malaka

    Directory of Open Access Journals (Sweden)

    Ramon Guillermo

    2013-06-01

    Full Text Available Salin ito ng sanaysay na “Ke Taman Manusia” (sinulat taong 1943 nakathang-isip ng Indones na lider komunista na si Tan Malaka o Ibrahimgelar Datuk Tan Malaka (1897-1949 hinggil sa isang “Taman Manusia”o “Hardin ng Tao” na itatayo ng darating na Republika ng Indonesia sahinaharap. Dahil sa futuristiko nitong perspektiba, maihahalintuladang obrang ito ni Tan Malaka sa sanaysay ni Jose Rizal na “Filipinasdentro de cien años” (Ang Pilipinas sa loob ng isang dantaon (1891.Galing ito sa napakalaking akdang pilosopikal ni Tan Malaka napinamagatang Madilog: Materialisme, Dialektika, Logika (1948(Larawan 1 at tila tumatayo bilang pansarang mga repleksyon nito(Magnis-Suseno, 2005, pp. 205-233. Ang akdang ito ay unanginilathala noong 1951 ng Terbitan Widjaya sa Jakarta.

  18. Combined ability of chromium (Cr) tolerant plant growth promoting bacteria (PGPB) and salicylic acid (SA) in attenuation of chromium stress in maize plants.

    Science.gov (United States)

    Islam, Faisal; Yasmeen, Tahira; Arif, Muhammad Saleem; Riaz, Muhammad; Shahzad, Sher Muhammad; Imran, Qaiser; Ali, Irfan

    2016-11-01

    Heavy metal contamination of agricultural soil has become a serious global problem. This study was aimed to evaluate the effects of two chromium (Cr) tolerant plant growth promoting bacteria (PGPB) in combination with salicylic acid (SA) on plant growth, physiological, biochemical responses and heavy metal uptake under Cr contamination. A pot experiment (autoclaved sand as growing medium) was performed using maize (Zea mays L.) as a test crop under controlled conditions. Cr toxicity significantly reduced plant growth, photosynthetic pigment, carbohydrates metabolism and increased H2O2, MDA, relative membrane permeability, proline and Cr contents in maize leaves. However, inoculation with selected PGPB (T2Cr and CrP450) and SA application either alone or in combination alleviated the Cr toxicity and promoted plant growth by decreasing Cr accumulation, H2O2 and MDA level in maize. Furthermore, dual PGPB inoculation with SA application also improved plant performance under Cr-toxicity. Results obtained from this study indicate that PGPB inoculation and SA application enhanced Cr tolerance in maize seedlings by decreasing Cr uptake from root to shoot. Additionally, combination of both PGPB and SA also reduced oxidative stress by elevating the activities of enzymatic and non-enzymatic antioxidant, also indicated by improved carbohydrate metabolism in maize plant exposed to Cr contamination. Comparatively, alleviation effects were more pronounced in PGPB inoculated plants than SA applied plants alone. The results suggest that combined use of PGPB and SA application may be exploited for improving production potential of maize in metal (Cr) contaminated soil. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  19. Growth, physicochemical properties, and morphogenesis of Chinese wild-type PRV Fa and its gene-deleted mutant strain PRV SA215

    Directory of Open Access Journals (Sweden)

    Tang Shanhu

    2011-06-01

    Full Text Available Abstract Background PRV Fa is common in China and causes most of the pseudorabies in the pig industry. A PRV SA215 strain with deleted gE, gI, and TK genes was constructed to develop a commercial attenuated live vaccine. However, the physicochemical properties, growth pattern, penetration kinetics, and morphogenesis of the PRV SA215 and its parental PRV Fa strain are unclear. Results A series of experiments were conducted to characterize both strains and provide more information. PRV Fa and PRV SA215 were found to have similar penetration patterns, with about 5 min half-time of penetration. The SA215 strain exhibited a slight delay in entry compared with PRV Fa. In the one-step growth test, the titers of the SA215 strain were first detected at 8 h, rapidly increased, and peaked at 12 h. A plateau was formed between 12-36 h of culturing. PRV SA215 showed delayed replication and approximately 10-30-fold lower titers during 0-16 h of culturing compared with the PRV-Fa strain. After 16 h, the PRV Fa titers dramatically decreased, whereas those of PRV SA215 were prolonged to 36 h and reached a titer value equal to that of PRV Fa and then decreased. Both strains were sensitive to both heat and acid-alkali treatments; however, PRV Fa was relatively more stable to heat treatment than PRV SA215. Both strains could propagate in the cultures with pH values from 5.0 to 9.0. Cultures with pH below 3.0 or above 11.0 were fatal to both strains. Both strains had considerable resistance to freeze-thawing treatments. Morphogenetic investigations showed that typical phases in the maturation pathway were observed in the PRV Fa-infected PK15 cells, whereas secondary envelopment was not observed in the PRV SA215 strain. Instead, capsid aggregations with concomitants of electrodense materials were observed. Conclusions These results suggest that PRV SA215 is a promising strain for vaccine development

  20. SA8000标准的来历

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    社会道德责任标准Social Accoutability 8000或简称SA8000。自1997年问世以来,受到了公众极大的关注,在美欧工商界引起了强烈反响。专家们认为,SA8000是ISO9000、ISO14000之后出现的又一个重要的国际性标准,并迟早会转化为ISO标准;通过SA8000认证将成为国际市场竞争中的又一重要武器。有远见的组织家应未

  1. PET-Saúde: micropolítica, formação e o trabalho em saúde

    Directory of Open Access Journals (Sweden)

    Kathleen Tereza da Cruz

    2015-12-01

    Full Text Available O presente artigo analisa os efeitos que podem ser coletados das múltiplas experiências cotidianas vivenciadas pelos tutores/as, preceptores/as e alunos/as participantes do Programa de Educação pelo Trabalho para Saúde (PET-Saúde quando se trata de utilizá-las para se pensarem transformações na micropolítica da formação universitária e no trabalho em saúde. Tem como eixo uma pergunta: O Programa Pet-Saúde, nos seus processos cotidianos, é capaz de produzir efeitos que alargam a matriz de formação que tem como característica principal os processos de ensignação? Mais do que polarizar entre o sim e o não, temos como objetivo colocar em discussão as apostas na formação e atuação do campo da produção do cuidado em saúde, tentando pensar o que têm sido esses campos no âmbito da educação brasileira, e como é possível re-inventar processos de formação que tomam muito mais as desaprendizagens e as potencialidades dos diferentes atores envolvidos.

  2. Sindicalismo, SUS e planos de saúde

    Directory of Open Access Journals (Sweden)

    José Augusto Pina

    Full Text Available Este artigo discute a interlocução do sindicalismo brasileiro com o Sistema Único de Saúde (SUS e os planos e seguros privados de saúde. São ponderadas algumas teses na Saúde Coletiva à luz de estudos mais recentes nas Ciências Sociais sobre o sindicalismo e realizada análise documental para o caso da Central Única dos Trabalhadores (CUT, tomado aqui como referência. Aponta-se a necessidade de considerar os pesos relativos que a ação sindical atribuiu a cada um dos aspectos da relação, SUS e planos privados de saúde, pelas distintas conjunturas do país. O conflito entre trabalhadores e empresas somado ao desemprego e à precarização do trabalho expõe os limites das coberturas assistenciais privadas e impele a representação sindical a pleitear a intervenção estatal. O trabalho refletiu sobre as distintas modalidades de ação sindical na empresa e no Estado. A complexidade dessa dinâmica fez emergir um setor sindical interessado na gestão da previdência complementar e dos planos de saúde e, ao mesmo tempo, recria as circunstâncias e traz novas possibilidades de as organizações sindicais se colocarem na cena política e aglutinar os interesses de amplos segmentos dos trabalhadores para pressionar o Estado na defesa da melhoria do sistema público de saúde.

  3. Product policy of SC Electrecord S.A.

    Directory of Open Access Journals (Sweden)

    Ph. D. Candidate Cristina Andreescu (Manolache

    2009-12-01

    Full Text Available The global brand has the advantage of the scale economy, facilitates the company image and prestige and sometimes benefits even from its origin country effect. Its use is quite difficult (the semantic variations can impede the use of the same brand. The international brands act as a restriction against standardisation (the product should not be differentiated as there are internationally accepted and recognized brands. This paper makes an overview description of the general market environment, but also of the arket environment of SC ELECTRECORD S.A.; it underlines the product characteristics as well as the commercial diagnosis within SC ELECTRECORD S.A.

  4. FaSa: A Fast and Stable Quadratic Placement Algorithm

    Institute of Scientific and Technical Information of China (English)

    HOU WenTing(侯文婷); HONG XianLong(洪先龙); WU WeiMin(吴为民); CAI YiCi(蔡懿慈)

    2003-01-01

    Placement is a critical step in VLSI design because it dominates overall speed andquality of design flow. In this paper, a new fast and stable placement algorithm called FaSa is pro-posed. It uses quadratic programming model and Lagrange multiplier method to solve placementproblems. And an incremental LU factorization method is used to solve equations for speeding up.The experimental results show that FaSa is very stable, much faster than previous algorithms andits total wire length is comparable with other algorithms.

  5. SaRDIn - A Safe Reconfigurable Distributed Interlocking

    DEFF Research Database (Denmark)

    Fantechi, A.; Gnesi, S.; Haxthausen, Anne Elisabeth;

    2016-01-01

    Current computer-based interlocking systems most often have a centralized design, with all logic residing in a single computer. Centralized interlockings are complex to design. Following the general trend in Cyber-Physical Systems, the SaRDIn (Safe Reconfigurable Distributed Interlockings) concept...... promises a radically simpler solution. The novelty of the SaRDIn concept is a fine-grained distribution of the logic over all processors deployed at the sensors and actuators along the track layout, i.e. within the track circuits, point machines, signals, etc. The advantages and drawbacks...

  6. For-LySa: UML for Authentication Analysis

    DEFF Research Database (Denmark)

    Buchholtz, Mikael; Montangero, Carlo; Perrone, Lara;

    2005-01-01

    The DEGAS project aims at enriching standard UML-centred development environments in such a way that the developers of global applications can exploit automated formal analyses with minimal overhead. In this paper, we present For-LySa, an instantiation of the DEGAS approach for authentication...... analysis, which exploits an existing analysis tool developed for the process calculus LySa. We discuss what information is needed for the analysis, and how to build the UML model of an authentication protocol in such a way that the needed information can be extracted from the model. We then present our...

  7. Ressignificando Promoção de Saúde em Grupos para Profissionais da Saúde

    Directory of Open Access Journals (Sweden)

    Siegrid Kurzawa Zwiener dos Santos

    Full Text Available RESUMO Diferenças entre os conceitos de promoção e prevenção não estão claras para parte dos profissionais de saúde, incluindo médicos e estudantes de Medicina. Este trabalho objetivou problematizar o conceito de grupos de promoção de saúde para contribuir com o desenvolvimento da autonomia de profissionais de modo a avaliarem criticamente a maneira como vinham realizando educação em saúde e a refletirem sobre novas práticas. Foram realizados seis encontros no formato de círculos de cultura com profissionais da Estratégia Saúde da Família (ESF. Após esse trabalho, o grupo compreendeu a diferença entre promoção e prevenção. Promoção foi entendida como abordagem de condições de vida, cidadania, moradia, dinâmica familiar, como um processo que capacita para enfrentamentos, desenvolvimento do afeto, da discussão, do ouvir, do aceitar, do opinar e do oferecer. Os profissionais concluíram que é necessário desenvolver a autonomia dos grupos e indivíduos, ouvir a comunidade para compreender suas necessidades, resgatar o saber que a população possui e ver a saúde como um todo. Fatores biológicos foram relacionados à prevenção, e os sociais e psicológicos à promoção. O grupo é um instrumento importante para a promoção de saúde e deve ter uma metodologia problematizadora.

  8. Mga Kuwento-Kuwento ng Baliw: Lihis na Pagkilos sa Mga Maikling-Kuwentong Tagalog

    Directory of Open Access Journals (Sweden)

    Diana Ziganay

    1990-12-01

    Full Text Available Ang sulating ito ay nalikha upang magbigay ng isang pagsusuri at pagtatalakay sa pagbuo ng konsepto ng abnormalidad o kakaibang kilos o pananaw buhat sa mga piling uri ng panitikang Pilipinong naisulat sa wikang Ingles noong ika-1900 hanggang 1945. Pag-uukulan ng pansin dito ang panahon at kalagayang binanggit, ang mga suliraning binanggit, ang maga suliranin ng pagbuo ng panitikang Pilipino sa Ingles, at ang daloy ng kaisipan ng mga manunulat na may kaugnayan sa pag-unawa ng konsepto ng abnormalidad na sumasalamin sa ilang mga piling sulatin, tuwiran man o di tuwiran.

  9. Saúde mental nas práticas em saúde: a experiência do PROLIG

    Directory of Open Access Journals (Sweden)

    Samantha Mucci

    Full Text Available O presente trabalho apresenta o relato de experiências do Serviço de Atenção Psicossocial Integrada em Saúde (SAPIS nos Programas de Ligação (PROLIG. O SAPIS foi implantado em junho de 2002, no Hospital São Paulo (HSP, com o objetivo de promover uma atenção mais ampla às necessidades gerais e específicas do hospital no que diz respeito aos aspectos psicossociais bem como de reorganizar a inclusão de profissionais de saúde mental nas enfermarias e ambulatórios. Esse estudo tem como objetivo descrever a atuação do psicólogo como profissional de ligação em saúde mental no atendimento às demandas específicas de unidades do HSP. A tarefa do profissional de ligação em saúde mental envolve a assistência psicológica ao paciente e seu familiar assim como o desempenho do papel de especialista em saúde mental junto à equipe multiprofissional. Temos encontrado em nossa prática, no entanto, algumas dificuldades para a implementação e a manutenção de algumas propostas. Concluímos que a atuação do psicólogo como profissional de ligação de saúde mental tem promovido mudanças nos cuidados em saúde nessa instituição, porém ainda exige uma profunda reflexão e maior envolvimento da instituição e de políticas de saúde que viabilizem mudanças estruturais para a construção de uma efetiva prática integral e integrada nessa área.

  10. Programa de saúde mental Programme in mental health

    Directory of Open Access Journals (Sweden)

    Cid Guimarães

    1975-12-01

    Full Text Available É apresentado o programa de Saúde Mental decorrente de convênio estabelecido pela Secretaria da Saúde do Estado de São Paulo com a Universidade de São Paulo, através da Faculdade de Saúde Pública. Este convênio tem por finalidade a realização de estudos na área de Saúde Mental, tais como assistência psiquiátrica preventiva e pesquisas visando a medir transtornos mentais através de casos de óbito e na população da cidade e de cursos e atividades curriculares e extra-curriculares.The School of Public Health is conducting a project, sponsored by the Health Department of the State of S. Paulo Government, aiming at: studying the integration of a team of mental health workers in a polivalent community health center; carrying out two large surveys on the incidence and prevalence of mental disorders and some of their characteristics; promoting courses and seminars on Mental Health for the personnel of Community Health Centers.

  11. Fonoaudiologia em saúde pública

    Directory of Open Access Journals (Sweden)

    Regina M. Freire

    1992-06-01

    Full Text Available Objetivou-se obter o entendimento das funções do fonoaudiólogo enquanto profissional da saúde. Discutem-se as dificuldades ligadas à implantação de um serviço novo, estranho às Unidades Básicas de Saúde. A seguir, analisa-se a demanda pelo serviço de Fonoaudiologia em postos de saúde, e verifica-se que 32% da população que busca esse serviço está em idade escolar e vem encaminhada pelas escolas, com queixa de problemas de aprendizagem. Uma aproximação maior dessas crianças, através do atendimento fonoaudiológico, delineia uma outra realidade: a de que não se pode considerar como distúrbio/desvio/problema/patologia marcas gráficas que se constituem como indícios do choque entre o processo de letramento e o de alfabetização. Entendendo a problemática do ponto de vista da saúde pública, propõe-se um programa de atendimento ao professor, cujo objetivo é o esclarecimento da escola com relação ao seu papel de co-construtora do processo de letramento da criança, devolvendo-lhe a responsabilidade pelo sucesso e/ou fracasso da alfabetização.

  12. KELEMBAGAAN DAN STRATEGI PENINGKATAN DAYA SAING KOMODITAS CABAI KAPUPATEN GARUT

    Directory of Open Access Journals (Sweden)

    Silmi Tsurayya

    2015-03-01

    Full Text Available The objectives of this study were to identify supply chains, analyze the institutions, formulate strategies for competitiveness enhancement, design competitiveness enhancement model, and determine the main strategies in competitiveness enhancement of chili pepper in Garut District. This study used primary data (observations, interviews, and questionnaires and secondary data (literature study. The data were processed and analyzed by Descriptive Analysis, SWOT Analysis, the House Model, and Pairwise Comparison. The results of this study showed that: 1 there were 6 supply chain structures in chili pepper distribution; 2 the major institutional sectors contributed to competitiveness enhancement of chili pepper including public sector, voluntary sector, and private sector; 3 SWOT Analysis obtained 15 alternative strategies; 4 the House Model as competitiveness enhancement model had 3 pillars consisting of products, human resource, and institutional and marketing; 5 the main strategies in competitiveness enhancement of chili pepper included Increase in the number of productions, Market expansion, and Partnership Strengthening and development. The managerial implications of the study suggest: 1 land expansion and plant arrangement pattern to ensure continuity of production quantities; 2 Optimization of the role of Agribusiness Sub-Terminal as the marketing institution; and 3 Maximization in the government’s role in facilitating farmer groups with associations or corporations.Keywords: institutional, the house model, competitiveness, chili, SWOTABSTRAKPenelitian ini bertujuan mengidentifikasi rantai pasok, menganalisis kelembagaan, merumuskan strategi peningkatan daya saing, merancang model peningkatan daya saing, dan menentukan strategi utama dalam peningkatan daya saing  komoditas cabai di Kabupaten Garut. Data yang digunakan terdiri dari data primer (observasi, wawancara, dan kuesioner dan data sekunder (studi literatur. Metode pengolahan dan

  13. WRKY Transcription Factors Involved in Activation of SA Biosynthesis Genes

    Directory of Open Access Journals (Sweden)

    Bol John F

    2011-05-01

    Full Text Available Abstract Background Increased defense against a variety of pathogens in plants is achieved through activation of a mechanism known as systemic acquired resistance (SAR. The broad-spectrum resistance brought about by SAR is mediated through salicylic acid (SA. An important step in SA biosynthesis in Arabidopsis is the conversion of chorismate to isochorismate through the action of isochorismate synthase, encoded by the ICS1 gene. Also AVRPPHB SUSCEPTIBLE 3 (PBS3 plays an important role in SA metabolism, as pbs3 mutants accumulate drastically reduced levels of SA-glucoside, a putative storage form of SA. Bioinformatics analysis previously performed by us identified WRKY28 and WRKY46 as possible regulators of ICS1 and PBS3. Results Expression studies with ICS1 promoter::β-glucuronidase (GUS genes in Arabidopsis thaliana protoplasts cotransfected with 35S::WRKY28 showed that over expression of WRKY28 resulted in a strong increase in GUS expression. Moreover, qRT-PCR analyses indicated that the endogenous ICS1 and PBS3 genes were highly expressed in protoplasts overexpressing WRKY28 or WRKY46, respectively. Electrophoretic mobility shift assays indentified potential WRKY28 binding sites in the ICS1 promoter, positioned -445 and -460 base pairs upstream of the transcription start site. Mutation of these sites in protoplast transactivation assays showed that these binding sites are functionally important for activation of the ICS1 promoter. Chromatin immunoprecipitation assays with haemagglutinin-epitope-tagged WRKY28 showed that the region of the ICS1 promoter containing the binding sites at -445 and -460 was highly enriched in the immunoprecipitated DNA. Conclusions The results obtained here confirm results from our multiple microarray co-expression analyses indicating that WRKY28 and WRKY46 are transcriptional activators of ICS1 and PBS3, respectively, and support this in silico screening as a powerful tool for identifying new components of stress

  14. Promoção da saúde, qualidade de vida e iniquidade em saúde: reflexões para a saúde pública.

    Directory of Open Access Journals (Sweden)

    Aline Rodrigues de ALMEIDA

    2016-01-01

    Full Text Available A ideia de promover saúde tem se tornado uma energia fundamental no movimento de saúde coletiva, no qual saúde é um fenômeno social e marcado por iniquidades. Este trabalho teve como objetivo compreender as relações entre promoção da saúde e iniquidades de acesso e assistência em saúde, identificandoos entraves para uma prática equânime da saúde pública com ênfase à qualidade de vida. Os diferentes perfis de doença e suas mediações sociais ultrapassam os estudos de variação biológica e incorpora o foco na dimensão social das vulnerabilidades. Para promover saúde no Brasil, é indissociável do enfrentamento de uma realidade de iniquidades históricas de grandes proporções que impõem desafios cotidianos não apenas ao setor de saúde, mas a todos aqueles que constroem políticas públicas. A qualidade de vida depende da satisfação das necessidades básicas de todos os cidadãos, propondo uma gestão baseada na solidariedade social, uma visão holística dos problemas e a redução das iniquidades. A promoção da saúde em um país tão desigual como o Brasil propõe um desafio constante aos atores envolvidos no sistema de saúde. A compreensão das iniquidades em saúde para estabelecer uma assistência holística é um processo difícil, mas extremamente relevante para a saúde pública.

  15. Sequence determinants for DNA packaging specificity in the S. aureus pathogenicity island SaPI1.

    Science.gov (United States)

    Bento, Joana C; Lane, Kristin D; Read, Erik K; Cerca, Nuno; Christie, Gail E

    2014-01-01

    The SaPIs and their relatives are a family of genomic islands that exploit helper phages for high frequency horizontal transfer. One of the mechanisms used by SaPIs to accomplish this molecular piracy is the redirection of the helper phage DNA packaging machinery. SaPIs encode a small terminase subunit that can be substituted for that of the phage. In this study we have determined the initial packaging cleavage sites for helper phage 80α, which uses the phage-encoded small terminase subunit, and for SaPI1, which uses the SaPI-encoded small terminase subunit. We have identified a 19nt SaPI1 sequence that is necessary and sufficient to allow high frequency 80α transduction of a plasmid by a terminase carrying the SaPI1-encoded small subunit. We also show that the hybrid enzyme with the SaPI1 small terminase subunit is capable of generalized transduction.

  16. Isolation of Asticcacaulis sp. SA7, a novel agar-degrading alphaproteobacterium.

    Science.gov (United States)

    Hosoda, Akifumi; Sakai, Masao

    2006-03-01

    An agar-degrading bacterium, strain SA7, was isolated from plant roots cultivated in soil. Analysis of the 16S rDNA sequence showed that strain SA7 is affiliated with the genus Asticcacaulis. Strain SA7 produced extracellular agarase, and grew utilizing agar in the culture medium as sole carbon source. Zymogram analysis showed that strain SA7 extracellularly secreted single agarase protein (about 70 kDa).

  17. Revista de Saúde Pública in scientific publications on Violence and Health (1967-2015

    Directory of Open Access Journals (Sweden)

    Lilia Blima Schraiber

    Full Text Available ABSTRACT This article retrieved the publications from the Revista de Saúde Pública journal (from 1967 to 2015 on violence and health, on the SciELO and PubMed bases, by searching for the terms “violence”, “suicide”, “aggression”, “bullying”, and “external causes”, registered in any part of the text. We found 130 articles (the first one published in 1974. We observed: increase of publications over time, with decrease in the last five years; similar production volume in lethal and non-lethal violence; later publication of the latter; few studies in qualitative research; mostly descriptive production; and visualization of the problem more by the acts than by contexts or motivations and aggressors. Social markers were little approached, appearing, from largest to smallest frequency, social class, gender, race/ethnicity, and generation. Human rights were little used and only recently used as analytical framework, connected more to gender than to social class. Although Revista de Saúde Pública has registered the theme in its publications, consolidating it as scientific production line, there is still great explanatory theoretical rarefaction and little intersectionality between violence, social inequalities, and human rights.

  18. Aspectos relevantes sobre tuberculose para profissionais de saúde

    Directory of Open Access Journals (Sweden)

    Alexandre Daronco

    2012-01-01

    Full Text Available A Tuberculose (TB é uma patologia infectocontagiosa com clínica ampla cujo agentecausador é o Mycobacterium tuberculosis (Bacilo de Koch, uma micobactéria aeróbia estrita. Apesar de tratar-se dedoença antiga, que acomete seres humanos há séculos, sendo uma importante causa de morte no mundo inteiro,diferentes pesquisas do Ministério da Saúde apontam números preocupantes no tocante a novos casos. Materiais eMétodos: O presente artigo de revisão procura, de forma objetiva e clara, explicitar os principais aspectos de interessepara profissionais de saúde no tocante a Tuberculose doença. O artigo divide-se em tópicos: Defi nição, Sintomatologia,Diagnóstico, Tratamento, Multirresistência, Profi laxia, Formas de Contágio e Formas de Prevenção. Foram utilizadasreferências atuais sobre o tema, incluindo Manuais, Guidelines e Artigos científicos diversos de bases de dados comoUp to Date e Science Direct. Discussão: Sinais e sintomas da doença aumentam o grau de suspeição da mesma, oque torna o pedido de exames para confirmação da infecção dentro de tempo hábil para instituição da terapêuticaadequada. Assim como diagnóstico e tratamento, medidas para evitar o contágio, em serviços de saúde, locaiscom aglomerações humanas e em residências, são de fundamental importância no combate a tuberculose. Osprofissionais de saúde devem atentar para possíveis casos de resistência aos fármacos e as indicações de profilaxia,pois tais variáveis são de extrema relevância no controle da disseminação da doença. Conclusão: Por tratar-se dedoença infecciosa que pode acometer todas as classes sociais, além de possuir formas diferentes de acometimento,o conhecimento básico acerca da Tuberculose é deveras imprescindível em serviços de saúde, desde a atençãoprimária até os centros de saúde com alta tecnologia.

  19. Preclinical evaluation of [{sup 11}C]SA4503. Radiation dosimetry, in vivo selectivity and PET imaging of sigma{sub 1} receptors in the cat brain

    Energy Technology Data Exchange (ETDEWEB)

    Kawamura, Kazunori; Ishiwata, Kiichi; Shimada, Yuhei; Kimura, Yuichi; Senda, Michio [Tokyo Metropolitan Inst. of Gerontology (Japan). Positron Medical Center; Kobayashi, Tadayuki; Matsuno, Kiyoshi; Homma, Yoshio

    2000-08-01

    Our previous in vivo study with rats has demonstrated that {sup 11}C-labeled 1-(3,4-dimethoxyphenethyl)-4-(3-phenylpropyl)piperazine ([{sup 11}C]SA4503) is a potential radioligand for mapping central nervous system (CNS) sigma{sub 1} receptors by positron emission tomography (PET). In the present study, we further characterized this ligand. The radiation absorbed-dose of [{sup 11}C]SA4503 in humans estimated with the tissue distribution in mice, was higher in the liver, kidney and pancreas than in other organs studied, but was low enough for clinical use. The brain uptake of [{sup 11}C]SA4503 in mice was reduced to approximately 60-70% by co-injection of carrier SA4503 and haloperidol, but not by co-injection of any of six ligands for sigma{sub 2} or other receptors, for which SA4503 showed in vitro >100 times weaker affinity than for sigma{sub 1} receptor. In the cat brain, the uptake in the cortex was higher than that in the cerebellum. The radioactivity in the cortex and cerebellum accumulated for the first 10 min and then gradually decreased until 81.5 min in the baseline measurement, but rapidly decreased in the carrier-loading condition. The receptor-mediated uptake was estimated to be approximately 60-65% of the total radioactivity in the cortex and cerebellum at 76 min after tracer injection. We have concluded that [{sup 11}C]SA4503 has the potential for mapping sigma{sub 1} receptor by PET. (author)

  20. Por um programa preventivo em saúde mental do trabalhador na brigada militar

    Directory of Open Access Journals (Sweden)

    Fernanda Spanier Amador

    Full Text Available O presente artigo argumenta sobre a importância de políticas de Saúde e Segurança Públicas que sustentem programas voltados à saúde do trabalhador na Brigada Militar. Aborda, mais especificamente, a necessidade de ações preventivas e promotoras de saúde mental nesse âmbito.

  1. Zitkala-Sa and the Problem of Regionalism: Nations, Narratives, and Critical Traditions

    Science.gov (United States)

    Totten, Gary

    2005-01-01

    Although Yankton Sioux writer Zitkala-Sa (Gertrude Bonnin, 1876-1938) was, as P. Jane Hafen notes, "virtually unknown for many decades," much critical work has appeared since Dexter Fisher's 1979 article,"Zitkala-Sa: Evolution of a Writer." Some critics desiring to bring Zitkala-Sa into the conversation about turn-of-the-century American women…

  2. 76 FR 7511 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2011-02-10

    ... Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 Airplanes; and Model ERJ 190-100..., contact Empresa Brasileira de Aeronautica S.A. (EMBRAER), Technical Publications Section (PC 060), Av.... 39.13 by adding the following new AD: Empresa Brasileira de Aeronautica S.A. (EMBRAER): Docket...

  3. Política de recursos humanos em saúde: análise de documentos oficiais do ministério da saúde

    OpenAIRE

    Luciana Pavanelli Von Gal de Almeida

    2007-01-01

    A reforma do setor saúde no Brasil levou à criação do Sistema Único de Saúde que contemplou a saúde como um direito social. Dessa forma, na atualidade, a saúde é tratada como um bem universal a ser provido para todos os cidadãos, implicando no princípio da equidade, em que cada cidadão tem direito a ações e serviços requeridos para manutenção e recuperação de sua saúde. Esse ideário tem forte implicação com os recursos humanos em saúde, em termos de definições políticas e técnicas relacionada...

  4. BIHOURLY DIAGRAMS OF FORBUSH DECREASES

    Science.gov (United States)

    Bihourly diagrams were made of Forbush decreases of cosmic ray intensity as observed at Uppsala from 31 Aug 56 to 31 Dec 59, at Kiruna from Nov 56 to 31 Dec 59, and at Murchison Bay from 26 Aug 57 to 30 Apr 59. (Author)

  5. The interdisciplinarity experienced in the PET- Saúde program A interdisciplinaridade vivenciada no PET-Saúde

    Directory of Open Access Journals (Sweden)

    Sueli Moreira Pirolo

    2010-01-01

    Full Text Available Introduction: The incorporation of the oral health team in the Family Health Strategy (ESF, in 2000, enabled the adoption of a more active attitude of Primary Health Care in this field, in as much as oral health consists of an inseparable and integral part of the individual’s health. The interaction of health professionals becomes possible through policies like “PET-Saúde” which promotes the professional formation articulated with the ESF professionals as well as the process of integration of teaching, service and community in the perspective of interdisciplinarity. Objective: To report the experience of students during an interdisciplinary research. Description of the experience: This report was experienced in “PET-Saúde” of the Faculty of Medicine of Marília, at the “Man’s Health” subproject aiming at elaborating and validating a data collection instrument through Delphi Technique in order to help the health care team to detect early dental problems because of the damaged oral health pattern of the age group between 35 and 44 in Brazil. The members of this study are: medical and nursing students, a dentist preceptor and a nursing tutor. For the educational activities, the active methodology of teaching-learning was used. Conclusion: The reflexive actions, the moments for discussions provided the development of scientific investigation. The approximation of the process of validation through Delphi Technique also allowed the expansion of multidisciplinary knowledge on oral health. This experience made it possible to qualify the academic-professional formation on the interdisciplinary approach, and it’s important to strengthen the interaction among professionals and the articulation of health actions.Introdução: A incorporação da equipe de saúde bucal na Estratégia de Saúde da Família (ESF, em 2000, possibilitou a adoção de uma postura mais ativa de atenção primária nesta área, visto que a saúde bucal consiste

  6. Quantitation of Staphylococcus aureus in seawater using CHROMagar SA.

    Science.gov (United States)

    Tice, Alan D; Pombo, David; Hui, Jennifer; Kurano, Michelle; Bankowski, Matthew J; Seifried, Steven E

    2010-01-01

    A microbiological algorithm has been developed to analyze beach water samples for the determination of viable colony forming units (CFU) of Staphylococcus aureus (S. aureus). Membrane filtration enumeration of S. aureus from recreational beach waters using the chromogenic media CHROMagar SA alone yields a positive predictive value (PPV) of 70%. Presumptive CHROMagar SA colonies were confirmed as S. aureus by 24-hour tube coagulase test. Combined, these two tests yield a PPV of 100%. This algorithm enables accurate quantitation of S. aureus in seawater in 72 hours and could support risk-prediction processes for recreational waters. A more rapid protocol, utilizing a 4-hour tube coagulase confirmatory test, enables a 48-hour turnaround time with a modest false negative rate of less than 10%.

  7. Andragogia na saúde: estudo bibliométrico

    OpenAIRE

    Draganov, Patrícia Bover [UNIFESP; Friedländer,Maria Romana; Sanna, Maria Cristina [UNIFESP

    2011-01-01

    O sucesso da aprendizagem envolve o uso de estratégias adequadas. Como a clientela de formação profissional e de educação permanente e a população assistida, para quem se dirigem as ações de educação em saúde, são majoritariamente adultas, metodologias como a Andragogia, que é a arte e ciência de conduzir adultos ao aprendizado, são uma alternativa interessante. Com o objetivo de quantificar e descrever a produção científica sobre Andragogia nas Ciências da Saúde no período de 1999 a 2009, re...

  8. Vibration analysis of the SA349/2 helicopter

    Science.gov (United States)

    Heffernan, Ruth; Precetti, Dominique; Johnson, Wayne

    1991-01-01

    Helicopter airframe vibration is examined using calculations and measurements for the SA349/2 research helicopter. The hub loads, which transmit excitations to the fuselage, are predicted using a comprehensive rotorcraft analysis and correlated with measuring hub loads. The predicted and measured hub loads are then coupled with finite element models representing the SA349/2 fuselage. The resulting vertical acceleration at the pilot seat is examined. Adjustments are made to the airframe structural models to examine the sensitivity of predicted vertical acceleration to the model. Changes of a few percent to the damping and frequency of specific models lead to large reductions in predicted vibration, and to major improvements in the correlations with measured pilot-seat vertical acceleration.

  9. Analysis and correlation of SA349/2 helicopter vibration

    Science.gov (United States)

    Heffernan, Ruth; Precetti, Dominique; Johnson, Wayne

    1991-01-01

    Helicopter airframe vibration is examined using calculation and measurements for the SA349/2 research helicopter. The hub loads, which transmit excitation to the fuselage, are predicted using a comprehensive rotorcraft analysis and correlated with measured hub loads. The predicted and measured hub loads are then coupled with finite element models representing the SA349/2 fuselage. The resulting vertical acceleration at the pilot seat is examined. Adjustments are made to the airframe structural models to examine the sensitivity of predicted vertical acceleration to the model. Changes of a few percent to the damping and frequency of specific modes lead to large reductions in predicted vibration and to major improvements in the correlations with measured pilot seat vertical acceleration.

  10. Eventos de massa, desastres e Saúde Pública

    Directory of Open Access Journals (Sweden)

    Camilla Figueiredo de Castro

    2014-09-01

    Full Text Available O Brasil tem sediado eventos de massa (EM e seus participantes estão sujeitos a riscos à saúde. Objetivou-se sistematizar as principais relações, de interesse da Saúde Pública, entre eventos de massa e ocorrência de desastres. Foram realizadas três estratégias metodológicas: revisão da literatura de EM, com busca sistemática, sistematização das principais informações sobre EM e seleção e sistematização das Referências que tratavam do tema desastre em suas palavras-chave, título ou Resumo. Foram selecionadas 28 Referências sobre EM, a maioria artigo científico, revisão de literatura, de 2012 e de natureza esportiva. Os principais assuntos abordados foram sistemas de vigilância e planejamento dos EM. Evidenciou-se a pouca informação analítica sobre os EM, bem como a importância de eventos não transmissíveis para a ocorrência de desastres, com destaque aos relacionados à multidão. O risco de desastres deve ser considerado no planejamento dos EM, para aumentar a capacidade de resposta considerando áreas estratégicas como: emergência médica, vigilância de doenças transmissíveis e vetores, segurança alimentar e dos serviços de saúde, saúde ambiental e laboratório. Ressalta-se a importância de pesquisas analíticas e de registro das experiências relacionadas aos EM, para a redução de risco de desastres.

  11. Genome sequencing and annotation of Morganella sp. SA36

    Directory of Open Access Journals (Sweden)

    Samy Selim

    2015-12-01

    Full Text Available We report draft genome sequence of Morganella sp. Strain SA36, isolated from water spring in Aljouf region, Saudi Arabia. The draft genome size is 2,564,439 bp with a G + C content of 51.1% and contains 6 rRNA sequence (single copies of 5S, 16S & 23S rRNA. The genome sequence can be accessed at DDBJ/EMBL/GenBank under the accession no. LDNQ00000000.

  12. Gripe Suína: Saúde em destaque

    Directory of Open Access Journals (Sweden)

    HELOÍZA FELTRIN BANDEIRA

    2009-05-01

    Full Text Available

    O texto tem por objetivo analisar alguns

    fatos ligados à crise mundial na saúde causada pelo

    virus da Influenza A.

  13. A narrativa nas pesquisas qualitativas em saúde

    Directory of Open Access Journals (Sweden)

    Marcelo Eduardo Pfeiffer Castellanos

    2014-04-01

    Full Text Available O forte interesse das ciências sociais e humanas em saúde nos estudos narrativos levou a várias formas de incorporação das contribuições desses estudos na pesquisa qualitativa em saúde. Torna-se importante refletir sobre os contextos e as características dessa incorporação. Para tanto, destacamos as principais questões teóricas aí envolvidas, assim como situamos essa incorporação no contexto da produção científica mais ampla das ciências sociais e humanas em saúde. Apontamos, também, a contribuição dos estudos narrativos para reflexão sobre as relações entre estrutura e ação social ou entre contextos específicos de interação social e contextos societários mais amplos. Essa contribuição pode ser identificada na análise das relações narrativamente estabelecidas entre interpretação, experiência e ação, ao longo do processo de saúde-doença-cuidado. Argumenta-se que as narrativas não somente organizam interpretações, mas também consistem em uma forma específica de agenciamento social. Nesse sentido, as interpretações narrativas e as performances narrativas podem ser vistas como elementos centrais da construção social de experiências e trajetórias de adoecimento e cuidado.

  14. Using SA508/533 for the HTGR Vessel Material

    Energy Technology Data Exchange (ETDEWEB)

    Larry Demick

    2012-06-01

    This paper examines the influence of High Temperature Gas-cooled Reactor (HTGR) module power rating and normal operating temperatures on the use of SA508/533 material for the HTGR vessel system with emphasis on the calculated times at elevated temperatures approaching or exceeding ASME Code Service Limits (Levels B&C) to which the reactor pressure vessel could be exposed during postulated pressurized and depressurized conduction cooldown events over its design lifetime.

  15. Decreasing incidence rates of bacteremia

    DEFF Research Database (Denmark)

    Nielsen, Stig Lønberg; Pedersen, C; Jensen, T G

    2014-01-01

    BACKGROUND: Numerous studies have shown that the incidence rate of bacteremia has been increasing over time. However, few studies have distinguished between community-acquired, healthcare-associated and nosocomial bacteremia. METHODS: We conducted a population-based study among adults with first......-time bacteremia in Funen County, Denmark, during 2000-2008 (N = 7786). We reported mean and annual incidence rates (per 100,000 person-years), overall and by place of acquisition. Trends were estimated using a Poisson regression model. RESULTS: The overall incidence rate was 215.7, including 99.0 for community......-acquired, 50.0 for healthcare-associated and 66.7 for nosocomial bacteremia. During 2000-2008, the overall incidence rate decreased by 23.3% from 254.1 to 198.8 (3.3% annually, p bacteremia decreased by 25.6% from 119.0 to 93.8 (3.7% annually, p

  16. Structural analysis of the JT-60SA cryostat vessel body

    Energy Technology Data Exchange (ETDEWEB)

    Botija, José, E-mail: jose.botija@ciemat.es [Association EURATOM – CIEMAT, Avda. Complutense 40, 28040 Madrid (Spain); Alonso, Javier; Fernández, Pilar; Medrano, Mercedes; Ramos, Francisco; Rincon, Esther; Soleto, Alfonso [Association EURATOM – CIEMAT, Avda. Complutense 40, 28040 Madrid (Spain); Davis, Sam; Di Pietro, Enrico; Tomarchio, Valerio [Fusion for Energy, JT-60SA European Home Team, 85748 Garching bei Munchen (Germany); Masaki, Kei; Sakasai, Akira; Shibama, Yusuke [JAEA – Japan Atomic Energy Agency, Naka Fusion Institute, Ibaraki 311-0193 (Japan)

    2013-10-15

    Highlights: ► Structural analysis to validate the JT-60SA cryostat vessel body design. ► Design code ASME 2007 “Boiler and Pressure Vessel Code. Section VIII”. ► First buckling mode: load multiplier of 10.644, higher than the minimum factor 4.7. ► Elastic and elastic–plastic stress analysis meets ASME against plastic collapse. ► Bolted fasteners have been analyzed showing small gaps closed by strong welding. -- Abstract: The JT-60SA cryostat is a stainless steel vacuum vessel (14 m diameter, 16 m height) which encloses the Tokamak providing the vacuum environment (10{sup −3} Pa) necessary to limit the transmission of thermal loads to the components at cryogenic temperature. It must withstand both external atmospheric pressure during normal operation and internal overpressure in case of an accident. The paper summarizes the structural analyses performed in order to validate the JT-60SA cryostat vessel body design. It comprises several analyses: a buckling analysis to demonstrate stability under the external pressure; an elastic and an elastic–plastic stress analysis according to ASME VIII rules, to evaluate resistance to plastic collapse including localized stress concentrations; and, finally, a detailed analysis with bolted fasteners in order to evaluate the behavior of the flanges, assuring the integrity of the vacuum sealing welds of the cryostat vessel body.

  17. Performance verification tests of JT-60SA CS model coil

    Energy Technology Data Exchange (ETDEWEB)

    Obana, Tetsuhiro, E-mail: obana.tetsuhiro@LHD.nifs.ac.jp [National Institute for Fusion Science, 322-6 Oroshi, Toki, Gifu 509-5292 (Japan); Murakami, Haruyuki [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan); Takahata, Kazuya; Hamaguchi, Shinji; Chikaraishi, Hirotaka; Mito, Toshiyuki; Imagawa, Shinsaku [National Institute for Fusion Science, 322-6 Oroshi, Toki, Gifu 509-5292 (Japan); Kizu, Kaname; Natsume, Kyohei; Yoshida, Kiyoshi [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan)

    2015-11-15

    Highlights: • The performance of the JT-60SA CS model coil was verified. • The CS model coil comprised a quad-pancake wound with a Nb{sub 3}Sn CIC conductor. • The CS model coil met the design requirements. - Abstract: As a final check of the coil manufacturing method of the JT-60 Super Advanced (JT-60SA) central solenoid (CS), we verified the performance of a CS model coil. The model coil comprised a quad-pancake wound with a Nb{sub 3}Sn cable-in-conduit conductor. Measurements of the critical current, joint resistance, pressure drop, and magnetic field were conducted in the verification tests. In the critical-current measurement, the critical current of the model coil coincided with the estimation derived from a strain of −0.62% for the Nb{sub 3}Sn strands. As a result, critical-current degradation caused by the coil manufacturing process was not observed. The results of the performance verification tests indicate that the model coil met the design requirements. Consequently, the manufacturing process of the JT-60SA CS was established.

  18. Cuidados paliativos: o desafio das equipes de saúde

    Directory of Open Access Journals (Sweden)

    Fernanda de Carvalho Braga

    2013-12-01

    Full Text Available O avanço tecnológico possibilitou tanto a redução da morte quanto o prolongamento da vida. Essa última traz consigo a necessidade de se pensar em como cuidar de pessoas fora de perspectiva de cura, especialmente porque tal cuidado inclui aspectos psicossociais, com implicações tanto para as relações entre os profissionais quanto com o paciente e sua família. Este estudo teve como objetivo buscar na literatura nacional artigos sobre equipes de saúde que oferecem cuidados paliativos. Realizou-se uma revisão de produção em periódicos nacionais com os descritores cuidados paliativos, equipe de saúde e neonatologia. Foram identificados 62 trabalhos, porém somente 11 atenderam ao critério de relacionar pelo menos dois descritores. Nenhum artigo relacionou as três palavras-chaves. O baixo número de publicações evidencia a necessidade de mais pesquisas nessa área, pois proporcionar qualidade de vida desde o diagnóstico da doença até o momento do óbito representa grande estresse para os profissionais de saúde.

  19. Saúde, este obscuro objeto de desejo

    Directory of Open Access Journals (Sweden)

    Fernando Lefèvre

    1997-07-01

    Full Text Available Exploram-se no presente ensaio as relações entre saúde e desejo, envolvendo um dado querer denominado "saúde" e as formas que este querer adquire no contexto do viver contemporâneo. Aponta-se ao final para uma situação radical no que toca à saúde, vítima de um processo irreversível de expansão, que acaba por inviabilizar qualquer tentativa de defini-la, levando a uma perda total de sentido, no contexto de um universo humano tentendo à completa robotização.The present essay explores the relations between health and desire involving a given yearning named "health" and the forms that such feeling acquires in the contemporaneous context of living. It ultimately points to a radical situation in terms of health, victim of a irreversible process of expansion that eventually makes any attempt of definition not viable, leading to a total loss of meaning within a human universe tending to complete robotization.

  20. O impacto da homofobia na saúde do adolescente

    Directory of Open Access Journals (Sweden)

    Taison Regis Penariol Natarelli

    2015-12-01

    Full Text Available Resumo Objetivo: Objetivou-se conhecer os tipos de violência sofrida por adolescentes homossexuais e compreender a influência da homofobia na saúde dessa população. Métodos: Foram realizadas entrevistas, em profundidade, com nove adolescentes residentes em um município do interior de São Paulo que se autodeclararam homossexuais. Resultados: Os tipos de violência sofridos e referidos pelos adolescentes foram: física, verbal, psicológica e sexual. A homofobia provoca percepções negativas sobre si mesmo e a não adoção de hábitos de vida saudáveis relacionados aos cuidados com alimentação, prática de atividades físicas, padrão de sono e ideações suicidas. Foram relatadas situações de homofobia nos serviços de saúde. Conclusão: Adolescentes homossexuais são vulneráveis a diferentes tipos de violência. A dificuldade de acesso aos serviços de saúde é um fator concorrente ao aumento da vulnerabilidade. A contribuição deste estudo reside na problematização de tópicos que podem auxiliar na construção do cuidado integral dos adolescentes homossexuais.

  1. Life satisfaction decreases during adolescence.

    Science.gov (United States)

    Goldbeck, Lutz; Schmitz, Tim G; Besier, Tanja; Herschbach, Peter; Henrich, Gerhard

    2007-08-01

    Adolescence is a developmental phase associated with significant somatic and psychosocial changes. So far there are few studies on developmental aspects of life satisfaction. This cross-sectional study examines the effects of age and gender on adolescent's life satisfaction. 1,274 German adolescents (aged 11-16 years) participated in a school-based survey study. They completed the adolescent version of the Questions on Life Satisfaction (FLZ(M) - Fragen zur Lebenszufriedenheit), a multidimensional instrument measuring the subjective importance and satisfaction with eight domains of general and eight domains of health-related life satisfaction. Effects of gender and age were analysed using ANOVAs. Girls reported significantly lower general (F = 5.0; p = .025) and health-related life satisfaction (F = 25.3; p life domains, there was a significant decrease in general (F = 14.8; p life satisfaction (F = 8.0; p Satisfaction with friends remained on a high level, whereas satisfaction with family relations decreased. Only satisfaction with partnership/sexuality increased slightly, however this effect cannot compensate the general loss of satisfaction. Decreasing life satisfaction has to be considered as a developmental phenomenon. Associations with the increasing prevalence of depression and suicidal ideation during adolescence are discussed. Life satisfaction should be considered a relevant aspect of adolescent's well-being and functioning.

  2. 八羧基铜酞菁修饰海藻酸钠阳膜层制备CuPc(COOH)_8-SA/mCS双极膜及其表征%Preparation and Characterization of CuPc(COOH)_8-SA/mCS Bipolar Membrane Modified by Copper Octocarboxyphthalocyanine in Cation Layer

    Institute of Scientific and Technical Information of China (English)

    陈日耀; 陈震; 郑曦; 陈晓; 张娟灵

    2009-01-01

    In this paper,the sodium alginate(SA)cation layer was modified by copper octocarboxyphthalocyanine (CuPc(COOH)_8),then the CuPc(COOH)_8-SA and chitosan(CS)were modified by Fe~(3+)and ghtaraldehyde as linking reagents to prepare CuPc(COOH)-8-SA/mCS bipolar membrane(BPM).The FTIR and SEM were used to characterize the CuPc(COOH)_8-SMmCS BPM.The CuPc(COOH)-8 can promote water splitting at the interlayer of the CuPc (COOH)_8-SA/mCS BPM.For comparison with the CuPc(COOH)_8-SA/mCS BPM,the mSA/mCS BPMs modified by Fe~(3+)and ferrocene were prepared.The experimental results showed that the ion exchange capacity and hydrogen ion transmigration rate of the CuPc(COOH)_8-SA cation exchange membrane were increased.In comparison with the mSA/mCS BPM modified by Fe~(3+)or ferrocene,the membrane impedance,IR drop and swelling degree of the CuPc(COOH)_8-SA/mCS BPM were decreased.The BPM was stable in an acid solution(c_(H~+)<8 mol·L~(-1).%在海藻酸钠(SA)中添加八羧基铜酞菁(CuPc(COOH)_8),并分别用Fe~(3+)离子和戊二醛作为交联剂对海藻酸钠一八羧基铜酞菁阳膜层和壳聚糖(CS)阴膜层进行改性,制备了八羧基铜酞菁-海藻酸钠/改性壳聚糖双极膜(CuPe(COOH)_8-SA/BPM).在海藻酸钠中添加八羧基铜酞菁以促进中间层中水的解离.用FTIR、SEM等对制备的CuPc(COOH)_8-SMmCS双极膜进行了表征.作为比对,制备了Fe~(3+)离子改性的Fe-SA/mCS双极膜和二茂铁(Fc)离子改性的Fc-SA/mCS双极膜.实验结果表明,CuPc(COOH)8-SA阳离子交换膜的离子交换容量、H+离子透过率均获得提高.与Fe~(3+)离子改性或二茂铁离子改性的mSA/mCS双极膜相比,CuPc(COOH)_8-SA/mCS双极膜的阻抗、电阻压降(IR降)和溶胀度降低,在H+离子浓度低于8 mol·L~(-1)的酸溶液中具有稳定的工作性能.

  3. DAYA SAING DAN STRATEGI PENGEMBANGAN MINYAK SAWIT DI INDONESIA

    Directory of Open Access Journals (Sweden)

    Jauhar Samudera Nayantakaningtyas

    2012-11-01

    Full Text Available ABSTRACTThe aims of this study were to analyze the competitiveness of Indonesian Crude palm oil CPO products in the international market and to analyze the strategy to improve the competitiveness of Indonesian CPO. The analysis methods used this research were descriptive qualitative methods. The tools used to analyze the competitiveness of palm oil is Revealed Comparative Advantages and Porter Diamond Theory, while the development of the strategy used to determine the SWOT method. Based on the analysis of Porter's Diamond System and revealed comparative advantages, this study concluded that the competitiveness of Indonesian CPO was pretty strong, but it still needed a strategy to strengthen its competitiveness especially on derivative products. Some of the routine strategies that need to be done every year, are the development of the CPO industry human resources through training and innovation activities, paying attention to national and international issues by improving government policies, downstream industrial development and palm oil value-added increase, enhance cooperation with manufacturers from other countries through promotions.Keywords: crude palm oil, competitiveness, strategy, analysis of porter's diamondABSTRAKTujuan penelitian ini adalah menganalisis daya saing produk Crude Palm Oil (CPO Indonesia di pasar internasional dan menganalisis strategi peningkatan daya saing CPO Indonesia. Metode pengolahan dan analisis data yang digunakan dalam penelitian ini adalah metode deskriptif kualitatif. Alat  yang digunakan untuk menganalisis daya saing minyak sawit  adalah Revealed Comparative Advantages dan Teori Berlian Porter, sedangkan untuk mengetahui strategi pengembangan digunakan metode SWOT. Hasil analisis Sistem Berlian Porter dan revealed comparative advantages disimpulkan bahwa daya saing CPO Indonesia cukup kuat, namun masih diperlukan adanya strategi untuk memperkuat terutama pada produk turunan CPO. Strategi rutin yang harus

  4. O Direito à Saúde no Sistema Prisional

    Directory of Open Access Journals (Sweden)

    Gabrielle Jacobi KOLLING

    2013-04-01

    Full Text Available O direito à saúde é objeto de constante análise e, a cada momento, visualiza-se a necessidade de enfrentar diferentes interfaces desse direito fundamental. A complexidade inerente ao sistema social, e, por conseguinte, ao da saúde também, demanda-nos romper com a classificação de cidadãos de primeira e de segunda classe; isso não é republicano, tampouco democrático. A lógica dos desumanizados e excluídos (esquecidos e negligenciados deve ser cambiada pela lógica da inclusão. A análise enfocará a saúde no sistema prisional. Para isso, é condição de possibilidade analisarmos os condicionantes de saúde e os seus efeitos no panorama prisional-sanitário brasileiro. Observaremos, ainda, as ações governamentais para efetivar o direito à saúde no sistema prisional, em especial a Política Pública de Saúde “Plano Nacional de Saúde no Sistema Penitenciário”, que se apresenta como uma tentativa concreta de romper com a negligência do Estado em relação aos integrantes do sistema prisional, aos esquecidos, aos sem voz. ABSTRACT The right to health is matter of constant analysis and, at each moment the need to challenge the different interfaces of this basic right is visible. The innate complexity of the social system and, by consequence to the health system as well, demands that we break with the concept of first and second class citizens; this is not republican or even democratic. The de-humanized and excluded logic (forgotten and neglected must be traded for the inclusion logic. The analysis will focus the prison system’s health. For this is condition of possibility to analyze the health conditions and its effects in the Brazilian prison-sanitary scope. We will also observe the government’s actions to make the right to heath effective in the prison system, in special the Public Health Policy “Nacional Health Plan in the Prison System”, which is presented as a real attempt to break with the state’s negligence

  5. Decreasing Fires in Mediterranean Europe.

    Directory of Open Access Journals (Sweden)

    Marco Turco

    Full Text Available Forest fires are a serious environmental hazard in southern Europe. Quantitative assessment of recent trends in fire statistics is important for assessing the possible shifts induced by climate and other environmental/socioeconomic changes in this area. Here we analyse recent fire trends in Portugal, Spain, southern France, Italy and Greece, building on a homogenized fire database integrating official fire statistics provided by several national/EU agencies. During the period 1985-2011, the total annual burned area (BA displayed a general decreasing trend, with the exception of Portugal, where a heterogeneous signal was found. Considering all countries globally, we found that BA decreased by about 3020 km2 over the 27-year-long study period (i.e. about -66% of the mean historical value. These results are consistent with those obtained on longer time scales when data were available, also yielding predominantly negative trends in Spain and France (1974-2011 and a mixed trend in Portugal (1980-2011. Similar overall results were found for the annual number of fires (NF, which globally decreased by about 12600 in the study period (about -59%, except for Spain where, excluding the provinces along the Mediterranean coast, an upward trend was found for the longer period. We argue that the negative trends can be explained, at least in part, by an increased effort in fire management and prevention after the big fires of the 1980's, while positive trends may be related to recent socioeconomic transformations leading to more hazardous landscape configurations, as well as to the observed warming of recent decades. We stress the importance of fire data homogenization prior to analysis, in order to alleviate spurious effects associated with non-stationarities in the data due to temporal variations in fire detection efforts.

  6. Technologies for Decreasing Mining Losses

    Science.gov (United States)

    Valgma, Ingo; Väizene, Vivika; Kolats, Margit; Saarnak, Martin

    2013-12-01

    In case of stratified deposits like oil shale deposit in Estonia, mining losses depend on mining technologies. Current research focuses on extraction and separation possibilities of mineral resources. Selective mining, selective crushing and separation tests have been performed, showing possibilities of decreasing mining losses. Rock crushing and screening process simulations were used for optimizing rock fractions. In addition mine backfilling, fine separation, and optimized drilling and blasting have been analyzed. All tested methods show potential and depend on mineral usage. Usage in addition depends on the utilization technology. The questions like stability of the material flow and influences of the quality fluctuations to the final yield are raised.

  7. Caso Ouro Fino Saúde Animal Caso Ouro Fino Saúde Animal Ouro Fino Saúde Animal case

    Directory of Open Access Journals (Sweden)

    Bernardo Hauch Ribeiro de Castro

    2012-04-01

    Full Text Available O Caso Ouro Fino Saúde Animal ilustra uma tomada de decisão, pelos executivos da empresa, sobre a entrada em um novo mercado, de vacinas para bovinos. Diante da necessidade de dar um passo maior em direção ao crescimento sustentável, a empresa não poderia deixar de entrar nesse segmento, que representava mais de metade do mercado brasileiro de produtos veterinários. No entanto, era um passo arriscado. A principal questão do caso é avaliar as alternativas de comprar vacinas de terceiros ou produzir internamente suas próprias vacinas. A empresa do caso é a Ouro Fino Saúde Animal, empresa brasileira de produtos veterinários, instalada no Estado de São Paulo, com faturamento de mais de R$ 100 milhões anuais. Os dois principais personagens deste caso são os diretores financeiro e industrial da empresa. A situação passa-se em 2005. Como instrumento de ensino, o caso foi concebido para o ensino de estratégia em cursos de pós-graduação em administração, levando os alunos a avaliar vantagens e desvantagens de cada uma das alternativas. Como objetivo secundário, o caso propicia alguns elementos para uma estimativa da viabilidade financeira da opção de implantar uma nova unidade produtiva e a possibilidade de refletir sobre uma decisão já tomada, de entrada no novo mercado. Por fim, o caso traz uma série de informações sobre o mercado brasileiro e sobre o mercado mundial de produtos veterinários. É possível, com base nestes dados, trabalhar questões ligadas à segmentação e posicionamento da empresa no setor, ficando a critério do professor este tipo de uso.El Caso Ouro Fino Saúde Animal ilustra una toma de decisiones por los ejecutivos de la empresa, a la entrada en un nuevo mercado de las vacunas para el ganado. Ante la necesidad de dar un paso importante hacia el crecimiento sostenible, Ouro Fino Saúde Animal no podía dejar de entrar, ya que representaba más de la mitad del mercado de productos veterinarios

  8. Level of Need for Cognition and Metacognitive Thinking among Undergraduate Kindergarten Female Students at King Sa'ud University in Sa'udi Arabia

    Science.gov (United States)

    Daghistani, Bulquees

    2015-01-01

    This study aims at examining the level of need for cognition and metacognitive thinking among undergraduate kindergarten female students in Education Faculty at King Sa'ud University in Sa'udi Arabia from their own perceptions. Results showed that the need for the cognition level was moderate, but metacognitive thinking level was high. In…

  9. Grupo PET-Saúde/Vigilância em Saúde do Trabalhador Portuário: vivência compartilhada

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Ferreira Queiróz

    2015-12-01

    Full Text Available Trata-se de um relato de vivência compartilhada do Grupo PET-Saúde/ Vigilância em Saúde do Trabalhador Portuário, da Universidade Federal de São Paulo – Unifesp e o Centro de Referência em Saúde do Trabalhador – CEREST, de Santos, SP. O objetivo é descrever a experiência desse grupo tutorial e sua contribuição para o fortalecimento de ações de vigilância em saúde do trabalhador de Santos. O trabalho portuário é a temática do PET-Saúde por sua importância no cenário nacional e por sofrer transformações que geram fatores de agravos à saúde dos trabalhadores. As ações são desenvolvidas englobando o CEREST, os serviços da rede de saúde de Santos e a comunidade portuária santista. Observa-se que os participantes têm compartilhado conhecimento teórico e prático profissional, contribuindo nas ações dos trabalhadores do CEREST e apontando na direção de aproximação com a rede básica de atenção à saúde.

  10. Level of Need for Cognition and Metacognitive Thinking among Undergraduate Kindergarten Female Students at King Sa'ud University in Sa'udi Arabia

    Science.gov (United States)

    Daghistani, Bulquees

    2015-01-01

    This study aims at examining the level of need for cognition and metacognitive thinking among undergraduate kindergarten female students in Education Faculty at King Sa'ud University in Sa'udi Arabia from their own perceptions. Results showed that the need for the cognition level was moderate, but metacognitive thinking level was high. In…

  11. Revista de Saúde Pública in scientific publications on Violence and Health (1967-2015).

    Science.gov (United States)

    Schraiber, Lilia Blima; Barros, Claudia; d'Oliveira, Ana Flávia Pires Lucas; Peres, Maria Fernanda Tourinho

    2016-11-10

    This article retrieved the publications from the Revista de Saúde Pública journal (from 1967 to 2015) on violence and health, on the SciELO and PubMed bases, by searching for the terms "violence", "suicide", "aggression", "bullying", and "external causes", registered in any part of the text. We found 130 articles (the first one published in 1974). We observed: increase of publications over time, with decrease in the last five years; similar production volume in lethal and non-lethal violence; later publication of the latter; few studies in qualitative research; mostly descriptive production; and visualization of the problem more by the acts than by contexts or motivations and aggressors. Social markers were little approached, appearing, from largest to smallest frequency, social class, gender, race/ethnicity, and generation. Human rights were little used and only recently used as analytical framework, connected more to gender than to social class. Although Revista de Saúde Pública has registered the theme in its publications, consolidating it as scientific production line, there is still great explanatory theoretical rarefaction and little intersectionality between violence, social inequalities, and human rights. RESUMO A produção da Revista de Saúde Pública (de 1967 até 2015) sobre violência e saúde foi recuperada nas bases SciELO e PubMed utilizando-se os termos "violência", "suicídio", "agressões", "bullying" e "causas externas", registrados em qualquer parte do texto. Foram encontrados 130 artigos (o primeiro deles publicado em 1974). Constatou-se: aumento das publicações no tempo, com decréscimo nos últimos cinco anos; volume similar de produção em violência letal e não letal; publicação mais tardia desta última; poucos estudos em pesquisa qualitativa; produção majoritariamente descritiva; e visibilização do problema, mais pelos atos que pelos contextos ou motivações e agressores. Os marcadores sociais foram pouco tematizados

  12. Rigidity spectrum of Forbush decrease

    Science.gov (United States)

    Sakakibara, S.; Munakata, K.; Nagashima, K.

    1985-01-01

    Using data from neutron monitors and muon telescopes at surface and underground stations, the average rigidity spectrum of Forbush decreases (Fds) during the period of 1978-1982 were obtained. Thirty eight Ed-events are classified into two groups Hard Fd and Soft Fd according to size of Fd at Sakashita station. It is found that a spectral form of fractional-power type (P to the-gamma sub 1 (P+P sub c) to the -gamma sub2) is more suitable for the present purpose than that of power-exponential type or of power type with an upper limiting rigidity. The best fitted spectrum of fractional-power type is expressed by gamma sub1 = 0.37, gamma sub2 = 0.89 and P subc = 10 GV for Hard Fd and gamma sub1 = 0.77, gamma sub2 = 1.02 and P sub c - 14GV for Soft Fd.

  13. Hyperhomocysteinemia decreases bone blood flow

    Directory of Open Access Journals (Sweden)

    Neetu T

    2011-01-01

    Full Text Available Neetu Tyagi*, Thomas P Vacek*, John T Fleming, Jonathan C Vacek, Suresh C TyagiDepartment of Physiology and Biophysics, School of Medicine, University of Louisville, Louisville, KY, USA *These authors have equal authorshipAbstract: Elevated plasma levels of homocysteine (Hcy, known as hyperhomocysteinemia (HHcy, are associated with osteoporosis. A decrease in bone blood flow is a potential cause of compromised bone mechanical properties. Therefore, we hypothesized that HHcy decreases bone blood flow and biomechanical properties. To test this hypothesis, male Sprague–Dawley rats were treated with Hcy (0.67 g/L in drinking water for 8 weeks. Age-matched rats served as controls. At the end of the treatment period, the rats were anesthetized. Blood samples were collected from experimental or control rats. Biochemical turnover markers (body weight, Hcy, vitamin B12, and folate were measured. Systolic blood pressure was measured from the right carotid artery. Tibia blood flow was measured by laser Doppler flow probe. The results indicated that Hcy levels were significantly higher in the Hcy-treated group than in control rats, whereas vitamin B12 levels were lower in the Hcy-treated group compared with control rats. There was no significant difference in folate concentration and blood pressure in Hcy-treated versus control rats. The tibial blood flow index of the control group was significantly higher (0.78 ± 0.09 flow unit compared with the Hcy-treated group (0.51 ± 0.09. The tibial mass was 1.1 ± 0.1 g in the control group and 0.9 ± 0.1 in the Hcy-treated group. The tibia bone density was unchanged in Hcy-treated rats. These results suggest that Hcy causes a reduction in bone blood flow, which contributes to compromised bone biomechanical properties.Keywords: homocysteine, tibia, bone density

  14. 认识SA8000更要关注ISO26000%Concerned on SA 8000, and Focused on ISO 26000 Further

    Institute of Scientific and Technical Information of China (English)

    张振明

    2006-01-01

    @@ 近年来,在我国形成来势凶猛的SA 8000运动浪潮,特别是2004年初,国内部分媒体的相关报道铺天盖地,各种收费培训班或专题讲座火爆异常,一时间人们谈及社会责任,言必称SA 8000,笔者同年6月参加在深圳举办的SA 8000专题讲座,授课人甚至称SA 8000是国际标准,似乎SA 8000就是社会责任的代名词.

  15. DAYA SAING PRODUK TURUNAN SUSU INDONESIA DI PASAR DUNIA

    Directory of Open Access Journals (Sweden)

    Lina Yanti

    2012-06-01

    Full Text Available ABSTRACTThis research purposes were (1 to measures the competitiveness of Indonesian milk derivative product in international market based on its comparative advantage, (2 to analyze the dynamics of Indonesian milk and also to analyze the commodity’s competitive position in the international market through its dynamic export product performance, (3 to analyze dominant factors that influencing Indonesian dairy export growth based on constant market share analysis. The analysis methods used to measure the competitiveness of Indonesian milk in this research are based on revealed comparative advantage analysis, Export product dynamic analysis (EPD, and constant market share analysis. The result from RCA showed that the Indonesian milk derivative products which are Milk not concentrated nor sweetened 1–6% fat (HS 040120, Milk and cream, concentrated or sweetened (HS 0402 and Buttermilk, curdled milk, cream, kephir, etc (HS 040390 do not have comparative advantage but for Milk and cream powder unsweetened > 1,5%  fat (HS 040221, Milk and cream nes sweetened or concentrated (HS 040299 and Cereal, flour, starch, milk preparations and products (HS19 have comparative advantage. The EPD found that all Indonesian milk derivative products are included in the Rising Star position. The result test using CMS analysis concluded that the most significant factor which affect the export growth for Indonesian HS 040390 and HS 0402 derivative products are the import growth effect, HS 19 is mainly dominated by commodity composition effect, and the export growth for the rest derivative products are dominated with the competitiveness effect. Therefore, it needs to be implemented efforts to enhance the competitiveness of dairy derived products IndonesiaKeywords: milk, competitiveness, revealed comparative advantage (RCA, export product dynamic (EPD, constant market share analysis (CMSAABSTRAKPenelitian ini bertujuan (1 menganalisis daya saing komoditas susu

  16. Desigualdades socioeconômicas na saúde

    Directory of Open Access Journals (Sweden)

    Diaz Maria Dolores M.

    2003-01-01

    Full Text Available Este artigo analisa as desigualdades socioeconômicas na área da saúde no Brasil, por meio da mensuração de índice de concentração para a variável autoavaliação do estado de saúde. Utilizou-se a base de dados originada pela Pesquisa Domiciliar sobre Padrões de Vida - PPV - realizada pelo IBGE no período de março/1996 a março/1997, em convênio com o Banco Mundial. Entre os principais resultados, deve-se destacar a constatação de que existem diferenças estatisticamente significativas entre índices calculados a partir de distintas variáveis caracterizadoras do nível socioeconômico dos indivíduos. Neste caso, em particular, os indicadores calculados a partir da classificação baseada na variável renda indicou, sistematicamente, a presença de desigualdades na saúde ligeiramente superiores àquelas identificadas a partir da utilização das despesas familiares. Constatou-se, ainda, que os resultados obtidos são bastante robustos em relação às distintas ponderações utilizadas na construção das escalas de equivalência entre os indivíduos. Todas as simulações realizadas revelaram a presença de desigualdades que favorecem os indivíduos pertencentes às camadas mais elevadas das escalas socioeconômicas adotadas.

  17. Indutores de mudança na formação dos profissionais de saúde: pró-saúde e PET-SAÚDE

    Directory of Open Access Journals (Sweden)

    Isabel Cristina Luck Coelho de Holanda

    2012-12-01

    Full Text Available Na última década, a formação de profissionais de saúde tem sido reformulada no intuito de atender às necessidades de saúde das pessoas e não somente suas demandas. Políticas públicas de educação e saúde promovidas em parceria com o Ministério da Educação (MEC e o Ministério da Saúde (MS sinalizaram uma reforma curricular imprescindível nos cursos de graduação da área de saúde(1,2 .A formalização dessa mudança teve seu marco com a instituição das Diretrizes Curriculares Nacionais (DCN para os cursos de graduação no campo da saúde. Todos os instrumentos vigentes orientam a construção do perfil dos egressos por meio de um modelo acadêmico e profissional em que atitudes, habilidades e conteúdos almejem a formação generalista, humanista, crítica e reflexiva, com competência para a atuação em todos os níveis de atenção à saúde, embasando suas condutas nos rigores científico e ético(3-7.Não por acaso, todos os documentos ressaltam os mesmos campos de competência a serem desenvolvidos durante a formação dos diferentes profissionais da área: atenção à saúde, tomada de decisões, comunicação, liderança, educação permanente, administração e gerenciamento(3-7, pois a saúde, como um complexo campo de atuação, não consegue imprimir ações resolutivas através de uma única disciplina ou área do saber.A proposta preconizada pelo MEC e MS de produzir transformação nos processos de formação, trabalho e ampliação da cobertura dos serviços tem sido concretizada mediante programas indutores, como o Programa Nacional de Reorientação da Formação Profissional em Saúde (Pró-Saúde e o Programa de Educação pelo Trabalho para a Saúde (PET–Saúde(1,2.O Pró-Saúde, implementado no país desde 2005 através da divulgação de editais, pretende sintonizar a formação em saúde com as necessidades sociais, considerando as dimensões históricas, culturais e econômicas da população(8

  18. SA8000基本知识解读

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    1SA8000的含义 社会责任国际标准体系(Social Accountability 8000 Intemational standard,简称SAS000)是一种基于国际劳工组织宪章(ILO宪章)、联合国儿童权利公约、世界人权宣言而制定的,以保护劳动环境和条件、劳工权利等为主要内容的管理标准体系。

  19. SA8000基础知识解读

    Institute of Scientific and Technical Information of China (English)

    黎友焕

    2004-01-01

    社会责任国际标准体系(Social Ac-countability 8000 International slandard,简称SA8000)是一种基于国际劳工组织宪章(ILO宪章),联台国儿童权利公约,世界人权宣言而制定的.以保护劳动环境和条件、劳工权利等为主要内容的管理标准体系。

  20. Programa de Monitoreo Ambiental para Cementos Cienfuegos S.A

    OpenAIRE

    Mario A. Curbelo Hernández; José Luis Romero Cabrera; Henrry Ricardo Cabrera

    2012-01-01

    La presente investigación se realizó en las instalaciones de Cementos Cienfuegos S.A. Cuba, con el objetivo de diseñar e implementar un programa de monitoreo de las variables de concentración de polvo en aire, tasa de deposición y concentración de metales pesados, para la valoración de la calidad del aire a partir de índices establecidos en la norma NC ISO 111:2004. Este programa incluye también el monitoreo de los parámetr...

  1. Composition and Value of waste in landfills in SA

    CSIR Research Space (South Africa)

    Oelofse, Suzanna HH

    2015-09-01

    Full Text Available stream_source_info Oelofse1_2015.pdf.txt stream_content_type text/plain stream_size 3221 Content-Encoding UTF-8 stream_name Oelofse1_2015.pdf.txt Content-Type text/plain; charset=UTF-8 1 Composition and Value of waste... in landfills in SA German Chamber of Business From Mining to Urban Mining 16 September 2015 IFAT Environmental Technology Forum Africa 2015 by Prof Suzan Oelofse Research Group Leader: Waste for Development Competency Area: Solutions for a Green...

  2. Caso Molinos Roa S.A.: historia empresarial

    OpenAIRE

    2013-01-01

    Durante su trayectoria empresarial Molinos Roa S.A. ha enfocado sus estrategias gerenciales al logro de objetivos basados en principios y valores corporativos, por lo anterior el documento presenta el estudio de la historia empresarial, donde se da un reflejo de la pujanza y la visión de gestores y administradores. Sin embargo se analiza el impacto que trae en el negocio de la industria arrocera la firma de los tratados de libre comercio, así como el contrabando desmedido de este cereal y el ...

  3. Impacto de ingrediente funcional sobre a saúde intestinal

    OpenAIRE

    Gabriela Santos Souza

    2014-01-01

    O microbioma intestinal influencia de maneira positiva e/ou negativa o bem estar e o equilíbrio da saúde no organismo humano. Carboidratos não disponíveis, tais como frutanos e amido resistente (encontrado na farinha de banana verde), são ingredientes funcionais que resistem à digestão, estimulam o peristaltismo e o trânsito intestinal, e podem aumentar população de bactérias benéficas. O presente estudo teve como objetivo avaliar o impacto do consumo regular e descontinuado (durante 6 semana...

  4. The rebranding of Electrica Soluziona SA - a case study

    Directory of Open Access Journals (Sweden)

    Monica GOMOESCU

    2016-07-01

    Full Text Available This article intends to present the design and implementation stages of a rebranding campaign that took place in the Electrica Soluziona SA company. The rebranding targets a company that provides consultancy services and software solutions and that underwent a change of its main shareholders structure, as it was taken over by Indra Group. After being taken over by Indra, Electrica Soluziona has considerably enlarged its product portfolio and the market segments targeted. Thus, it was mandatory to define a complex rebranding campaign. The rebranding process was not determined only by the broadening of activity, but also by the change of visual identity elements, along with the desire of repositioning.

  5. Genética, saúde e sociedade

    OpenAIRE

    2013-01-01

    O documentário apresenta quatro projetos de pesquisa realizados pelo Instituto de GenéticaMédica Populacional (INAGEMP) em diferentes regiões do país.As atividades mencionadasrepresentam uma amostra do trabalho do INAGEMP, que se estruturou de modo a colocar agenética médica populacional na prática ao associar pesquisa e atenção em saúde parapopulações afetadas por doenças com forte componente genético em sua etiologia.

  6. Significado da massagem com aromaterapia em saúde mental

    OpenAIRE

    Domingos,Thiago da Silva; Braga,Eliana Mara

    2014-01-01

    Objetivo Compreender o significado da intervenção de massagem com aromaterapia em saúde mental para o usuário durante a internação psiquiátrica.Métodos Pesquisa qualitativa que incluiu 22 participantes com diagnóstico de Transtornos de Personalidade internados em unidade psiquiátrica de um hospital geral. Foram realizadas entrevistas semiestruturadas, com uma questão norteadora aos participantes, os quais se submeteram a intervenç...

  7. Role of dioxygenase α-DOX2 and SA in basal response and in hexanoic acid-induced resistance of tomato (Solanum lycopersicum) plants against Botrytis cinerea.

    Science.gov (United States)

    Angulo, Carlos; de la O Leyva, María; Finiti, Ivan; López-Cruz, Jaime; Fernández-Crespo, Emma; García-Agustín, Pilar; González-Bosch, Carmen

    2015-03-01

    Resistance of tomato (Solanum Lycopersicum) to the fungal pathogen Botrytis cinerea requires complex interplay between hormonal signalling. In this study, we explored the involvement of new oxylipins in the tomato basal and induced response to this necrotroph through the functional analysis of the tomato α-dioxygenase2 (α-DOX2)-deficient mutant divaricata. We also investigated the role of SA in the defence response against this necrotrophic fungus using SA-deficient tomato nahG plants. The plants lacking dioxigenase α-DOX2, which catalyses oxylipins production from fatty acids, were more susceptible to Botrytis, and hexanoic acid-induced resistance (Hx-IR) was impaired; hence α-DOX2 is required for both tomato defence and the enhanced protection conferred by natural inducer hexanoic acid (Hx) against B. cinerea. The divaricata plants accumulated less pathogen-induced callose and presented lower levels of jasmonic acid (JA) and 12-oxo-phytodienoic acid (OPDA) upon infection if compared to the wild type. Glutathion-S-transferase (GST) gene expression decreased and ROS production significantly increased in Botrytis-infected divaricata plants. These results indicate that absence of α-DOX2 influences the hormonal changes, oxidative burst and callose deposition that occur upon Botrytis infection in tomato. The study of SA-deficient nahG tomato plants showed that the plants with low SA levels displayed increased resistance to Botrytis, but were unable to display Hx-IR. This supports the involvement of SA in Hx-IR. NaghG plants displayed reduced callose and ROS accumulation upon infection and an increased GST expression. This reflects a positive relationship between SA and these defensive mechanisms in tomato. Finally, Hx boosted the pathogen-induced callose in nahG plants, suggesting that this priming mechanism is SA-independent. Our results support the involvement of the oxylipins pathway and SA in tomato response to Botrytis, probably through complex crosstalk of

  8. Percepção do processo saúde-doença: significados e valores da educação em saúde

    Directory of Open Access Journals (Sweden)

    Ana Maria Chagas Sette Câmara

    Full Text Available A relevância sociológica do estudo das representações sociais do processo saúde-doença está no fato de que elas fundamentam práticas e atitudes dos seus atores, assim como as relações que eles estabelecem com o seu contexto social e com aquilo que lhes acontece. O problema dessa pesquisa consiste em conhecer as representações sociais do processo saúde-doença dos profissionais do PSF, considerando que esse conhecimento pode ser fundamental para o desenvolvimento de práticas educativas em saúde. A abordagem metodológica desta pesquisa foi qualitativa, tendo por base as representações sociais dos profissionais de apoio e das equipes de saúde da família do Centro de Saúde Milionários, em Belo Horizonte, Minas Gerais. Para a coleta de dados, foi utilizada entrevista individual semi-estruturada abordando os seguintes aspectos: processo saúde-doença; educação em saúde; e barreiras ou dificuldades para prescrição/adoção de hábitos saudáveis. Os dados foram analisados pela técnica de análise de conteúdo, a partir das categorias: dimensões do processo saúde-doença; barreiras ou dificuldades para adoção de hábitos saudáveis; e significados e valores da educação em saúde. Os dados apontam que há necessidade de modificações conceituais na formação permanente desses profissionais e da inclusão do enfoque coletivo, abordando o conceito ampliado de saúde com seus determinantes sociais e contextuais. Faz-se necessária também a busca de novas metodologias de educação em saúde, para que os profissionais do PSF possam ir além da informação e consigam a ressignificação dos conceitos do processo saúde-doença, podendo de fato estabelecer novas práticas e novos processos de trabalho em saúde.

  9. Steroid hormones affect binding of the sigma ligand {sup 11}C-SA4503 in tumour cells and tumour-bearing rats

    Energy Technology Data Exchange (ETDEWEB)

    Rybczynska, Anna A.; Elsinga, Philip H.; Sijbesma, Jurgen W.; Jong, Johan R. de; Vries, Erik F. de; Dierckx, Rudi A.; Waarde, Aren van [University of Groningen, Nuclear Medicine and Molecular Imaging, University of Groningen Medical Center, Groningen (Netherlands); Ishiwata, Kiichi [Tokyo Metropolitan Institute of Gerontology, Positron Medical Center, Tokyo (Japan)

    2009-07-15

    Sigma receptors are implicated in memory and cognitive functions, drug addiction, depression and schizophrenia. In addition, sigma receptors are strongly overexpressed in many tumours. Although the natural ligands are still unknown, steroid hormones are potential candidates. Here, we examined changes in binding of the sigma-1 agonist {sup 11}C-SA4503 in C6 glioma cells and in living rats after modification of endogenous steroid levels. {sup 11}C-SA4503 binding was assessed in C6 monolayers by gamma counting and in anaesthetized rats by microPET scanning. C6 cells were either repeatedly washed and incubated in steroid-free medium or exposed to five kinds of exogenous steroids (1 h or 5 min before tracer addition, respectively). Tumour-bearing male rats were repeatedly treated with pentobarbital (a condition known to result in reduction of endogenous steroid levels) or injected with progesterone. Binding of {sup 11}C-SA4503 to C6 cells was increased ({proportional_to}50%) upon removal and decreased ({proportional_to}60%) upon addition of steroid hormones (rank order of potency: progesterone > allopregnanolone = testosterone = androstanolone > dehydroepiandrosterone-3-sulphate, IC{sub 50} progesterone 33 nM). Intraperitoneally administered progesterone reduced tumour uptake and tumour-to-muscle contrast (36%). Repeated treatment of animals with pentobarbital increased the PET standardized uptake value of {sup 11}C-SA4503 in tumour (16%) and brain (27%), whereas the kinetics of blood pool radioactivity was unaffected. The binding of {sup 11}C-SA4503 is sensitive to steroid competition. Since not only increases but also decreases of steroid levels affect ligand binding, a considerable fraction of the sigma-1 receptor population in cultured tumour cells or tumour-bearing animals is normally occupied by endogenous steroids. (orig.)

  10. Psicologia da saúde crítica no contexto hospitalar

    Directory of Open Access Journals (Sweden)

    Denis Barros de Carvalho

    Full Text Available O texto apresenta uma discussão sobre a Psicologia da saúde no contexto hospitalar a partir de uma perspectiva histórica e ética, mostrando como o desenvolvimento desse campo foi caracterizado pelo surgimento de duas perspectivas: a Psicologia da saúde tradicional e a Psicologia da saúde crítica. O modelo de quatro abordagens à Psicologia da saúde é apresentado e reformulado com a inclusão do conceito de Psicologia sanitária, e a prática em Psicologia da saúde é discutida à luz do conceito de reflexividade. Por fim, alguns questionamentos derivados da Psicologia da saúde crítica são feitos à prática do psicólogo no contexto hospitalar.

  11. Cuidados em saúde entre portadores de diabetes mellitus autorreferido no Brasil, Pesquisa Nacional de Saúde, 2013

    Directory of Open Access Journals (Sweden)

    Deborah Carvalho Malta

    2015-12-01

    Full Text Available Resumo: Objetivo: Descrever medidas do cuidado assistencial destinadas ao paciente com diabetes mellitus autorreferido no Brasil. Métodos: Foram utilizados dados da Pesquisa Nacional de Saúde(2013, estudo transversal de base populacional, referentes ao cuidado em saúde com o diabetes mellitus autorreferido, quanto ao uso de serviços de saúde e acesso a medicamentos. Resultados: A prevalência de diabetes mellitus autorreferido foi de 6,2%, e 11,5% da população nunca fez uma glicemia na vida. Dos adultos que referiram diabetes mellitus , 80,2% tomaram medicamentos nas duas semanas anteriores à entrevista, 57,4% usaram o Programa Farmácia Popular, 73,2% receberam assistência médica e 47,1% realizaram o atendimento nas Unidades Básicas de Saúde. Em 65,2%, o médico que atendeu na última consulta era o mesmo das consultas anteriores, 95,3% dos pacientes conseguiram realizar os exames complementares solicitados e 83,3% conseguiram fazer as consultas com o médico especialista. A avaliação de pés e olhos foi relatada por 35,6 e 29,1% dos portadores de diabetes mellitus , respectivamente. Relataram internação hospitalar por causa do diabetes ou de alguma complicação 13,4% dos adultos, e outros 7,0% relataram limitações nas atividades diárias. Em geral, mulheres, assim como a população mais idosa, de maior escolaridade, brancos e residentes nas regiões Sul e Sudeste, tiveram maior prevalência da doença e maior acesso aos serviços, medicamentos e consultas. Discussão: Os cuidados aos portadores de diabetes foram recebidos de forma adequada, na maioria dos casos, o que é essencial para manter a qualidade de vida dos pacientes e prevenir desfechos mais graves.

  12. Mineralization of bone-related SaOS-2 cells under physiological hypoxic conditions.

    Science.gov (United States)

    Müller, Werner E G; Schröder, Heinz C; Tolba, Emad; Diehl-Seifert, Bärbel; Wang, Xiaohong

    2016-01-01

    Inorganic polyphosphate (polyP) is a physiological energy-rich polymer with multiple phosphoric anhydride bonds. In cells such as bone-forming osteoblasts, glycolysis is the main pathway generating metabolic energy in the form of ATP. In the present study, we show that, under hypoxic culture conditions, the growth/viability of osteoblast-like SaOS-2 cells is not impaired. The addition of polyP to those cells, administered as amorphous calcium polyP nanoparticles (aCa-polyP-NP; approximate size 100 nm), significantly increased the proliferation of the cells. In the presence of polyP, the cells produce significant levels of lactate, the end product of anaerobic glycolysis. Under those conditions, an eight-fold increase in the steady-state level of the membrane-associated carbonic anhydrase IX is found, as well as a six-fold induction of the hypoxia-inducible factor 1. Consequently, biomineral formation onto the SaOS-2 cells decreases under low oxygen tension. If the polyP nanoparticles are added to the cells, the degree of mineralization is enhanced. These changes had been measured also in human mesenchymal stem cells. The assumption that the bicarbonate, generated by the carbonic anhydrase in the presence of polyP under low oxygen, is deposited as a constituent of the bioseeds formed during initial hydroxyapatite formation is corroborated by the identification of carbon besides of calcium, oxygen and phosphorus in the initial biomineral deposit onto the cells using the sensitive technology of high-resolution energy dispersive spectrometry mapping. Based on these data, we conclude that polyP is required for the supply of metabolic energy during bone mineral formation under physiological, hypoxic conditions, acting as a 'metabolic fuel' for the cells to grow.

  13. Enredando lutas cotidianas: dispositivos de saúde pela cidade

    Directory of Open Access Journals (Sweden)

    Arielle Rocha de Oliveira Silva

    2009-12-01

    Full Text Available A partir das experiências de intervenções em serviços públicos de saúde e em outros setores da cidade, este trabalho afirma uma prática oficineira descentralizada capaz de compor na construção de redes sociais, servindo de instrumento de análise e possibilitando a invenção de modos de vida e afirmação de singularidades. As intervenções na cidade abrem caminhos para mudanças nos processos em curso e contribuem para a produção de saúde/cidadania por meio da potência conectiva das lutas. O enlace dessas temáticas visa ampliar o campo problemático da atenção psicossocial e fortalecer a luta antimanicomial no Espírito Santo, apostando em novas formas de atuação.

  14. Altera – Technical update, presented by Sascoholz SA

    CERN Multimedia

    FI Department

    2008-01-01

    Thursday 28 August 2008 From 9h00 to 12h00 (welcome at 08h45) in Room B (Main Building 61/1-009) SascoHolz SA cordially invites you to an informative and interesting technical update on the latest Altera FPGA developments. Introducing Altera’s Stratix IV Device Family 40-nm high-performance, high-end FPGAs with 8.5-Gbps transceiver option The Stratix IV FPGA family gives you the highest density, highest system performance, and the lowest power available in an FPGA, enabling innovation without compromise. Speaker Ole Horn, FAE Sascoholz Agenda Altera Stratix IV Device FamilyIntroduction Logic Fabric Architecture DSP Blocks Tri-Matrix Memory PLL and Clock Networks Design Security I/O Connectivity High-Speed Transceiver Low Power Consumption Language: English As a member of the globally active distribution group, Arrow Electronics, SascoHolz SA does more than just following the concepts of classic broadline distributors. In fact, we offer a depth of service throughou...

  15. New Young Star Candidates in CG4 and Sa101

    CERN Document Server

    Rebull, L M; Hoette, V; Kim, J S; Laine, S; Foster, M; Laher, R; Legassie, M; Mallory, C R; McCarron, K; Sherry, W H

    2011-01-01

    The CG4 and Sa101 regions together cover a region of ~0.5 square degree in the vicinity of a "cometary globule" that is part of the Gum Nebula. There are seven previously identified young stars in this region; we have searched for new young stars using mid- and far-infrared data (3.6 to 70 microns) from the Spitzer Space Telescope, combined with ground-based optical data and near-infrared data from the Two-Micron All-Sky Survey (2MASS). We find infrared excesses in all 6 of the previously identified young stars in our maps, and we identify 16 more candidate young stars based on apparent infrared excesses. Most (73%) of the new young stars are Class II objects. There is a tighter grouping of young stars and young star candidates in the Sa101 region, in contrast to the CG4 region, where there are fewer young stars and young star candidates, and they are more dispersed. Few likely young objects are found in the "fingers" of the dust being disturbed by the ionization front from the heart of the Gum Nebula.

  16. Magnetic field measurements of JT-60SA CS model coil

    Energy Technology Data Exchange (ETDEWEB)

    Obana, Tetsuhiro, E-mail: obana.tetsuhiro@LHD.nifs.ac.jp [National Institute for Fusion Science, 322-6 Oroshi, Toki, Gifu 509-5292 (Japan); Takahata, Kazuya; Hamaguchi, Shinji; Chikaraishi, Hirotaka; Mito, Toshiyuki; Imagawa, Shinsaku [National Institute for Fusion Science, 322-6 Oroshi, Toki, Gifu 509-5292 (Japan); Kizu, Kaname; Murakami, Haruyuki; Natsume, Kyohei; Yoshida, Kiyoshi [Japan Atomic Energy Agency, 801-1 Mukoyama, Naka, Ibaraki 311-0193 (Japan)

    2015-01-15

    Highlights: • Magnetic fields of the JT-60SA CS model coil were measured. • While the coil current was held constant at 20 kA, magnetic fields varied slightly with several different long time constants. • We investigated coils consisting of CIC conductors and having long time constants. - Abstract: In a cold test of the JT-60SA CS model coil, which has a quad-pancake configuration consisting of a Nb{sub 3}Sn cable-in-conduit (CIC) conductor, magnetic fields were measured using Hall sensors. For a holding coil current of 20 kA, measured magnetic fields varied slightly with long time constants in the range 17–571 s, which was much longer than the time constant derived from a measurement using a short straight sample. To validate the measurements, the magnetic fields of the model coil were calculated using a computational model representing the positions of Nb{sub 3}Sn strands inside the CIC conductor. The calculated results were in good agreement with the measurements. Consequently, the validity of the magnetic field measurements was confirmed. Next, we investigated other coils consisting of CIC conductors and having long time constants. The only commonality among the coils was the use of CIC conductors. At present, there is no obvious way to prevent generation of such magnetic-field variations with long time constants.

  17. Finite element analysis of (SA) mechanoreceptors in tactile sensing application

    Science.gov (United States)

    N, Syamimi; Yahud, S.

    2015-05-01

    This paper addresses the structural design of a fingertip model in order to analyse the sensory function of slow adapting (SA) mechanoreceptors by using the finite element analysis (FEA) method. A biologically inspired tactile sensor was designed to mimic a similar response of the human mechanoreceptors in the human glabrous skin. The simulation work was done by using COMSOL Multiphysics. The artificial skin was modelled as a solid square block of silicone elastomer with a semi cylinder protrusion on top. It was modelled as a nearly incompressible and linear hyperelastic material defined by Neo Hookean constitutive law. The sensing element on the other hand was modelled by using constantan alloy mimicking the SA1 receptor. Boundary loads of 1 N/m² to 4 N/m² with the increment of 1 N/m² were applied to the top surface of the protrusion in z and x-direction for normal and shear stress, respectively. The epidermal model base was constrained to maintain the same boundary conditions throughout all simulations. The changes of length experienced by the sensing element were calculated. The simulations result in terms of strain was identified. The simulated result was plotted in terms of sensing element strain against the boundary load and the graph should produce a linear response.

  18. Reflexões sobre o papel das unidades de economia da saúde no âmbito de sistemas nacionais de saúde

    Directory of Open Access Journals (Sweden)

    Fabiola Sulpino Vieira

    Full Text Available Resumo O objetivo deste texto é apresentar algumas reflexões sobre o papel e a relevância das unidades de economia da saúde (UES no âmbito de sistemas nacionais de saúde. Parte-se dos fundamentos deste campo de conhecimento e de sua contribuição à gestão em saúde para tecer considerações sobre o papel e a relevância dessas unidades. São discutidas questões como o conhecimento dos gestores da saúde e lideranças políticas sobre economia da saúde, a necessidade de atuação transversal da UES na organização e de corpo técnico multidisciplinar qualificado, assim como a natureza técnica e política do trabalho, as possibilidades e limites para sua atuação, seus aspectos e a relação com grupos externos de pesquisa. Por fim, ressalta-se que o trabalho de equipe interna especializada em economia da saúde constitui um dos meios para qualificar o processo de tomada de decisão nas organizações públicas de saúde, visando à otimização do uso dos recursos e à equidade em sua alocação.

  19. Contribuições do PET-Saúde/Redes de Atenção Psicossocial à Saúde da Família

    Directory of Open Access Journals (Sweden)

    Larissa de Almeida Rézio

    2015-12-01

    Full Text Available O estudo objetivou analisar as contribuições do Programa de Educação pelo Trabalho para a Saúde – PET-Saúde/Redes de Atenção Psicossocial à Saúde - a uma unidade de Estratégia de Saúde da Família em Cuiabá, Mato Grosso, Brasil. Trata-se de um estudo descritivo, com abordagem qualitativa, utilizando entrevista com cinco profissionais de saúde e dois acadêmicos bolsistas e registros de atividades realizadas no serviço. À luz da análise de conteúdo temática, sistematizamos quatro subtemas: “articulação da rede”; “qualificação da assistência à saúde mental”, “melhora do conhecimento dos profissionais” e “superação de estigmas sobre o paciente em sofrimento psíquico”. Houve sensibilização dos profissionais e bolsistas sobre a importância do acompanhamento das pessoas com sofrimento mental na atenção básica, em articulação com serviços de saúde mental.

  20. Obesity Decreases Perioperative Tissue Oxygenation

    Science.gov (United States)

    Kabon, Barbara; Nagele, Angelika; Reddy, Dayakar; Eagon, Chris; Fleshman, James W.; Sessler, Daniel I.; Kurz, Andrea

    2005-01-01

    Background: Obesity is an important risk factor for surgical site infections. The incidence of surgical wound infections is directly related to tissue perfusion and oxygenation. Fat tissue mass expands without a concomitant increase in blood flow per cell, which might result in a relative hypoperfusion with decreased tissue oxygenation. Consequently, we tested the hypotheses that perioperative tissue oxygen tension is reduced in obese surgical patients. Furthermore, we compared the effect of supplemental oxygen administration on tissue oxygenation in obese and non-obese patients. Methods: Forty-six patients undergoing major abdominal surgery were assigned to one of two groups according to their body mass index (BMI): BMI < 30 kg/m2 (non-obese) and BMI ≥ 30 kg/m2 (obese). Intraoperative oxygen administration was adjusted to arterial oxygen tensions of ≈150 mmHg and ≈300 mmHg in random order. Anesthesia technique and perioperative fluid management were standardized. Subcutaneous tissue oxygen tension was measured with a polarographic electrode positioned within a subcutaneous tonometer in the lateral upper arm during surgery, in the recovery room, and on the first postoperative day. Postoperative tissue oxygen was also measured adjacent to the wound. Data were compared with unpaired two tailed t-tests and Wilcoxon rank-sum tests; P < 0.05 was considered statistically significant. Results: Intraoperative subcutaneous tissue oxygen tension was significantly less in the obese patients at baseline (36 vs. 57 mmHg, P = 0.002) and with supplemental oxygen administration (47 vs. 76 mmHg, P = 0.014). Immediate postoperative tissue oxygen tension was also significantly less in subcutaneous tissue of the upper arm (43 vs. 54 mmHg, P = 0.011) as well as near the incision (42 vs. 62 mmHg, P = 0.012) in obese patients. In contrast, tissue oxygen tension was comparable in each group on the first postoperative morning. Conclusion: Wound and tissue hypoxia were common in obese

  1. Joint Service Aircrew Mask (JSAM) - Strategic Aircraft (SA): Noise Attenuation Performance

    Science.gov (United States)

    2015-08-25

    AFRL-RH-WP-TP-2015-0026 Joint Service Aircrew Mask (JSAM) – Strategic Aircraft (SA): Noise Attenuation Performance...2015 – July 2015 4. TITLE AND SUBTITLE Joint Service Aircrew Mask (JSAM) – Strategic Aircraft (SA): Noise Attenuation Performance 5a. CONTRACT...determine if the Joint Service Aircrew Mask (JSAM) –Strategic Aircraft (SA) performance specification requirements were being met. The requirement stated

  2. ANALISIS DAN MODEL STRATEGI PENINGKATAN DAYA SAING PRODUK EDAMAME BEKU

    Directory of Open Access Journals (Sweden)

    Sandryas Alief Kurniasanti

    2015-03-01

    penelitian ini adalah untuk menganalisis daya saing dan merumuskan prioritas alternatif strategi peningkatan daya saing produk edamame beku di PT MT 27. Metode yang digunakan dalam penelitian ini adalah Revealed Comparative Advantage untuk mengetahui kinerja ekspor dari produk edamame beku di pasar dunia, kemudian menganalisis faktor persaingan dengan menggunakan Diamond Porter’s Theory. Alternatif strategi dihasilkan dari analisis SWOT dan ditentukan prioritasnya dengan menggunakan analytical hierarchy process dari satu narasumber ahli. Hasil penelitian menunjukkan bahwa prioritas alternatif strategi peningkatan daya saing produk edamame beku PT MT 27 secara berurutan meliputi: (1 diversifikasi pasar, (2 diversifikasi produk, (3 meningkatkan kerjasama luar negeri, (4 pengembangan divisi Research and Development, (5 mengembangkan program Corporate Social Responsibility, (6 pengelolaan keuangan secara baik dan benar, serta (7 mengembangkan areal pertanian yang berbasis rumah kaca untuk menghindari cuaca buruk karena beriklim tropis. Implikasi Manajerial dari penelitian ini adalah mengembangkan pasar yang sudah ada, dan mengembangkan jenis produk yang diproduksi untuk memenuhi selera pasar ekspor dan juga penghematan biaya produksi. Kata kunci: daya saing, edamame beku, Mitratani Dua Tujuh, strategi daya saing

  3. SaOS-2 cell response to macro-porous boron-incorporated TiO2 coating prepared by micro-arc oxidation on titanium.

    Science.gov (United States)

    Huang, Qianli; Elkhooly, Tarek A; Liu, Xujie; Zhang, Ranran; Yang, Xing; Shen, Zhijian; Feng, Qingling

    2016-10-01

    The aims of the present study were to develop boron-incorporated TiO2 coating (B-TiO2 coating) through micro-arc oxidation (MAO) and subsequently evaluate the effect of boron incorporation on the in vitro biological performance of the coatings. The physicochemical properties of B-TiO2 coating and its response to osteoblast like cells (SaOS-2) were investigated compared to the control group without boron (TiO2 coating). The morphological and X-ray diffraction results showed that both coatings exhibited similar surface topography and phase composition, respectively. However, the incorporation of B led to an enhancement in the surface hydrophilicity of B-TiO2 coating. The spreading of SaOS-2 cells on B-TiO2 coating was faster than that on TiO2 coating. The proliferation rate of SaOS-2 cells cultured on B-TiO2 decreased after 5days of culture compared to that on TiO2 coating. SaOS-2 cells cultured on B-TiO2 coating exhibited an enhanced alkaline phosphatase (ALP) activity, Collagen I synthesis and in vitro mineralization compared to those on TiO2 coating. The present findings suggest that B-TiO2 coating is a promising candidate surface for orthopedic implants.

  4. Cobertura de Planos de Saúde na população brasileira, segundo a Pesquisa Nacional de Saúde, 2013

    Directory of Open Access Journals (Sweden)

    Deborah Carvalho Malta

    Full Text Available Resumo O objetivo do estudo é descrever as coberturas de planos de saúde no Brasil, conforme características sociodemográficas, a partir dos dados da Pesquisa Nacional de Saúde, realizada em 2013, e comparar com dados administrativos da Agencia Nacional de Saúde Suplementar para este mesmo ano. Foram utilizados dados da Pesquisa Nacional de Saúde e do Sistema de Informações de Beneficiários da Agência Nacional de Saúde para o ano de 2013. Foi descrita a cobertura dos planos de saúde segundo estratificação para Brasil, urbano/rural, Grandes Regiões, Unidades da Federação e Capitais, sexo, faixa etária, nível de instrução, posição na força de trabalho, cor/raça e estado de saúde. Como resultado, a proporção de pessoas que referiu ter algum plano de saúde no Brasil foi de 27,9% (IC95%: 27,1-28,8. Foi observada diferença significativa com relação a nível de instrução, sendo maior para os que referiram ter educação superior completa (68,8% IC95%: 67,2-70,4 e para aqueles que referiram ter ocupação (32,5% IC95%: 31,5-33,5. O aumento da cobertura de planos de saúde na população brasileira reflete a melhora da oferta de empregos e do crescimento da economia do país na época.

  5. Nas Trilhas (desconhecidas da saúde: a política pública de saúde para os homens no Brasil.

    Directory of Open Access Journals (Sweden)

    Marlene Neves Strey

    2012-11-01

    Full Text Available Neste estudo abordamos as diferentes formas de masculinidades e sua relação com a saúde, contempladas na Política de Atenção Integral à saúde do Homem (PNAISH implementada no Brasil no ano de 2009. Através de uma análise documental dessa política, pretendemos compreender os discursos masculinos que nela estão, bem como analisar a relação entre o discurso da política e as diferentes formas de produção de saúde. Devido a não estarem acostumados a se expor a um profissional de saúde, os homens sentem-se envergonhados, e além disso, atribuem sua baixa procura aos serviços de saúde, à falta de cuidados e escuta adequadas com um olhar de gênero que possa dar conta de suas demandas. Essa nova política de saúde para os homens criada no Brasil pretende atuar de maneira a atingir uma mudança cultural, que possibilite aos homens maior cuidado com sua saúde. Além disso, olhar para os modos de produção de masculinidades nos dias atuais e seus discursos sobre saúde é estar atento aos comportamentos que, devido à herança pautada nas diferenças entre os sexos, contribui para obstaculizar o acesso dos homens aos serviços de saúde.

  6. A política de saúde bucal em pauta no Conselho Municipal de Saúde no Município de Nova Friburgo - RJ

    Directory of Open Access Journals (Sweden)

    Rafael Gomes Ditterich

    Full Text Available Objetivo O presente estudo teve como objetivo analisar, por meio dos documentos técnicos do Conselho Municipal de Saúde (CMS, a organização dos serviços de saúde bucal no Município de Nova Friburgo - RJ, a partir da institucionalização da Política Nacional de Saúde Bucal. Metodologia Para a análise documental, utilizou-se o registro de frequência e categorização por assunto: saúde bucal das atas do CMS de junho/2006 a agosto/2011, do Plano Municipal de Saúde de 2003-2005 e 2010-2013, e os documentos encaminhados entre 2005 e 2011. Resultado Os registros analisados até 2012 indicaram que a população estava desassistida na questão da média complexidade, como também no acesso à água fluoretada. As equipes de saúde bucal ainda não tinham sido qualificadas e ampliadas, como é bem colocado como prioridade no Brasil Sorridente. O Município ainda não desenvolvia programas de prevenção e promoção de saúde bucal de forma contínua e efetiva. Conclusão Concluiu-se que a Política Nacional de Saúde Bucal, até o ano de 2012, não tinha ainda reflexo nas ações de saúde bucal em Nova Friburgo.

  7. Mathematics teachers' beliefs about scientific approach (SA) and implementation in mathematics learning

    Science.gov (United States)

    Mutholib, Ahmad Abdul; Sujadi, Imam; Subanti, Sri

    2017-08-01

    SA is the approach used for the exploration of research and answer questions. Teachers' beliefs have a greater influence than the teacher's knowledge of designing lesson plans in the classroom. The objectives of this study are to explore the teachers' beliefs in SA, to reveal how the beliefs are reflected in classroom practices; and to figure out the factors affecting their beliefs and practices of SA to the teaching of mathematics. This qualitative research applied case study. The data was gained from classroom observation, face-to-face interview, and documentation. Interactive models from Miles and Huberman were used to examine the data. Results of the study: 1) The teachers believe about the conception of SA. They also believe that the SA is important and gives impact to students' progress. They believe that by applying SA, the target of mathematics learning is acquired. As to learning procedure, they believe that SA steps are conducted in sequence by combining some steps for each. 2) Teachers formulate their beliefs of applying the five scientific step of integrating all steps by keeping the sequence. Teachers argue that target of mathematics learning can be attained by some ways, namely presence of theoretical and practical support, teachers' guidance, providing variety of media and motivation to students. 3) There are five factors which influence teachers' beliefs and practices of SA, namely learning and teaching experience, teachers' motivation, sharing with colleagues and facility. This study concludes that teachers believe in the importance of SA, therefore they implement it in the classroom.

  8. The visualization of DHSI based on the relationship model of CL and SA

    Science.gov (United States)

    Wang, Haibo; Guo, Huijuan; Xue, Chengqi

    2013-03-01

    The source and cause of cognitive load (CL) and situation awareness (SA) in digital human-system interface (DHSI) is explained. Based on the analysis of cognitive procedure and the relation of CL and SA, The relationship model of CL and SA in DHSI is put forward. Using the association target and the relationship model of CL and SA, the method and strategy of information visualization of DHSI is presented which is based on the cognitive psychology. Selecting the Boeing 757 autopilot as the case, the comparison of design is shown.

  9. Software reference for SaTool - a Tool for Structural Analysis of Automated Systems

    DEFF Research Database (Denmark)

    Lorentzen, Torsten; Blanke, Mogens

    2004-01-01

    This software reference details the functions of SaTool – a tool for structural analysis of technical systems. SaTool is intended used as part of an industrial systems design cycle. Structural analysis is a graph-based technique where principal relations between variables express the system...... of the graph. SaTool makes analysis of the structure graph to provide knowledge about fundamental properties of the system in normal and faulty conditions. Salient features of SaTool include rapid analysis of possibility to diagnose faults and ability to make autonomous recovery should faults occur....

  10. A participação do enfermeiro de saúde pública na saúde familiar

    Directory of Open Access Journals (Sweden)

    Zélia Sena Costa

    1986-09-01

    Full Text Available As autoras partem do pressuposto de que o avanço da epidemiologia tem demonstrado que muitas enfermidades estão associadas a determinadas estruturas sociais. Face a um enfoque científico, humanístico e personalizado, o Enfermeiro tem conquistado um papel de destaque junto à família, uma vez que este grupo social se constitui em uma via estratégica para utilização de parâmetros psicossocias tendo em vista a função básica de ajuda e apoio. Considerando que a contribuição do Enfermeiro de Saúde Pública é de vital importância para a melhoria do nível de saúde familiar, concluem que existe uma necessidade premente da aplicação adequada do Processo de Enfermagem a nível familiar, propondo a inserção da concepção - unidade familiar - como princípio básico da Assistência de Enfermagem.

  11. O conceito de saúde The health's concept

    Directory of Open Access Journals (Sweden)

    Marco Segre

    1997-10-01

    Full Text Available Questiona-se a atual definição de saúde da Organização Mundial da Saúde: "situação de perfeito bem-estar físico, mental e social" da pessoa, considerada ultrapassada, primeiramente, por visar a uma perfeição inatingível, atentando-se as próprias características da personalidade. Menciona-se como principal sustentação dessa idéia, a renúncia necessária a parte da liberdade pulsional do homem, em troca da menor insegurança propiciada pelo convívio social. Discute-se a validade da distincão entre soma, psique e sociedade, esposando o conceito de homem "integrado", e registrando situações em que a interação entre os três aspectos citados é absolutamente cristalina. É revista a noção de qualidade de vida sob um vértice antipositivista. Essa priorização e proposta de resgate do subjetivismo, reverte a um questionamento da atual definição de saúde, toda ela embasada em avaliações externas, "objetivas", dessa situação.Objections to the present WHO (World Health Organization definition of HEALTH, as "the state of perfect physical, mental and social well-being", are expressed. It is considered to be anachronistic, first because it aims at perfection which is unaltainelle because of distict personality characteristics. As the main support for this idea, the necessary renunciation of part of man's drive to liberty in exchange for the lesser insecurity provided by social life (Freud, Castoriadis and Mc Dougall, is groted. The validity of distinguishing between "soma", "psyche" and "society" is questioned and the concept of the "integrated man", alluding to Pierre Marty and to Freud himself is adapted, and situations are recalled in which the interaction of the three aspects mentioned above is actually evident. Finally, the notion of the quality of life, in accordance with an antipositivistic taken from Bion, point of view, is discussed, and the concept that reality is that of each human being, is adapted. This

  12. 美国SA8000标准介绍

    Institute of Scientific and Technical Information of China (English)

    2004-01-01

    20世纪末期,欧洲、美国和澳大利亚都先后出现了一些关于“企业社会责任”的多边组织,并逐步形成了一些评价体系和认证制度。SA8000(Social Accoutability 8000的英文简称)是其中最有名的标准之一。企业社会责任是指企业在赚取利润的同时,主动承担对环境、社会和利益相关者的

  13. Impacto da microbiota intestinal na saúde mental

    OpenAIRE

    Landeiro, Joana Almeida Vilão Raposo

    2016-01-01

    Dissertação para obtenção do grau de Mestre no Instituto Superior de Ciências da Saúde Egas Moniz A microbiota intestinal consiste no conjunto de microrganismos residentes no intestino humano e que é responsável pela execução de diversas funções, sendo essencial para a manutenção da homeostase. Esta encontra-se em comunicação com o sistema nervoso central através do eixo intestino-cérebro, sendo esta comunicação bidirecional. Vários estudos têm revelado que a microbiota intestinal influenc...

  14. Editorial challenges of the Revista de Saúde Pública.

    Science.gov (United States)

    Antunes, José Leopoldo Ferreira; França Júnior, Ivan; de Andrade, Maria Teresinha Dias; Barata, Rita de Cássia Barradas; Monteiro, Carlos Augusto

    2015-07-01

    The editors of the Revista de Saúde Pública describe the journal's editorial profile and discuss the challenges of scientific publication in the area. A historical overview of almost 50 years of the journal is reported, with the temporal projection of their bibliometric indicators. Qualitative and quantitative parameters of its editorial profile and indexes are also reported. Budget constraints and the actions being taken to address them are discussed. The difficulty in allocating reviewers for manuscripts submitted to the editorial process is also discussed; an issue that affects scientific publication in many areas of knowledge. In particular, we sought to reflect on the proposal of measures to boost the editorial process by alleviating the shortage of reviewers and their possible harmful consequences for the editorial process.

  15. STRATEGI PENINGKATAN DAYA SAING RUMAH POTONG AYAM PT XYZ

    Directory of Open Access Journals (Sweden)

    Arli Arli

    2012-07-01

    chicken-based food company in Indonesia.Keywords:  competitiveness, global value chain, poultry slaughterhouse, PT XYZABSTRAKTujuan penelitian ini adalah (1 menganalisis peran aktor-aktor di dalam rantai nilai Rumah Potong Ayam (RPA PT XYZ  yang berpengaruh terhadap daya saingnya, (2 menganalisis para pemain kunci dalam stakeholders RPA PT XYZ , (3 menganalisis faktor-faktor internal dan eksternal (IE yang berpengaruh terhadap daya saing RPA PT XYZ , (4 memformulasikan tujuan dan sasaran jangka panjang strategik untuk meningkatkan daya saing RPA PT XYZ , (5 menganalisis alternatif dan prioritas strategi untuk meningkatkan daya saing RPA PT XYZ . Metode yang digunakan adalah analisis deskriptif. Analisis yang digunakan adalah global value chain, analisis stakeholder, internal factor evaluation, external factor evaluation, matriks IE, SWOT, dan quantitative strategic planning matrix. Hasil dari analisis global value chain, analisis stakeholders, analisis internal dan eksternal, dan visi-misi perusahaan, tujuan jangka panjang adalah (a menyediakan nilai tambah bagi pelanggan, (b memaksimalkan laba dari hasil operasi bisnis, (c meningkatkan kesejahteraan stakeholders, (d melakukan kegiatan sustainable business. Hasil matriks IE dan analisis SWOT, strategi untuk mencapai sasaran dan tujuan jangka panjang strategik adalah (a meningkatkan efektivitas dan efisiensi manajemen rantai pasok; (b mengimplementasikan evaluasi kinerja untuk pegawai dan partner bisnis; (c memperkuat  citra sebagai perusahaan domestik penghasil makanan olahan berbasis daging ayam berkualitas tinggi di Indonesia; (d meningkatkan kegiatan penelitian dan pengembangan; (e membangun aliansi strategik dengan pemasok ayam hidup eksternal; (f melakukan sosialisasi mengenai pentingnya konsumsi protein hewani kepada masyarakat Indonesia. Tiga strategi prioritas dari analisis QSPM adalah meningkatkan efektivitas dan efisiensi rantai pasok, mengimplementasikan evaluasi kinerja untuk pegawai dan partner bisnis, dan

  16. Saúde mental: reconstruindo saberes em enfermagem

    Directory of Open Access Journals (Sweden)

    Francisca Bezerra de Oliveira

    2003-02-01

    Full Text Available O manicômio, apesar de criticado, reformado ou mesmo negado, ainda é uma prática preponderante no cuidado às pessoas com transtornos mentais. Tal prática tem como princípio básico o isolamento do doente mental, contrariando todas as possibilidades de assistência centrada num humanismo ético. Este ensaio procura interpretar a institucionalização do asilo, da psiquiatria, da doença mental e o processo da reforma psiquiátrica, buscando contribuir para as reflexões acerca da desinstitucionalização e dos saberes e práticas de enfermagem em saúde mental.

  17. SalSA: A Teraton UHE Neutrino Detector

    Energy Technology Data Exchange (ETDEWEB)

    Reil, Kevin; /SLAC

    2006-04-19

    The observed spectrum of ultra-high energy cosmic rays virtually guarantees the presence of ultra-high energy neutrinos due to their interaction with the cosmic microwave background. Unlike cosmic rays, each of these neutrinos will point back directly to its source and will arrive at the Earth unattenuated, from sources perhaps as distant as z = 20. The neutrino telescopes currently under construction, should discover a handful of these events, probably too few for detailed study. This paper describes how an array of VHF and UHF antennas embedded in a large salt dome, SalSA (Salt dome Shower Array) promises to yield a teraton detector (> 500 km{sup 3 sr}) for contained neutrino events with energies above 10{sup 17} eV. Our simulations show that such a detector may observe several hundreds of these neutrinos over its lifetime with excellent angular resolution providing source locations.

  18. Teaching Computer System-DMT DESIGN(SA.1

    Directory of Open Access Journals (Sweden)

    A. O. Shteynberg

    2012-01-01

    Full Text Available Тhe paper introduces the training computer system of sub- agential type based on a didactic multidimensional technology. The methodology bases incorporate the systematic activity approach, some elements of artificial intelligence theory, and the instrumental didactic theory and technology developed by Scientific Experimental Laboratory at Bashkirsky State Pedagogical University. The above training system – Didactic Multidimensional Technology Design of Sub-Agential Type (DMT_DESIGN (SA.1 – has been developed for raising teachers’ technological competence and creativity regarding both the general and vocational education. Its training structure is specified by invariant socio-cultural and anthropological bases; logically semantic modeling of course materials is provided. The research data can be used by people, engaged in developing educational information technologies; practicing teachers; and post-graduates conducting research and implementing the findings. 

  19. Bien communiquer sur sa thèse, suite.

    Directory of Open Access Journals (Sweden)

    Philippe Heller

    2005-07-01

    Full Text Available Après une brève présentation sur lui-même, Edouard Paulino du Craft (Centre de recherche et d’appui pour la formation et ses technologies, qui travaille à l’ Epfl lance le débat : que signifie communiquer sur sa thèse ? Parmi le petit auditoire de doctorants présents, les questions-réponses fusent : à qui s’adresse-t-on ? Pourquoi ? Comment s’adapter à son auditoire ? Mais en fait qu’est-ce que communiquer ? Doit-on suivre forcément son plan de thèse ou ...

  20. MENDORONG PASAR MODAL EFISIEN DAN BERDAYA SAING GLOBAL

    Directory of Open Access Journals (Sweden)

    Satia Nur Maharani

    2006-01-01

    Full Text Available Globalisasi semakin memperpendek jarak dan waktu. Kemampuannya mampu  merubah wajah planet bumi menjadi” just a small village “ melalui peningkatan ilmu pengetahuan dan teknologi. Perubahan tersebut bertransformasi pula pada  sistem ekonomi. Modal berdiri sendiri tanpa identitas dan siapa saja berhak untuk berinvestasi tanpa batas melalui sebuah mekanisme antar negara dan benua. Salah satu lintasan modal untuk meraih keuntungan adalah melalui mekanisme pasar modal. Pasar modal manakah yang diminati oleh arus modal masuk adalah pasar modal yang mampu memberikan jamuan terbaik berupa keuntungan yang tinggi dengan resiko yang optimal. Maka untuk mencapai pelayan yang maksimal bagi masyarakat pemodal , pasar modal harus efisien dan berdaya saing global. Maka keterbukaan informasi, peningkatan teknologi, efisiensi biaya penegakan hukum, partisipasi masyarakat dan pemerintah, inovasi produk mutlak untuk dievaluasi dan ditingkatkan

  1. Comunicação entre usuários e trabalhadores de saúde em colegiados de Saúde da Família

    Directory of Open Access Journals (Sweden)

    Marcelen Palu Longhi

    2013-02-01

    Full Text Available Atualmente, têm sido observados problemas relativos à comunicação nos fóruns de participação social da saúde. O presente estudo tem o objetivo de analisar a comunicação entre usuários e trabalhadores de saúde, em colegiados da Saúde da Família. O referencial teórico utilizado foi a Teoria da Ação Comunicativa de Habermas. Realizou-se uma pesquisa qualitativa. Os dados coletados revelaram duas dimensões que se entrelaçavam: distanciamentos e aproximações entre usuários e trabalhadores de saúde. Quanto aos distanciamentos, destacaram-se a presença de relações assimétricas, de coerção e de manipulação por parte dos trabalhadores de saúde, processos que prejudicam a participação dos usuários. Por outro lado, estiveram presentes momentos de interação e lutas por direitos, abordados nas aproximações entre usuários e trabalhadores de saúde. Por fim, consideramos que a comunicação nos colegiados da Saúde da Família apresenta potencialidades e limites, sendo que estes devem ser problematizados, especialmente, por meio da educação permanente em saúde.

  2. 企业社会责任与SA8000

    Institute of Scientific and Technical Information of China (English)

    2006-01-01

    国际市场正逐渐认可的一种新兴的标准体系——SA8000(Social Accoutability 8000,社会责任标准8000),社会责任国际(Social Accountability International,简称SAI)是SA8000标准(即社会责任标准)的制订和执行机构,其前身为1997年成立的美国经济优先认可委员会(CEPAA),总都设在美国纽约,2001年该组织更改为现名。这个全球首个对企业进行道德规范的标准自1997年问世以来,受到了公众极大的关注,如同ISO9000、ISO14000、HACCP等标准体系,已成为国际市场的“通行证”。尽管国内对这个标准还有不同意见,但是通过规范的制度化的约束机制来推动企业社会责任建设,是一个必然的趋势。海尔集团首席执行官张瑞敏说;“责任和利润不是博弈关系。人们对百年老店做过调查,他们都倡导社会责任第一,利益、利润第二。”(以下中译文仅供参考)

  3. Master curve analysis of the SA508 Gr. 4N Ni-Mo-Cr low alloy steels for reactor pressure vessels

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Ki Hyoung; Wee, Dang Moon [KAIST, Daejeon (Korea, Republic of); Kim, Min Chul; Lee, Bong Sang [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2009-10-15

    Low alloy steels used as Reactor Pressure Vessels (RPVs) materials directly relate to the safety margin and the life span of reactors. Currently, SA508 Gr.3 low alloy steel is generally used for RPV material. But, for larger capacity and long-term durability of RPV, materials that have better properties including strength and toughness are needed. Therefore, tempered martensitic SA508 Gr.4N low alloy steel is considered as a candidate material due to excellent mechanical properties. The fracture toughness loss caused by irradiation embrittlement during reactor operation is one of the important issues for ferritic RPV steels, because the decrease of fracture toughness is directly related to the integrity of RPVs. One reliable and efficient concept to evaluate the fracture toughness of ferritic steels is master curve method. In ASTM E1921, it is clearly mentioned the universal shape of the median toughness-temperature curve for ferritic steels including tempered martensitic steels. However, currently, concerns have arisen regarding the appropriateness of the universal shape in ASTM for the tempered martensitic steels such as Eurofer97. Therefore, it may be necessary to assess the master curve applicability for the tempered martensitic SA508 Gr.4N low alloy steel. In this study, the fracture toughness behavior with temperature of the tempered martensitic SA508 Gr.4N low alloy steels was evaluated using the ASTM E1921 master curve method. And the results were compared with those of the bainitic SA508 Gr.3 low alloy steel. Furthermore, the way to define the fracture toughness behavior of Gr.4N steels well is discussed.

  4. Saúde mental na Estratégia Saúde da Família: a avaliação de apoio matricial

    Directory of Open Access Journals (Sweden)

    Fernanda Barreto Mielke

    2010-12-01

    Full Text Available O objetivo deste artigo é avaliar o apoio matricial na perspectiva de 14 profissionais de uma unidade de saúde da família em um estudo avaliativo qualitativo realizado a partir da Avaliação de Quarta Geração. Os dados foram coletados por meio de observação e entrevistas e analisados pelo Método Comparativo Constante, enfocando a inclusão de ações de saúde mental na Estratégia Saúde da Família. Os profissionais das equipes estudadas avaliaram a necessidade de retaguarda assistencial e orientações técnicas de equipes especializadas em saúde mental para a realização de ações de saúde mental no território, o que poderia ser implementado por meio do apoio matricial. Avaliamos que este arranjo organizacional é importante na construção de ações de saúde mental no território.

  5. Homossexualidade e o direito à saúde: um desafio para as políticas públicas de saúde no Brasil

    Directory of Open Access Journals (Sweden)

    Grayce Alencar Albuquerque

    Full Text Available Objetivou-se evidenciar a atuação das políticas públicas direcionadas à saúde da população homossexual brasileira. Trata-se de uma revisão integrativa da literatura, realizada na Scientific Eletronic Library Online (SciELO e na Literatura Latino-Americana e do Caribe em Ciências da Saúde (Lilacs, utilizando os Decs: políticas públicas, assistência integral à saúde e homossexualidade. A saúde LGBT é apontada como vulnerável mesmo após a publicação de importantes documentos que garantem o acesso e a inclusão do grupo na saúde. A fragilidade na efetivação das propostas preconizadas vão ao encontro ao atendimento discriminatório e heteronormativo prestado pelos profissionais de saúde.

  6. A música popular brasileira na construção do conhecimento em Saúde Pública: o tema processo de trabalho e saúde

    Directory of Open Access Journals (Sweden)

    José Augusto Pina

    2014-01-01

    Full Text Available Este estudo destaca temas relativos ao trabalho e à saúde na música popular brasileira, especialmente no samba. Tem como objetivo apresentar um corpo de conhecimentos sobre o tema processo de trabalho e saúde. Nas canções selecionadas foram identificadas categorias tomadas como ponto de partida para discussão com a literatura. Com o desenvolvimento do texto, percebe-se o manancial da canção popular para proporcionar conteúdos sobre múltiplas dimensões do processo de trabalho e do processo saúde-doença dos trabalhadores, inclusive a dimensão coletiva e histórica da luta pelo direito à saúde. Esta pesquisa resultou na valorização da música popular brasileira como uma forma de se entenderem as relações trabalho-saúde e de se desenvolver conhecimento em Saúde Coletiva.

  7. Percepções e atuação do Agente Comunitário de Saúde em saúde mental

    Directory of Open Access Journals (Sweden)

    Maria Angélica Pagliarini Waidman

    2012-10-01

    Full Text Available Este estudo teve como objetivo identificar as percepções de Agentes Comunitários de Saúde acerca de saúde e transtorno mental, bem como verificar o preparo desses agentes para atuar na área. Trata-se de uma pesquisa qualitativa que utilizou como técnica de coleta de dados a entrevista semiestruturada e, para interpretação dos dados, a técnica de análise de conteúdo. Foram entrevistados 45 Agentes Comunitários de Saúde da Estratégia Saúde da Família, pertencentes às 21 unidades básicas de saúde do município de Maringá, PR. Os resultados obtidos demonstram os preconceitos em relação ao transtorno mental desses profissionais, que reconhecem a importância de se trabalhar tanto com o portador quanto com a família, mas não se sentem capacitados para prestar uma assistência adequada. Por compartilharem o mesmo contexto social e por conhecerem de perto a dinâmica da comunidade, vislumbramos os agentes como importantes facilitadores no cuidado à saúde mental.

  8. The Staphylococcus aureus Membrane Protein SA2056 Interacts with Peptidoglycan Synthesis Enzymes

    Directory of Open Access Journals (Sweden)

    Brigitte Berger-Bächi

    2013-01-01

    Full Text Available The yet uncharacterized membrane protein SA2056 belongs to the ubiquitous RND (Resistance-Nodulation-cell Division family of transmembrane efflux transporters. The sa2056 gene is located downstream of femX, the gene encoding the essential, non-ribosomal peptidyl-transferase adding the first glycine in the staphylococcal cell wall pentaglycine interpeptide. Due to its proximity to and weak co-transcription with femX, we assumed that sa2056 may somehow be involved in peptidoglycan synthesis. Specific antibodies against SA2056 showed that this protein is expressed during growth and present in the membrane fraction of cell preparations. Using a bacterial two hybrid system, SA2056 was shown to interact (i with itself, (ii with FemB, which adds glycines 4 and 5 to the peptidoglycan interpeptide and (iii with the essential penicillin binding proteins, PBP1 and PBP2, required for cell division and incorporation of the peptidoglycan into the cell wall. Unexpectedly, deletion of sa2056 led to no phenotype regarding growth, antibiotic resistances or cell morphology; nor did sa2056 deletion in combination with femB inactivation alter b-lactam and lysostaphin sensitivity and resistance, respectively, pointing to possible redundancy in the cell wall synthesis pathway. These results suggest an accessory role of SA2056 in S. aureus peptidoglycan synthesis, broadening the range of biological functions of RND proteins.

  9. 78 FR 5712 - Airworthiness Directives; CFM International, S.A. Turbofan Engines Modified by Supplemental Type...

    Science.gov (United States)

    2013-01-28

    ..., S.A. Turbofan Engines Modified by Supplemental Type Certificate SE00034EN AGENCY: Federal Aviation... directive (AD) for CFM International, S.A. CFM56-3, CFM56-3B, and CFM56-3C turbofan engines. This AD... of multiple turbine blades, damage to the engine, and damage to the airplane. DATES: This AD...

  10. Intersetorialidade na política de saúde do idoso

    Directory of Open Access Journals (Sweden)

    Grossi, Patricia Krieger

    2006-01-01

    Full Text Available Este artigo versa sobre a intersetorialidade na política de saúde do idoso. Apresenta uma discussão referente à conceituação e à construção da intersetorialidade. Aborda a saúde do idoso nos aspectos conceituais, legais e no enfrentamento de problemas concretos

  11. Draft Genome Sequence of Ochrobactrum intermedium Strain SA148, a Plant Growth-Promoting Desert Rhizobacterium

    KAUST Repository

    Lafi, Feras Fawzi

    2017-03-03

    Ochrobactrum intermedium strain SA148 is a plant growth-promoting bacterium isolated from sandy soil in the Jizan area of Saudi Arabia. Here, we report the 4.9-Mb draft genome sequence of this strain, highlighting different pathways characteristic of plant growth promotion activity and environmental adaptation of SA148.

  12. Educação Popular e Saúde e democracia no Brasil

    Directory of Open Access Journals (Sweden)

    Eduardo Navarro Stotz

    2014-12-01

    Full Text Available O ensaio se propõe a entender os limites, as possibilidades e os desafios do controle social do Sistema Único de Saúde à luz de uma reflexão sobre a democracia no Brasil com base nas referências da Educação Popular e Saúde.

  13. Data of evolutionary structure change: 1C5SA-1QRZD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available dbID> A 1C5SA AHCYK-----SGIQV ...>GGG ----- EEE> ATOM 550 CA ALA A 56 34.816 22.651...QRZD AHCLEKSPRPSSYKV >EGGG EEEe>...DChain>1C5SA SCKSA--YPGQI ure>HHHHH-- ...DChain> VCNRYEFLNGRV >HH > <

  14. Data of evolutionary structure change: 1O2SA-2FOHA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available entryIDChain>1O2SA SLNSG-----YHFCG >EEE ----- EE...ID>2FOH A 2FOHA SLQYRSGSSWAHTCG ...>EEEEEE EEE EEucture> ATOM 123 CA SER A 32 53....yIDChain>1O2SA PVVCS----GKLQG >EEEE ---- EEEE...LHCLVNGQYAVHG >EEEEEE EEEEEEe>

  15. Best Practices Case Study: S&A Homes, East Liberty, PIttsburgh, PA

    Energy Technology Data Exchange (ETDEWEB)

    None

    2010-12-01

    S&A Homes worked with Building America's IBACOS and architects Pfaffmann & Associates and Moss Associates to design energy-efficient homes for urban in-fill lots. This is a new market for S&A Homes, which builds over 500 homes a year using suburban designs.

  16. 77 FR 25644 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. Airplanes

    Science.gov (United States)

    2012-05-01

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira...) that apply to all Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ 190 airplanes... information identified in this proposed AD, contact Empresa Brasileira de Aeronautica S.A....

  17. 75 FR 47190 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135...

    Science.gov (United States)

    2010-08-05

    ...-212-AD; Amendment 39-16378; AD 2010-16-02] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135 Airplanes; and Empresa Brasileira de Aeronautica S.A..., 44701. Sec. 39.13 0 2. The FAA amends Sec. 39.13 by adding the following new AD: 2010-16-02...

  18. 75 FR 52263 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2010-08-25

    ...; AD 2010-18-04] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira de Aeronautica S.A... [Amended] 0 2. The FAA amends Sec. 39.13 by adding the following new AD: 2010-18-04 Empresa Brasileira de..., contact Empresa Brasileira de Aeronautica S.A. (EMBRAER), Technical Publications Section (PC 060),...

  19. 77 FR 36224 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2012-06-18

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... all Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135 airplanes, and Model EMB-145... information identified in this proposed AD, contact Empresa Brasileira de Aeronautica S.A....

  20. 76 FR 27237 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2011-05-11

    ...-153-AD; Amendment 39-16684; AD 2011-10-03] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... the following new AD: 2011-10-03 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16684... Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170-100 LR, -100 STD, -100 SE, and -100...

  1. 78 FR 66258 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2013-11-05

    ...-194-AD; Amendment 39-17650; AD 2013-22-18] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... directive (AD) for certain Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135ER, - 135KE, -135KL... information identified in this AD, contact Empresa Brasileira de Aeronautica S.A. (EMBRAER),...

  2. 75 FR 260 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2010-01-05

    ...; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 Airplanes; and Model ERJ 190-100 STD, -100... Friday, except Federal holidays. For service information identified in this proposed AD, contact Empresa... amends Sec. 39.13 by adding the following new AD: Empresa Brasileira de Aeronautica S.A....

  3. Hydrogen infrastructure within HySA national program in South Africa: road map and specific needs

    CSIR Research Space (South Africa)

    Bessarabov, D

    2012-01-01

    Full Text Available The Department of Science and Technology of South Africa developed the National Hydrogen and Fuel Cells Technologies (HFCT) Research, Development and Innovation Strategy. The National Strategy was branded Hydrogen South Africa (HySA). HySA has been...

  4. CMC-PVA/CS-PVA Bipolar Membrane Modified by PVA-SA-CuTsPc Nanofiber Using Electrospinning Technique%静电纺丝法制备PVA-SA-CuTsPc纳米纤维改性CMC-PVA/CS-PVA双极膜

    Institute of Scientific and Technical Information of China (English)

    周挺进; 陈晓; 陈日耀; 郑曦; 陈震

    2013-01-01

    分别用Fe3+离子和戊二醛作为交联剂对羧甲基纤维素钠(CMC)-聚乙烯醇(PVA)阳膜层和壳聚糖(CS)-聚乙烯醇阴膜层进行改性,利用静电纺丝法制备聚乙烯醇(PVA)-海藻酸钠(SA)-四磺酸基铜酞菁(CuTsPc)纳米纤维纺丝,引入中间界面层,制备CMC-PVA/PVA-SA-CuTsPc/CS-PVA双极膜(BPM),并用扫描电镜、接触角测定仪,电流密度-槽电压关系曲线、交流阻抗谱等对制备的双极膜进行了表征.研究结果表明,经PVA.SA-CuTsPc纳米纤维纺丝改性后,CMC-PVA阳膜表面亲水性增强,双极膜的中间界面层水解离效率提高,膜阻抗和槽电压下降.当电流密度为90 mA/cm2时,CMC-PVA/PVA-SA-CuTsPc/CS-PVA(w (CuTsPc)=3.0%)双极膜的电阻压降(即膜IR降)仅为0.5V.%In this paper, the carboxymethyl cellulose (CMC)-polyvinyl alcohol (PVA) cation exchange membranes and the chitosan (CS)-polyvinyl alcohol anion exchange membranes were modified by Fe 3+ and glutaraldehyde as linking reagents, respectively, and the polyvinyl alcohol-sodium alginate (SA)-copper phthalocyanine tetrasulfonic acid (CuTsPc) nanofibers prepared by electrospinning technique were introduced into the interlayer to prepare the CMC-PVA/PVA-SA-CuTsPc/CS-PVA bipolar membrane (BPM). The BPM was characterized using SEM, contact angle measurement, current-voltage characteristics, AC impedance spectroscopy and so on. The results show that after the modification with PVA-SA-CuTsPc nanofibers, the hydrophilicity of CMC-PVA membrane surface and the water splitting efficiency at the interlayer increase, and the membrane impedance and cell voltage of the BPM decrease. The trans-membrane voltage drop (IR drop) of the CMC-PVA/PVA-SA-CuTsPc/CS-PVA (w(CuTsPc) = 3.0%) BPM is as low as 0. 5V at a current density of 90 mA/cm2.

  5. Aprendem doença, educam para a saúde : influência da formação, em futuros profissionais de saúde em concepções saúde/doença, educação para a saúde e sua implementação

    OpenAIRE

    Araújo, Isabel Maria Batista de

    2004-01-01

    Dissertação de mestrado em Educação, área de especialização em Educação para a Saúde Sucessivas reuniões internacionais apelam à implementação de actividades de educação para a saúde, apoiando-se na evolução do conceito de saúde, entendido como um recurso, um estado positivo de bem-estar individual e comunitário. Perspectivam a educação para a saúde como processo de capacitar os indivíduos e comunidades a aumentar o controlo sobre os factores que determinam a saúde através de diferentes me...

  6. An efficient hybrid evolutionary optimization algorithm based on PSO and SA for clustering

    Institute of Scientific and Technical Information of China (English)

    Taher NIKNAM; Babak AMIRI; Javad OLAMAEI; Ali AREFI

    2009-01-01

    The K-means algorithm is one of the most popular techniques in clustering. Nevertheless, the performance of the Kmeans algorithm depends highly on initial cluster centers and converges to local minima. This paper proposes a hybrid evolutionary programming based clustering algorithm, called PSO-SA, by combining particle swarm optimization (PSO) and simulated annealing (SA). The basic idea is to search around the global solution by SA and to increase the information exchange among particles using a mutation operator to escape local optima. Three datasets, Iris, Wisconsin Breast Cancer, and Riplcy's Glass, have been considered to show the effectiveness of the proposed clustering algorithm in providing optimal clusters. The simulation results show that the PSO-SA clustering algorithm not only has a better response but also converges more quickly than the K-means, PSO, and SA algorithms.

  7. A eterna busca da verdade em Die Lehrlinge zu Saïs, de Novalis

    Directory of Open Access Journals (Sweden)

    Natália Corrêa Porto Sanches Fadel

    2010-01-01

    Full Text Available The purpose of this essay is to undergo an investigation geared towards identifying the consolidation of the symbolized Upper or Ideal Truth illustrated by the figure of the goddess Saïs in the fragmentary novel Die Lehrlinge zu Saïs, from Novalis, written in 1801. As part of our approach, we traced a parallel between the allegorical use of Saïs myth by Novalis and in Schiller´s poem Das verschleierte Bild zu Saïs, aiming at a better characterization of Novalis' concept of the Ideal Truth. Lastly, we analyzed the fairy tale Hyazinth und Rosenblüte, which is part of the novel Die Lehrlinge zu Saïs, where it is possible to envisage the finding of the Ideal Truth searched by the poets of German Early Romanticism, especially by Novalis.

  8. Qualidade de vida relacionada à saúde de filhos de profissionais da área de saúde

    Directory of Open Access Journals (Sweden)

    Silvia Maria Moussi Gamallo

    2012-12-01

    Full Text Available Neste estudo mensuramos a qualidade de vida relacionada à saúde (QVRS e a fadiga de filhos de profissionais da área da saúde, com idades entre 2 e 11 anos, e avaliamos os hábitos diários e o sono dessas crianças e dos respectivos pais. Foram incluídas no estudo crianças de uma escola pública. Dados demográficos e dados de hábitos diários foram colhidos. A QVRS, o sono e a fadiga foram mensurados por questionários. Participaram 249 pais - 63,5% referiram sono adequado e 47,4% acordavam cansados. A média da idade das crianças foi 5,6 anos - 62,2% assistiam televisão no quarto, 50% usavam computador (> 4 horas/dia e 27,8% faziam atividades físicas extracurriculares. O escore do sono foi de 45,8 ± 12,2. Os escores de QVRS foram mais elevados no aspecto físico e mais baixos no emocional. Detectamos que o sono de pior qualidade dos filhos e dos pais pode estar relacionado à pior QVRS dos filhos. Concluímos que os hábitos inadequados dos pais, bem como das crianças, estão relacionados a uma diminuição da QVRS dos filhos, especialmente no aspecto emocional.

  9. The ChrSA and HrrSA Two-Component Systems Are Required for Transcriptional Regulation of the hemA Promoter in Corynebacterium diphtheriae

    Science.gov (United States)

    Burgos, Jonathan M.

    2016-01-01

    ABSTRACT Corynebacterium diphtheriae utilizes heme and hemoglobin (Hb) as iron sources for growth in low-iron environments. In C. diphtheriae, the two-component signal transduction systems (TCSs) ChrSA and HrrSA are responsive to Hb levels and regulate the transcription of promoters for hmuO, hrtAB, and hemA. ChrSA and HrrSA activate transcription at the hmuO promoter and repress transcription at hemA in an Hb-dependent manner. In this study, we show that HrrSA is the predominant repressor at hemA and that its activity results in transcriptional repression in the presence and absence of Hb, whereas repression of hemA by ChrSA is primarily responsive to Hb. DNA binding studies showed that both ChrA and HrrA bind to the hemA promoter region at virtually identical sequences. ChrA binding was enhanced by phosphorylation, while binding to DNA by HrrA was independent of its phosphorylation state. ChrA and HrrA are phosphorylated in vitro by the sensor kinase ChrS, whereas no kinase activity was observed with HrrS in vitro. Phosphorylated ChrA was not observed in vivo, even in the presence of Hb, which is likely due to the instability of the phosphate moiety on ChrA. However, phosphorylation of HrrA was observed in vivo regardless of the presence of the Hb inducer, and genetic analysis indicates that ChrS is responsible for most of the phosphorylation of HrrA in vivo. Phosphorylation studies strongly suggest that HrrS functions primarily as a phosphatase and has only minimal kinase activity. These findings collectively show a complex mechanism of regulation at the hemA promoter, where both two-component systems act in concert to optimize expression of heme biosynthetic enzymes. IMPORTANCE Understanding the mechanism by which two-component signal transduction systems function to respond to environmental stimuli is critical to the study of bacterial pathogenesis. The current study expands on the previous analyses of the ChrSA and HrrSA TCSs in the human pathogen C

  10. Decreased serotonin2C receptor responses in male patients with schizophrenia.

    Science.gov (United States)

    Lee, Myung Ae; Jayathilake, Karuna; Sim, Min Young; Meltzer, Herbert Y

    2015-03-30

    Serotonin (5-HT)2C receptors in brain affect psychosis, reward, substance abuse, anxiety, other behaviors, appetite, body temperature, and other physiological measures. They also have been implicated in antipsychotic drug efficacy and side effects. We previously reported that the hyperthermia following administration of MK-212, a predominantly 5-HT(2C) receptor agonist, was diminished in a small sample of patients with schizophrenia (SCH), suggesting decreased 5-HT(2C) receptor responsiveness. We have now studied the responses to oral MK-212 and placebo in a larger sample of unmedicated male SCH (n = 69) and normal controls (CON) (n = 33), and assessed the influence of comorbid substance abuse (SA) on oral body temperature, behavioral responses, etc. The placebo-adjusted oral body temperature response to MK-212 was significantly lower in SCH compared to CON and not significantly different between the SCH with or without SA. Some behavioral responses to MK-212, e.g. self-rated feelings of increased anxiety, depression and decreased calmness, or good overall feeling, were significantly lower in the SCH patients compared to CON. These results add to the evidence for diminished 5-HT(2C) receptor responsiveness in SCH patients compared to CON and are consistent with reported association of HTR(2C) polymorphisms, leading to decreased expression or function of the HTR(2C) in patients with SCH.

  11. Diretrizes Curriculares na saúde e as mudanças nos modelos de saúde e de educação

    Directory of Open Access Journals (Sweden)

    Carlos Otávio Fiúza Moreira

    2015-12-01

    Full Text Available Artigo produzido a partir de pesquisa bibliográfica e de questões formuladas para uma conferência no módulo “Educação na Saúde II” do Mestrado Profissional da Rede Nordeste de Formação em Saúde da Família. O texto discute questões dos campos da saúde e da educação relacionadas à emergência de novos modelos de saúde e de formação; analisa também as Diretrizes Curriculares Nacionais (DCN de três cursos da área da saúde (Medicina, Enfermagem e Odontologia como expressão desses novos modelos para saúde e para a educação. Uma questão transversal ao artigo são as relações entre os campos da saúde e da educação. Para isto, lança‑se mão do conceito de campo, desenvolvido pelo sociólogo Pierre Bourdieu. Considera‑se, ainda, o desafio de transformar as DCN em currículos e programas, ferramentas ou dispositivos necessários para fazer a passagem do que está prescrito para os cenários de ensino e aprendizagem.

  12. Hortas comunitárias como atividade promotora de saúde: uma experiência em Unidades Básicas de Saúde

    Directory of Open Access Journals (Sweden)

    Christiane Gasparini Araújo Costa

    2015-10-01

    Full Text Available ResumoA agricultura urbana e periurbana (AUP vem sendo praticada em diferentes espaços, contribuindo para a melhoria da saúde nas comunidades e ambientes mais saudáveis. Objetivando identificar significados e repercussões da prática da AUP em Unidades Básicas de Saúde (UBS, enquanto uma atividade de Promoção da Saúde (PS, e em que medida sua dimensão terapêutica a caracteriza como uma atividade alinhada às práticas integrativas e complementares, foi realizado um estudo transversal com abordagem qualitativa no município de Embu das Artes, SP. Da análise, emergiram as seguintes categorias: concepção de saúde, resultados na saúde, resgate de práticas e hábitos tradicionais e reorientação dos serviços de saúde. Identificou-se a estreita ligação entre a prática das hortas e as diretrizes e campos de ação da PS como: criação de ambientes saudáveis, reforço da ação comunitária, desenvolvimento de habilidades pessoais, estímulo à autonomia e empoderamento e demandas por reorientação dos serviços. As atividades de horta instituídas nas UBS se mostraram uma estratégia de implementação das práticas integrativas e complementares (PIC. Conclui-se que as atividades de cultivo nas hortas comunitárias mostram-se como práticas promotoras da saúde que integram elementos fundamentais das PIC.

  13. Vigilância ambiental em saúde e sua implantação no Sistema Único de Saúde

    Directory of Open Access Journals (Sweden)

    Christovam Barcellos

    2006-02-01

    Full Text Available A incorporação da vigilância ambiental no campo das políticas públicas de saúde é uma demanda relativamente recente no Brasil. Um dos principais desafios da vigilância ambiental em saúde é a definição do seu objeto e a especificidade de suas ações. O conceito ampliado de exposição, tratado não como um atributo da pessoa, mas do conjunto de relações complexas entre a sociedade e o ambiente, é central para a definição de indicadores e para a orientação da prática de vigilância ambiental. Entre as dificuldades encontradas para sua efetivação no Sistema Único de Saúde estão a necessidade de reestruturação das ações de vigilância em saúde e a formação de equipes multidisciplinares, com capacidade de diálogo com outros setores, além da construção de sistemas de informação capazes de auxiliar a análise de situações de saúde e a tomada de decisões. Nesse sentido, foi realizada uma revisão do objeto e conceitos da vigilância ambiental em saúde, bem como identificados os desafios para a sua implantação no Sistema Único de Saúde.

  14. Antropologia no campo da saúde global

    Directory of Open Access Journals (Sweden)

    João Biehl

    2011-06-01

    Full Text Available Neste artigo, eu exploro os limites de abordagens baseadas em balas mágicas para os problemas de saúde global e mostro como as iniciativas centradas nas pessoas desafiam as ortodoxias econômicas e dos direitos humanos e ampliam nossa percepção daquilo que é socialmente possível e desejável. Utilizo o meu estudo etnográfico de longo prazo sobre a resposta terapêutica brasileira ao HIV/AIDS e suas repercussões nos âmbitos de governo, mercados, sistemas de saúde e vida pessoal. Faço também o relato de um novo projeto comparativo sobre as consequências de grandes intervenções farmacêuticas em contextos com recursos limitados. Considerando tanto os processos mais amplos quanto as singularidades humanas, o artigo abre uma janela crítica para os valores e os resultados de intervenções farmacêuticas e humanitárias contemporâneas na vida real. Ao criticar as práticas institucionais de produção de evidência, também reconsidero as noções de responsabilidade e cuidado dentro da antropologia e da medicina.In this article, I explore the limits of magic-bullet approaches to global health problems and show how people-centered initiatives challenge economic and human rights orthodoxies and enlarge our sense of what is socially possible and desirable. I draw from my long-term ethnographic study of the Brazilian therapeutic response to HIV/AIDS and its repercussions through government, markets, health systems and personal lives. I also report on a new comparative project on the aftermath of large-scale pharmaceutical interventions in resource-poor settings. Attending to both larger processes and to human singularities, the article opens a critical window into the values and the real-life outcomes of contemporary pharmaceutical and humanitarian interventions. As I critique institutional evidence-making practices I also reconsider anthropology and medicine's notions of responsibility and care.

  15. Dinamičke simulacije solarnih kombi-sustava sa sezonskim sorpcijskim spremnikom topline: Utjecaj konfiguracije kombi-sustava.

    OpenAIRE

    Hennaut, Samuel; Thomas, Sébastien; Davin, Elisabeth; SKRYLNYK, Alexandre; Frere, Marc; Andre, Philippe

    2012-01-01

    Ovaj članak je fokusiran na dimenzioniranje solarnog kombi-sustava sa sezonskim adsorpcijskim spremnikom topline sa ciljem autonomnog solarnog grijanja prostora. Dvije konfiguracije kombi-sustava su simulirane, uključujući jedan ili dva toplinska spremnika. Utjecaj sezonskog skladištenja energije na dimenzioniranje spremnika je također diskutirano. Analiza je vršena simulacijom u programu TRNSYS. Rezultati analize pokazuju da je performansa sustava sa dva spremnika bolja (2 do 4% sa sezonskim...

  16. Setting priorities for mental health research in Brazil Agenda de prioridades de pesquisa para saúde mental no Brasil

    Directory of Open Access Journals (Sweden)

    Guilherme Gregório

    2012-12-01

    Full Text Available BACKGROUND: The main aim of this study is to review the agenda for research priorities of mental health in Brazil. METHODOLOGY: The first step was to gather 28 experts (22 researchers, five policy makers, and the coordinator representing all mental health fields from different geographical areas of the country. Participants were asked to list what they considered to be the most relevant mental health research questions for the country to address in the next 10 years. Seventeen participants answered this question; after redundancies were excluded, a total of 110 responses were collected. As the second step, participants were asked to rank which questions were the 35 most significant. The final step was to score 15 items for each of the 35 selected questions to determine whether it would be a answerable, b effective, c deliverable, d equitable, and e effective at reducing the burden of mental health. The ten highest ranked questions were then selected. RESULTS: There were four questions addressing primary care with respect to a the effectiveness of interventions, b "matrix support", c comparisons of different models of stepped care, and d interventions to enhance identification and treatment of common mental disorders at the Family Health Program. The other questions were related to the evaluation of mental health services for adults and children/adolescents to clarify barriers to treatment in primary care, drug addiction, and severe mental disorders; to investigate the cost-benefit relationship of anti-psychotics; to design interventions to decrease alcohol consumption; and to apply new technologies (telemedicine for education and supervision of non-specialists. CONCLUSION: This priority-setting research exercise highlighted a need for implementing investments at the primary-care level, particularly in the family health program; the urgent need to evaluate services; and policies to improve equity by increasing accessibility to services and

  17. [Psychosocial and socioeconomic factors related to insomnia and menopause: Pró-Saúde Study].

    Science.gov (United States)

    Robaina, Jaqueline Rodrigues; Lopes, Claudia S; Rotenberg, Lúcia; Faerstein, Eduardo

    2015-03-01

    This study evaluated the association between insomnia and menopausal status and the influence of socioeconomic and psychosocial variables on this association in a cross-sectional analysis of 2,190 university employees (the Pró-Saúde Study). A self-administered questionnaire was used, covering menopausal status, complaints of insomnia, common mental disorders, stressful life events, social support, and socioeconomic variables. Odds ratios were calculated using logistic regression with a polytomous outcome. After adjusting for potential socio-demographic confounders, women who had entered menopause more than 60 months previously were more likely to report complaints with sleep (OR 1.53-1.86) as compared to women in menopause for less than 60 months. After adjusting for psychosocial variables, in the first group the ORs decreased to 1.53 (95%CI: 0.92-2.52) for difficulty initiating sleep, 1.81 (95%CI: 1.09-2.98) for difficulty maintaining sleep, and 1.71 (95%CI: 1.08-2.73) for general complaints of insomnia. Psychosocial factors can mediate the manifestation of insomnia among menopausal women.

  18. Improvement in Mechanical Properties of SA508 Gr.1a Piping Material by Modifying Microstructure

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jin Weon; Choi, Myung Rak [Chosun Univ., Gwangju (Korea, Republic of); Oh, Young Jin; Park, Heung Bae; Kim, Kyung Su [KEPCO E-C, Yongin (Korea, Republic of)

    2014-10-15

    It is attempted to apply LBB concept to the design of secondary piping systems, such as main-steam line and feed-water line. But, for obtaining sufficient margin in LBB analysis for these piping systems, it is necessary to reduce the applied loads by improving structural design and to employ piping material with higher toughness and strength than existing piping materials such as SA106 Gr.C and SA106 Gr.B carbon steels. SA508 Gr.1a ferritic steel has been used for the reactor coolant system (RCS) piping in KSNP (Korea Nuclear Power Plant) and is known to have good toughness and strength as well as weld ability. Such characteristics provide a sufficient margin in the LBB analysis for RCS piping. Based on SA508 Gr.1a piping material, thus, this study attempts to obtain a further improved piping material by modifying microstructure of SA508 Gr.1a without change of chemical composition. In order to obtain a modified microstructure, thus, this study simply heat-treated again SA508 Gr.1a piping material at the same heat-treatment condition that had been employed in the fabrication of SA508 Gr.1a piping material. The microstructure is composed of the homogeneous mixture of fine-grained ferrite and bainite. This is different from that of as-received SA508 Gr.1a. This difference is associated with different size of object to be heat-treated. This shows that SA508 Gr.1a piping material has a microstructure with fine-grained ferrite and bainite mixture, which provides good toughness and strength, if it is properly heat-treated. Tensile and J-R tests were conducted using specimens machined form modified SA508 Gr.1a piping material given by heat-treated, and the results were compared with those tested from as-received SA508 Gr..1a piping material. At 316 .deg. C, however, both strength and elongation of modified SA508 Gr.1a are higher than those of as-received SA508 Gra.1a. The results of J-R tests showed that J-R curve of modified SA508 Gr.1a is almost the same as that of as

  19. 75 FR 52238 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ...

    Science.gov (United States)

    2010-08-25

    ...; AD 2010-18-01] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira de Aeronautica S.A... new AD: 2010-18-01 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16414. Docket No... Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170-100 LR, -100 STD, -100 SE, and -100...

  20. 76 FR 55781 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ...

    Science.gov (United States)

    2011-09-09

    ...-16786; AD 2011-18-04] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira de Aeronautica S.A... the following new AD: 2011-18-04 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16786... to Empresa Brasileira de Aeronautica S.A. (EMBRAER) airplanes as identified in paragraphs (c)(1)...

  1. Práticas de cuidado à saúde de mulheres camponesas

    Directory of Open Access Journals (Sweden)

    Iraí Maria de Campos Teixeira

    2014-12-01

    Full Text Available O presente artigo apresenta resultados de pesquisa acerca de práticas de cuidado à saúde de mulheres camponesas do Assentamento Monte Alegre VI – SP. A metodologia, qualitativa, constou de observação participante, entrevistas individuais e coletivas, tendo ocorrido 15 visitas no período de abril de 2010 a julho de 2011. Participaram doze moradoras, das quais, seis agentes comunitárias de saúde. As práticas de cuidado à saúde referem-se a: companheirismo, diálogo, escuta ativa, mobilizações sociais, assistência multiprofissional dos serviços de saúde, uso de plantas medicinais, crença religiosa como apoio social e dietas. Tais práticas somam-se e articulam-se. As participantes ensinam e aprendem sobre o cuidado à saúde nas relações entre elas, nas intergeracionais e nas com os profissionais de saúde, além de recorrerem a outras fontes de informação e outros processos formativos específicos, como do Programa Saúde da Família.

  2. Sa-Lrp from Sulfolobus acidocaldarius is a versatile, glutamine-responsive, and architectural transcriptional regulator.

    Science.gov (United States)

    Vassart, Amelia; Van Wolferen, Marleen; Orell, Alvaro; Hong, Ye; Peeters, Eveline; Albers, Sonja-Verena; Charlier, Daniel

    2013-02-01

    Sa-Lrp is a member of the leucine-responsive regulatory protein (Lrp)-like family of transcriptional regulators in Sulfolobus acidocaldarius. Previously, we demonstrated the binding of Sa-Lrp to the control region of its own gene in vitro. However, the function and cofactor of Sa-Lrp remained an enigma. In this work, we demonstrate that glutamine is the cofactor of Sa-Lrp by inducing the formation of octamers and increasing the DNA-binding affinity and sequence specificity. In vitro protein-DNA interaction assays indicate that Sa-Lrp binds to promoter regions of genes with a variety of functions including ammonia assimilation, transcriptional control, and UV-induced pili synthesis. DNA binding occurs with a specific affinity for AT-rich binding sites, and the protein induces DNA bending and wrapping upon binding, indicating an architectural role of the regulator. Furthermore, by analyzing an Sa-lrp deletion mutant, we demonstrate that the protein affects transcription of some of the genes of which the promoter region is targeted and that it is an important determinant of the cellular aggregation phenotype. Taking all these results into account, we conclude that Sa-Lrp is a glutamine-responsive global transcriptional regulator with an additional architectural role.

  3. Saúde bucal coletiva: caminhos da odontologia sanitária à bucalidade

    Directory of Open Access Journals (Sweden)

    Narvai Paulo Capel

    2006-01-01

    Full Text Available O ensaio aborda o surgimento das primeiras atividades odontológicas sob responsabilidade do poder público no Brasil e sua evolução no século XX, enfatizando a emergência do marco referencial denominado odontologia sanitária. Caracteriza, sumariamente, a odontologia social e preventiva e a odontologia de mercado, indicando as principais publicações que se ocuparam dessas correntes. As características essenciais da saúde bucal coletiva e da bucalidade são apresentadas, tecendo-se considerações sobre a articulação da saúde bucal coletiva com a saúde coletiva. Discutem-se as implicações do conceito de bucalidade para a organização da prática odontológica e a necessidade de reorientação do trabalho clínico nos serviços de saúde bucal, no âmbito do Sistema Único de Saúde brasileiro. Indicam-se os elementos essenciais de uma agenda para a saúde bucal coletiva, com base nas proposições apresentadas na 3ª Conferência Nacional de Saúde Bucal.

  4. Necessidades em saúde segundo percepções de pessoas com tuberculose pulmonar

    Directory of Open Access Journals (Sweden)

    Paula Hino

    Full Text Available O presente estudo teve como objetivo conhecer as percepções sobre necessidades em saúde de pessoas com tuberculose pulmonar. Trata-se de estudo qualitativo, desenvolvido no distrito administrativo Capão Redondo, São Paulo. Os dados foram coletados em janeiro de 2010 por meio de entrevista semidiretiva. Foram entrevistadas onze pessoas em tratamento contra tuberculose, com idade mínima de 18 anos e sem limites de cognição. O material empírico foi decodificado a partir de técnica de análise de discurso. As percepções sobre necessidades em saúde estão relacionadas às dificuldades enfrentadas no processo saúde-doença, e o reconhecimento das necessidades em saúde mostrou-se condicionado à vigência do agravo à saúde. As necessidades identificadas decorrem de alterações biológicas, do cotidiano e de insuficiências no processo de produção dos serviços de saúde. A qualidade da assistência às pessoas com tuberculose está, entre outros fatores, condicionada à identificação e ao atendimento de suas necessidades em saúde.

  5. Necessidades em saúde segundo percepções de pessoas com tuberculose pulmonar

    Directory of Open Access Journals (Sweden)

    Paula Hino

    2012-12-01

    Full Text Available O presente estudo teve como objetivo conhecer as percepções sobre necessidades em saúde de pessoas com tuberculose pulmonar. Trata-se de estudo qualitativo, desenvolvido no distrito administrativo Capão Redondo, São Paulo. Os dados foram coletados em janeiro de 2010 por meio de entrevista semidiretiva. Foram entrevistadas onze pessoas em tratamento contra tuberculose, com idade mínima de 18 anos e sem limites de cognição. O material empírico foi decodificado a partir de técnica de análise de discurso. As percepções sobre necessidades em saúde estão relacionadas às dificuldades enfrentadas no processo saúde-doença, e o reconhecimento das necessidades em saúde mostrou-se condicionado à vigência do agravo à saúde. As necessidades identificadas decorrem de alterações biológicas, do cotidiano e de insuficiências no processo de produção dos serviços de saúde. A qualidade da assistência às pessoas com tuberculose está, entre outros fatores, condicionada à identificação e ao atendimento de suas necessidades em saúde.

  6. Controle social do Sistema Único de Saúde: o que pensam os conselheiros municipais de saúde

    Directory of Open Access Journals (Sweden)

    Vera Dib Zambon

    2013-12-01

    Full Text Available Desafios estão presentes para a consolidação da participação da comunidade e este estudo objetiva analisar o controle social na perspectiva dos conselheiros municipais de saúde. Trata-se de estudo de abordagem qualitativa utilizando entrevistas semiestruturadas. Identificou-se que alguns conselheiros não reconhecem a participação social como diretriz do Sistema Único de Saúde. Apesar do reconhecimento dos conselhos como espaços deliberativos, identificam-se dificuldades como a centralização das decisões na gestão, a valorização do saber técnico e a não realização de conferências de saúde. Há limitações no efetivo exercício do papel de conselheiro, dificuldade de interlocução com as bases de representação e de acesso a informações. Aponta-se a necessidade de articulação dos conselheiros e capacitações. Conclui-se pela necessidade de valorização dos espaços colegiados instituídos no Pacto pela Saúde, para fortalecimento do controle social, com destaque à educação permanente em saúde.

  7. Estratégia saúde da família e saúde do trabalhador: um diálogo possível?

    Directory of Open Access Journals (Sweden)

    Francisco Antonio de Castro Lacaz

    Full Text Available Reflete-se sobre a omissão de práticas voltadas para a saúde dos trabalhadores no âmbito de atuação da Estratégia Saúde da Família (ESF e propõe-se a inclusão dessas práticas. Considera-se que a mudança do modelo de atenção médico-centrado exige uma nova abordagem que incorpore a análise de elementos da produção de bens, da circulação e do consumo. Fundamenta-se na teoria da determinação social do processo saúde-doença e nas categorias trabalho e reprodução social. Propõe-se que a incorporação da temática Saúde do Trabalhador (ST na ESF seja realizada pela operacionalização de: um instrumento que levante e analise variáveis e indicadores de reprodução social; um sistema de apoio matricial que integre os Centros de Referência em ST com as Unidades Básicas de Saúde; educação permanente das equipes da ESF em conteúdos de ST.

  8. Intervenções em saúde pública e seu impacto nas desigualdades sociais em saúde

    Directory of Open Access Journals (Sweden)

    José Leopoldo Ferreira Antunes

    2015-06-01

    Full Text Available Este artigo resume a avaliação de três programas de saúde pública em relação à sua eficácia e impacto sobre as desigualdades sociais na saúde. Foram examinadas a fluoração da água de abastecimento público no contexto brasileiro, a provisão de terapêutica antirretroviral para pacientes com Aids e a vacinação de idosos contra a gripe na cidade de São Paulo. As três intervenções foram consideradas efetivas, na medida em que propiciaram uma redução na carga de doença na população. No entanto, elas tiveram resultados conflitantes quanto ao impacto sobre as desigualdades em saúde. Concluiu-se, por fim, que os programas de saúde pública devem ser implementados com um alcance imediata e efetivamente universal, direcionando recursos adicionais aos grupos com mais necessidades de saúde. Essa estratégia reduziria, ao mesmo tempo, o nível geral de doença na população e as desigualdades na experiência de doenças entre os estratos sociais.

  9. Preliminary treatment of bovine mastitis caused by Staphylococcus aureus, with trx-SA1, recombinant endolysin of S. aureus bacteriophage IME-SA1.

    Science.gov (United States)

    Fan, Jindai; Zeng, Zhiliang; Mai, Kaijie; Yang, Yu; Feng, Jiaqi; Bai, Yang; Sun, Baoli; Xie, Qingmei; Tong, Yigang; Ma, Jingyun

    2016-08-15

    Methicillin-resistant Staphylococcus aureus (MRSA) has become a great threat to human and animal health and there is an urgent need to develop novel antibacterial agents to control this pathogen. The objective of this study was to obtain an active recombinant endolysin from the novel bacteriophage (IME-SA1), and conduct an efficacy trial of its effectiveness against bovine mastitis. We isolated a phage that was virulent and specific for S. aureus with an optimal multiplicity of infection of 0.01. Electron microscopy revealed that IME-SA1 was a member of the family Myoviridae, with an isometric head (98nm) and a long contractile tail (200nm). Experimental lysis experiments indicated the phage had an incubation period of 20min with a burst size of 80. When host bacteria were in early exponential growth stages, a multiplicity of infection of 0.01 resulted in a complete bacterial lysis after 9h. The endolysin gene (804bp) was cloned into the pET-32a bacterial expression vector and recombinant endolysin Trx-SA1 was successfully obtained with molecular size of about 47kDa. Preliminary results of therapeutic trials in cow udders showed that Trx-SA1 could effectively control mild clinical mastitis caused by S. aureus. The endolysin Trx-SA1 might be an alternative treatment strategy for infections caused by S. aureus, including MRSA.

  10. Complexidade em Saúde da Família e formação do futuro profissional de saúde

    Directory of Open Access Journals (Sweden)

    Rodrigo Otávio Moretti-Pires

    2009-09-01

    Full Text Available As características do Sistema Único de Saúde (SUS e da Estratégia de Saúde da Família (ESF os aproximam do pensamento complexo, termo que não se refere à adjetivação de fenômeno de aspectos múltiplos, e sim ao marco teórico e epistemológico. Indícios de inadequação da formação dos profissionais de saúde para a atuação em Saúde da Família levaram a proposta de levantar a formação desses profissionais para a abordagem ampliada de saúde implicada no SUS/ESF. Foram realizados grupos focais com acadêmicos de Enfermagem, Medicina e Odontologia da Universidade Federal do Amazonas, analisado sob a perspectiva hermenêutica dialética. Os dados apontaram para a formação reducionista/biomédica nas três profissões assim como o foco no trabalho individual, e não em equipe multiprofissional, quadro inadequado ao SUS/ESF, que preconiza atuação profissional focada na complexidade do entorno sócioeconômico e antropológico dos usuários do sistema.

  11. Condicionalidades em saúde do programa Bolsa Família – Brasil: uma análise a partir de profissionais da saúde

    Directory of Open Access Journals (Sweden)

    Alice Teles de Carvalho

    2014-12-01

    Full Text Available Este estudo apresenta a percepção de profissionais de equipes de Saúde da Família de municípios do Nordeste do Brasil acerca das mudanças na vida das famílias participantes do programa Bolsa Família, da relação destas com os serviços de saúde e do impacto na dinâmica de trabalho dos profissionais, a partir do acompanhamento das condicionalidades de saúde do programa Bolsa Família. As informações foram obtidas por meio de entrevistas semiestruturadas e encontros de grupo focal. Os profissionais acreditam que o programa ocasionou mudanças favoráveis na vida das famílias participantes, como a redução da pobreza, o aumento da frequência escolar das crianças e mudanças positivas na relação entre as famílias participantes e os serviços de saúde. No entanto, relataram dificuldades de caráter organizacional no acompanhamento das condicionalidades, sobretudo devido ao aumento da demanda de trabalho. É importante que as condicionalidades de saúde proporcionem oportunidades para a realização de ações que visem ao empoderamento e autonomia dos sujeitos quanto ao autocuidado e desenvolvimento da cidadania.

  12. Dinâmica do capital e sistemas locais de saúde: em busca de uma análise integradora do setor saúde

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Siliansky de Andreazzi

    2006-06-01

    Full Text Available Apresenta-se uma proposta metodológica direcionada à análise dos determinantes da oferta de atenção à saúde, com base na dinâmica da acumulação de capital a ser agregada aos elementos de definição das políticas de saúde mais convencionalmente empregados na área da Saúde Coletiva. A análise está baseada nos conceitos e métodos da Economia Industrial, já testados para o setor saúde em trabalhos desenvolvidos no âmbito europeu e por pesquisadores da CEPAL, aos quais se propõem agregar variáveis do contexto geral, que condicionam possibilidades e impõem limites às estratégias dos agentes locais, e análises de corte histórico que permitam identificar rugosidades. Destina-se a apoiar os gestores do SUS, estaduais e municipais, na sua atribuição de comando único do setor saúde sobre um determinado território, o que inclui o conjunto das possibilidades de regulação do setor privado - do planejamento da oferta ao controle de qualidade.

  13. SA BASED SOFTWARE DEPLOYMENT RELIABILITY ESTIMATION CONSIDERING COMPONENT DEPENDENCE

    Institute of Scientific and Technical Information of China (English)

    Su Xihong; Liu Hongwei; Wu Zhibo; Yang Xiaozong; Zuo Decheng

    2011-01-01

    Reliability is one of the most critical properties of software system.System deployment architecture is the allocation of system software components on host nodes.Software Architecture (SA)based software deployment models help to analyze reliability of different deployments.Though many approaches for architecture-based reliability estimation exist,little work has incorporated the influence of system deployment and hardware resources into reliability estimation.There are many factors influencing system deployment.By translating the multi-dimension factors into degree matrix of component dependence,we provide the definition of component dependence and propose a method of calculating system reliability of deployments.Additionally,the parameters that influence the optimal deployment may change during system execution.The existing software deployment architecture may be ill-suited for the given environment,and the system needs to be redeployed to improve reliability.An approximate algorithm,A*_D,to increase system reliability is presented.When the number of components and host nodes is relative large,experimental results show that this algorithm can obtain better deployment than stochastic and greedy algorithms.

  14. em saúde e doença mental

    Directory of Open Access Journals (Sweden)

    Neuza Maria de Fátima Guareschi

    2008-01-01

    Full Text Available This article aims at discussing social vulnerability from an experiment carried out with users of the Day-Hospital Program. This program, proposed by Sistema Único de Saúde, is a strategy directed towards another social agency of madness, distinct from the model of the hospice culture, with health practices that may lead to social exclusion and stigma. This study has been structured from a weekly activity developed in a Day-Hospital of a public general hospital in Rio Grande do Sul, through participative observations’. The group was constituted as a speech space in which users could talk about daily practices, sharing different ways of thinking and feeling the experience of psychic distress. Aiming at debating upon how the condition of social vulnerability has been produced in carriers of psychic distress, we have considered discursive practices of mental health public policies, from the Psychiatric Reform, as well as the notion of performativity in the production of mental health/disease. The forms these subjects think of and recognize both themselves and the world become visible through certain identity marks that constitute them as mentally ill. Even being a program situated in the field of the Psychiatric Reform, the Day-Hospital is still crossed by meanings from both the hospital-centered psychiatric discourse about madness and the medicamentous therapeutic practice, which have inscribed ways of subjects living mental health/disease with strict possibilities of subjectifying themselves out of this logic.

  15. Saúde bucal no Brasil Oral health in Brazil

    Directory of Open Access Journals (Sweden)

    Vitor Gomes Pinto

    1983-08-01

    Full Text Available Apresenta-se um retrato sobre a saúde bucal no Brasil, com ênfase em informações relativas à situação econômica e epidemiológica, prevenção da cárie dental, recursos humanos, montante de gastos financeiros e estrutura de prestação de serviços. O país mostra quadro típico de uma área em desenvolvimento, com elevada incidência de problemas, crescente oferta de cirurgiões-dentistas e difícil acesso aos serviços ofertados mormente face a barreiras de ordem econômica. Visando expandir cuidados odontológicos e reduzir a incidência dos principais problemas, propõe-se um programa de serviços básicos de âmbito nacional.The oral health situation in Brazil is described, with special emphasis on data relating to the economic and epidemiological situation, caries prevention, human resources, health expenditure and dental care structure. The country presents a picture typical of a developing area, with high disease rates, an increase in the offer of dentists and access to dental care hindered principally by economic barriers. A comprehensive program of basic services in odontology is proposed, with the objective of expanding dental care and reducing the incidence of more prevalent problems.

  16. PRODUCTIVITY AND QUALITY: A STRATEGY FOR THE SA DEFENCE FORCE

    Directory of Open Access Journals (Sweden)

    R. Eberlein

    2012-02-01

    Full Text Available In recent times the SA Defence Force (SADF has been bombarded with a variety of methods and approaches to the improvement of productivity, financial savings and, most recently, for quality of work life or quality assurance. Various approaches have included the concepts of Total Quality Management (TQM, Quality Circles (and variants in the guise of Triads and others, Methodology, Unit Management Systems, Cost Control Systems, Deterministic Productivity Accounting and the Iike. There have been many benefits to be found in these various approaches, each of which concentrates on certain aspects of productivity. That there have been great achievements in productivity in the SADF is a matter of record, a record which is reflected in a National Award for Productivity, a smaller more efficient SADF, and a reputation for submitting more recommendations for improvements than other departments in the Public Service. At a more personal level though, the writer has gained the impression that no or very little attempt has been made to integrate selected aspects of these approaches into an overall "productivity” strategy acceptable to the SADF. That there is a need for such an overall strategy is clear from the sentiments expressed recently by the members of the SADF's Productivity Co-ordination Committee when attempting to indicate the way ahead to even greater productivity in the SADF (Meeting, January 1991. In this paper a strategy for the improvement of productivity and the quality of work life which is acceptable to the SADF is proposed.

  17. AUTOMATIZACIÓN DE OFICINAS S.A.

    Directory of Open Access Journals (Sweden)

    Luis Carlos Diaz Osorio

    1998-01-01

    Full Text Available El caso muestra la situación de Automatización de Oficinas S.A., una empresa de gran trayectoria nacional, orientada a la comercialización de muebles y equipos para oficina. A principios de la década pasada, comenzó a comercializar microcomputadoras y elementos de conectividad de redes, manejando grandes márgenes por ser monopolio, aprovechando los beneficios de importación que le otorgaba el ser exportador de muebles. En el momento en que se abren las importaciones, más de doscientas empresas entran a competir en el mercado de los microcomputadores, llegando incluso a manejar márgenes de hasta el 10%. Las ventas de la empresa han bajado a niveles alarmantes, incluso se cree que únicamente compran empresas allegadas a los directivos o personas que no conocen nada del tema de los computadores. La situación puntual es la toma de decisión de las estrategias para ser competitivos o decidir salir del mercado de los PC. La orientación que hemos decidido darle al caso es “fijación de precios”.

  18. Can Diuretics Decrease Your Potassium Level?

    Science.gov (United States)

    ... and Conditions High blood pressure (hypertension) Can diuretics decrease your potassium level? Answers from Sheldon G. Sheps, ... D. Yes, some diuretics — also called water pills — decrease potassium in the blood. Diuretics are commonly used ...

  19. A revista Saúde em Debate como fonte e objeto de estudo

    OpenAIRE

    Sophia,Daniela Carvalho

    2013-01-01

    A presente nota de pesquisa busca divulgar estudo sobre o Centro Brasileiro de Estudos da Saúde e o movimento de reforma sanitária desenvolvido no âmbito do Programa de História das Ciências e da Saúde Pública da Casa de Oswaldo Cruz. Atém-se à revista Saúde em Debate , periódico do Centro, devido à relevância que teve na área ao longo dos dez anos de publicação. A utilização da revista na pesquisa deu ...

  20. Qualidade em saúde: que trajetos de formação dos enfermeiros?

    OpenAIRE

    Pinho, Carla Amorim

    2012-01-01

    ENQUADRAMENTO: A avaliação da qualidade dos serviços de saúde, a crescente melhoria do desempenho dos profissionais, e a monitorização sistemática das atividades desenvolvidas pelas instituições de saúde, potenciam a qualidade dos cuidados prestados. A intervenção dos enfermeiros e dos restantes profissionais de saúde é imprescindível na promoção desta qualidade conforme defendem os diversos modelos da sua gestão. Para a generalidade destes, considera-se que a supervisão clí...

  1. Oficina de trabalho corporal em um serviço de saúde mental

    OpenAIRE

    Carolina Cristina do Nascimento

    2011-01-01

    Com a reforma psiquiátrica surgiram novos serviços substitutivos na assistência à saúde mental, bem como novas propostas de estratégias de tratamento no processo de reabilitação psicossocial às pessoas em sofrimento psíquico. São possibilidades de assistência que tipificaram os serviços em saúde mental, como Oficinas Terapêuticas, dentre outras designações. As oficinas em saúde mental correspondem a atividades grupais de socialização e expressão, privilegiando a singularidade e subjetividade ...

  2. A autonomia do paciente no processo terapêutico como valor para a saúde

    OpenAIRE

    Jussara Calmon Reis de Souza Soares; Kenneth Rochel de Camargo Jr.

    2007-01-01

    No presente artigo analisam-se as críticas à concepção reducionista de saúde e doença da biomedicina, buscando contribuir para um repensar sobre saúde em uma vertente de proposições positivas. Remetemo-nos, sobretudo, à epistemologia de Canguilhem, para destacar pontos fundamentais na discussão sobre saúde, integrando-a a uma nova leitura do conceito de autonomia do paciente no processo terapêutico. O método de análise seguiu a perspectiva do pensamento complexo. Nesta perspectiva, a autonomi...

  3. Normal-patológico, saúde-doença: revisitando Canguilhem

    OpenAIRE

    Coelho, Maria Thereza Ávila Dantas; Almeida Filho, Naomar de

    1999-01-01

    Este artigo pretende reavaliar a obra de G. Canguilhem sobre a normalidade, a saúde, a doença e a patologia. Discute inicialmente a crítica canguilhemiana da abordagem positivista da dicotomia normal-patológico, avaliando-a como insatisfat6ria porque reafirma a disjunção qualitativo-quantitativo. Analisa ainda a distinção entre normalidade e saúde, juntamente com a proposição da saúde como capacidade normativa. Por fim, apresenta a reflexão ética pioneira de Canguilhem sobre a engenharia gené...

  4. Saúde Masculina: representação e experiência de homens trabalhadores com o corpo, saúde e doença.

    Directory of Open Access Journals (Sweden)

    Marco Antonio Alves SEPARAVICH

    2015-10-01

    Full Text Available Este estudo analisou as experiências e representações de homens trabalhadores com o corpo, saúde, doença e cuidado, e os problemas principais de saúde por eles percebidos, quais sejam, a hipertensão arterial e as lombalgias crônicas. Analisou-se como explicam as suas causas; a forma como enfrentam e buscam a resolução ou mitigação desses problemas de saúde, as terapêuticas utilizadas, a interferência que elas acarretam em suas rotinas de vida e identidades. A revisão da literatura da Saúde Coletiva sobre a saúde do homem e masculinidades mostrou que as demandas masculinas na busca por tratamentos nos serviços públicos de saúde e a percepção de que são portadores de necessidades específicas de saúde são minoritárias. Constatou-se também que as abordagens socioantropológicas de como eles convivem e lidam com as enfermidades que os acometem também são raras. Justifica-se, portanto, o interesse e as razões que motivaram este trabalho. As demandas minoritárias masculinas aos serviços de saúde, concebidas a partir da masculinidade tradicional socialmente vigente, e os dados epidemiológicos das altas taxas de morbimortalidade masculina, embasaram a formulação da Política Nacional de Atenção Integral à Saúde do Homem (PNAISH, cujos objetivos buscam promover a melhora da saúde da população masculina na faixa etária dos 20 aos 59, facilitando o seu acesso aos serviços de atendimento integral à saúde na atenção primária. Campinas abriga projeto piloto de tal política. Analisou-se o processo de implementação da PNAISH em um dos centros de saúde da cidade elegido como piloto, cujos serviços estruturam-se na Estratégia Saúde da Família. Entrevistou-se 9 profissionais que nele atuam, especificamente na saúde do adulto, considerando o conhecimento que têm de tal política, as atividades que realizam para o seu atendimento, e os obstáculos observados que dificultam a sua implementação. Para o

  5. Caracterização das atividades de enfermagem em saúde coletiva desenvolvidas na regional norte de saúde do Distrito Federal

    Directory of Open Access Journals (Sweden)

    Helena Eri Shimizu

    Full Text Available O estudo teve como objetivo identificar e analisar as ações desenvolvidas pela equipe de enfermagem em saúde coletiva na Regional Norte de Saúde do Distrito Federal. Para a coleta de dados aplicou-se um questionário com a descrição das diversas atividades cotidianas da assistência a 29 enfermeiras, 91 auxiliares de enfermagem e 42 agentes de saúde. Para a melhor compreensão de como as atividades são desenvolvidas realizou-se grupos focais com cada uma das categorias profissionais. Os resultados mostram que todos elementos da equipe empregam grandes esforços para organizar, controlar e atender a demanda espontânea e ainda executar as atividades de auxilio às ações médicas, consequentemente priorizam o atendimento individual em detrimento do coletivo.

  6. A saúde mental no contexto da Estratégia Saúde da Família no Brasil

    OpenAIRE

    2015-01-01

    São discutidas as concepções sobre saúde mental e loucura e os modos de funcionamento das equipes de Estratégia Saúde da Família (ESF) associadas a essas concepções em duas unidades da rede básica de saúde das cidades de Natal –capital no nordeste brasileiro- e Porto Alegre –capital do extremo sul do país. O referencial teórico-metodológico da análise institucional foi utilizado para tratamento das informações levantadas através da realização de 40 entrevistas com os profissionais da unidade ...

  7. Concepções de saúde de mulheres cuidadoras-leigas : estratégias à sua promoção da saúde

    OpenAIRE

    2007-01-01

    A situação das mulheres cuidadoras-leigas, acompanhantes de crianças hospitalizadas, representa nesse estudo, a sua visão em relação à saúde, a qualidade da atenção dispensada a elas pelos profissionais e as políticas públicas de saúde instituídas em um ambiente hospitalar. Trata-se de uma pesquisa qualitativa do tipo descritivo-exploratório e intervencionista desenvolvida em um hospital-escola na cidade de Porto Alegre/RS, que objetivou conhecer as concepções de saúde de mulheres cuidadoras-...

  8. Da Saúde Pública às Políticas Saudáveis — Saúde e Cidadania na Pós-modernidade

    Directory of Open Access Journals (Sweden)

    Antônio Ivo de Carvalho

    1996-01-01

    Full Text Available O artigo discute alternativas para o futuro da Saúde Pública, nos marcos do pensamento e das exigências da pós-modernidade. Apresenta os avanços sanitários alcançados na época moderna, e aborda os efeitos mórbidos da tecno-ciência. Com base nos aportes do pensamento pós-moderno, propõe uma agenda de desafios a serem enfrentados pela nova Saúde Pública. Especificamente, propõe novos aportes conceituais para lidar com as relações subjetivo-objetivo e coletivo-individual no campo sanitário. Discute, ainda, as condições e possibilidades de que a proposta de Políticas Saudáveis possa apontar para uma renovação da identidade da saúde pública.

  9. Saúde do homem e masculinidades na Política Nacional de Atenção Integral à Saúde do Homem: uma revisão bibliográfica

    Directory of Open Access Journals (Sweden)

    Marco Antonio Separavich

    2013-06-01

    Full Text Available Este artigo, orientado pela teoria do gênero sobre masculinidades, revisa os textos que trataram do tema nos periódicos de Saúde Coletiva/Saúde Pública no período de 2005-2011. Os eixos temáticos encontrados coincidem com as prioridades conferidas pela Política Nacional de Atenção Integral à Saúde do Homem, criada pelo Ministério da Saúde em 2008. São eles: o acesso dos homens aos serviços de saúde, sexualidade, saúde reprodutiva, violência e os principais agravos à saúde masculina, contextualizados à luz dos determinantes sociais da saúde. Tais determinantes se baseiam em um tipo de masculinidade tradicional concebida como hegemônica, que apesar de comprometer a saúde masculina, não é o tipo único de masculinidade existente na sociedade. As diferentes masculinidades encontram-se imbricadas no processo saúde/doença vivido pelos homens. Elas devem ser consideradas na busca da adesão dos homens aos serviços de saúde.

  10. Ether modifications to 1-[2-(3,4-dimethoxyphenyl)ethyl]-4-(3-phenylpropyl)piperazine (SA4503): effects on binding affinity and selectivity for sigma receptors and monoamine transporters.

    Science.gov (United States)

    Xu, Rong; Lord, Sarah A; Peterson, Ryan M; Fergason-Cantrell, Emily A; Lever, John R; Lever, Susan Z

    2015-01-01

    Two series of novel ether analogs of the sigma (σ) receptor ligand 1-[2-(3,4-dimethoxyphenyl)ethyl]-4-(3-phenylpropyl)piperazine (SA4503) have been prepared. In one series, the alkyl portion of the 4-methoxy group was replaced with allyl, propyl, bromoethyl, benzyl, phenethyl, and phenylpropyl moieties. In the second series, the 3,4-dimethoxy was replaced with cyclic methylenedioxy, ethylenedioxy and propylenedioxy groups. These ligands, along with 4-O-des-methyl SA4503, were evaluated for σ1 and σ2 receptor affinity, and compared to SA4503 and several known ether analogs. SA4503 and a subset of ether analogs were also evaluated for dopamine transporter (DAT) and serotonin transporter (SERT) affinity. The highest σ1 receptor affinities, Ki values of 1.75-4.63 nM, were observed for 4-O-des-methyl SA4503, SA4503 and the methylenedioxy analog. As steric bulk increased, σ1 receptor affinity decreased, but only to a point. Allyl, propyl and bromoethyl substitutions gave σ1 receptor Ki values in the 20-30 nM range, while bulkier analogs having phenylalkyl, and Z- and E-iodoallyl, ether substitutions showed higher σ1 affinities, with Ki values in the 13-21 nM range. Most ligands studied exhibited comparable σ1 and σ2 affinities, resulting in little to no subtype selectivity. SA4503, the fluoroethyl analog and the methylenedioxy congener showed modest six- to fourteen-fold selectivity for σ1 sites. DAT and SERT interactions proved much more sensitive than σ receptor interactions to these structural modifications. For example, the benzyl congener (σ1Ki=20.8 nM; σ2Ki=16.4 nM) showed over 100-fold higher DAT affinity (Ki=121 nM) and 6-fold higher SERT affinity (Ki=128nM) than the parent SA4503 (DAT Ki=12650 nM; SERT Ki=760 nM). Thus, ether modifications to the SA4503 scaffold can provide polyfunctional ligands having a broader spectrum of possible pharmacological actions.

  11. Does Salicylic Acid (SA) Improve Tolerance to Salt Stress in Plants? A Study of SA Effects On Tomato Plant Growth, Water Dynamics, Photosynthesis, and Biochemical Parameters.

    Science.gov (United States)

    Mimouni, Hajer; Wasti, Salma; Manaa, Arafet; Gharbi, Emna; Chalh, Abdellah; Vandoorne, Bertrand; Lutts, Stanley; Ben Ahmed, Hela

    2016-03-01

    Environmental stresses such as salinity directly impact crop growth, and by extension, world food supply and societal prosperity. It is estimated that over 800 million hectares of land throughout the world are salt-affected. In arid and semi-arid regions, salt concentration can be close to that in the seawater. Hence, there are intensive efforts to improve plant tolerance to salinity and other environmental stressors. Salicylic acid (SA) is an important signal molecule for modulating plant responses to stress. In the present study, we examined, on multiple plant growth related endpoints, whether SA applied through the rooting medium could mitigate the adverse effects of salinity on tomato (Solanum lycopersicum) cv. Marmande. The latter is a hitherto understudied tomato plant from the above perspective; it is a classic variety that produces the large ribbed tomatoes in the Mediterranean and consumed worldwide. We found salt stress negatively affected the growth of cv. Marmande tomato plants. However, the SA-treated plants had greater shoot and root dry mass, leaf area compared to untreated plants when exposed to salt stress. Application of SA restores photosynthetic rates and photosynthetic pigment levels under salt (NaCl) exposure. Leaf water, osmotic potential, stomatal conductance transpiration rate, and biochemical parameters were also ameliorated in SA-treated plants under saline stress conditions. Overall, these data illustrate that SA increases cv. Marmande tomato growth by improving photosynthesis, regulation and balance of osmotic potential, induction of compatible osmolyte metabolism, and alleviating membrane damage. We suggest salicylic acid might be considered as a potential growth regulator to improve tomato plant salinity stress resistance, in the current era of global climate change.

  12. O complexo industrial da saúde e a necessidade de um enfoque dinâmico na economia da saúde

    Directory of Open Access Journals (Sweden)

    Carlos Augusto Grabois Gadelha

    2003-01-01

    Full Text Available O artigo desenvolve um enfoque analítico voltado para o estudo do complexo industrial da saúde, englobando o conjunto das atividades produtivas e suas relações de interdependência, segundo uma perspectiva de economia política e da inovação. A lógica empresarial capitalista penetra em todos os segmentos produtivos, envolvendo tanto as indústrias que já operavam tradicionalmente nessas bases quanto segmentos que possuíam formas de organização em que era possível verificar a convivência de lógicas empresariais com outras que dela se afastavam, como a produção de vacinas e produtos biológicos, fitoderivados e a prestação de serviços de saúde. O artigo analisa a interação entre o sistema de saúde e o sistema econômico-industrial, mostrando como tem havido uma dicotomia na relação entre ambos, que se exprime na deterioração do potencial de inovação do país e numa crescente e preocupante vulnerabilidade externa da política de saúde. Sugere-se que o enfoque neoclássico tradicional da economia da saúde é insuficiente para tratar do complexo industrial da saúde, dada a intensidade do processo de mudança estrutural, e a necessidade de um enfoque teórico alternativo que incorpore a dinâmica de transformação econômica e institucional, de acumulação e de inovação.

  13. Perfil social do usuário do sistema único de saúde na atenção primária em saúde

    Directory of Open Access Journals (Sweden)

    Aline Braido Pereira

    2012-01-01

    Full Text Available O Sistema Único de Saúde (SUS foi criado como uma política para toda população. Conhecer o perfil de seu usuário é de fundamental importância para sua organização. Sendo assim, o objetivodessa pesquisa foi delinear o perfil social do usuário do SUS na Atenção Básica em Saúde de Santa Maria/RS. Métodos: Pesquisa descritiva, realizada em uma Estratégia de Saúde da Família ( ESF e uma Unidade Básica de Saúde (UBS de Santa Maria/RS no período de março a abril de 2010, onde foram incluídos usuários adultos, de ambos os gêneros. Resultados: Um total d e 1 12 u suários participaram da pesquisa. A grande procura pelo serviço de saúde foi à emergência/urgência, com relação a opinião em relação ao SUS, 60% dos usuários da UBS consideram o SUS ruim e 40,4% dos usuários da ESF consideraram bom. Conclusão: Cabe aos trabalhadores, usuários e apoiadores de uma teoria sobre a produção de saúde, tratar de construir projetos objetivando as necessidades, bem como dos meios necessários para atendê-las.

  14. Pesquisa em saúde, política de saúde e eqüidade na América Latina

    Directory of Open Access Journals (Sweden)

    Alberto Pellegrini Filho

    2004-06-01

    Full Text Available O autor analisa as relações entre pesquisa de saúde, políticas de saúde e eqüidade na América Latina. Descreve novas tendências no modo de produção do conhecimento, que permitem maior integração entre as necessidades sociais e a pesquisa, facilitando o vínculo entre esta e o processo de definição de políticas. Analisa as manifestações das novas tendências na América Latina e finaliza com a descrição de algumas iniciativas promovidas pela OPAS no sentido de aproveitar as oportunidades abertas pelas novas tendências para a melhoria das condições de saúde na região. Busca defender a tese de que a informação e o conhecimento são bens públicos essenciais e que as iniqüidades de acesso a esses bens são importantes determinantes das iniqüidades em saúde. Para que as políticas de saúde e as políticas de pesquisa em saúde se integrem e se consolidem como políticas públicas voltadas a atender ao interesse público e à promoção da eqüidade, é necessário o fortalecimento do processo democrático de definição das mesmas, multiplicando os atores envolvidos, os espaços e oportunidades de interação entre eles e instrumentando sua participação com o acesso eqüitativo a informações e conhecimentos científicos pertinentes que permitam a defesa fundamentada de seus interesses.

  15. BiodanÃa e SaÃde Percebida: um Olhar BiocÃntrico sobre a SaÃde

    OpenAIRE

    Kelen Gomes Ribeiro

    2008-01-01

    Diante da constataÃÃo de uma grande quantidade de abordagens de desenvolvimento humano e de terapias existentes e praticadas no Brasil, atendendo a uma considerÃvel parcela da demanda social relativa aos cuidados com a saÃde dos indivÃduos, consideramos relevante estudar uma abordagem que se coloca como novidade no campo da SaÃde: o Sistema BiodanÃa. A escolha por esse Sistema ocorreu tambÃm devido à nossa afinidade com o mesmo e ao fato de termos realizado pesquisa de iniciaÃÃo cientÃfica so...

  16. Double Band CDMA/AMPS Down Frequeney Converter SA9500%双频段CDMA/AMPS下变频器SA9500

    Institute of Scientific and Technical Information of China (English)

    张颖光; 李斌涛

    2000-01-01

    双频段CDMA/AMPS下变频器集成电路SA9500集成了用于双频段、三模式CDMA/AMPS蜂窝移动通信电话手机所必需的所有前端接收混频器,可工作于高频段1900MHz PCS CDMA和低频段800MHz CDMA蜂窝移动通信系统,或模拟模式的FM AMPS/TACS中.本文介绍了SA9500的原理、特点与典型应用.

  17. Condições de saúde bucal de industriários participantes de Programa de Saúde Bucal na Empresa

    OpenAIRE

    Luísa Silva Lima; Maristela Santos Araújo; Paloma Perez Castro; Maria Cristina Teixeira Cangussu

    2015-01-01

    Resumo Objetivo: verificar as condições de saúde bucal de trabalhadores de cinco indústrias da região metropolitana de Salvador, Bahia, que participavam do Programa de Saúde Bucal na Empresa (PSBE) entre os anos 2003 a 2008. Métodos: estudo transversal retrospectivo, com dados secundários do banco de dados do SESI/DR-BA. Participaram todos os funcionários que realizaram pelo menos dois exames odontológicos no período, totalizando 1.277 trabalhadores. Foram investigados dados sociodemográficos...

  18. GERDAU S.A.: a empresa brasileira mais internacionalizada

    Directory of Open Access Journals (Sweden)

    EVA STAL

    2007-07-01

    Full Text Available Muitas empresas dos países em desenvolvimento não se consideram aptas a explorar outrosmercados devido à distância tecnológica entre as empresas globais e os seus padrões locais. Oartigo mostra que existe espaço para a inovação empresarial oriunda de países emdesenvolvimento, e ela é um dos principais fatores responsáveis pelo sucesso de suasempresas na conquista do mercado mundial. Descreve o processo de expansão internacionalda Gerdau S.A., que começou com exportações e evoluiu para a aquisição de empresassiderúrgicas na América Latina, América do Norte e Europa, num total de 32 usinas em 10países, sendo 21 no exterior, que empregam mais de 32 mil funcionários. Hoje, a empresapossui valor de mercado estimado em 10 bilhões de dólares e 111.000 acionistas. Analisa-sesua estratégia de internacionalização à luz das teorias econômicas, comportamentais eestratégicas e verifica-se que a trajetória internacional pode ser explicada por aspectoscaracterísticos de cada uma dessas teorias. Um traço importante na cultura da empresa é atransferência de seu modelo de negócios, estrutura, valores e tecnologia para as empresasadquiridas, sem deixar de considerar as necessárias adaptações às culturas locais.

  19. Kuu plaat : Lauri Saatpalu ja Katrin Mandel "Sa oled hea". Plaadid kauplusest Lasering

    Index Scriptorium Estoniae

    2005-01-01

    Heliplaatidest: Lauri Saatpalu ja Katrin Mandel "Sa oled hea", Goldfrapp "Supernature", Ultima Thule "Ingel ja suli", Sigur Ros "Takk...", Franz Ferdinand "You Could Have It So Much Better", Ans.Andur "Tuled peale"

  20. Políticas de saúde e blocos econômicos

    OpenAIRE

    André Medici; Bernardo Barros Weaver

    2007-01-01

    O Artigo "Políticas de saúde e blocos econômicos" trata da integração de sistemas de saúde dentro de blocos econômicos. Entretanto, a obra não é restrito aos temas de saúde. Tópicos como proteção ao imigrante intra-regional, e extra-regional também são abordados. Dentro do tópico de proteção ao trabalhador, vêm os temas de pensão: Modelos de aposentadoria para o trabalhador imigrante na Europa e nos EUA. O direito do cidadão de um bloco econômico de ir e vir, garantido não só o acesso à saúde...

  1. BengaSaVex: A new computational genetic sequence extraction tool ...

    African Journals Online (AJOL)

    BengaSaVex : A new computational genetic sequence extraction tool for DNA repeats. ... AFRICAN JOURNALS ONLINE (AJOL) · Journals · Advanced Search ... This research aimed to develop new tools for extracting DNA repeats from the ...

  2. A construção de um modelo de saúde complexo e transdisciplinar

    Directory of Open Access Journals (Sweden)

    Regina Stella Spagnuolo

    2005-02-01

    Full Text Available A saúde como um estado dinâmico coerente e construtivo do ser vivo é o fundamento da proposta deste texto. Nessa ótica, uma visão sistêmica e integrativa do ser humano a ser cuidado na prática diária da saúde está sendo proposta com base nos conceitos de pesquisadores e educadores das últimas décadas. Conceitos de caos, complexidade, transdisciplinaridade e auto-organização são introduzidos e fazem mais sentido como temas orientadores dos procedimentos sugeridos. Maneiras de promover a saúde assim compreendida são discutidas em algumas situações práticas, incluindo o atual programa oficial da Estratégia da Saúde da Família.

  3. SA-MAC:Self-Stabilizing Adaptive MAC Protocol for Wireless Sensor Networks

    Institute of Scientific and Technical Information of China (English)

    波澄; 韩君泽; 李向阳; 王昱; 肖波

    2014-01-01

    A common method of prolonging the lifetime of wireless sensor networks is to use low power duty cycling protocol. Existing protocols consist of two categories: sender-initiated and receiver-initiated. In this paper, we present SA-MAC, a self-stabilizing adaptive MAC protocol for wireless sensor networks. SA-MAC dynamically adjusts the transmission time-slot, waking up time-slot, and packet detection pattern according to current network working condition, such as packet length and wake-up patterns of neighboring nodes. In the long run, every sensor node will find its own transmission phase so that the network will enter a stable stage when the network load and qualities are static. We conduct extensive experiments to evaluate the energy consumption, packet reception rate of SA-MAC in real sensor networking systems. Our results indicate that SA-MAC outperforms other existing protocols.

  4. 马兰士 SA-13S2 SACD/CD播放机

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    SA-13S2内部的规划十分整齐,所使用的激光读取模组是新开发的SACDM-10.有厚达2mm的钢板作为机箱底座.再加上新开发的SACDM-10激光读取机构。光碟的读出精度有很大的提升,同时还减轻噪音辐射。SA-13S2采用了马兰士公司独家开发的HDAM模组,同样配备了马兰士SACD播放机SA-7S1采用的著名的第二代HDAM(High Definition Amplifier Module)SA2放大模组。

  5. O sistema social da saúde: conceito, limites e possibilidades

    Directory of Open Access Journals (Sweden)

    Sandra Regina Martini Vial

    2014-06-01

    Full Text Available Discutem-se as possibilidades de definir o sistema da saúde como um sistema social, diferenciado funcionalmente, a partir da ótica da Teoria dos Sistemas Sociais, utilizando os pressupostos gerais da Teoria e a estrutura apresentada por Niklas Luhmann sobre o sistema médico. Apresentam-se alguns “desassossegos” provocados pela Teoria; as possíveis relações entre o sistema da saúde e o que Luhmann chamou de sistema médico e como esse sistema, atualmente, pode ser considerado sistema da saúde; e, por fim, a nossa concepção do sistema da saúde na atualidade.

  6. Data of evolutionary structure change: 1A4SA-2ONNF [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A4SA-2ONNF 1A4S 2ONN A F AQLVDSMPSASTGSVVVTDDLNYWGGRRIKSKDGATTEP...KVMEMSAK-TVKHVTLELGGKSPLLIFKDCELENAVRGALMANFLTQGQVCTNGTRVFVQREIMPQFLEEVVKRTKAIVVG...ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEA...HHHHH ------ EEE EEEEEE HHHHHHHH EEEE HHHHHHHHHH EEE GGG EEE GGG EEEEEEEEE -- ... 2ONN F 2ONNF

  7. In Memoriam, Doctor Saúl Rugeles Moreno

    Directory of Open Access Journals (Sweden)

    Carlos Cortés C.

    1994-06-01

    Full Text Available

    Académico Correspondiente

    El pasado cinco de noviembre falleció súbitamente en su tierra natal el Dr. Saúl Rugeles Moreno. Para las nuevas generaciones distantes de la comunidad socorrana, quizá éste nombre no les signifique mucho, pero sí para quienes lo conocimos, lo admiramos y fuimos afortunados de contar con su amistad. Saúl no ejerció en la Capital y pertenecía al grupo de aquellos colegas que por no tener asiento en los centros de docencia, se les ignora, como si sólo existiese la medicina teórica de las universidades, desconociéndose que hay en todo cuerpo médico un grupo silencioso de discípulos de Galeno, que lejos del ruido que brindan los computadores y toda la tecnología moderna, desempeñan una irremplazable labor a otro nivel, ya sea en la periferia de las áreas metropolitanas, de los Institutos municipales de salud y en la provincia, principalmente. Algunos de ellos forman a una generación, cada vez más diezmada pues el tiempo no pasa en vano.

    Ejercen una medicina integral y práctica que a todo encuentra solución, sin traspasar los límites de la temeridad; no dan cátedras magistrales pero ejercen la docencia con el ejemplo; pues también se enseña viviendo honestamente; no han publicado muchos artículos médicos o quizás ninguno, pues con su ejemplo lo han dicho todo. Van a los Congresos Médicos porque les nace estar actualizados; son respetuosos en el trato con sus colegas y no murmuran de ellos pues nunca consideran sus intereses lesionados y como han sido buenos en el sentido evángelico de la palabra, así piensan de los demás.

    Son sencillos en sus comentarios que siempre matizan con su larga experiencia profesional, sin hacer alarde de que en verdad saben. Su afán de servicio los ha llevado a incursionar en otros campos diferentes al médico; actúan también como consejeros y sienten como propia la problemática del medio en el cual actúan, pues para todo tienen tiempo ya

  8. 出口企业应关注SA8000标准认证

    Institute of Scientific and Technical Information of China (English)

    李志军

    2004-01-01

    @@ 一、SA8000标准的宗旨与主要内容 SA8000标准(Social Accountability 8000)是根据国际劳工组织(ILO)公约、联合国儿童权利公约及世界人权宣言制定的,其宗旨是为了保护劳工基本权益.

  9. Planos privados de assistência à saúde: cobertura populacional no Brasil

    Directory of Open Access Journals (Sweden)

    Luiz Felipe Pinto

    Full Text Available Foram utilizados o Cadastro de Beneficiários da Agência Nacional de Saúde Suplementar (ANS e a Pesquisa Nacional por Amostra de Domicílios (PNAD/IBGE para descrever o perfil da cobertura dos serviços por planos privados de saúde. Apesar da regulação pela ANS, não se deve perder de vista que o acesso, a utilização e a cobertura populacional em planos de saúde precisam ser periodicamente monitorados, principalmente na região Sudeste, que concentra 70% da população coberta por planos de saúde. Também são necessários estudos mais detalhados sobre as capitais brasileiras, que constituem grandes centros de concentração de clientela; e investigações para os subgrupos etários que mais utilizam os serviços de saúde: crianças menores de 5 anos, mulheres em idade fértil e idosos. Os resultados do estudo indicam que, no Sistema de Saúde Brasileiro, os planos privados de assistência à saúde se configuram como mais um fator de geração de desigualdades sociais no acesso e na utilização de serviços de saúde, pois cobrem apenas uma parcela específica da população brasileira: pessoas de maior renda familiar, de cor branca, com maior nível de escolaridade, inseridas em determinados ramos de atividade do mercado de trabalho, moradores das capitais/regiões metropolitanas.

  10. Planos privados de assistência à saúde: cobertura populacional no Brasil

    Directory of Open Access Journals (Sweden)

    Pinto Luiz Felipe

    2004-01-01

    Full Text Available Foram utilizados o Cadastro de Beneficiários da Agência Nacional de Saúde Suplementar (ANS e a Pesquisa Nacional por Amostra de Domicílios (PNAD/IBGE para descrever o perfil da cobertura dos serviços por planos privados de saúde. Apesar da regulação pela ANS, não se deve perder de vista que o acesso, a utilização e a cobertura populacional em planos de saúde precisam ser periodicamente monitorados, principalmente na região Sudeste, que concentra 70% da população coberta por planos de saúde. Também são necessários estudos mais detalhados sobre as capitais brasileiras, que constituem grandes centros de concentração de clientela; e investigações para os subgrupos etários que mais utilizam os serviços de saúde: crianças menores de 5 anos, mulheres em idade fértil e idosos. Os resultados do estudo indicam que, no Sistema de Saúde Brasileiro, os planos privados de assistência à saúde se configuram como mais um fator de geração de desigualdades sociais no acesso e na utilização de serviços de saúde, pois cobrem apenas uma parcela específica da população brasileira: pessoas de maior renda familiar, de cor branca, com maior nível de escolaridade, inseridas em determinados ramos de atividade do mercado de trabalho, moradores das capitais/regiões metropolitanas.

  11. Saúde e qualidade de vida de jornalistas: estudo de revisão

    Directory of Open Access Journals (Sweden)

    Regina Zanella Penteado

    2016-06-01

    Full Text Available Objetivo: Realizar revisão sistemática da literatura voltada para a saúde e a qualidade de vida de jornalistas, relacionadas ao trabalho. Métodos: Foram realizadas buscas nas seguintes bases: LILACS, SciELO, Doaj, MEDLINE, Science Direct, Wiley Online Library, Springer Link e Clase. Foram priorizados artigos publicados em periódicos nacionais e internacionais, nos idiomas em português, inglês e espanhol, no período entre 2005 e 2015. O processo de seleção seguiu etapas e critérios pré-definidos do estudo, bem como a aplicação de Testes de Relevância. Resultados: A seleção resultou em oito publicações para revisão. Os aspectos e/ou questões do processo saúde-doença-cuidado de jornalistas, que têm sido enfatizados nas investigações, integram as categorias: saúde vocal/expressividade (três: 37,5%; saúde mental (quatro: 50% e saúde alimentar/nutricional (um: 12,5%; e eles vêm sendo abordados de maneira isolada. Faltam estudos pautados por uma concepção ampliada e abrangente de saúde e qualidade de vida. Conclusão: O estudo mostra a necessidade de pesquisas e investimentos na formação de uma cultura de promoção da saúde e qualidade de vida dos jornalistas, o que pode ocorrer na interdisciplinaridade das áreas de Saúde, Comunicação e Educação, com apoio das entidades de classe da categoria e da mídia.

  12. Saúde internacional: alguns aspectos conceituais contemporâneos

    Directory of Open Access Journals (Sweden)

    Villa Tereza Cristina Scatena

    2001-01-01

    Full Text Available Este ensaio consiste em uma reflexão teórica acerca de algumas abordagens contemporâneas de Saúde Internacional, que suscitam o apontamento de questões que merecem ser refletidas e discutidas, permitindo subsidiar a compreensão no campo da Saúde Internacional em seus aspectos conceituais e operacionais, no processo de integração econômico-social das regiões de fronteira.

  13. Análisis factorial confirmatorio del Cuestionario SA-45 en una muestra mexicana

    OpenAIRE

    2012-01-01

    El objetivo de la presente investigación consistió en examinar la estructura factorial, la fiabilidad y los datos normativos del Cuestionario SA-45 (Symptom Assessment-45) en una muestra de estudiantes universi-tarios mexicanos. Como se predijo, los análisis factoriales confirmatorios indicaron que el modelo de nueve factores proporcionaba el mejor ajuste del SA-45. Así mismo, los datos demostraron buenos niveles de fiabilidad (consistencia interna) del cuestionario. Los datos normativos most...

  14. The Sahel-Doukkala Information Network (SaDIN) – A regional online geoinformation system

    OpenAIRE

    2003-01-01

    A critical necessity to achieve international standards in public health and sustainable development is to monitor the quality of the limited groundwater resources. To provide a basis for any sort of environmental investigations, the SaDIN project creates a knowledge pool in the centre of the Chouaïb Doukkali University, El Jadida (Morocco), in collaboration with the Data Centre of the GeoForschungsZentrum Potsdam (Germany). SaDIN comprises tools for data acquisition, sample collection and mu...

  15. Daidzin decreases ethanol consumption in rats.

    Science.gov (United States)

    Heyman, G M; Keung, W M; Vallee, B L

    1996-09-01

    In a previous study, daidzin, a constituent of an ancient Chinese herbal treatment for alcoholism, decreased home-cage ethanol consumption in laboratory Syrian golden hamsters. The present study tested the generality of daidzin's antidipsotropic effects. Rats served as subjects in a two-lever choice procedure. At one lever, responses earned 10% ethanol, flavored with saccharin. At the other lever, responses earned an isocaloric starch solution. Daidzin decreased both ethanol and starch consumption, but the decreases in ethanol intake were larger. Changes in consumption were dose dependent, and differences in ethanol and food consumption increased slightly (but significantly) as dose increased. Daidzin produced a similar pattern of decreases in lever pressing. In baseline, there was an approximately equal distribution of responses between the two levers; at the highest daidzin dose, the relative number of responses at the ethanol lever decreased to 30%. These results replicate and extend earlier findings, and they encourage further research on daidzin's capacity to decrease ethanol consumption.

  16. Red blood cell decreases of microgravity

    Science.gov (United States)

    Johnson, P. C.

    1985-01-01

    Postflight decreases in red blood cell mass (RBCM) have regularly been recorded after exposure to microgravity. These 5-25 percent decreases do not relate to the mission duration, workload, caloric intake or to the type of spacecraft used. The decrease is accompanied by normal red cell survivals, increased ferritin levels, normal radioactive iron studies, and increases in mean red blood cell volume. Comparable decreases in red blood cell mass are not found after bed rest, a commonly used simulation of the microgravity state. Inhibited bone marrow erythropoiesis has not been proven to date, although reticulocyte numbers in the peripheral circulation are decreased about 50 percent. To date, the cause of the microgravity induced decreases in RBCM is unknown. Increased splenic trapping of circulating red blood cells seem the most logical way to explain the results obtained.

  17. A inserção da vigilância em saúde ambiental no sistema único de saúde

    Directory of Open Access Journals (Sweden)

    Edenilo Baltazar Barreira Filho

    2012-03-01

    Full Text Available A inserção das atividades de vigilância ambiental no SUS apresenta algumas características que se diferenciam das práticas de vigilância epidemiológica. Isto ocorre principalmente em decorrência de que muitos dados sobre a exposição aos fatores ambientais são obtidos fora do setor saúde e a adoção de ações que busquem controlar e/ou prevenir exigem, na grande maioria dos casos, uma compreensãoe articulação intra e intersetorial, pois o setor saúde não é capaz de, sozinho, dar respostas as questões de saúde ambiental.Nos últimos anos vem consolidando-se cada vez mais o campo da saúdeambiental, que compreende a área da saúde pública, afeita ao conhecimento científico, à formulação de políticas públicas e às correspondentes intervenções (ações relacionadas à interação entre a saúde humana e os fatores do meio ambiente natural e antrópico que a determinam, condicionam e influenciam, com vistas a melhorar a qualidade de vida do ser humano sob o ponto de vista dasustentabilidade(1.Conforme entendimento acordado no I Seminário da Política Nacional de Saúde Ambiental, realizado em outubro de 2005, e consolidado na primeira Conferência Nacional de Saúde Ambiental, realizada em dezembro de 2009, compreende-se como uma área de práticas intersetoriais e transdisciplinares voltadas aos reflexos, na saúde humana, das relações ecogeossociais do homem com o ambiente(1.Nesse sentido, o Ministério da Saúde vem implementando em todo o território nacional um Sistema de Vigilância em Saúde Ambiental (SINVISA, buscando o aprimoramento deste “modelo” de atuação e estabelecendo competências nas três esferas de gestão, com o objetivo de consolidar a prática da Saúde Ambiental dentro do SUS.A Instrução Normativa nº 1, de 7 de março de 2005, cria o SINVISA, estabelece a área de atuação, as competências para as três esferas de Gestão do SUS e define a Vigilância em Saúde Ambiental como sendo

  18. Da medicina do trabalho à saúde do trabalhador From occupational medicine to workers' health

    Directory of Open Access Journals (Sweden)

    René Mendes

    1991-10-01

    Full Text Available Ensaio de revisão sobre a evolução dos conceitos e práticas da medicina do trabalho à saúde do trabalhador, passando pela saúde ocupacional. Busca-se responder às seguintes questões: quais as características básicas da medicina do trabalho (na sua origem e na sua evolução; como e por que evoluiu a medicina do trabalho para a saúde ocupacional; por que o modelo da saúde ocupacional se mostrou insuficiente; em que contexto surge a saúde do trabalhador; quais as principais características da saúde do trabalhador.The evolution of the concepts and practice of occupational medicine, occupational health and workers' health is tentatively reviewed. An attemp is made to answer the following questions: what were the major characteristics of occupational medicine throughout its evolution? How and why did occupational medicine evolve into occupational health? Why has the "occupational health model" become inadequate? Writhin what context did workers' health arise? What are the principal characteristics of workers' health?

  19. Teatro do oprimido em saúde mental: participação social com arte

    Directory of Open Access Journals (Sweden)

    Érika Sales dos Santos

    2016-09-01

    Full Text Available Relato de experiência de intervenção do projeto Teatro do oprimido na saúde mental em um Centro de Atenção Psicossocial (CAPS de Fortaleza, Ceará, Brasil, no qual descrevemos como esta ferramenta é capaz de contribuir para o fortalecimento da participação social. O projeto foi elaborado por um grupo de residentes e preceptores da Residência Integrada em Saúde, com ênfase em Saúde Mental Coletiva, da Escola de Saúde Pública do Ceará. Utilizamos a pesquisa qualitativa. Em face do difícil contexto de efetivação da política de saúde mental no município, percebemos que a arte pode contribuir para a construção de uma atenção em saúde efetiva, emancipatória e apta a acolher as diversidades. Na nossa ótica, o teatro do oprimido é uma ferramenta importante para fortalecer a participação social e para reinventá-la, problematizando estigmas e impulsionando a garantia de direitos.

  20. A proteomic study of rice cultivar TNG67 and its high aroma mutant SA0420.

    Science.gov (United States)

    Lin, Da-Gin; Chou, Szu-Yi; Wang, Arthur Z; Wang, Yi-Wen; Kuo, Shu-Ming; Lai, Chien-Chen; Chen, Liang-Jwu; Wang, Chang-Sheng

    2014-01-01

    Fragrance is a very important economic trait for rice cultivars. To identify the aroma genes in rice, we performed a proteomics analysis of aroma-related proteins between Tainung 67 (TNG67) and its high aroma mutant SA0420. Seventeen of the differentially identified proteins were close related with the aroma phenotype of SA0420. Among them, 9 were found in leaves and 8 were found in grains. One protein (L3) was identified as the chloroplastic glyceraldehyde-3-phosphate dehydrogenase B (OsGAPDHB) which was less abundant in SA0420 than TNG67. Sequence analysis demonstrated that this protein in SA0420 carries a P425S mutation in the C-terminal extension domain, which might hinder the formation of holoenzyme, thereby changing the profile of aroma compounds. The protein profile of OsGAPDHB showed only a weak correlation to its transcription profile. This result indicated that the reduction of OsGAPDHB in SA0420 is regulated by post-translational processes and can only be analyzed by proteomics approach. Transgenic lines suppressing OsGAPDHB through RNAi harbored more fragrance than TNG67 but less than SA0420. With betaine-aldehyde dehydrogenase as the only fragrance gene identified in rice to date, OsGAPDHB may serve as the second protein known to contribute to the aroma phenotype.

  1. A finitude humana e a saúde pública Human finitude and public health

    Directory of Open Access Journals (Sweden)

    Sergio Rego

    2006-08-01

    Full Text Available A morte é uma questão implícita na prática e na formação dos profissionais da saúde. Há, todavia, uma tendência dos profissionais de saúde de restringir sua discussão aos aspectos meramente técnicos, seja na assistência à saúde, seja nas ações de saúde pública. Este artigo analisa a importância da adoção do cuidado de qualidade no fim de vida como norteador das práticas assistenciais e a necessidade de que o campo da Saúde Pública tome esses cuidados como objeto de reflexão e de pesquisas. Por fim, aponta-se para aspectos relevantes para a formação de profissionais de saúde para que sejam respeitadores das diferenças e comprometidos com o diálogo.Death is an implicit subject in both health practice and health professionals' training. There is a tendency by health professionals to reduce this analysis merely to technical aspects. This paper analyzes the importance of adopting quality care at the end of life as a guide for public health care. We highlight relevant aspects for training health professionals to respect moral differences and to be prepared to discuss their own points of view.

  2. Kakaibang Halimuyak: Iba't Ibang Imahe ng Pangangapital sa Balintawak

    Directory of Open Access Journals (Sweden)

    Mariah Amour C. Miranda

    2015-06-01

    Full Text Available Ginagalugad ng sanaysay na ito ang isang pangunahing lugar na nadaraanan mula Norte patungong Maynila—ang Balintawak. Nagsisilbing manibela ng pagsusuri ang kontemporaneong pananaw sa lunan bilang pugad ng mga anyong may magkakasalungat na kahulugan. Binibigyang-pansin ng sanaysay ang iba't ibang imahe ng pagbebenta na matatagpuan sa Balintawak: ang billboard ng kumpanyang Bench na siyang pinakamalaki, ang mismong palengke, at ang mga lakong paninda sa tabing-kalsada. Sa pamamagitan nito, maipapakita ng sanaysay kung paano madadalumat ang Balintawak bilang isang panlipunang texto na sumasalamin sa mga magkakaibang pangangapital sa naturang lunan. This essay explores the space of Balintawak—a focal point of urban travel from northern Luzon to Manila. Using the contemporary view on space as a site of structures with contradictory meanings, the study seeks to understand how various images of market activities in Balintawak create meaningful representations. These images include the gigantic billboard of Bench, the central market itself, and flea markets in the area. The essay shows how Balintawak as a social text serves as a trading center of different forms of capital.

  3. A autonomia do paciente no processo terapêutico como valor para a saúde

    Directory of Open Access Journals (Sweden)

    Jussara Calmon Reis de Souza Soares

    2007-04-01

    Full Text Available No presente artigo analisam-se as críticas à concepção reducionista de saúde e doença da biomedicina, buscando contribuir para um repensar sobre saúde em uma vertente de proposições positivas. Remetemo-nos, sobretudo, à epistemologia de Canguilhem, para destacar pontos fundamentais na discussão sobre saúde, integrando-a a uma nova leitura do conceito de autonomia do paciente no processo terapêutico. O método de análise seguiu a perspectiva do pensamento complexo. Nesta perspectiva, a autonomia caracteriza-se como relativa e relacional, inseparável da dependência. É também condição necessária para a saúde, compreendida em seu sentido mais amplo, como potência auto-recuperadora do organismo humano. Assim, autonomia passa a ser um valor fundamental a ser resgatado e defendido tanto na clínica, quanto no campo das ciências humanas e sociais em saúde. Discutem-se implicações do resgate da autonomia, ainda que como um vir-a-ser, como precondição para a saúde e a cidadania, para a própria vida.

  4. Imaging Interplanetary Disturbances Causing Forbush Decreases

    Science.gov (United States)

    2005-01-01

    NUMBER Imaging Interplanetary Disturbances Causing Forbush Decreases 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 61102F • 6. AUTHOR(S) 5d. PROJECT...3-10 AUG 05. 14. ABSTRACT Forbush decreases (FDs) in neutron monitor (NM) counting rates are caused by enhanced magnetic fields in interplanetary...VS-HA-TR-2007-1044 29th International Cosmic Ray Conference Pune (2005) 2, 267-270 Imaging Interplanetary Disturbances Causing Forbush Decreases S.W

  5. Produção e citação em Saúde Coletiva: um olhar a partir dos periódicos Cadernos de Saúde Pública e Revista de Saúde Pública Output and citation in Public Health: a perspective based on the journals Cadernos de Saúde Pública and Revista de Saúde Pública

    Directory of Open Access Journals (Sweden)

    Leandro Carvalho

    2007-12-01

    Full Text Available O presente trabalho é um estudo bibliométrico comparativo entre as duas principais revistas científicas da área da Saúde Coletiva publicadas no Brasil: Cadernos de Saúde Pública (CSP e Revista de Saúde Pública (RSP. Foram analisados 24 fascículos de cada periódico, publicados entre 1996 e 2003, construindo uma amostra de 819 artigos (496 de CSP e 323 de RSP. Os seguintes elementos dos artigos foram identificados e analisados: área temática do artigo e padrão de citações de publicações (artigos em periódicos, livros e/ou capítulos de livro, teses/dissertações, documentos de Internet, "literatura cinzenta" e outros tipos de publicações. Os dados encontrados mostram que a maioria dos artigos publicados é da subárea "epidemiologia". O padrão de citação identificado nas revistas foi de citações a artigos em periódico em maior número, seguidas das citações a livros e/ou capítulos de livro. Artigos na subárea "ciências sociais em saúde" publicados em CSP apresentam características distintas, com maior número de citações a livros e capítulos. Os autores argumentam que as informações são relevantes na caracterização da produção da área, com desdobramentos importantes no plano da avaliação acadêmico-científica da Saúde Coletiva no país.This is a comparative bibliometric study of the two main scientific journals in the Public Health field in Brazil: Cadernos de Saúde Pública (CSP and Revista de Saúde Pública (RSP. Twenty-four issues of each periodical were analyzed, published from 1996 to 2003, comprising a sample of 819 articles (496 from CSP and 323 from RSP. The following elements in the articles were identified and analyzed: thematic area of the article and citation pattern of publications (articles in periodicals, books and/or book chapters, theses/dissertations, Internet documents, "gray" literature, and other types of publications. The resulting data showed that the majority of the

  6. Accumulation and depuration of pectenotoxins in brown crab Cancer pagurus

    Institute of Scientific and Technical Information of China (English)

    LI Zhaoxin

    2009-01-01

    Pectenotoxins (PTXs) are a group of marine algal toxins. In this study, the accumulation and depuration of pectenotoxins in brown crab Cancer pagurus were investigated. Crabs were fed with toxic blue mussels Mytilus edulis for 21 days and then depurated for 42 days. Toxins were extracted with methanol from the digestive glands of contaminated crabs, uncontaminated crabs (control group) and from blue mussels for comparison. Extracts were analyzed by liquid chromatograph coupled with tandem mass spectrometry (LC-MS-MS). The concentrations of PTX-2, PTX-2 SA, 7-epi-PTX-2 SA, and PTX-12 were analyzed in two batches of toxic blue mussels and the crabs. A one-compartment model was applied to describe the depuration of PTXs. The half-life of PTXs was estimated to be 6-7.5 days. After depuration for 42 days, the amount of PTXs measured in the crab digestive glands was less than 1 μg/kg.

  7. Possibilidades do WHOQOL-bref para a promoção da saúde na estratégia saúde da família

    Directory of Open Access Journals (Sweden)

    Anna Maria Chiesa

    2011-12-01

    Full Text Available A ampliação das ações de promoção da saúde na Estratégia Saúde da Família pode contribuir para a construção da integralidade, mas, ainda persistem lacunas de tecnologias para instrumentalizar os profissionais a analisarem os potenciais de saúde da população. O objetivo deste estudo é sintetizar as contribuições do WHOQOL-bref para instrumentalizar ações de promoção da saúde na Estratégia Saúde da Família. Foi realizada uma metassíntese qualitativa a partir de pesquisas realizadas pelo grupo Modelos tecnoassistenciais e a promoção da saúde com o uso do WHOQOL-bref e sua interface com a promoção da saúde. As sínteses das cinco pesquisas mostraram que existem relações conceituais entre os domínios do WHOQOL-bref e a promoção da saúde, legitimando este como um instrumento para a promoção da saúde. A utilização do WHOQOL-bref pode facilitar o vinculo e o cuidado longitudinal na Estratégia Saúde da Família.

  8. Acupuntura e promoção de saúde: possibilidades no serviço público de saúde

    Directory of Open Access Journals (Sweden)

    Maria Elisa Rizzi Cintra

    2010-03-01

    Full Text Available O presente estudo objetivou analisar as possíveis contribuições da Acupuntura aplicada nos serviços públicos de saúde do município de São Paulo para a Promoção da Saúde. Foi utilizada a abordagem qualitativa de pesquisa, com uso de entrevistas em profundidade. Os resultados apontam que a Acupuntura praticada nos serviços públicos permite um trânsito interdisciplinar integrando a percepção do indivíduo sobre si mesmo e seu contexto, possibilitando mudanças nas causas primárias das doenças. Assim, o contato com a Acupuntura praticada nos serviços de saúde da rede municipal de São Paulo mostra-se passível de contribuir para o desenvolvimento de ações de Promoção de Saúde.

  9. Challenges of SA 8000 standard implantation: social responsibility at PETROBRAS LUBNOR; Os desafios da implantacao da Norma SA 8000: responsabilidade social na PETROBRAS LUBNOR

    Energy Technology Data Exchange (ETDEWEB)

    Abreu, Monica Cavalcanti Sa de [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Fac. de Economia, Administracao, Atuaria e Contabilidade. Dept. de Administracao de Empresas; Leal Neto, Antenor Gomes de Barros [PETROBRAS S.A., Fortaleza, CE (Brazil). Lubrificantes e Derivados de Petroleo do Nordeste (LUBNOR)

    2004-07-01

    This paper presents the developing steps during the establishment of Social Accountability SA 8000 standards in LUBNOR - a PETROBRAS refining plant at Ceara. The SA 8000 standards have been incorporated to Quality, Environmental, Health and Safety Integrated Management System in accordance with ISO 9001, ISO 14001 and OHSAS 18001. In order to implement the social accountability, the company established a work group task with a mission of communicating, maintaining and promoting some actions with all employees of the Refinery. The biggest challenge of implementing this standard is concerned with the compromise of the supply chain (consisting of suppliers and sub suppliers of products and services), the supervision of the labor task and the adequacy of the management system with the embodying of SA 8000 requisites. New demands were generated, for example: the election of the employee's representative; the celebration of a term of compromise with suppliers; the development of a follow up plan to figure out the supplier's performance; and, the monitoring of extra time worked. The establishment of SA 8000 is a way to stand out the effort at LUBNOR in order to improve the working environment conditions and to consolidate an administration committed with sustainable development and human being improvement. (author)

  10. Tumor imaging with 2 sigma-receptor ligands, F-18-FE-SA5845 and C-11-SA4503 : A feasibility study

    NARCIS (Netherlands)

    van Waarde, A; Buursma, AR; Hospers, GAP; Kawamura, K; Kobayashi, T; Ishii, K; Oda, K; Ishiwata, K; Vaalburg, W; Elsinga, PH

    2004-01-01

    Our objective was to study 2 radioligands for visualization of sigma-receptors with PET. Methods: Two radioligands--sigma(1)-selective C-11-1-(3,4-dimethoxyphenethyl)-4-(3-phenylpropyl)piperazine (C-11-SA4503) and nonsubtype-selective 1-(4-2'-F-18-fluoroethoxy-3-methoxyphenethyl)-4-(3-(4-fluoropheny

  11. Significados e sentidos das práticas de saúde: a ontologia fundamental e a reconstrução do cuidado em saúde

    Directory of Open Access Journals (Sweden)

    Tatiana de Vasconcellos Anéas

    Full Text Available O cuidado em saúde tem sido um tema abordado atualmente por autores da Saúde Coletiva. Essas práticas e estudos refletem dois modos aparentemente antagônicos de se conceber o cuidado, ora baseado na instrumentalidade, com ênfase nos procedimentos e nas intervenções técnicas, ora com foco na relação de encontro entre profissionais e usuários dos serviços de saúde. A partir de uma leitura crítica desse conjunto de estudos, procura-se não opor os dois grupos identificados, mas articulá-los em sua complementaridade por meio da ontologia fundamental de Martin Heidegger. Em Ser e Tempo, Heidegger desconstrói a ontologia tradicional para reconstruir uma nova ontologia que busque os fundamentos da existência humana. Um retorno aos fundamentos mostra-se essencial para uma reconstrução das práticas de saúde e do cuidado.

  12. Significados e sentidos das práticas de saúde: a ontologia fundamental e a reconstrução do cuidado em saúde

    Directory of Open Access Journals (Sweden)

    Tatiana de Vasconcellos Anéas

    2011-09-01

    Full Text Available O cuidado em saúde tem sido um tema abordado atualmente por autores da Saúde Coletiva. Essas práticas e estudos refletem dois modos aparentemente antagônicos de se conceber o cuidado, ora baseado na instrumentalidade, com ênfase nos procedimentos e nas intervenções técnicas, ora com foco na relação de encontro entre profissionais e usuários dos serviços de saúde. A partir de uma leitura crítica desse conjunto de estudos, procura-se não opor os dois grupos identificados, mas articulá-los em sua complementaridade por meio da ontologia fundamental de Martin Heidegger. Em Ser e Tempo, Heidegger desconstrói a ontologia tradicional para reconstruir uma nova ontologia que busque os fundamentos da existência humana. Um retorno aos fundamentos mostra-se essencial para uma reconstrução das práticas de saúde e do cuidado.

  13. Estresse no trabalho e interrupção de atividades habituais, por problemas de saúde, no Estudo Pró-Saúde

    National Research Council Canada - National Science Library

    Luís Eduardo Teixeira de Macedo; Dóra Chor; Valeska Andreozzi; Eduardo Faerstein; Guilherme L. Werneck; Claudia S. Lopes

    2007-01-01

    .... Esta investigação, do tipo transversal, se insere em um estudo prospectivo de 2.343 funcionários técnico-administrativos de uma universidade no Estado do Rio de Janeiro - Estudo Pró-Saúde...

  14. Acupuntura e promoção de saúde: possibilidades no serviço público de saúde

    Directory of Open Access Journals (Sweden)

    Maria Elisa Rizzi Cintra

    Full Text Available O presente estudo objetivou analisar as possíveis contribuições da Acupuntura aplicada nos serviços públicos de saúde do município de São Paulo para a Promoção da Saúde. Foi utilizada a abordagem qualitativa de pesquisa, com uso de entrevistas em profundidade. Os resultados apontam que a Acupuntura praticada nos serviços públicos permite um trânsito interdisciplinar integrando a percepção do indivíduo sobre si mesmo e seu contexto, possibilitando mudanças nas causas primárias das doenças. Assim, o contato com a Acupuntura praticada nos serviços de saúde da rede municipal de São Paulo mostra-se passível de contribuir para o desenvolvimento de ações de Promoção de Saúde.

  15. Institutos de pesquisa em saúde Health research institutes

    Directory of Open Access Journals (Sweden)

    Erney Plessmann Camargo

    2004-06-01

    Full Text Available Ao fim do século 19, em seguida aos avanços na assepsia cirúrgica e no esclarecimento do papel de microorganismos como causadores de moléstias infecciosas, foram criados em escala mundial "institutos de pesquisa com os objetivos de conduzir pesquisa sobre as causas, prevenção e tratamento de homens e animais e de desenvolver produtos preventivos e curativos como vacinas e antitoxinas". Para atingir esses objetivos os institutos recrutaram os melhores cientistas disponíveis em todos os lugares. Este foi um período fulgurante para a pesquisa sublinhado por inúmeras descobertas sobre as doenças infecciosas. Passada essa fase, os institutos entraram em depressão e até mesmo insolvência. Muitos se recuperaram, alguns não. Muitos ainda sofrem de uma "crise de identidade". Neste ensaio analisamos o destino dos institutos de pesquisa em saúde no Brasil, as causas de seu sucesso e eventuais fracassos e as medidas possíveis de ajudá-los a contornar suas presentes dificuldades.By the end of the 19th century, after the advances in surgical asepsis and the understanding of the role of microorganisms in the etiology of many infectious diseases, research institutes in the public health area were created worldwide with the objectives of undertaking "scientific research into the causes, prevention and treatment of disease in man and animals and to prepare and supply protective and curative materials such as vaccines and antitoxins". To pursue these objectives the institutes hired the best scientists from everywhere. This was an exhilarating period for research in which discoveries proliferated. After that, institutes got into depression and even insolvency. Most recovered, many not. Many are still suffering from an "identity crisis". In this paper we analyze the fate of the health research institutes in Brazil, the causes of their success and eventual failures and the possible ways to get out of their current difficulties.

  16. Marimuthu Munien V BMW Financial Services (SA (PTY LTD Unreported

    Directory of Open Access Journals (Sweden)

    C van Heerden

    2009-12-01

    Full Text Available Section 129(1(a read with section 130(1 and 130(3 of the National Credit Act 34 of 2005 (the NCA provides that, as a required procedure before debt enforcement, a credit provider must draw the default to the consumer's notice in writing and propose that the consumer refer the credit agreement to a debt counsellor, alternative dispute resolution agent, consumer court or ombud with jurisdiction, with the intent that the parties resolve any dispute under the agreement or develop and agree on a plan to bring the payments under the agreement up to date. Even though section 129(1(a is silent as to the method by which the default should be brought to the consumer's notice, section 130(1(a provides clarity by requiring the section 129(1(a notice to be delivered. It appears that a credit provider who fails to comply with the provisions of section 129(1(a prior to debt enforcement by means of litigation will be in a procedural predicament as the credit provider will not possess a complete cause of action thus, for instance, rendering the summons excipiable. The crucial question thus appears to be whether or not in a given situation one may say that there was proper compliance with section 129(1(a as this directly affects the existence or absence of a complete and proper cause of action. A number of factors has to be considered in order to address this question, the most important being if the section 129(1(a notice was duly 'delivered'. In this regard two questions are especially relevant:a When exactly can it be said that a section 129(1(a notice was 'delivered' for purposes of the NCA?b Is it necessary for such notice to be received by the consumer in order to constitute proper compliance with the delivery requirement pertaining to section 129(1(a?The above questions were decided on in a recent judgment, Marimuthu Munien v BMW Financial Services (SA (Pty Ltd Case no 16103/08 (KZD (unreported. This article will analyse section 129(1(a of the NCA by inter

  17. A agência nacional de saúde suplementar - ANS: onze anos de regulação dos planos de saúde

    Directory of Open Access Journals (Sweden)

    Rachel Torres Salvatori

    2012-09-01

    Full Text Available Trata-se de um trabalho com objetivo de apresentar os principais resultados alcançados pela regulação dos planos de saúde exercida pela Agência Nacional de Saúde Suplementar, autarquia instituída para promover o equilíbrio das relações entre operadoras e consumidores, tornando o mercado de planos de saúde mais efi ciente. Como avanços mais significativos oriundos da regulação do setor podem ser citados: as barreiras à entrada e à saída das operadoras no mercado, a ampliação das coberturas assistenciais contratuais, o monitoramento e o controle dos reajustes, a indução a práticas de promoção da saúde e à qualifi cação do setor, e a possibilidade da portabilidade de carências. Como desafios a serem enfrentados, podem ser apontados: o monitoramento da qualidade da assistência prestada, a renúncia fiscal, a existência dos cartões de desconto, a operação de empresas como operadoras de planos de saúde sem o registro na ANS e a adoção de alguns mecanismos nocivos de regulação assistencial pelas operadoras de planos de saúde. ----- The National Agency of Supplementary Health – ANS: eleven years in regulating health insurance plans ----- ABSTRACT ----- This study aims to present the main results achieved in the regulation of health insurance plans through the National Agency of Supplementary Health, an agency set up to promote a balance in the relationship between health insurance plans and their consumers, making the health insurance market more efficient. As examples of the important progress achieved in regulating the sector, the authors emphasize: greater control of the infl ow and outfl ow of service operators in the market; the widening of contractual coverage; monitoring and control of readjustments; encouragement of health promotion practices and increased training in the sector; grace period flexibility. Examples of regulatory gaps however, include: problems monitoring the quality of the care provided

  18. Homens e saúde na pauta da Saúde Coletiva Men and health as targets of the Public Health

    Directory of Open Access Journals (Sweden)

    Lília Blima Schraiber

    2005-03-01

    Full Text Available Apresenta-se a temática "homens e saúde" como questão contemporânea da Saúde Coletiva e produto da interface entre as ciências humanas e a saúde: o caráter social do adoecimento; a perspectiva de gênero como forma particular da relação saúde-sociedade; e a promoção da saúde como conceituação positiva Elabora-se a temática em torno de três eixos de aproximação, sob a perspectiva dos exercícios das masculinidades: saúde sexual e reprodutiva; violência e gênero e morbi-mortalidade em homens. São apontadas as contribuições que estes eixos produzem como esforço empírico para realizar a categoria gênero, ao tempo em que revelam novas problemáticas para a área de saúde: a paternidade, o exercício interativo da sexualidade, a violência interpessoal no âmbito da vida privada, a hiper-masculinidade na violência entre homens, o cuidado de si e o cuidar em saúde para os homens. Estas contribuições permitirão não apenas inserir as masculinidades como questão de saúde, mas renovar as formas de tratamento de homens e mulheres no campo da saúde.It shows the thematic "men and health" as a contemporary matter of the Public Health and interface product among human sciences and health: the social view of illness; the gender perspective as a particular form of the relation health-society and the health promotion while positive means of health. It elaborates the thematic around three approach axises, conformed in the relation between men and health from the perspective of exercises of the masculinity: sexual and reproductive health; violence and gender, and morbid-mortality in men. The contributions that these axises produce are mentioned as empiric effort to accomplish the category gender, the time in which they reveal health new problems to the health's area: the paternity, the interactive exercise of the sexuality, the interpersonal violence in life closet scope, the hipper-masculinity in the violence among men, the

  19. Suporte social, promoção de saúde e saúde bucal na população idosa no Brasil

    Directory of Open Access Journals (Sweden)

    Silvânia Suely Caribé de Araújo

    2006-06-01

    Full Text Available O crescente envelhecimento da população mundial, inclusive no Brasil, ressalta a importância de medidas para se lidar com esta situação. No Brasil, a maioria dos idosos é do sexo feminino; vive em domicílios multigeracionais; é referência econômica nos mesmos; possui baixo nível socioeconômico; portadora de, pelo menos, uma doença crônica; independente para realização das atividades da vida diária; não possui dentes, e busca atenção em saúde no SUS. Os idosos brasileiros expostos a situações de vulnerabilidade social estão sujeitos à interferência direta dos determinantes sociais no processo saúde-doença. O Suporte Social inclui políticas e redes de apoio social, que atuam como agente de integração do idoso na sociedade, minimizando os riscos de exclusão social e, conseqüentemente, de danos à sua saúde por meio de medidas de Promoção de Saúde. Este artigo aborda o Suporte Social e alguns de seus aspectos, tais como: tipo e local de residência, transporte e suporte financeiro; em idosos brasileiros e sua relação com a Promoção de Saúde.

  20. Saúde Mental na Atenção Básica: Sentidos Atribuídos pelos Agentes Comunitários de Saúde

    Directory of Open Access Journals (Sweden)

    Raul Franklin Sarabando de Moura

    Full Text Available Em consideração a normas recentes do Ministério da Saúde, que regulamentam as relações entre a Saúde Mental e a Atenção Básica, esta pesquisa tem por objetivo estudar os sentidos atribuídos pelo ACS à Saúde Mental e suas implicações na prática cotidiana, além de suas percepções sobre as ações do Programa de Residência Multiprofissional em Atenção à Saúde (PRMAS. Trata-se de um estudo qualitativo, segundo o referencial da Hermenêutica de Profundidade,feito através de observação participante e entrevistas semidirigidas. Os resultados alcançados apontam a centralização dos cuidados em Saúde Mental nos CAPS, especialmente através de medicações. Em relação ao PRMAS, percebe-se o papel de matriciamento exercido pela residência, por meio da escuta e acompanhamento do ACS, que encontra situações de sofrimento psíquico em seu cotidiano mas se sente despreparado para lidar com elas. A residência fortalece a integralidade do cuidado, conforme qualifica a atuação do ACS e o orienta em casos difíceis, bem como pode ser um articulador do trabalho, através das iniciativas de aproximação entre os serviços que tem promovido.

  1. Concepção de enfermeiros de uma rede pública de saúde sobre Educação para a Saúde

    Directory of Open Access Journals (Sweden)

    Gisele Coscrato

    2013-06-01

    Full Text Available Estudo qualitativo que objetivou conhecer as concepções de 12 enfermeiros assistenciais, que compõem a rede pública de saúde de um município do interior paulista, sobre Educação para a Saúde, e propor ação educativa. Utilizou-se da metodologia da pesquisa-ação. A coleta dos dados ocorreu no segundo semestre de 2009, nas unidades públicas de saúde desse município. Foram usadas as técnicas de observação participante e entrevistas individuais. A análise e interpretação dos dados foi feita por categorização, fundamentada na teoria de Paulo Freire. Como resultados, revelou-se o reducionismo da Educação para a Saúde na abordagem pedagógica que envolvia a transmissão de conhecimentos, contemplando uma tendência biologicista da formação acadêmica. Porém, nos círculos de discussão, presumiu-se o despertar de uma consciência política relacionada à temática e à promoção da saúde. Concluindo, apreendeu-se a necessidade de mudanças na formação, e de viabilizar novos modos de produção de ciência, na busca pela transformação social.

  2. Development of remote pipe cutting tool for divertor cassettes in JT-60SA

    Energy Technology Data Exchange (ETDEWEB)

    Hayashi, Takao, E-mail: hayashi.takao@jaea.go.jp; Sakurai, Shinji; Shibanuma, Kiyoshi; Sakasai, Akira

    2014-10-15

    Remote pipe cutting tool accessing from inside pipe has been newly developed for JT-60SA. The tool head equips a disk-shaped cutter blade and four rollers which are subjected to the reaction force. The tool pushes out the cutter blade by decreasing the distance between two cams. The tool cuts a cooling pipe by both pushing out the cutter blade and rotating the tool head itself. The roller holder is not pushed out anymore after touching the inner wall of the pipe. In other words, only cutter blade is pushed out after bringing the tool axis into the pipe axis. Outer diameter of the cutting tool head is 44 mm. The cutting tool is able to push out the cutter blade up to 32.5 mm in radius, i.e. 65 mm in diameter, which is enough to cut the pipe having an outer diameter of 59.8 mm. The thickness and material of the cooling pipe are 2.8 mm and SUS316L, respectively. The length of the cutting tool head is about 1 m. The tool is able to cut a pipe locates about 480 mm in depth from the mounting surface on the divertor cassette. The pipe cutting system equips two cutting heads and they are able to cut two pipes at the same time in order to remove the inner target plate. Reproducibility of the cross-sectional shape of the cut pipe is required for re-welding. The degree of reproducibility is inside 0.1 mm except for burr at outside of the pipe, which is enough to re-weld the cut pipe. Some swarf is generated during cutting the double-layered pipe assuming a plug located on the top of the pipe. The swarf is deposited on the bottom of the plug and collected by pulling out the plug in the actual equipment.

  3. Direito à saúde: um convite à reflexão

    Directory of Open Access Journals (Sweden)

    Nogueira Vera Maria Ribeiro

    2004-01-01

    Full Text Available As alterações e rupturas que vêm ocorrendo na sociedade contemporânea em relação ao direito à saúde como valor universal, consoantes às orientações das agências multilaterais veiculadas especialmente a partir dos anos 90, constitui-se o foco central do presente estudo. A partir da gênese dos direitos sociais e do resgate da interdependência entre os aspectos sociais e econômicos na conformação da cidadania social nos países capitalistas democráticos, apresenta os dois paradigmas que delimitam o encaminhamento da atenção à saúde no início do século XXI. O paradigma da cidadania plena, no qual o direito à saúde é um valor universal, e o da cidadania social restrita, em que o direito à saúde é orientado pelo critério da eficiência e racionalidade econômica. Essas proposições alinham-se ao paradigma da economia da saúde, que defende a focalização dos recursos para atenuar as condições de miserabilidade, reduz o papel do Estado, sugere a alocação de recursos para a saúde aliada à proteção social e coloca o mercado como o regulador privilegiado das ações de saúde.

  4. Mulheres encarceradas em São Paulo: saúde mental e religiosidade

    Directory of Open Access Journals (Sweden)

    Paulo Augusto Costivelli de Moraes

    2006-01-01

    Full Text Available OBJETIVO: A religião tem um importante papel na vida de indivíduos encarcerados. A saúde mental e a possibilidade de reabilitação parecem ser favorecidas através da religião. Entretanto poucos estudos no Brasil abordaram a saúde mental em população carcerária feminina e a relacionaram com a religiosidade. O objetivo deste estudo é verificar o perfil de saúde mental e a relação entre religião, religiosidade e saúde mental numa amostra de mulheres encarceradas em São Paulo. MÉTODOS: Foram entrevistadas 358 mulheres, detentas da Penitenciária Feminina da Capital (São Paulo-SP. Foi aplicado um questionário amplo que abrangeu dados sociodemográficos e culturais (incluindo a religiosidade, assim como itens sobre saúde mental e perfil criminal. A avaliação psicopatológica foi feita com o General Health Questionnaire (GHQ-12. Análises estatísticas comparando as variáveis com o GHQ-12 foram realizadas. Foi utilizada também a análise de regressão logística multivariada para respostas dicotômicas para as variáveis que possivelmente interagiram com a saúde mental. RESULTADOS: A idade média da amostra foi 30,7 anos ± 8,5. A prevalência de possível caso psiquiátrico foi 26,6%. CONCLUSÕES: Uma maior religiosidade pessoal associou-se a menor freqüência de possível transtorno mental. Não foram encontradas associações entre tipo de crime e saúde mental.

  5. Direito à saúde: um convite à reflexão

    Directory of Open Access Journals (Sweden)

    Vera Maria Ribeiro Nogueira

    2004-06-01

    Full Text Available As alterações e rupturas que vêm ocorrendo na sociedade contemporânea em relação ao direito à saúde como valor universal, consoantes às orientações das agências multilaterais veiculadas especialmente a partir dos anos 90, constitui-se o foco central do presente estudo. A partir da gênese dos direitos sociais e do resgate da interdependência entre os aspectos sociais e econômicos na conformação da cidadania social nos países capitalistas democráticos, apresenta os dois paradigmas que delimitam o encaminhamento da atenção à saúde no início do século XXI. O paradigma da cidadania plena, no qual o direito à saúde é um valor universal, e o da cidadania social restrita, em que o direito à saúde é orientado pelo critério da eficiência e racionalidade econômica. Essas proposições alinham-se ao paradigma da economia da saúde, que defende a focalização dos recursos para atenuar as condições de miserabilidade, reduz o papel do Estado, sugere a alocação de recursos para a saúde aliada à proteção social e coloca o mercado como o regulador privilegiado das ações de saúde.

  6. Paism: um marco na abordagem da saúde reprodutiva no Brasil

    Directory of Open Access Journals (Sweden)

    Maria José Martins Duarte Osis

    Full Text Available O Programa de Assistência Integral à Saúde Mulher (PAISM foi lançado pelo Ministério da Saúde em 1983, sendo anunciado como uma nova e diferenciada abordagem da saúde da mulher. Paradoxalmente, o PAISM constitui-se também na primeira vez em que o Estado brasileiro propôs explicitamente, e implantou, embora de modo parcial, um programa que contemplava a regulação da fecundidade. Isso suscitou suspeitas acerca de possíveis intenções ocultas de controle da natalidade. Porém, analisando brevemente a história desse Programa e seu significado social, conclui-se que o PAISM foi pioneiro, inclusive no cenário mundial, ao propor o atendimento à saúde reprodutiva das mulheres, no âmbito da atenção integral à saúde, e não mais a utilização de ações isoladas em planejamento familiar. Por isso mesmo, os movimentos de mulheres, de imediato, passaram a lutar por sua implementação. Seu conteúdo inclui plenamente a definição de saúde reprodutiva adotada pela Organização Mundial da Saúde em 1988, ampliada e consolidada no Cairo em 1994 e em Beijing em 1995. Conseqüentemente, a adoção do PAISM representou, sem dúvida, um passo significativo em direção ao reconhecimento dos direitos reprodutivos das mulheres, mesmo antes que essa expressão ganhasse os diversos foros internacionais de luta.

  7. Inactivation of the WNT5A Alternative Promoter B Is Associated with DNA Methylation and Histone Modification in Osteosarcoma Cell Lines U2OS and SaOS-2.

    Directory of Open Access Journals (Sweden)

    Himani Vaidya

    Full Text Available WNT5A is a secreted ligand involved in Wnt pathway signaling and has a role in cell movement and differentiation. Altered WNT5A expression is associated with various cancers, although in most studies the focus has been on only one of the known WNT5A isoforms. In this study, we analyzed expression from two of the major WNT5A promoters, termed promoter A and promoter B, in normal human osteoblasts, SaOS-2 and U2OS osteosarcoma cell lines, and osteosarcoma tumor tissue. We found that both promoters A and B are active in normal osteoblasts with nearly 11-fold more promoter B than A transcripts. Promoter B but not promoter A transcripts are decreased or nearly undetectable in the SaOS-2 and U2OS cell lines and osteosarcoma tumor tissues. Transient transfection of promoter A and promoter B reporter constructs confirmed that SaOS-2 cells have the necessary factors to transcribe both promoters. Bisulfite sequencing analysis revealed that three CpG enriched regions upstream of the promoter B exon 1βare highly methylated in both SaOS-2 and U2OS cells. The CpG island sub-region R6 located in promoter B exon 1β was approximately 51% methylated in SaOS-2 and 25% methylated in U2OS. Region 3 was approximately 28% methylated in normal osteoblasts, whereas the others were unmethylated. Promoter B was re-activated by treatment of SaOS-2 cells with 1 μM 5-azacytidine, which was associated with only a small insignificant change in methylation of sub-region R6. ChIP analysis of U2OS and SaOS-2 cells indicated that the promoter B region is less enriched in the active histone mark H3K4me3, in comparison to promoter A and that there is increased enrichment of the repressive mark H3K27me3 in association with the promoter B genomic region in the cell line SaOS-2. These findings show that epigenetic inactivation of the WNT5A promoter B involves both DNA methylation and histone modifications and suggest that differential expression of the WNT5A alternative promoters A

  8. Decreasing residual aluminum level in drinking water

    Institute of Scientific and Technical Information of China (English)

    王志红; 崔福义

    2004-01-01

    The relativity of coagulant dosage, residual turbidity, temperature, pH etc. with residual aluminum concentration were investigated, and several important conclusions were achieved. Firstly, dosage of alum-coagulant or PAC1 influences residual aluminum concentration greatly. There is an optimal-dosage-to-aluminum, a bit less than the optimal-dosage-to-turbidity. Secondly, it proposes that decreasing residual aluminum concentration can be theoretically divided into two methods, either decreasing (even removing) the concentration of particulate aluminum component, or decreasing dissolved aluminum. In these tests there is an optimal value of residual turbidity of postprecipitation at 7.0 NTU. Thirdly, residual aluminum level will increase while water temperature goes higher. At the last, optimal pH value corresponds a minimum dissolved aluminum at a given turbidity. Data shows the optimal pH value decreases with water temperature's increasing.

  9. The Forbush decrease of November 17, 1966

    Science.gov (United States)

    Ahluwalia, H. S.

    1975-01-01

    The Forbush decrease of November 17, 1966, takes place in two steps, a predecrease is followed by the main decrease. SSCs are observed on both occasions. The decrease is modest, short-lived, and is preceded and followed by an exceptionally steady level of the cosmic ray intensity. Preliminary results from a phenomenological study are presented. The observed changes in the cosmic ray intensity are correlated with interplanetary magnetic field direction at the onset of the predecrease and during part of the recovery phase. A simple explanation is given for the fact that the predecrease is not observed at the stations in the European-zone. It appears that a preferential recovery takes place from some directions in space, during the recovery phase of the Forbush decrease. Off-ecliptic scattering of lower energy cosmic rays is probably responsible for this. The same phenomena is probably also responsible for the difference between the amplitudes of the predecrease observed at different stations.

  10. Planejamento, gestão e ações à saúde do homem na estratégia de saúde da família

    Directory of Open Access Journals (Sweden)

    Leonardo Peixoto Pereira

    2014-12-01

    Full Text Available Objetivo: Analisar a situação do planejamento, da gestão e das ações de saúde diante da perspectiva de implantação da Política de Atenção à Saúde do Homem na Estratégia de Saúde da Família no município de Jequié. Métodos: Tratou-se de um estudo qualitativo. Entrevistaram-se gestores municipais dos serviços de saúde, profissionais de saúde da Estratégia de Saúde da Família e homens com 25 a 59 anos residentes nas áreas adscritas das unidades de saúde estudadas; realizou-se análise documental do Plano de Saúde e Relatórios de Gestão na Secretaria Municipal de Saúde e análise de conteúdo, modalidade temática. Resultados: Não há atividades assistenciais; de prevenção e promoção à saúde masculina desenvolvidas e os processos de implantação da atenção à saúde do homem encontram-se incipientes. Conclusão: É preciso ampliar o diálogo e reorganizar as estratégias de planejamento e gestão para compreender as reais necessidades masculina e articular com os atores envolvidos a implantação das ações de atenção à saúde do homem.

  11. Comparison of the live-attenuated Japanese encephalitis vaccine SA14-14-2 strain with its pre-attenuated virulent parent SA14 strain: similarities and differences in vitro and in vivo.

    Science.gov (United States)

    Yun, Sang-Im; Song, Byung-Hak; Polejaeva, Irina A; Davies, Christopher J; White, Kenneth L; Lee, Young-Min

    2016-10-01

    Japanese encephalitis virus (JEV) is the main cause of acute viral encephalitis, primarily affecting children and young adults in the Asia-Pacific region. JEV is a vaccine-preventable pathogen, with four types of JE vaccine licensed in different regions of the world. To date, the most common JEV strain used in vaccine development and production is SA14-14-2, an attenuated strain derived from its wild-type parental strain SA14. In this study, we directly compared the phenotypic and genotypic characteristics of SA14 and SA14-14-2 to determine the biological and genetic properties associated with their differential virulence. In susceptible BHK-21 cells, SA14-14-2 grew slightly more slowly and formed smaller plaques than SA14, but unlike SA14, it showed almost no expression of the viral protein NS1', the product of a conserved predicted RNA pseudoknot-mediated ribosomal frameshift. In weanling ICR mice, SA14-14-2 was highly attenuated in terms of both neuroinvasiveness and neurovirulence, with its median lethal doses invariably over five logs higher than those of SA14 when inoculated intramuscularly and intracerebrally. Interestingly, the neurovirulence of SA14-14-2 was dependent on mouse age, with the 1- to 7-day-old mice being highly susceptible and the 14- to 21-day-old mice becoming resistant to intracerebral inoculation. At the genome level, SA14-14-2 differed from SA14 by 57 nucleotides, including one silent G-to-A substitution at position 3599 within the predicted RNA pseudoknot for NS1' synthesis; of the 57 differences, 25 resulted in amino acid substitutions. Our data pave the way for the development of new genetically modified JE vaccines.

  12. Fluoxetine causes decrease in intestinal motility

    Directory of Open Access Journals (Sweden)

    Ayesha Afzal

    2015-04-01

    Conclusion: Our study has indicated that fluoxetine on isolated ileal intestinal smooth muscle decrease the motility and this decrease in motility is possibly due to the inability of fluoxetine in vitro to enhance the serotonergic transmission and also because of the interaction of these agents with some of the other receptors, present in the intestinal smooth muscles. [Int J Basic Clin Pharmacol 2015; 4(2.000: 265-268

  13. Natural Science and Technology Terminology in the Sesotho sa Leboa Monolingual Dictionary

    Directory of Open Access Journals (Sweden)

    W.M. Mojapelo

    2011-10-01

    Full Text Available

    Abstract: The main purpose of this article is to make a comparative analysis of the structural and the lexical differences between coinage and transliteration, as methods for the acquisition of foreign natural sci-ence and technology lexical items, which are meant for inclusion in the Sesotho sa Leboa comprehensive monolingual dictionary, Pukuntšutlhaloši ya Sesotho sa Leboa. With the exception of the multilingual glossaries ('dictionaries' as they are called, which are compiled by the National Language Service of the Department of Arts and Culture, the Sesotho sa Leboa National Lexicography Unit does not at present have any monolin-gual dictionary specializing in specific subjects like natural science and technology. As a start, the Lexicogra-phy Unit decided to include this specialized terminology in the second edition of its comprehensive monolin-gual dictionary. The main purpose for lemmatizing the natural science and technology terminology is to give these lexical items comprehensive definitions in Sesotho sa Leboa, instead of 'a one word translation defini-tion' as is the case in the bilingual and multilingual dictionaries.

    Keywords: TRANSLITERATION, COINAGE, COINED LEXICAL ITEM, LOAN WORD, ADOPTIVE, FOREIGN WORD, LEXICOGRAPHY, SOTHOIZED WORD, INDIGENOUS WORD, NATURAL SCIENCE, TECHNOLOGY, COMPOUND WORD, AMBIGUITY

    Opsomming: Natuurwetenskaplike en tegnologiese terminologie in die Sesotho sa Leboa eentalige woordeboek. Die hoofdoel van hierdie artikel is om 'n ver-gelykende ontleding te maak van die strukturele en die leksikale verskille tussen nuutskepping en transliterasie as metodes vir die verwerwing van vreemde natuurwetenskaplike en tegnologiese leksikale items wat bedoel is vir insluiting in die Sesotho sa Leboa omvattende eentalige woorde-boek Pukuntšutlhaloši ya Sesotho sa Leboa. Met die uitsondering van die meertalige woordelyste ("woordeboeke" soos hulle genoem word wat deur die Nasionale Taaldiens van die

  14. Quatro tensões na saúde pública

    Directory of Open Access Journals (Sweden)

    Nicolas Lechopier

    2015-04-01

    Full Text Available Este artigo examina a interação da ética, da antropologia social e da epistemologia na saúde pública. Na primeira seção do artigo, introduzimos ao amplo espectro de abordagens existentes que consideram a saúde pública como um campo político, como uma ciência e como um projeto antropológico global que levanta inúmeras questões éticas. Na segunda seção, propomos uma apresentação mais detalhada das principais questões levantadas pela saúde pública através de uma rede de quatro tensões dialéticas fundamentais. A primeira tensão concerne principalmente às dubiedades das definições de saúde e às finalidades propostas para esse campo. A segunda tensão concerne à legitimidade dos meios utilizados para chegar aos objetivos da saúde pública. A terceira tensão diz respeito ao regime de evidência e ao referencial das abordagens empregadas na saúde pública. A quarta tensão se origina nas relações de poder construídas no interior dessas práticas da saúde pública. Sugerimos que essas quatro tensões, nas quais a polarização apresenta uma variedade de formatos, relacionam-se entre si. Isso conduz à conclusão de que na saúde pública, as considerações éticas, antropológicas e epistemológicas precisam andar juntas. Para entender criticamente as questões da saúde pública, precisamos, portanto, levar em conta as íntimas interações entre as ciências, os valores e as práticas.

  15. Toplum Ruh Sağlığı Merkezlerinde Hemşirenin Rolü

    OpenAIRE

    İçel, Sema; Özkan, Birgül; Aydoğan, Arzu

    2016-01-01

     Toplum ruh sağlığı merkezleri, ağır ruhsal bozukluğu olan hastalara, toplum temelli ruh sağlığı modeli çerçevesinde bireysel işlevi iyileştirmeye dönük etkin tedaviler sunulması, psikososyal destek hizmetlerinin verilmesi, takip ve tedavilerinin yaşadıkları ortamda, birinci basamak sağlık hizmetlerine entegre biçimde sunulabilmesi için gerekli hizmetlerin yürütüldüğü merkezlerdir.Bir ülkede ruh sağlığı hizmetlerinin etkinliğini sağlayabilmek için, bu ülke bireylerinin ruh sağlığı yönünden ko...

  16. Percepção de gerentes sobre a assistência à saúde coletiva

    Directory of Open Access Journals (Sweden)

    Helena Eri Shimizu

    2002-02-01

    Full Text Available Este estudo tem como objetivo conhecer a percepção de gestores e gerentes dos serviços de saúde sobre a assistência à saúde coletiva no contexto do Sistema Único de Saúde (SUS no Distrito Federal (DF. Trata-se de uma pesquisa qualitativa realizada por meio de entrevistas semi-estruturadas com gestores e gerentes da Regional Norte de Saúde do Distrito Federal. Conclui-se que a implantação dos princípios do SUS ainda é um desafio a ser enfrentado, tanto pela comunidade como pelos profissionais de saúde, que precisam unir esforços para encontrar estratégias que redirecionem a assistência à saúde coletiva.

  17. Prefeitos eleitos, descentralização na saúde e os compromissos com o SUS

    Directory of Open Access Journals (Sweden)

    Lenaura de Vasconcelos Costa Lobato

    Full Text Available O artigo analisa a municipalização na saúde por meio das proposições para a política de saúde de prefeitos eleitos no ano de 2012. Realizou-se análise documental das plataformas de governo dos então candidatos e de documentos oficiais da política e da gestão municipais de saúde - Relatórios das Conferências Municipais de Saúde e Planos Municipais de Saúde - de 24 municípios brasileiros nas cinco regiões do País. Os resultados indicam que os programas das candidaturas, em geral, incorporam a defesa do direito à saúde, embora principalmente através da ampliação da oferta de serviços médicos.

  18. O debate sobre educação em saúde no âmbito do Conselho Municipal de Saúde de Vitória, ES, Brasil

    Directory of Open Access Journals (Sweden)

    Welington Serra Lazarini

    2014-12-01

    Full Text Available Analisou-se a relação entre educação em saúde e a política de participação e controle social em saúde da Secretaria Municipal de Saúde de Vitória-ES, Brasil, entre 2005 e 2012. Realizou-se análise documental nos planos municipais de saúde, relatórios de gestão e em 139 atas do Conselho Municipal de Saúde. Evidenciou-se que a gestão orientou sua política pela participação, mas restringiu-se ao Conselho Municipal de Saúde. A educação em saúde foi tratada pontualmente durante as reuniões. Quando debatida, foi como modelo tradicional, configurando-se em estratégia para vigilância. A Educação Popular em Saúde foi mencionada no segundo governo, mas sem a redefinição das práticas. Sinaliza-se a necessidade de reconhecer as diferentes formas de participação social em Vitória e ampliar o debate acerca do modelo dialógico da educação em saúde.

  19. An??lise das percep????es de professores e profissionais de sa??de sobre pr??ticas educativas em sa??de: subs??dios para a estrat??gia integrada de preven????o da dengue.

    OpenAIRE

    Assis, Sheila Soares de

    2012-01-01

    A dengue integra o conjunto de doen??as negligenciadas, constituindo-se como um grave problema de sa??de p??blica em todo o mundo, inclusive no Brasil. A abordagem dos aspectos relacionados ao processo sa??de-doen??a ?? uma responsabilidade partilhada entre os servi??os de sa??de e os de educa????o. No ensino formal, os temas relacionados ?? sa??de devem ser tratados de forma transversal. Entretanto, historicamente a responsabilidade da abordagem deste tema tem reca??do sobre os componentes c...

  20. Políticas de saúde um contexto de saberes para o cuidado na estratégia de saúde da família

    OpenAIRE

    Eulina Patrícia Oliveira Ramos Pires; Maria Andréa Kertész de Souza

    2011-01-01

    Estudo de relato de experiência, das ações cuidativas vivenciadas por enfermeiras na Estratégia de Saúde da Família, cujo objetivo é contribuir no enlace de conhecimentos para o ser-saber-fazer profissional no cuidado à saúde da família. Embasado nas políticas de saúde e na contextualização do atendimento proximal à população como princípio integrador do Sistema Único de Saúde.

  1. Algumas características do setor privado de saúde de Salvador, Bahia, Brasil

    Directory of Open Access Journals (Sweden)

    Silva Ligia Maria Vieira da

    1997-01-01

    Full Text Available Com o objetivo de descrever algumas características dos serviços de saúde privados do Município de Salvador, foi realizado inquérito envolvendo 174 estabelecimentos cadastrados no IBGE. Foram investigados a natureza jurídica, a capacidade instalada ambulatorial e hospitalar, a produção e o custo das consultas médicas segundo modalidades de financiamento público e privado. As diferentes formas de assistência médica supletiva são a principal fonte de financiamento da assistência ambulatorial, e 51,1% das unidades investigadas são independentes dos recursos públicos oriundos do Sistema Único de Saúde (SUS. Os convênios-empresa e o seguro saúde stricto sensu participaram de forma moderada e elevada do financiamento das consultas médicas, em 54% e 41,9% dos serviços respectivamente. Os autores discutem o significado das modificações verificadas no segmento privado da atenção à saúde de Salvador, bem como as implicações desses achados no que diz respeito ao redimensionamento das estratégias de reorganização das práticas e serviços de saúde no País e de relacionamento entre o público e o privado.

  2. 保险企业,你了解SA8000吗?

    Institute of Scientific and Technical Information of China (English)

    吴慧

    2006-01-01

    SA8000是企业社会责任标准(Social Accoutability 8000)的简称。SA8000是继ISI9000、ISO14000之后出现的又一个涉及体系的重要的国际性认证标准。SA8000认证就是依据该标准的要求审查、评价组织是否与保护人类权益的基本标准相符。尽管SA8000标准不是ISO标准。但由于它得到代表全球广泛利益的公司和组织的支持,加上公众和消费者对全球社会责任的压力,SA8000认证得到高度的认可。

  3. Uma experiência em comunicação e saúde

    Directory of Open Access Journals (Sweden)

    Marina Ruiz de Matos

    2009-12-01

    Full Text Available Este trabalho refere-se à experiência desenvolvida no município de Guarulhos, sob o patrocínio do Ministério da Saúde, com o objetivo de envolver radiocomunicadores no processo educativo em saúde. Organizaram-se oficinas de trabalho com a participação de funcionários dos serviços municipais de saúde e de radialistas das rádios comunitárias das mesmas áreas de abrangência, para reflexão, discussão e elaboração de ações conjuntas sobre temas de saúde. Desenvolveu-se metodologia que articulou, além de textos acadêmicos, outros tipos de linguagem como pintura, música, radionovela, poesia etc., na abordagem dos assuntos. A avaliação final constou de um questionário preenchido pelos participantes e a análise das respostas indicou tratar-se de uma metodologia compatível com os objetivos de alcançar envolvimento e desenvolver parcerias entre comunicadores, serviços de saúde e comunidade.

  4. Sampling and sensitivity analyses tools (SaSAT for computational modelling

    Directory of Open Access Journals (Sweden)

    Wilson David P

    2008-02-01

    Full Text Available Abstract SaSAT (Sampling and Sensitivity Analysis Tools is a user-friendly software package for applying uncertainty and sensitivity analyses to mathematical and computational models of arbitrary complexity and context. The toolbox is built in Matlab®, a numerical mathematical software package, and utilises algorithms contained in the Matlab® Statistics Toolbox. However, Matlab® is not required to use SaSAT as the software package is provided as an executable file with all the necessary supplementary files. The SaSAT package is also designed to work seamlessly with Microsoft Excel but no functionality is forfeited if that software is not available. A comprehensive suite of tools is provided to enable the following tasks to be easily performed: efficient and equitable sampling of parameter space by various methodologies; calculation of correlation coefficients; regression analysis; factor prioritisation; and graphical output of results, including response surfaces, tornado plots, and scatterplots. Use of SaSAT is exemplified by application to a simple epidemic model. To our knowledge, a number of the methods available in SaSAT for performing sensitivity analyses have not previously been used in epidemiological modelling and their usefulness in this context is demonstrated.

  5. A diversidade cultural presente nos vídeos em saúde

    Directory of Open Access Journals (Sweden)

    Alice Ferry de Moraes

    2008-12-01

    Full Text Available Os vídeos, cada vez mais, são utilizados como suportes informacionais nas ações de intervenção social na área da saúde. Conhecer os elementos culturais existentes nos vídeos em saúde foi o objetivo deste trabalho, pois eles são facilitadores da transferência da informação. Estudos sobre o uso da informação em saúde no país, a força das imagens no processo cognitivo dos indivíduos e a necessidade de contextualização das informações repassadas serviram de base para a análise dos vídeos finalistas da III Mostra de Vídeos em Saúde, promovida pela Fundação Oswaldo Cruz (Fiocruz e realizada no Rio de Janeiro, em 1998. Com base na observação de alguns dados das fichas técnicas desses vídeos, foi possível identificar o meio cultural no qual eles foram produzidos. A diversidade cultural presente nas ações comunicacionais em todos os âmbitos, inclusive na promoção da saúde e na prevenção de doenças, é um elemento essencial para o progresso social.

  6. A segunda crítica social da Saúde de Ivan Illich

    Directory of Open Access Journals (Sweden)

    Roberto Passos Nogueira

    2003-02-01

    Full Text Available Na Nêmesis da Medicina, Ivan Illich expôs os elementos essenciais da sua primeira crítica da saúde, afirmando que a ampla industrialização da saúde e medicalização da vida na sociedade moderna faz aparecer diversas formas de iatrogênese ou danos à saúde, como resultado da perda da capacidade de ação autônoma das pessoas perante a enfermidade, a dor e o envelhecimento. Na segunda crítica social da saúde, Illich trata do surgimento de uma nova iatrogênese social, a iatrogênese do corpo, que resulta de uma espécie de obsessão com a saúde corporal e com sua produção através de atividades físicas, dietas etc. em aparente condição de autonomia. Trata-se de um consumismo do corpo saudável, que responde menos à ação dos médicos e mais às informações difundidas pelos meios de comunicação e pelos agentes terapêuticos não-oficiais.

  7. Para uma análise existencial da saúde

    Directory of Open Access Journals (Sweden)

    Roberto Passos Nogueira

    2006-12-01

    Full Text Available A ontologia fundamental de Heidegger de Ser e Tempo tem servido de fonte de inspiração para investigadores que realizam seus trabalhos nas áreas de saúde mental e saúde coletiva, a despeito das dificuldades de interpretação dessa obra. O entendimento equivocado por Binswanger, na tentativa de transpô-la para a psicanálise, serve de exemplo e é brevemente exposto com base na análise detalhada feita por Loparic. Neste artigo, parte-se do pressuposto de que a linguagem antimetafísica de Heidegger pode ajudar a fechar o que denomina de fenda ontológica entre saúde mental e saúde do corpo. Na primeira parte, recapitulam-se alguns equívocos que podem ser cometidos na interpretação da ontologia heideggeriana e delineiam-se os critérios de não-objetivação e não-determinismo. Na segunda, o autor aporta sua contribuição pessoal, ao explicitar sua própria interpretação da analítica existencial da saúde, articulada em torno de termos, tais como: padecimento, socorro e reatamento.

  8. Refletindo sobre valores éticos da Saúde Global

    Directory of Open Access Journals (Sweden)

    Paulo Antonio de Carvalho Fortes

    2015-06-01

    Full Text Available Desde as últimas décadas do século passado vem sendo construído o campo da saúde global, enfocando questões de saúde supraterritoriais, que extrapolam as fronteiras nacionais, assim como seus determinantes e suas possíveis soluções. Este ensaio objetiva refletir sobre os valores éticos envolvidos na saúde global: justiça social, equidade e solidariedade. Procedeu-se à revisão de artigos científicos e documentos de agências multilaterais. Identificou-se a defesa da saúde global como um bem universal público, analisando os valores da justiça e da equidade com enfoque na alocação e distribuição de recursos, com tendência a priorizar os mais desfavorecidos. São apresentados conceitos de solidariedade, buscando compreender se há a responsabilidade moral de ser solidário com pessoas de outros países, o que justificaria a cooperação internacional na saúde.

  9. Sampling and sensitivity analyses tools (SaSAT) for computational modelling.

    Science.gov (United States)

    Hoare, Alexander; Regan, David G; Wilson, David P

    2008-02-27

    SaSAT (Sampling and Sensitivity Analysis Tools) is a user-friendly software package for applying uncertainty and sensitivity analyses to mathematical and computational models of arbitrary complexity and context. The toolbox is built in Matlab, a numerical mathematical software package, and utilises algorithms contained in the Matlab Statistics Toolbox. However, Matlab is not required to use SaSAT as the software package is provided as an executable file with all the necessary supplementary files. The SaSAT package is also designed to work seamlessly with Microsoft Excel but no functionality is forfeited if that software is not available. A comprehensive suite of tools is provided to enable the following tasks to be easily performed: efficient and equitable sampling of parameter space by various methodologies; calculation of correlation coefficients; regression analysis; factor prioritisation; and graphical output of results, including response surfaces, tornado plots, and scatterplots. Use of SaSAT is exemplified by application to a simple epidemic model. To our knowledge, a number of the methods available in SaSAT for performing sensitivity analyses have not previously been used in epidemiological modelling and their usefulness in this context is demonstrated.

  10. Conselhos locais de saúde: caminhos e (descaminhos da participação social

    Directory of Open Access Journals (Sweden)

    Edgar Andrade Lisboa

    Full Text Available Resumo Este estudo analisou a criação e a implantação dos conselhos locais de saúde no município de Anchieta, no estado do Espírito Santo. Buscou-se identificar os fatores que apoiaram ou limitaram a sua efetiva participação no contexto do Sistema Único de Saúde local. Por meio de abordagem qualitativa, realizaram-se 13 entrevistas com os conselheiros. Utilizou-se a análise de conteúdo, evidenciando três categorias trabalhadas neste texto: Ser ou não ser conselheiro de saúde? Eis a questão!; O não pertencimento e a não participação; e Conselhos locais de saúde: elos, meios e mediações. Concluiu-se que os conselheiros enfrentam grandes dificuldades que acabam por desvirtuar os caminhos desejados da participação social no âmbito do Sistema Único de Saúde. Por isso, é imprescindível que haja vontade política, apoio à participação efetiva e programas de educação para a cidadania dos atores envolvidos nesses fóruns, para que assim possam exercer de forma plena seu papel.

  11. Necessidades em saúde: questões importantes para o trabalho da enfermagem

    Directory of Open Access Journals (Sweden)

    Edir Nei Teixeira Mandu

    1999-03-01

    Full Text Available A construção de novos parâmetros e práticas em saúde e enfermagem, no sentido do efetivo exercício de direitos sociais, é um desafio posto na atualidade. Este trabalho é uma contribuição ao enfrentamento desse desafio. Olhando para o saber da enfermagem, reflete-se sobre um dado modo de interpretação das necessidades em saúde. A partir de uma discussão acerca das necessidades humanas e de sua relação com o trabalho em saúde, submete-se à crítica a interpretação das necessidades humanas/em saúde presente na teoria de Wanda de Aguiar Horta. Destaca-se na análise a importância da autonomia/autovalorização humana e a interpretação de necessidades a partir da consideração aos sujeitos que recebem-fazem saúde e ao contexto social.

  12. Representações sociais da educação em saúde pelos profissionais da equipe de saúde da família

    Directory of Open Access Journals (Sweden)

    Maria Flávia Carvalho Gazzinelli

    Full Text Available Este estudo discute a forma como os profissionais da equipe de saúde da família pensam e representam a educação em saúde e a prática educativa que realizam. Os sujeitos da pesquisa (n=248 - médico, enfermeiro, auxiliar de enfermagem e agente comunitário de saúde de 20 unidades básicas de saúde de Belo Horizonte - foram entrevistados mediante a utilização da técnica de evocação livre e da teoria das representações sociais. Solicitou-se aos sujeitos que verbalizassem cinco palavras que lhes ocorressem imediatamente em relação à educação em saúde, classificando-as em positiva ou negativa. Utilizou-se o software Evoc e calculou-se a frequência simples de ocorrência, a média ponderada de ocorrência em função da ordem de evocação e a média das ordens ponderadas do conjunto dos termos evocados. Construiu-se o quadro de quatro casas composto do núcleo central, elementos de contraste e periféricos da representação. Médicos e enfermeiros compartilham conteúdos representacionais entre si, expressando representações sociais similares, ao apresentarem nos possíveis núcleos centrais 'capacitação' e 'prevenção'. Auxiliares de enfermagem e agentes comunitários de saúde se assemelham por meio dos possíveis elementos centrais 'educação' e 'prevenção'. O foco recai na transmissão de orientações com o objetivo de persuadir os indivíduos à adoção de modos de vida saudáveis.

  13. Intervenções Psicossociais para Promoção da Saúde do Homem em Unidade de Saúde da Família

    Directory of Open Access Journals (Sweden)

    Luiz Gustavo Silva Souza

    Full Text Available Este relato de experiência profissional busca contribuir a responder a questão: Como promover a saúde do homem na Atenção Primária à Saúde? São descritas duas estratégias implantadas em uma Unidade de Saúde da Família de Vitória, ES, as "Ações de Sábado" e o "Grupo de Homens". Cada "Ação de Sábado" é realizada trimestralmente, em um sábado pela manhã, com duração de quatro horas, contando com atividades recreativas e de educação em saúde (discussões sobre doenças sexualmente transmissíveis, por exemplo. O "Grupo de Homens" é realizado semanalmente, com duração de 1h15min, com exposições dialogadas (sobre problemas com o álcool, por exemplo e com oficinas terapêuticas. No período de setembro de 2011 a julho de 2013, as intervenções envolveram cerca de 230 homens de classe popular. Os conceitos de clínica ampliada e atitude psicoterapêutica são utilizados para promover a expressão dos usuários e a corresponsabilização com o processo saúde-doença. Dentre os resultados, destacam-se: o aumento da presença masculina na USF, a melhoria do cuidado dirigido a condições crônicas (especialmente hipertensão, diabetes e problemas com o álcool/alcoolismo e o fortalecimento de comportamentos de redução de danos. Conclui-se que as intervenções são proveitosas para abordar desafios relativos à Saúde do Homem.

  14. SaOS-2 cell response to macro-porous boron-incorporated TiO{sub 2} coating prepared by micro-arc oxidation on titanium

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Qianli [State Key Laboratory of New Ceramics and Fine Processing, School of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Elkhooly, Tarek A. [State Key Laboratory of New Ceramics and Fine Processing, School of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Department of Ceramics, Inorganic Chemical Industries Division, National Research Centre, Dokki, 12622 Cairo (Egypt); Liu, Xujie [State Key Laboratory of New Ceramics and Fine Processing, School of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Graduate School at Shenzhen, Tsinghua University, Shenzhen 518055 (China); Zhang, Ranran; Yang, Xing; Shen, Zhijian [State Key Laboratory of New Ceramics and Fine Processing, School of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Feng, Qingling, E-mail: biomater@mail.tsinghua.edu.cn [State Key Laboratory of New Ceramics and Fine Processing, School of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Key Laboratory of Advanced Materials of Ministry of Education of China, School of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China)

    2016-10-01

    The aims of the present study were to develop boron-incorporated TiO{sub 2} coating (B-TiO{sub 2} coating) through micro-arc oxidation (MAO) and subsequently evaluate the effect of boron incorporation on the in vitro biological performance of the coatings. The physicochemical properties of B-TiO{sub 2} coating and its response to osteoblast like cells (SaOS-2) were investigated compared to the control group without boron (TiO{sub 2} coating). The morphological and X-ray diffraction results showed that both coatings exhibited similar surface topography and phase composition, respectively. However, the incorporation of B led to an enhancement in the surface hydrophilicity of B-TiO{sub 2} coating. The spreading of SaOS-2 cells on B-TiO{sub 2} coating was faster than that on TiO{sub 2} coating. The proliferation rate of SaOS-2 cells cultured on B-TiO{sub 2} decreased after 5 days of culture compared to that on TiO{sub 2} coating. SaOS-2 cells cultured on B-TiO{sub 2} coating exhibited an enhanced alkaline phosphatase (ALP) activity, Collagen I synthesis and in vitro mineralization compared to those on TiO{sub 2} coating. The present findings suggest that B-TiO{sub 2} coating is a promising candidate surface for orthopedic implants. - Highlights: • SaOS-2 cell response to pure TiO{sub 2} and B-TiO{sub 2} coatings was investigated. • Initial cell spreading on B-TiO{sub 2} coating was accelerated compared to that on TiO{sub 2} coating. • Cell proliferation on B-TiO{sub 2} coating was inhibited compared to that on TiO{sub 2} coating. • Cell differentiation on B-TiO{sub 2} coating was enhanced compared to that on TiO{sub 2} coating.

  15. Synthesis of a highly dispersive sinapinic acid@graphene oxide (SA@GO) and its applications as a novel surface assisted laser desorption/ionization mass spectrometry for proteomics and pathogenic bacteria biosensing.

    Science.gov (United States)

    Abdelhamid, Hani Nasser; Wu, Hui-Fen

    2015-03-07

    Graphene oxide (GO)-modified sinapinic acid (3,5-dimethoxy-4-hydroxycinnamic acid, SA) (SA@GO) was synthesized and characterized; it was then investigated as a new surface assisted laser desorption/ionization mass spectrometry (SALDI-MS) for proteomics and pathogenic bacteria biosensing. SA@GO could effectively decrease the time necessary for sweet spotting searching, reducing the amount of organic matrix and solvent and enhance the sensitivity. SA@GO shows high performance as a matrix alone without the need to add trifluoroacetic acid (TFA). However, the analysis of the intact bacteria cells shows improvement in the signal intensity (2-5 fold) and offers a low limit of detection. All these analyses could be performed with low concentrations (1-10 fmol) and tiny volumes (0.5-1 μL). This study demonstrated that the exploration of new hybrid materials is pivotal to achieve high performance and high ionization. Because of the plane of GO, it assists protein-protein interactions that make it undergo softer ionization.

  16. Distraction decreases prefrontal oxygenation: A NIRS study.

    Science.gov (United States)

    Ozawa, Sachiyo; Hiraki, Kazuo

    2017-04-01

    When near-infrared spectroscopy (NIRS) is used to measure emotion-related cerebral blood flow (CBF) changes in the prefrontal cortex regions, the functional distinction of CBF changes is often difficult because NIRS is unable to measure neural activity in deeper brain regions that play major roles in emotional processing. The CBF changes could represent cognitive control of emotion and emotional responses to emotional materials. Supposing that emotion-related CBF changes in the prefrontal cortex regions during distraction are emotional responses, we examined whether oxygenated hemoglobin (oxyHb) decreases. Attention-demanding tasks cause blood flow decreases, and we thus compared the effects of visually paced tapping with different tempos, on distraction. The results showed that the oxyHb level induced by emotional stimulation decreased with fast-tempo tapping significantly more than slow-tempo tapping in ventral medial prefrontal cortex regions. Moreover, a Global-Local task following tapping showed significantly greater local-minus-global response time (RT) difference scores in the fast- and mid-tempo condition compared with those in the slow-tempo, suggesting an increased attentional focus, and decreased negative emotion. The overall findings indicate that oxyHb changes in a relatively long distraction task, as measured by NIRS, are associated with emotional responses, and oxyHb can be decreased by successfully performing attention-demanding distraction tasks.

  17. Desafios e possibilidades no exercício da preceptoria do Pró-PET-Saúde

    Directory of Open Access Journals (Sweden)

    Patrícia Acioli de Barros Lima

    2015-12-01

    Full Text Available O Sistema Único de Saúde (SUS e as Diretrizes Nacionais de Educação (DCNs direcionam o cuidado e a formação em saúde. Para fazer essa integração, o Ministério da Educação e o Ministério da Saúde criaram o Programa Nacional de Reorientação da Formação Profissional em Saúde (Pró-Saúde e o Programa de Educação pelo Trabalho para Saúde (PET/Saúde, que necessitam de preceptores aptos a gerir suas práticas. O objetivo deste trabalho foi analisar os desafios e as possibilidades no exercício da preceptoria do Pró-PET-Saúde. Os sujeitos foram trinta preceptores do Pró-PET-Saúde/Ufal. O instrumento utilizado para a coleta dos dados foi a entrevista semiestruturada, e esses foram analisados por meio da análise de conteúdo. Os resultados indicam que as possibilidades seriam: o trabalho interprofissional, reavaliar as práticas e a contribuição com a formação. Entre os desafios, estão: o despreparo pedagógico, trabalho interprofissional e a deficiência na infraestrutura.

  18. Promoção da saúde e trabalho: um ensaio analítico

    Directory of Open Access Journals (Sweden)

    Cleonice Andréa Alves Cavalcante

    2008-03-01

    Full Text Available Este artigo teve como propósito discutir a articulação entre promoção da saúde e trabalho, na perspectiva de aproximar as práticas em saúde do trabalhador, com o enfoque na promoção da saúde. Para tanto, discutimos a trajetória histórica da promoção da saúde e das políticas de saúde do trabalhador no Brasil, apontando suas dificuldades, limitações e perspectivas. Em seguida, analisamos a temática sob o olhar de diferentes autores que discutem o assunto, no sentido de detectar as novas abordagens e perspectivas da relação promoção da saúde e trabalho propostas. Concluímos que a articulação entre Promoção da Saúde e trabalho não só é viável como extremamente importante no processo de implementação de uma política de saúde do trabalhador, que o considere sujeito ativo e participativo, além de contribuir para diminuir lacunas e encontrar respostas para questões não contempladas pelas atuais práticas em saúde do trabalhador no Brasil.

  19. Educação para a saúde a grupo de obesos

    Directory of Open Access Journals (Sweden)

    Glaci de Oliveira Pinto Vargas

    1983-03-01

    Full Text Available Este trabalho foi realizado por enfermeiras que atuam a nível ambulatorial, num Programa de Adulto, no Serviço de Saúde Pública, de um hospital geral de Porto Alegre, RS. É uma contribuição original de uma pesquisa descritivo analítica, com grupos de clientes obesos, atendidos através de cursos de educação para a saúde. Pretende-se avaliar quatro aspectos sem ordem de prioridade: a interesse da clientela pela educação da saúde, em grupo; b impressão, em relação aso conteúdos desenvolvidos; c redução do peso; d mudança de algum hábito de vida.

  20. O fazer da enfermeira no sistema local de saúde: individual ou coletivo?

    Directory of Open Access Journals (Sweden)

    Marluce Maria Araújo Assis

    1996-09-01

    Full Text Available Este ensaio consiste em uma reflexão teórica acerca do fazer da enfermeira no Sistema Local de Saúde (SILOS, permitindo compreender (ainda que provisoriamente se o espaço que vem sendo ocupado pela mesma, na "porta de entrada" dos serviços de saúde, tem possibilitado uma construção ideológica de sua ação social, enquanto sujeito coletivo ou individual. Assim, procuramos nos pautar teoricamente no pensamento de Testa (1995 e apontamos o SILOS, enquanto um espaço social de transformação do Sistema de Saúde. Discutimos também, as relações vivenciadas no cotidiano da organização institucional, tentando entender o processo de produção de sujeitos sociais, focalizando a enfermeira nesta construção.

  1. Atlas mundial da saúde Atlas mondial de la santé

    OpenAIRE

    Ligia Vizeu Barrozo

    2009-01-01

    O Atlas é de autoria de Zoé Vaillant, mestre de conferências da Universidade Paris-Ouest-Nanterre-La Défense e membro do laboratório Espaço, Saúde e Territórios e de Gérard Salem, professor de geografia da saúde da Universidade Paris-Ouest-Nanterre-La Défense e coordenador do laboratório Espaço, Saúde e Territórios. Cécile Marin, responsável pela cartografia do Atlas, é geógrafa-cartógrafa, formada pela Universidade d’Orléans.O Atlas mondial de la santé faz parte da série Collection Atlas/Mon...

  2. A construção coletiva da Biblioteca Virtual em Saúde

    Directory of Open Access Journals (Sweden)

    Abel Laerte Packer

    2005-08-01

    Full Text Available Retoma-se a origem da Biblioteca Virtual em Saúde (BVS como produto da evolução do programa de cooperação técnica em informação científica em saúde na América Latina e no Caribe. Analisa-se sua conformação tecnológica como produto da reestruturação da comunicação científica promovida pela internet, destacando o aprimoramento conceitual e operacional do modelo de gestão coletiva de informação e conhecimento no espaço virtual e os desafios de promover o acesso e uso democráticos da informação e do conhecimento atualizado nos processos que envolvem a saúde coletiva e individual.

  3. O papel do enfermeiro de saúde publica: projeções no ensino

    Directory of Open Access Journals (Sweden)

    Bertha Cruz Enders

    1995-09-01

    Full Text Available Analisa-se o papel do enfermeiro em saúde pública no contexto do ensino, como ponto de partida para uma avaliação da prática. Objetivou-se 1 Identificar o papel do enfermeiro em saúde pública projetado nos conteúdos programáticos das disciplinas de saúde pública do Curso de Enfermagem na Universidade Federal do Rio Grande do Norte desde sua implantação em 1974 até 1990 e, 2 Avaliar as concepções projetadas no ensino frente a realidade das práticas dos egressos. Conceptualizações da teoria de papeis nortearam o entendimento do termo "papel" e do processo de internalização do conceito. Utilizou-se uma abordagem qualitativa com triangulação na coleta de dados. Dados foram obtidos em duas fontes: nos conteúdos programáticos do Curso e nas opiniões dos enfermeiros egressos do Curso. Técnicas de análise documental foram aplicadas a 70 programas de disciplinas de Saúde Pública e uma amostra aleatória estratificada de 60 enfermeiros foi entrevistada utilizando um questionário específico. Os dados foram analisados à luz da teoria de papeis para a identificação do conceito. Em seguida, se analisou o conceito com base nas políticas de saúde vigentes da época em estudo. Os resultados demonstram que o papel do enfermeiro em saúde pública projetado nos conteúdos focaliza funções múltiplas, assistenciais educativas e administrativas dentro de uma visão preventiva. O objetivo da enfermagem em saúde pública tem sido a prevenção, dentro de uma prática de assistência primária e mais recentemente, dentro de uma perspectiva de mudança e de transformação das questões sociais e das políticas de saúde. Focaliza o enfermeiro planejador, competente nas técnicas epidemiológicas. A percepção dos egressos é também preventiva e focaliza o papel educador e conscientizador do enfermeiro, embora pouco avanço se observa com relação às questões sociais da população. Existe uma incompatibilidade entre os

  4. Electro-generation of TGA by Ni-mSA-mCS bipolar membrane

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    Ni-mSA-mCS bipolar membrane (BM) was prepared by sodium alginate (SA) and chitosan (CS), which were modified by Ca2+and glutaraldehyde as linking reagents, respectively. mSA-mCS membrane was characterized by FTIR, SEM, TG and used as a separator in the electrolysis cell to produce thioglycolic acid (TGA). The experiment results show that TGA was prepared effectively by electro-reduction of dithiodiglycolic acid (DTDGA) with the mixture of TGA and DTDGA in the cathodic chamber. The current efficiency was up to 66.7% at the room temperature (25 ℃) during the current density of 10 mA/cm2. Compared with the traditional metal reduction method, the electro-reduction technology saves the zinc powder and eliminates the pollution to environment.

  5. Psicologia da saúde : articulações entre vida e política

    OpenAIRE

    Bernardes,Anita Guazzelli

    2016-01-01

    O objetivo deste artigo é pensar a Psicologia da Saúde a partir de articulações entre vida e política. O foco da discussão está em um exercício que permita considerar vida e política para problematizar a relação entre Psicologia e Saúde, efetuando uma certa torção no pensamento. O campo de análise ampara-se na Psicologia Social, mais especificamente no pós-estruturalismo, em um diálogo com a Filosofia. Pensar com a vida na Psicologia da Saúde é considerar uma orientação, uma figura de pensame...

  6. Financiamento do Sistema Único de Saúde nos governos FHC, Lula e Dilma

    Directory of Open Access Journals (Sweden)

    Adilson Soares

    Full Text Available O artigo discute questões relativas ao financiamento e à alocação de recursos no SUS, no contexto de dois projetos políticos distintos. O estudo analisa os gastos com saúde no Brasil, no período de 1995 a 2012, comparados aos gastos internacionais, ao PIB e a Receita Corrente Bruta. Na análise, buscou-se comparar os compromissos assumidos com o SUS nas gestões dos presidentes FHC, Lula e Dilma. Observou-se que, com relação ao comportamento dos gastos com saúde, no âmbito federal, os governos do Partido dos Trabalhadores não diferiram dos governos do Partido da Social Democracia Brasileira. O perfil dos gastos com saúde não deu conta de atender ao sonho da reforma sanitária dos anos 1980.

  7. Bacharel em Saúde Coletiva: um Elo que faltava na Rede

    Directory of Open Access Journals (Sweden)

    Antônio José Costa CARDOSO

    2013-11-01

    Full Text Available O desafio deste último texto é, sem outras referências, fazer “emergir” um (incerto Discurso do Sujeito Coletivo – aqui referido ao conjunto de autores que assina esse número especial da Tempus Actas em Saúde Coletiva, a partir de um diálogo que se pretende articulador das ideias dos diversos autores que trataram da criação dos bacharelados, mercado de trabalho e carreira, identidade e regulamentação da profissão, campos de prática e estágio em Saúde Coletiva, tomando o texto-base Graduação em Saúde Coletiva: conquistas e passos para além do sanitarismo, de Jairnilson Silva Paim e Isabela Cardoso Pinto, como ponto de partida.

  8. Saúde mental e vulnerabilidade social: a direção do tratamento

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Pegolo da Gama

    2014-03-01

    Full Text Available O objetivo do texto é refletir sobre as relações entre saúde mental e vulnerabilidade social a partir do encontro da Psiquiatria Biológica com a Reforma Psiquiátrica. Problematizamos o conceito de saúde mental, o conceito de vulnerabilidade social, os manuais diagnósticos, as pesquisas epidemiológicas, tendo como pano de fundo as Políticas Públicas de Saúde. Identificamos a necessidade de superação da lógica técnico-científico tradicional incorporando a singularidade e saberes ligados aos sujeitos que são afetados pelo sofrimento.

  9. Saber e fazer: a tecitura da rede em saúde

    Directory of Open Access Journals (Sweden)

    Bellini, Maria Isabel Barros

    2004-01-01

    Full Text Available A emergência das Novas Tecnologias da Informação e Comunicação (NTIC impõe respostas dos profissionais da saúde que contemplem as transformações substanciais vividas pela sociedade. Esse contexto é abordado, aqui, como um dos cenários das necessidades humanas. A pesquisa “Rede de Recursos Humanos da SES em Nível de Especialização, Mestrado e Doutorado”, coordenada pelo Serviço Social na ESP, tem como objetivo anunciar alguns aspectos dessa realidade em redes virtuais. Para tanto, resgata alguns aspectos da história da saúde no Brasil, encadeando a evolução das tecnologias do conhecimento. Ao final, salienta as perspectivas vislumbradas até o momento, com esta estratégia de ação e reflexão sobre a saúde

  10. Implicit Volatility versus Statistical Volatility: an Exercise Using Options and Telemar S.A. Stock

    Directory of Open Access Journals (Sweden)

    Marcelo Savino Portugal

    2004-06-01

    Full Text Available The main goal this article was to find the best way of making forecast about future volatility using implicit or statistic forecast. The work is based on Telemar S.A. shares data from 21/09/1998 to 21/10/2002 and Telemar S.A. shares data from 2/10/2000 to 21/10/2002. The implicit volatility was obtained using back-out procedure from the Black-Scholes model. The statistics forecasts were obtained using weighted moving average models, GARCH, EGARCH and FIGARCH models. The Wald statistic shows that EGARCH and FIGARCH models are efficient and are not biased forecasts for Telemar S.A. absolute variation between t and t + 1. The volatility evaluation during the maturity time of an option, rejects the hypothesis that implicit volatility is the best forecast to future volatility and the Wald statistic show that FIGARCH model is an efficient and not biased forecast.

  11. Atlas mundial da saúde Atlas mondial de la santé

    Directory of Open Access Journals (Sweden)

    Ligia Vizeu Barrozo

    2009-06-01

    Full Text Available O Atlas é de autoria de Zoé Vaillant, mestre de conferências da Universidade Paris-Ouest-Nanterre-La Défense e membro do laboratório Espaço, Saúde e Territórios e de Gérard Salem, professor de geografia da saúde da Universidade Paris-Ouest-Nanterre-La Défense e coordenador do laboratório Espaço, Saúde e Territórios. Cécile Marin, responsável pela cartografia do Atlas, é geógrafa-cartógrafa, formada pela Universidade d’Orléans.O Atlas mondial de la santé faz parte da série Collection Atlas/Mon...

  12. Decreased group velocity in compositionally graded films.

    Science.gov (United States)

    Gao, Lei

    2006-03-01

    A theoretical formalism is presented that describes the group velocity of electromagnetic signals in compositionally graded films. The theory is first based on effective medium approximation or the Maxwell-Garnett approximation to obtain the equivalent dielectric function in a z slice. Then the effective dielectric tensor of the graded film is directly determined, and the group velocities for ordinary and extraordinary waves in the film are derived. It is found that the group velocity is sensitively dependent on the graded profile. For a power-law graded profile f(x)=ax(m), increasing m results in the decreased extraordinary group velocity. Such a decreased tendency becomes significant when the incident angle increases. Therefore the group velocity in compositionally graded films can be effectively decreased by our suitable adjustment of the total volume fraction, the graded profile, and the incident angle. As a result, the compositionally graded films may serve as candidate material for realizing small group velocity.

  13. Proceso de internacionalización de las empresas Compañía Licorera de Nicaragua, S.A. y Kraft Foods Nicaragua, S.A

    Directory of Open Access Journals (Sweden)

    Aurora Margarita Saravia

    2006-08-01

    Full Text Available AUNQUE NICARAGUA ES UN PAÍS SUBDESARROLLADO Y POBRE, fundamenta sus expectativas de crecimiento y desarrollo en la exportación, especialmente desde la firma de diferentes Tratados de Libre Comercio. Sin embargo, son pocas las empresas nacionales que han logrado competir con éxito en los mercados internacionales. Entre ellas, se encuentran la Compañía Licorera de Nicaragua, S.A. y Kraft Foods de Nicaragua, S.A. El éxito del proceso de internacionalización depende de muchos factores, incluyendo la decisión de aventurarse en el extranjero. El punto clave está en aprovechar las ventajas competitivas de cada empresa y enfocarlas para obtener productos y servicios de calidad que son los pilares del éxito. El éxito internacional de estas tres empresas se analiza en este trabajo para dar a conocer su experiencia

  14. Atenção Primária à Saúde: elementos de continuidade e mudanças na saúde do Distrito Federal

    Directory of Open Access Journals (Sweden)

    Helder Kiyoshi Kashiwakura

    Full Text Available RESUMO A Atenção Primária à Saúde (APS ocupa lugar de destaque na agenda governamental. Os objetos do estudo são o sistema de saúde do Distrito Federal e as iniciativas para reorganização da APS, com objetivo de analisar o comportamento dos gastos em busca de elementos de continuidade e mudanças nessa política, no período de 2005 a 2014. Adotou-se a pesquisa documental com foco em dados do Sistema de Informações sobre Orçamentos Públicos. Partindo do neoinstitucionalismo histórico, os resultados apontam contradição entre o discurso em defesa da APS e a manutenção das elevadas despesas com assistência hospitalar, testemunhando a característica de path dependence.

  15. Shock drift mechanism for Forbush decreases

    Science.gov (United States)

    Cheng, Andrew F.; Sarris, E. T.; Dodopoulos, C.

    1990-01-01

    Consideration is given to the way in which Forbush decreases can arise from variable drifts in nonuniform shocks, where the variation in shock strength along the shock front causes both the shock drift distance and the energy gain to become variable. More particles can then be transported out of a given region of space and energy interval than were transported in, so a spacecraft passing through this region can observe a Forbush decrease in this energy interval despite shock energization and compression. A simple example of how this can occur is presented.

  16. Caminhada e gastos com saúde em adultos usuários do sistema público de saúde brasileiro: estudo transversal retrospectivo

    Directory of Open Access Journals (Sweden)

    Bruna Camilo Turi

    2015-11-01

    Full Text Available A inatividade física é um dos maiores desafios à saúde pública devido à sua associação com doenças crônicas e ao impacto econômico sobre o sistema público de saúde. Entretanto, a prática de caminhada pode auxiliar a amenizar esses problemas. Objetivo Verificar se existem associações entre prática de caminhada no lazer, presença de fatores de risco e gastos relacionados ao uso de serviços de saúde em usuários do sistema público de saúde brasileiro. Metodologia A amostra foi composta por 963 adultos. A prática de caminhada foi avaliada a partir de questionário de Baecke. Gasto com tratamento/ano foi avaliado pela demanda por serviços registrados nos prontuários clínicos. Resultados Prática de caminhada como atividade física de lazer foi referida por 64,4% dos participantes. Os grupos de maior prática de caminhada apresentaram menores valores para idade, IMC, CC e gastos com medicamentos. Indivíduos inseridos na categoria de maior envolvimento apresentaram 41% menos chances de estarem inserido no grupo de maior gasto total (OR=0.59; IC95% 0.39-0.89. Conclusão Verificou-se que a prática de caminhada como atividade física de lazer foi a mais frequente para a maioria dos usuários do SUS, a qual foi associada a menores gastos com medicamentos e no total.

  17. A promoção da saúde no ensino profissional: desafios na Saúde e a necessidade de alcançar outros setores

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Lobato Tavares

    2016-06-01

    Full Text Available Resumo O artigo discute a natureza dinâmica e complexa da promoção da saúde, o que requer formação profissional que facilite formular e colocar em prática seus princípios teóricos e metodológicos mediante contínua reflexão sobre as contradições dos contextos e a necessidade de enfrentamento dos desafios e expectativas das comunidades nos territórios. Considera também outro desafio que se coloca no trabalho em saúde, que é a mediação/ação intersetorial para implementação do seu conceito ampliado. Assim, demanda uma formação baseada em competências, o que significa um conjunto de atitudes e saberes para viabilizar a capacidade de agir em determinada situação. Apresenta duas experiências de ensino desenvolvidas no Brasil que tem contribuído na formação profissional em saúde, na perspectiva da promoção: a do Programa de Pós-graduação stricto sensu, em Promoção de Saúde da Universidade de Franca e a do Programa de Pós-graduação lato sensu da ENSP/Fiocruz. Em ambas, o uso de metodologias problematizadoras instrumentalizam a construção de capacidades, possibilitando que a teoria se aproxime da prática e proporcione uma formação crítica e reflexiva com rigor científico e relevância temática.

  18. Velhice, incapacidade e cuidado na saúde pública

    Directory of Open Access Journals (Sweden)

    Karla Cristina Giacomin

    2015-12-01

    Full Text Available Resumo O envelhecimento populacional modifica profundamente o escopo de atuação da saúde coletiva, altera o perfil de morbimortalidade e aumenta a demanda por cuidados crônicos. Na população idosa, a incapacidade serve como indicador de saúde e balizador de ações e políticas. Esta pesquisa de abordagem qualitativa, fundamentada na antropologia interpretativa e na perspectiva êmica, tem por objetivo compreender a forma de pensar e agir dos idosos diante da “velhice com incapacidade” e suas relações com a saúde pública. Foram realizadas entrevistas individuais no domicílio, com roteiro semiestruturado, junto a 57 idosos residentes na cidade, inclusive participantes da coorte de Bambuí. A metodologia de Signos, Significados e Ações orientou a coleta e a análise dos dados, possibilitando a investigação antropológica das representações e comportamentos concretos associados à incapacidade na velhice na cultura local. Emergiram da análise duas categorias acerca das relações entre velhice, incapacidade e cuidado na saúde pública: experiências de cuidado na velhice com incapacidade; o medo da falta de cuidados. Os resultados revelam que a saúde pública precisa rever seus conceitos sobre incapacidade na velhice e incorporar a dimensão funcional da saúde e o cuidado à velhice com incapacidade na agenda.

  19. Trabalho escravo contemporâneo como um problema de saúde pública

    Directory of Open Access Journals (Sweden)

    Luís Henrique da Costa Leão

    Full Text Available Resumo O trabalho escravo contemporâneo (TE é uma das mais injustas e persistentes problemáticas sociais do Brasil. Frente à necessidade de implantação da política nacional de saúde do(a trabalhador(a, este artigo discute o trabalho escravo como problema de saúde pública, destacando possibilidades de ampliar as estratégias de vigilância e atenção integral a essa população específica de trabalhadores. Foi realizada uma pesquisa qualitativa, exploratória, sob o referencial teórico da construção social da realidade, conforme Lenoir, Berger e Luckmann. O estudo consistiu em uma revisão teórica sobre TE no cenário nacional e internacional no âmbito das ciências humanas, sociais e de saúde pública e uma análise das práticas de enfrentamento ao TE na região norte do estado do Rio de Janeiro. Foram efetuadas entrevistas semiestruturadas, individuais e coletivas, com trabalhadores e representantes de movimentos sociais e instituições públicas. Os resultados demonstram dimensões teóricas e práticas sobre o TE e suas relações com o campo da saúde e destacam o papel e o potencial da saúde pública no fortalecimento das práticas de vigilância e atenção à saúde dos trabalhadores submetidos a essas condições sociais crônicas.

  20. Justiça social e equidade em saúde: uma abordagem centrada nos funcionamentos

    Directory of Open Access Journals (Sweden)

    Carlos Dimas Ribeiro

    2015-12-01

    Full Text Available Trata-se de um ensaio de natureza teórica que objetiva defender uma concepção de justiça social voltada aos funcionamentos dos indivíduos, articulando a discussão da justiça com o debate sobre equidade em saúde. Na introdução, são discutidas as circunstâncias da justiça, abordando a questão da escassez dos recursos no campo da saúde. No primeiro item, analisa-se a noção da equidade em saúde, apresentando os principais enfoques abordados, em particular o conceito de equidade em saúde proposto por Margaret Whitehead, amplamente utilizado na saúde coletiva. No segundo item, apresenta-se, brevemente, a Abordagem das Capacitações desenvolvida por Amartya Sen e Martha Nussbaum, que recuperam a noção aristotélica de funcionamento. Ao final, critica-se essa abordagem e defende-se a Perspectiva dos Funcionamentos (PF, proposta por Maria Clara Dias, aplicada ao campo da saúde. Dessa forma, os concernidos da justiça são sistemas funcionais e o que se quer igualar para propósitos de justiça é a integridade funcional dos seres vivos. São apresentadas algumas vantagens dessa perspectiva, considerada aquela que melhor preenche os requisitos de uma concepção de justiça extensiva a todos no Brasil.

  1. Promoção de Saúde e a Funcionalidade Humana

    Directory of Open Access Journals (Sweden)

    Ana Cristhina de Oliveira Brasil

    2013-03-01

    Full Text Available Para a elaboração de políticas públicas de saúde no Brasil, dois aspectos devem ser levados em consideração, a saber, a transição demográfica e a transição epidemiológica. Cada vez mais, observa-se um aumento no número de pessoas idosas convivendo com inúmeras incapacidades e, ainda, um perfil epidemiológico. A Pesquisa Nacional por Amostra de Domicílios (PNAD 1998-2003 indica uma distribuição de doenças crônicas que, consequentemente, tem gerado um número expressivo de incapacidades. Essas pessoas com incapacidades necessitam dos serviços de saúde, e os utilizam quando conseguem ter acesso a eles. Contudo, os modelos vigentes de atenção à saúde do idoso ou à saúde das pessoas com deficiência são de alto custo e, em alguns aspectos, não se apresentam eficientes, demandando estratégias de prevenção e equipamentos de saúde destinados à manutenção ou recuperação da saúde de uma população mais envelhecida. Desse modo, a agenda de política pública do Brasil deveria priorizar a manutenção da funcionalidade dos idosos, com monitoramento das condições de saúde, ações preventivas específicas de saúde e educação, e cuidados buscando uma atenção multidimensional e integral, não necessariamente centrada na doença(1.A necessidade de se elaborar políticas e estratégias, em especial de promoção de saúde, com um olhar descentralizado da doença se justifica porque os problemas de saúde advêm não somente de doenças, mas de qualquer outra condição ou circunstância de saúde, tais como agravos, gravidez, envelhecimento, estresse, predisposição genética – todas classificadas pela CID-10, contudo, sem poder mensurar as mudanças de estado relativas à condição de saúde, e muito menos classificar para descrever o contexto em que esses problemas acontecem, o que dificulta e compromete o planejamento e a resolubilidade das ações e dos serviços em saúde, diferentemente dos dados por

  2. Ações de saúde mental na Estratégia Saúde da Família: Expectativas de familiares

    Directory of Open Access Journals (Sweden)

    Marcio Wagner Camatta

    2016-06-01

    Full Text Available RESUMO Objetivo: Compreender as expectativas de familiares de usuários com transtorno mental da Estratégia Saúde da Família (ESF, em relação às ações de saúde mental. Métodos: Trata-se de uma pesquisa qualitativa, com utilização do referencial da Sociologia fenomenológica. Foram realizadas entrevistas semiestruturadas com 12 familiares de duas unidades de ESF de Porto Alegre, Rio Grande do Sul, em 2010. Utilizou-se a análise compreensiva para a interpretação das categorias concretas: ter apoio da equipe da ESF; e ter atenção da equipe da ESF. Resultados: Em essência, os familiares têm por expectativas ter um relacionamento social genuíno com a equipe da ESF para compartilharem suas vivências, servindo de suporte para superarem angústias, ansiedades e sentimentos de impotência frente às adversidades de conviver com uma pessoa com transtorno mental. Conclusão: A relação intersubjetiva é um aspecto relevante para o cuidado em saúde mental na ESF, necessitando de maiores investimentos da equipe.

  3. Ambiente, saúde e trabalho: temas geradores para ensino em saúde e segurança do trabalho no Acre, Brasil

    Directory of Open Access Journals (Sweden)

    Josina Maria Pontes Ribeiro

    Full Text Available O artigo apresenta ambiente, saúde e trabalho como temas geradores necessários à construção de uma tecnologia social para educação profissional, considerando a ergologia como perspectiva de análise, e, o diálogo, como estratégia de ensino em Saúde e Segurança no Trabalho para Agentes de Combate a Endemias em Rio Branco, Acre, Brasil. A definição dos temas geradores é resultado do diálogo entre pesquisadores de diferentes áreas, trabalhadores que atuam ou atuaram no combate às endemias, bem como de discentes e docentes do Curso Técnico em Segurança do Trabalho no Instituto Federal do Acre (IFAC, mediante exercício de atividades de ensino, pesquisa e extensão. As pesquisas histórica e documental permitiram que se estabelecessem os nexos entre os projetos de desenvolvimento que impactaram significativamente o ambiente e as relações de trabalho na saúde daí resultantes.

  4. A Motivação dos Profissionais de Saúde das Unidades Básicas de Saúde

    Directory of Open Access Journals (Sweden)

    Antônio Alves Filho

    Full Text Available Relata-se pesquisa que objetivou estudar a motivação para o trabalho dos profissionais de saúde vinculados às Unidades Básicas de Saúde do município de Natal. Compreendeu-se a motivação como um processo e aplicou-se a Teoria das Expectativas que a considera como um fenômeno processual e envolve cinco componentes: resultados do trabalho, expectativa, valên-cia, instrumentalidade e força motivacional. Entendeu-se também a motivação como um fenômeno relacionado com o contexto de trabalho e adotou-se a perspectiva psicossociológica. Aplicou-se o Inventário da Motivação e Significado do Trabalho, identificando-se os fatores que mais contribuem, bem como os que enfraquecem a força motivacional dos profissionais de saúde. Conclui-se que a maioria dos profissionais apresentou força motivacional moderada e em queda, por vivenciarem e perceberem um contexto deteriorado com condições de trabalho desfavoráveis.

  5. [SciELO Public Health: the performance of Cadernos de Saúde Pública and Revista de Saúde Pública].

    Science.gov (United States)

    Barata, Rita Barradas

    2007-12-01

    The aim of this paper was to analyze two Brazilian scientific journals included in the SciELO Library of Public Health, using a group of bibliometric indicators and scrutinizing the articles most viewed. Cadernos de Saúde Pública was accessed 3,743.59 times per month, with an average of 30.31 citations per article. The 50 articles most viewed (6.72 to 524.5 views) were mostly published in Portuguese (92%). 42% were theoretical essays, 20% surveys, and 16% descriptive studies. 42% used argumentative techniques, 34% quantitative techniques, 18% qualitative techniques, and 6% mathematical modeling. The most common themes were: health and work (50%), epidemiology (22%), and environmental health (8%). Revista de Saúde Pública was accessed 1,590.97 times per month, with an average of 26.27 citations per article. The 50 articles most viewed (7.33 and 56.50 views) were all published in Portuguese: 46% were surveys, 14% databases analysis, and 12% systematic reviews. Quantitative techniques were adopted in 66% of such articles, while mathematical modeling was the same as observed in Cadernos de Saúde Pública, as were qualitative techniques. The most common themes were health services organization (22%), nutrition (22%), health and work (18%), epidemiology (12%), and environmental health (12%).

  6. O olhar das representações indigenas sobre a sua saúde e a interface com o subsistema de saúde indigena

    Directory of Open Access Journals (Sweden)

    Maria Elvira TOLEDO

    2013-12-01

    Full Text Available O movimento indígena acreano tem uma trajetória de mais de 20 anos, atuando em debates locais, regionais e nacionais sobre a política de saúde indígena; em mobilizações políticas para reivindicar direitos; participando das instâncias de controle social na saúde e atuando também na gestão de projetos com financiamento não governamental ou em parceira com o governo federal, através da administração terceirizada dos Distritos Sanitários Especiais Indígena (DSEIs. Apesar disso, na primeira década da implantação do Subsistema de Saúde Indígena, muitos obstáculos tiveram que ser enfrentados pelas associações indígenas para se apropriar dos meandros da política de participação e controle social e esforços foram investidos para melhorar sua participação neste setor.

  7. Saúde Mental Positiva Ocupacional: proposta de modelo teórico para abordagem positiva da saúde mental no trabalho

    Directory of Open Access Journals (Sweden)

    Julio César Vázquez-Colunga

    Full Text Available Resumo Propõe-se um modelo teórico para a abordagem da saúde mental positiva ocupacional baseado na psicologia positiva, a psicologia ecológica, a salutogênese e o humanismo. O modelo compreende uma estrutura de seis fatores: bem-estar pessoal no trabalho, relações interpessoais positivas no trabalho, filosofia da vida laboral, empoderamento no trabalho, fortalezas pessoais no trabalho, e imersão no serviço; que é traduzido em quatro dimensões: cognitiva, socioafetiva, de comportamento e espiritual. Para fundamentar essa proposta, foi realizada uma análise dos dois principais posicionamentos referentes a saúde mental: o tradicional, predominantemente negativo, centrado na supressão ou ausência de doença, e o positivo, focado na promoção da saúde e desenvolvimento de círculos virtuosos. Derivado da análise, encontramos uma postura mista e vazios teóricos que justificam a proposta de um modelo autenticamente positivo. Finalizamos com algumas conclusões e implicações práticas de relevância para esse tema.

  8. Grupos de pesquisa em história da saúde

    OpenAIRE

    Zytkuewisz,Gabriela Venier

    2011-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências da Saúde. Programa de Pós-Graduação em Enfermagem Trata-se de um estudo qualitativo, exploratório, descritivo documental que objetiva conhecer os grupos de pesquisa que possuem a linha de pesquisa história da saúde quanto à produção e difusão do conhecimento produzido perante a comunidade acadêmica e científica. A coleta de dados foi realizada no período de dezembro de 2010 a setembro de 2011. Os dados fora...

  9. A modified CoSaMP algorithm for electromagnetic imaging of two dimensional domains

    KAUST Repository

    Sandhu, Ali Imran

    2017-05-13

    The compressive sampling matching pursuit (CoSaMP) algorithm is used for solving the electromagnetic inverse scattering problem on two-dimensional sparse domains. Since the scattering matrix, which is computed by sampling the Green function, does not satisfy the restricted isometry property, a damping parameter is added to the diagonal entries of the matrix to make the CoSaMP work. The damping factor can be selected based on the level of noise in the measurements. Numerical experiments, which demonstrate the accuracy and applicability of the proposed algorithm, are presented.

  10. Saúde dos imigrantes: multidimensionalidade, desigualdades e acessibilidade em Portugal

    Directory of Open Access Journals (Sweden)

    Beatriz Padilla

    Full Text Available Este artigo descreve os aspectos multidimensionais da saúde das populações imigrantes e os seus descendentes, tomando como exemplo o caso português. Por um lado, coloca-se ênfase na importância da acessibilidade e das diferentes barreiras que a condicionam e por outro lado, salientam-se as intervenções do estado e da sociedade civil em prol da saúde dos imigrantes, num contexto actual marcado pela crise internacional.

  11. Representações sociais de gestantes sobre saúde bucal

    OpenAIRE

    2003-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências da Saúde. Programa de Pós-Graduação em Odontologia. Partindo do pressuposto de que é necessário melhor entender para melhor agir, este estudo investigou os saberes de gestantes sobre saúde bucal, tendo como objetivo a compreensão das representações sociais (RS) que influenciam suas práticas, à luz da Teoria das Representações Sociais, proposta por Moscovici, em 1961. Os sujeitos desta pesquisa qualitativa f...

  12. Sinteza i karakterizacija elektrolitičkog kupatila za pozlatu na bazi kompleksa zlata sa merkaptotriazolom

    OpenAIRE

    Dimitrijević, Silvana B.

    2013-01-01

    Elektrolit na bazi kompleksa zlata sa merkaptotriazolom sintetizovan je u širokoj oblasti pH vrednosti od kisele do alkalne (pH=2-12). Nakon sinteze elektrolita urađena je detaljna karakterizacija kompleksa u tečnom i čvrstom stanju u celom opsegu stabilnosti kompleksa. Fizičko-hemijska karakterizacija elektrolita urađena je najpre primenom Ultraljubičaste- Vidljive (UV-vis) spektroskopije i Atomske Emisione Spektrometrije sa indukovano spregnutom plazmom (AAS- ICP). UV-vis ...

  13. PREPARATION OF SA-Fe CATION EXCHANGE MEMBRANE AND IT'S APPLICATION IN ELECTRODIALYSIS FOR TREATING WASTEWATER

    Institute of Scientific and Technical Information of China (English)

    GENG Yamin; CHEN Zhen; ZHENG Xi; HUANG Xuehong; CHEN Riyao

    2006-01-01

    An insoluble SA-Fe membrane was prepared by being linked soluble sodium alginate with FeCl3. SEM was used to observe its surface structure. IR spectrum indicated that Fe3+ was linked with -COOH and -OH in SA membrane. As a cationic exchanging membrane in electrodialysis the membrane was applied in treating inorganic wastewater with high concentration of inorganic ammonia and azote. The results of experiment showed that it was well-selective to ammonia and azote. The percentage of the removal of ammonia and azote in wastewater was up to 80%.

  14. A integralidade das ações em saúde e a intersetorialidade municipal

    Directory of Open Access Journals (Sweden)

    Liane Teresinha Schuh Pauli

    2013-12-01

    Full Text Available Com a inclusão dos contextos biopsicosocial, econômico e cultural nos conceitos do processo saúde/doença aumentaram as exigências de atuação no âmbito municipal, levando à necessidade de novos contornos no planejamento e na política. Sob a justificativa de avançar no cumprimento das normas legislativas e direcionar esforços intersetoriais capazes de garantir a integralidade das ações em saúde, objetivamos com esta investigação analisar a percepção relativa ao conceito de saúde/doença nos vários níveis da gestão pública e o relacionamento do setor de trabalho com a área da saúde, verificando a viabilidade da intersetorialidade e a percepção sobre a importância desta como estratégia para a promoção da integralidade das ações em saúde. A pesquisa realizou-se em duas etapas, com a utilização do método qualitativo de análise em ambas, por meio de entrevista individual gravada no local de trabalho (Técnica do Discurso do Sujeito Coletivo, o que possibilitou a análise dos depoimentos verbais através das ideias centrais e suas correspondentes expressões-chave. Constituíram-se como sujeitos da pesquisa todos os elementos envolvidos na gestão municipal da cidade de Vera Cruz,RS, mais dois assessores diretos de cada um destes. Observou-se que existe a concepção do conceito de saúde ampliado e positivo, há o reconhecimento da responsabilidade dos vários setores sobre o processo saúde/doença da população e a intenção do trabalho intersetorial. Concluiu-se que, com mudanças político-organizacionais, capacitação de recursos humanos e planejamento, pode-se alcançar melhoria nas ações de promoção da integralidade das ações em saúde.

  15. Risk Management and Nuclear Insurance Program within Societatea Nationala Nuclearelectrica S.A

    Energy Technology Data Exchange (ETDEWEB)

    Havris, Alexandru [Societatea Nationala Nuclearelectrica S.A, 65 Polona Street, code 010494, sector 1, Bucharest (Romania)

    2008-07-01

    This paper shall present the Risk Management and associated nuclear insurance program developed within Societatea Nationala 'Nuclearelectrica' S.A, owner and operator of Units 1 and 2 Cernavoda NPP, the Nuclear Fuel Plant and in charge with commissioning of Units 3 and 4. From the risk management perspective, the main aspects that energy industry has to face due to global economic changes within a dynamic business environment are highlighted. In order to mitigate the operational and investment associated risks, Societatea Nationala 'Nuclearelectrica' S.A. successfully developed, implemented and maintained a coherent insurance program both on local and international insurance market. (authors)

  16. Fisioterapia e Saúde Funcional em Primeira Edição

    OpenAIRE

    Kátia Virginia Viana Cardoso

    2012-01-01

    É com grande satisfação que apresentamos à comunidade científica a primeira edição da Revista Eletrônica “Fisioterapia e Saúde Funcional”, um periódico eletrônico sob a forma de um projeto de extensão do Curso de Fisioterapia da Universidade Federal do Ceará – UFC, que objetiva divulgar estudos e resultados de pesquisas nas diversas áreas da Fisioterapia como também da Saúde Funcional, divulgando pesquisas de profissionais de nível superior, professores, pesquisadores e estudantes ligados às ...

  17. A reforma da sa??de de Clinton: li????es para o Brasil?

    OpenAIRE

    Marques, Marilia Bernardes; Possas, Cristina de Albuquerque

    1994-01-01

    O presente artigo analisa a proposta para a reforma do sistema de sa??de, apresentada pelo Presidente Clinton ao Congresso dos Estados Unidos, no ver??o de 1993. Ap??s considerar os aspectos essenciais da paradoxal situa????o da sa??de americana e que culminaram na conscientiza????o pela sociedade da necessidade inadi??vel da reforma, as autoras apresentam e analisam os seis princ??pios norteadores da proposta Clinton, destacando as principais implica????es para a experi??ncia da reforma sani...

  18. Caso de estudio. Automatización de Oficinas S.A.

    OpenAIRE

    2006-01-01

    En este caso se presentan las siguientes situaciones : La empresa cuenta con una buena posición e imagen en el negocio de los muebles. Un mercado altamente competitivo. Automatización de Oficinas S.A. posee un producto con altos estándares de calidad. La empresa han presentado una disminución en los márgenes rentabilidad manejados. DESCRIPCION : El caso muestra la situación de la empresa Automatización de Oficinas S.A., una empresa de gran trayectoria nacional, orientada a la comercialización...

  19. FARM-CHEMICALS S.A. PLANTA FORMULADORA Y PRODUCTORA DE AGROQUÍMICOS

    Directory of Open Access Journals (Sweden)

    Gabriel Arturo García Gómez

    2002-01-01

    Full Text Available En esta tesis se analiza el sector en el cual se encuentra la empresa Farm-Chemicals S.A. planta Formuladora y Productora de Agroquímicos genéricos, evaluando su potencial de mercado y se presenta un modelo financiero desde cuatro escenarios, con lo que obtenemos posibles panoramas futuros para la Compañía. La información ha sido preparada cuidadosamente, después de estudiar el mercado potencial existente, la situación competitiva de Farm-Chemicals S.A. y las expectativas futuras dentro del sector en que se desenvuelve.

  20. Saúde mental como tema transversal no curriculo de enfermagem

    OpenAIRE

    Ana Ruth Macêdo Monteiro

    2003-01-01

    Busca-se com este estudo averiguar a possibilidade do conteúdo de saúde mental ser transversal nas disciplinas dos cursos de graduação em enfermagem, descrevendo a experiência desenvolvida em uma universidade pública e conhecendo a percepção dos acadêmicos sobre essa prática. Participaram da pesquisa 27 alunos. Foi utilizado o questionário. No que diz respeito à inserção da saúde mental em outras disciplinas, 18,5 % considerou ótima, 70,5% boa e 11% como regular. Quanto a sua aplicabilidade 7...

  1. Educação em saúde e cidadania: revisão integrativa

    Directory of Open Access Journals (Sweden)

    Viviane Ferraz Ferreira

    Full Text Available Este artigo apresenta os resultados de uma revisão integrativa de literatura sobre educação em saúde e cidadania, que buscou conhecer e analisar as diferentes contribuições científicas disponíveis. A educação em saúde reflete uma estratégia que almeja um cidadão coautor do processo de construção do cuidado à sua saúde. Utilizouse para a coleta de dados a base Lilacs (Literatura LatinoAmericana do Caribe em Ciências da Saúde no período de 2000 a 2011, totalizando 79 produções. Após a aplicação dos critérios de inclusão e exclusão, a amostra final incluiu dez publicações. A pesquisa trouxe a prevalência de estudos da natureza artigo, apresentando mais de três autores, com predominância de docentes e produção do tipo revisão teórica. As categorias que emergiram do estudo foram: educação em saúde - historicidade e bases conceituais; e educação popular como geradora de cidadania. As evidências mostraram o processo histórico das políticas de saúde e o surgimento dos movimentos sociais voltados para as necessidades da população. Destacaram também que a educação permanente em saúde proporciona a construção de novos saberes, mediante a junção de conhecimentos científicos e de saberes populares. Manifestaramse na literatura contribuições relevantes sobre a educação em saúde, por ser uma prática emancipadora do sujeito, atuando como espaço gerador de cidadania.

  2. Desenvolvimento de um ambiente virtual de ensino em histologia para estudantes da saúde

    OpenAIRE

    2013-01-01

    As tecnologias da informação e da comunicação (TICs) têm sido amplamente utilizadas no ensino da saúde. As plataformas usadas para o desenvolvimento do ambiente virtual de ensino (AVE) geralmente apresentam uma linguagem de informática complexa. O objetivo deste trabalho foi desenvolver um AVE em Histologia voltado para estudantes da área da saúde, disponibilizado na internet com o uso de uma plataforma de uso gratuito e livre. O material elaborado utilizou diferentes TICs, como: animações, v...

  3. O livro Programa de saúde : um caso de censura durante a ditadura militar brasileira

    OpenAIRE

    Reimao,Sandra

    2013-01-01

    Estão liberados para consulta alguns documentos produzidos por órgãos do governo durante a ditadura militar brasileira, entre eles, pareceres de censura sobre televisão, rádio, teatro, filmes, músicas, publicidades e impressos. Entre os cerca de quinhentos pareceres relativos a livros está o indicativo de veto a Programa de saúde: projetos e temas de higiene e saúde , obra didática que propunha ações para que os alunos buscassem conh...

  4. A peptidoglycan recognition protein (PxPGRP-SA) regulating the expression of antimicrobial peptides in Plutella xylostella (Lepidoptera: Plutellidae)%一个调控抗菌肽表达的小菜蛾肽聚糖识别蛋白(PxPGRP-SA)

    Institute of Scientific and Technical Information of China (English)

    郑志华; 许小霞; 余静; 高延富; 张玉清; 欧阳莉娜; 金丰良

    2016-01-01

    PCR (qRT-PCR),and the regulation of the expression of antimicrobial peptide genes by PxPGRP-SA in P.xylostella was investigated by RNAi technology and antiserum blocking assay.[Results] qRT-PCR analysis revealed that the transcripts of PxPGRP-SA increased significantly at 6 h after injection of live B.thuringiensis into the fat body and hemocytes of the 4th instar larvae of P.xylostella,with the highest expression level at 24 h in fat body and 18 h in hemocytes,respectively.The transcript of PxPGRP-SA in the 4th instar larvae of P.xylostella decreased due to RNAi.Blocking down the transcript of PxPGRP-SA by RNAi also reduced the transcriptional levels of four antibacterial peptide genes including cecropin,moricin-2,lysozyme and defensin in the 4th instar larvae and the mRNA levels of Dorsal and Sp(a)tzle genes significantly.Blocking the activity of PxPGRP-SA by injection of anti-PxPGRP-SA serum into the 4th instar larvae of P.xylostella also decreased the transcription levels of antibacterial peptide genes in the fat body rapidly.Silence of the expression of PxPGRP-SA decreased the survival rate of P.xylostella larvae feeding live B.thuringiensis significantly.[Conclusion] PxPGRP-SA is involved in regulating the expression of downstream antibacterial peptide genes including cecropin,moricin-2,lysozyme and defensin in P.xylostella,and plays an important role in the immune defense of P.xylostella against B.thuringiensis infection.

  5. Temporal Decrease in Upper Atmospheric Chlorine

    Science.gov (United States)

    Froidevaux, L.; Livesey, N. J.; Read, W. G.; Salawitch, R. J.; Waters, J. W.; Drouin, B.; MacKenzie, I. A.; Pumphrey, H. C.; Bernath, P.; Boone, C.; hide

    2006-01-01

    We report a steady decrease in the upper stratospheric and lower mesospheric abundances of hydrogen chloride (HCl) from August 2004 through January 2006, as measured by the Microwave Limb Sounder (MLS) aboard the Aura satellite. For 60(deg)S to 60(deg)N zonal means, the average yearly change in the 0.7 to 0.1 hPa (approx.50 to 65 km) region is -27 +/- 3 pptv/year, or -0.78 +/- 0.08 percent/year. This is consistent with surface abundance decrease rates (about 6 to 7 years earlier) in chlorine source gases. The MLS data confirm that international agreements to reduce global emissions of ozone-depleting industrial gases are leading to global decreases in the total gaseous chlorine burden. Tracking stratospheric HCl variations on a seasonal basis is now possible with MLS data. Inferred stratospheric total chlorine (CITOT) has a value of 3.60 ppbv at the beginning of 2006, with a (2-sigma) accuracy estimate of 7%; the stratospheric chlorine loading has decreased by about 43 pptv in the 18-month period studied here. We discuss the MLS HCl measurements in the context of other satellite-based HCl data, as well as expectations from surface chlorine data. A mean age of air of approx. 5.5 years and an age spectrum width of 2 years or less provide a fairly good fit to the ensemble of measurements.

  6. Aggregate Unemployment Decreases Individual Returns to Education

    Science.gov (United States)

    Ammermueller, Andreas; Kuckulenz, Anja; Zwick, Thomas

    2009-01-01

    Aggregate unemployment may affect individual returns to education through qualification-specific responses in participation and wage bargaining. This paper shows that an increase in regional unemployment by 1% decreases returns to education by 0.005 percentage points. This implies that higher skilled employees are better sheltered from labour…

  7. Helical Gears Modified To Decrease Transmission Errors

    Science.gov (United States)

    Handschuh, R. F.; Coy, J. J.; Litvin, F. L.; Zhang, J.

    1993-01-01

    Tooth surfaces of helical gears modified, according to proposed design concept, to make gears more tolerant of misalignments and to improve distribution of contact stresses. Results in smaller transmission errors, with concomitant decreases in vibrations and noise and, possibly, increases in service lives.

  8. Aggregate Unemployment Decreases Individual Returns to Education

    Science.gov (United States)

    Ammermueller, Andreas; Kuckulenz, Anja; Zwick, Thomas

    2009-01-01

    Aggregate unemployment may affect individual returns to education through qualification-specific responses in participation and wage bargaining. This paper shows that an increase in regional unemployment by 1% decreases returns to education by 0.005 percentage points. This implies that higher skilled employees are better sheltered from labour…

  9. Moderate systemic hypothermia decreases burn depth progression.

    Science.gov (United States)

    Rizzo, Julie A; Burgess, Pamela; Cartie, Richard J; Prasad, Balakrishna M

    2013-05-01

    Therapeutic hypothermia has been proposed to be beneficial in an array of human pathologies including cardiac arrest, stroke, traumatic brain and spinal cord injury, and hemorrhagic shock. Burn depth progression is multifactorial but inflammation plays a large role. Because hypothermia is known to reduce inflammation, we hypothesized that moderate hypothermia will decrease burn depth progression. We used a second-degree 15% total body surface area thermal injury model in rats. Burn depth was assessed by histology of biopsy sections. Moderate hypothermia in the range of 31-33°C was applied for 4h immediately after burn and in a delayed fashion, starting 2h after burn. In order to gain insight into the beneficial effects of hypothermia, we analyzed global gene expression in the burned skin. Immediate hypothermia decreased burn depth progression at 6h post injury, and this protective effect was sustained for at least 24h. Burn depth was 18% lower in rats subjected to immediate hypothermia compared to control rats at both 6 and 24h post injury. Rats in the delayed hypothermia group did not show any significant decrease in burn depth at 6h, but had 23% lower burn depth than controls at 24h. Increased expression of several skin-protective genes such as CCL4, CCL6 and CXCL13 and decreased expression of tissue remodeling genes such as matrix metalloprotease-9 were discovered in the skin biopsy samples of rats subjected to immediate hypothermia. Systemic hypothermia decreases burn depth progression in a rodent model and up-regulation of skin-protective genes and down-regulation of detrimental tissue remodeling genes by hypothermia may contribute to its beneficial effects. Published by Elsevier Ltd.

  10. Promoção da Saúde na Escola: história e perspectivas

    Directory of Open Access Journals (Sweden)

    Andréa Monteiro de Castro Graciano

    2015-03-01

    Full Text Available Introdução: A promoção da saúde nas escolas envolve a educação em saúde, a criação de entornos saudáveis e a provisão de serviços de saúde. Este estudo objetivou realizar uma revisão crítica da literatura sobre a promoção da saúde nas escolas. Metodologia: Os critérios prévios de inclusão foram: artigos que relacionavam saúde escolar e promoção da saúde, sem limite temporal de publicação. Foram realizadas buscas eletrônicas nas principais bases de dados, entre janeiro e março de 2014. Foram utilizadas as seguintes palavras-chave e conjunto de palavras: promoção da saúde, saúde escolar, health promotion e school health [termo MeSH e termo palavra]. Também foram pesquisados estudos que preencheram os critérios de inclusão originados da lista de referências dos artigos selecionados. Revisão de literatura / Discussão: A saúde escolar avançou em sintonia com o conhecimento técnico-científico e com o desenvolvimento sócio-político, superando, de forma gradativa, o paradigma biomédico para a concepção da iniciativa das Escolas Promotoras de Saúde. No Brasil, foi instituído um novo programa para a saúde do escolar denominado Programa Saúde na Escola (PSE. O PSE se identifica como uma estratégia para a integração e articulação permanente entre as políticas e ações de educação e saúde. Considerações finais: Uma escola promotora de saúde caracteriza-se como uma escola que busca um estilo de vida, aprendizagem e trabalho que favoreça o desenvolvimento da saúde.

  11. Saúde Bucal no Âmbito Escolar e Familiar: da Autonomia à Transformação Social

    Directory of Open Access Journals (Sweden)

    Larissa Moreira de Souza

    Full Text Available RESUMO A promoção de saúde requer um trabalho com abordagens preventivas, educacionais, curativas e de controle da saúde pelo próprio indivíduo, sendo a motivação e a transformação social por meio da conscientização as únicas propostas viáveis para a diminuição das doenças bucais. O objetivo deste programa foi promover a saúde de forma ampla, atingindo vários atores sociais, e trabalhar a autonomia e a modificação de hábitos essenciais para alterações no fenômeno saúde-doença. Foi desenvolvido na rede pública de ensino do município de Patos (PB, com a participação de três eixos – a família, os educadores e as crianças –, tendo como ações as práticas de promoção e educação em saúde, análise do nível de conhecimento em saúde bucal, realização de tratamento restaurador atraumático, além de cursos de capacitação em saúde bucal para educadores e agentes comunitários de saúde. O projeto teve aceitação por todos os eixos assistidos e alcançou como resultado a melhoria nos níveis de saúde bucal e a criação de agentes multiplicadores de saúde, contribuindo para o desenvolvimento da autonomia e integralidade em saúde.

  12. Orientação sobre saúde bucal em um Centro de Saúde Dental health education in a public health centre

    Directory of Open Access Journals (Sweden)

    Roberto Augusto Castellanos

    1977-06-01

    Full Text Available Foi realizado estudo com o fim de verificar qual a orientação sobre saúde bucal dada aos clientes que pela primeira vez compareceram a um centro de saúde. Durante o período de 2 semanas foram observados 25 clientes; o método utilizado foi o da "observação participante''. Os dados necessários para o "diagnóstico educativo" foram colhidos com o auxílio de uma ficha. Da análise destes dados concluiu-se não haver uma adequada orientação com relação à saúde bucal, por parte do pessoal responsável. Sugere-se como "tratamento educativo" revisão das normas em relação à saúde da boca e desenvolvimento de um programa educativo, incidental e planejado, integrado às diferentes atividades realizadas pelo Centro. Propõe-se um conteúdo programático responsabilizando o dentista pelo adestramento do pessoal, execução e avaliação do programa. Ressalta-se a importância do centro de saúde para o desenvolvimento de programas integrados, preventivos, curativos e educativos.This paper deals with a study made with the purpose of observing dental health, education of patients coming for the first time to a Health Center. The study was carried out during two weeks and 25 patients were observed through "Participant Observation". Data for the "Educational Diagnosis" was collected in a card specially designed for it. Results showed that dental health orientation was not given by the staff to patients. An educational programme about dental health is suggested to be integrated with the activities of the various services, being the Dentist responsible for the staff programme coordination and evaluation. Finally the importance of the health center for the development of preventive, curative and educational integrated programmes is emphasized.

  13. Letramento funcional em saúde: reflexões e conceitos sobre seu impacto na interação entre usuários, profissionais e sistema de saúde

    Directory of Open Access Journals (Sweden)

    Maria da Penha Baião Passamai

    2012-06-01

    Full Text Available Letramento funcional em saúde (LFS é o grau pelo qual os indivíduos têm a capacidade para obter, processar e entender informações básicas e serviços necessários para a tomada de decisões adequadas em saúde. O tema preocupa pesquisadores/profissionais da saúde/formuladores de políticas públicas. Sua natureza interdisciplinar, relacional e interacional indica que o LFS sofre a influência dos sistemas de saúde/educacional, mídia, família, ambiente de trabalho/comunidade/decisão política. Analisam-se conceitos de LFS versus interação usuários-profissionais-sistema de saúde, norteando-se pelas questões: Em que consiste o LFS? Em que medida interfere na comunicação entre usuários, profissionais e sistema de saúde? Quais são suas consequências na saúde pública? Medidas para elevação do LFS devem melhorar as competências individuais e serviços de saúde humanizados, aperfeiçoando suas comunicações, escritas/orais, satisfazendo as necessidades/habilidades dos usuários.

  14. Atenção à saúde mental na Estratégia Saúde da Família: recursos não reconhecidos

    Directory of Open Access Journals (Sweden)

    Mariana de Oliveira Pasqualin Ribeiro

    2013-12-01

    Full Text Available Um dos pilares da política de Atenção Básica, a Estratégia Saúde da Família, realiza assistência descentralizada nos territórios adscritos, atendendo diferentes demandas, incluindo a saúde mental. Esta pesquisa teve como objetivo produzir sentidos com profissionais da Saúde da Família sobre seus recursos para o cuidado em saúde mental. Para tanto, foram realizados grupos focais com profissionais da saúde da família de um município do interior do estado de São Paulo. A análise do material foi realizada por procedimentos qualitativos de análise temática, com base nas contribuições do movimento construcionista social. Essa análise permitiu dar visibilidade a importantes recursos técnicos e relacionais da equipe para o cuidado em saúde mental, mas que pareciam pouco legitimados em seu cotidiano. Discutimos a necessidade de criação de espaços de reflexão onde os trabalhadores de saúde possam ressignificar suas ações, o que pode contribuir para a qualificação do atendimento em saúde mental na Atenção Básica.

  15. Reflexões sobre a saúde bucal no Brasil

    Directory of Open Access Journals (Sweden)

    Anya Pimentel Gomes Fernandes Vieira Meyer

    2013-12-01

    Full Text Available No último século, numerosos avanços em pesquisas e tecnologias biomédicas na área odontológica foram responsáveis por melhorias na saúde e no bem-estar das populações(1. Entretanto, apesar das grandes realizações no âmbito da saúde bucal, muitos problemas ainda permanecem, como a cárie dental, a mais comum das doenças bucais. A prevalência da cárie dentária apresentou uma tendência de declínio nas três últimas décadas do século XX e no início do século XXI, especialmente nos países desenvolvidos, contudo, ainda é considerada uma importante questão de saúde pública mundial, afetando de 60% a 90% das crianças em idade escolar, além da vasta maioria dos adultos(2-4. No levantamento epidemiológico SB Brasil 2010(5, foram observadas melhoras na condição bucal dos brasileiros, porém, ainda é alta a prevalência de cárie. Entre os adolescentes de 15 a 19 anos, por exemplo, a média de dentes afetados foi de 4,25 mais que o dobro do número médio encontrado aos 12 anos. Entre os idosos de 65a 74 anos, o número de dentes cariados, perdidos e obturados (CPO praticamente não se alterou, ficando em 27,5 em 2010, enquanto, em 2003, a média era de 27,8. Em termos internacionais, de acordo com o Ministério da Saúde brasileiro(5,um estudo realizado pela Organização Mundial da Saúde (OMS em 2004 indicou que, nos dados de 188 países, o valor médio do CPO aos 12 anos foi de 1,6, sendonas Américas a média de 2,8, enquanto na Europa ficou em 1,6. Na América do Sul,somente a Venezuela apresentou média de CPO aos 12 anos semelhante à brasileira(2,1. Nos demais países, as médias apresentaram-se mais altas, como na Argentina(3,4, Bolívia (4,7, Colômbia (2,3, Paraguai (2,8 e Peru (3,7. Os achados epidemiológicos de 2010 sobre a saúde bucal no Brasil(5mostraram que o país entrou para o grupo daqueles com baixa prevalência de carie aos 12 anos. Embora os resultados nesse quesito tenham sido animadores, a

  16. Saúde e imigrantes: as representações e as práticas sobre a saúde e a doença na Comunidade Cabo-Verdiana em Lisboa

    OpenAIRE

    Bárbara, Bäckström

    2009-01-01

    Trata-se da versão publicada da Tese de Doutoramento em Saúde Internacional apresentada ao Instituto de Higiene e Medicina Tropical da Universidade Nova de Lisboa em 2006, sob orientação da Prof. Graça Carapinheiro Este trabalho de investigação constitui uma aproximação sociológica no âmbito da saúde internacional e no contexto da sociologia da saúde, em particular da saúde dos migrantes, relativamente às suas representações e práticas de saúde e de doença. O objecto de investigação centra...

  17. A theoretical interpretation of Forbush decreases

    Science.gov (United States)

    Gall, R.; Thomas, B. T.

    1981-01-01

    An analysis is presented of the intensity variations of relativistic cosmic rays, at 1 AU, which are associated with the passage of a flare shock wave. The magnitude and time profile obtained is similar to that observed in flare-induced Forbush decreases, and the principal cause of the energy reduction is an increase in adiabatic cooling of the arriving particles due to prolonged containment behind the compressed field of the flare shock wave. The large decreases calculated for the smaller diffusion coefficients are inconsistent with observation, implying larger mean free paths than those traditionally assumed at these rigidities. The method presented may be used to study intensity variations associated with other large-scale structures of the interplanetary field, such as corotating interaction regions.

  18. Happy mood decreases self-focused attention.

    Science.gov (United States)

    Green, Jeffrey D; Sedikides, Constantine; Saltzberg, Judith A; Wood, Joanne V; Forzano, Lori-Ann B

    2003-03-01

    Research addressing the influence of happy mood on self-focused attention has yielded inconsistent results. Some studies found that happy mood decreased self-focus relative to sad mood. Other studies did not detect a significant difference between happy and neutral mood, and still other studies found that happy mood, relative to neutral mood, increased self-focus. These investigations have potential shortcomings, such as an insufficiently powerful happy mood induction and a confound between visualization mood inductions and self-focus itself. The present experiment addressed these shortcomings by inducing mood via musical selections, equalizing the approximate potency between happy and sad moods, and using a within-participants design. Relative to neutral mood, happy mood decreased self-focused attention.

  19. Decreasing Human Trafficking through Sex Work Decriminalization.

    Science.gov (United States)

    Albright, Erin; D'Adamo, Kate

    2017-01-01

    In order to decrease human trafficking, health care workers should support the full decriminalization of prostitution. Similar to trafficking in other forms of labor, preventing trafficking in the sex trade requires addressing the different forms of marginalization that create vulnerable communities. By removing punitive laws that prevent reporting of exploitation and abuse, decriminalization allows sex workers to work more safely, thereby reducing marginalization and vulnerability. Decriminalization can also help destigmatize sex work and help resist political, social, and cultural marginalization of sex workers.

  20. Keratinocyte Apoptosis is Decreased in Psoriatic Epidermis

    Directory of Open Access Journals (Sweden)

    Fatma Eskioğlu

    2009-12-01

    Full Text Available Background and Design: Abnormal differentiation and hyperproliferation of keratinocytes are the hallmarks of psoriasis vulgaris. Although psoriasis vulgaris is generally accepted as a disease of decreased keratinocyte apoptosis, the results are contradictory. The aim of the current study is to investigate whether decreased keratinocyte apoptosis contributes to the formation of a thickened epidermis as increased keratinocyte proliferation. Material and Method: Forty-three untreated psoriasis vulgaris patients and 20 healthy control subjects were included into the study. Biopsy specimens taken from the enrollee were evaluated by immunohistochemical staining for Ki-67 expressions to show the proliferation of keratinocytes and by the terminal deoxynucleotidyl transferase-mediated dUTP-biotin nick-end labeling (TUNEL method to show the apoptotic keratinocytes. Results: Apoptotic index (percentage of the TUNEL positive cells was significantly lower in psoriatic epidermis (0.33±0.64 than in normal epidermis (0.75±0.85; whereas Ki-67 index (percentage of positively staining cells for Ki-67 was significantly higher in psoriatic epidermis (30.86±10.49 than in normal epidermis (11.65±2.98, (p=0.021 and p=0.00; respectively. Conclusion: Decreased keratinocyte apoptosis also contribute to increased epidermal thickness in psoriasis as well as increased keratinocyte proliferation.

  1. Forbush Decrease: A New Perspective with Classification

    Science.gov (United States)

    Raghav, Anil; Shaikh, Zubair; Bhaskar, Ankush; Datar, Gauri; Vichare, Geeta

    2017-08-01

    Sudden short-duration decreases in cosmic ray flux, known as Forbush decreases (FDs), are mainly caused by interplanetary disturbances. A generally accepted view is that the first step of an FD is caused by a shock sheath and the second step is due to the magnetic cloud (MC) of the interplanetary coronal mass ejection (ICME). This simplistic picture does not consider several physical aspects, such as whether the complete shock sheath or MC (or only part of these) contributes to the decrease or the effect of internal structure within the shock-sheath region or MC. We present an analysis of 16 large ({≥} 8 %) FD events and the associated ICMEs, a majority of which show multiple steps in the FD profile. We propose a reclassification of FD events according to the number of steps observed in their respective profiles and according to the physical origin of these steps. This study determines that 13 out of 16 major events ({˜} 81%) can be explained completely or partially on the basis of the classic FD model. However, it cannot explain all the steps observed in these events. Our analysis clearly indicates that not only broad regions (shock sheath and MC), but also localized structures within the shock sheath and MC have a significant role in influencing the FD profile. The detailed analysis in the present work is expected to contribute toward a better understanding of the relationship between FD and ICME parameters.

  2. Decreasing luminescence lifetime of evaporating phosphorescent droplets

    Science.gov (United States)

    van der Voort, D. D.; Dam, N. J.; Sweep, A. M.; Kunnen, R. P. J.; van Heijst, G. J. F.; Clercx, H. J. H.; van de Water, W.

    2016-12-01

    Laser-induced phosphorescence has been used extensively to study spray dynamics. It is important to understand the influence of droplet evaporation in the interpretation of such measurements, as it increases luminescence quenching. By suspending a single evaporating n-heptane droplet in an acoustic levitator, the properties of lanthanide-complex europium-thenoyltrifluoroacetone-trioctylphosphine oxide (Eu-TTA-TOPO) phosphorescence are determined through high-speed imaging. A decrease was found in the measured phosphorescence decay coefficient (780 → 200 μs) with decreasing droplet volumes (10-9 → 10-11 m3) corresponding to increasing concentrations (10-4 → 10-2 M). This decrease continues up to the point of shell-formation at supersaturated concentrations. The diminished luminescence is shown not to be attributable to triplet-triplet annihilation, quenching between excited triplet-state molecules. Instead, the pure exponential decays found in the measurements show that a non-phosphorescent quencher, such as free TTA/TOPO, can be attributable to this decay. The concentration dependence of the phosphorescence lifetime can therefore be used as a diagnostic of evaporation in sprays.

  3. A Criação da Secretaria Especial de Saúde Indígena

    Directory of Open Access Journals (Sweden)

    Luciana Benevides Ferreira

    2013-12-01

    Full Text Available O Subsistema de Atenção à Saúde Indígena foi criado em 1999 proporcionando aumento da cobertura das ações de saúde para os povos aldeados, mas a dificuldade de gestão e a insatisfação dos usuários levaram o governo brasileiro a transferir a responsabilidade sobre as ações de saúde indígena da Fundação Nacional de Saúde para o Ministério da Saúde. Esse processo foi marcado por uma ampla participação de representantes da população indígena, pelo diálogo intercultural e por várias rodadas de negociação no governo, culminando na criação, em 2010, da Secretaria Especial de Saúde Indígena. O objetivo deste artigo é descrever esse processo. O conhecimento do contexto e o acompanhamento de mudanças ocorridas na Política Nacional de Atenção à Saúde dos Povos Indígenas foram proporcionados pela participação em eventos relacionados ao tema e pela realização de entrevistas com presidentes dos Conselhos Distritais de Saúde Indígena.

  4. The Novel Transcriptional Regulator SA1804 Is Involved in Mediating the Invasion and Cytotoxicity of Staphylococcus aureus

    Directory of Open Access Journals (Sweden)

    JUNSHU eYANG

    2015-03-01

    Full Text Available The two-component regulatory system, SaeRS, controls expression of important virulence factors, including toxins and invasins, which contribute to the pathogenicity of Staphylococcus aureus. Previously, we conducted a transcriptomics study for identification of SaeRS regulon and found that inactivation of SaeRS dramatically enhances the transcription of a novel transcriptional regulator (SA1804. This led us to question whether SA1804 is involved in bacterial pathogenicity by regulating the expression of virulence factors. To address this question, we created sa1804, saeRS, and sa1804/saeRS double deletion mutants in a USA300 community-acquired MRSA strain, 923, and determined their impact on the pathogenicity. The deletion of sa1804 dramatically increased the cytotoxicity and enhanced the capacity of bacteria to invade into the epithelial cells (A549, whereas the deletion of saeRS eliminated the cytotoxicity and abolished the bacterial ability to invade into the epithelial cells. Moreover, the double deletions of sa1804 and saeRS appeared a similar phenotype with the saeRS null mutation. Furthermore, we determined the regulatory mechanism of SA1804 using qPCR and gel-shift approaches. Our data indicate that the novel virulence repressor SA1804 is dependent on the regulation of SaeRS. This study sheds light on the regulatory mechanism of virulence factors and allows for us further elucidate the molecular pathogenesis of S. aureus.

  5. Draft Genome Sequence of Enterobacter sp. Sa187, an Endophytic Bacterium Isolated from the Desert Plant Indigofera argentea

    KAUST Repository

    Lafi, Feras Fawzi

    2017-02-17

    Enterobacter sp. Sa187 is a plant endophytic bacterium, isolated from root nodules of the desert plant Indigofera argentea, collected from the Jizan region of Saudi Arabia. Here, we report the genome sequence of Sa187, highlighting several genes involved in plant growth–promoting activity and environmental adaption.

  6. AziSA: an architecture for underground measurement and control networks - 2nd International Conference on Wireless Communications...

    CSIR Research Space (South Africa)

    Stewart, R

    2008-08-01

    Full Text Available AziSA is an architecture for measurement and control networks that can be used to collect, store and facilitate the analysis of data from challenging underground environments. AziSA defines four node classes, two (Classes Four and Three...

  7. Ang Kasaysayan at Panitikan sa Pagbuo ng Bayan: Rebyu ng Nobelang The Feet of Juan Bacnang ni F. Sionil Jose

    Directory of Open Access Journals (Sweden)

    Moreal Nagarit Camba

    2013-06-01

    Full Text Available Mababasa sa The Feet of Juan Bacnang (2011, ang pinakabagong nobela ni F. (Francisco Sionil Jose o Frankie sa kanyang mga kaibigan, ang mahigpit na ugnayan ng manunulat at ng kanyang bayan. Siya ang nagsisilbing zeitgeist ng maraming panahon; ang espiritu at boses ng nakaraan at kasalukuyan, isang manunulat na kumakatha ng mga akdang sumasalamin sa mayamang karanasan at kasaysayan ng kultura at lahing pinag-usbungan. Kung saan ang kanyang nobelang Juan Bacnang, katulad ng iba pa niyang naunang mga nobela, bagamat likhang-isip, ay repleksyon ng buhay, pasakit, at aspirasyon ng manunulat at lipunang lumikha rito; mga tunguhing hindi nalalayo sa layunin ng mga ninuno nitong anyong panitikan, ang mga epiko at kuwentong bayan. Ibig sabihin, ang akda bilang Weltanschauung na ayon kay Terry Eagleton ay “partikular na paraan ng pagtingin sa mundo; na may kaugnayan sa gahum na nagtatakda kung paano tingnan ang mundo na maituturing na ‘pag-iisip ng lipunan’ o ideyolohiya ng panahon”1 (sinipi ni Geok-Lin Lim A Modern National Epic 74. Dagdag pa rito, ang kanyang (mga nobela, partikular ang Juan Bacnang, ay nagsisilbing “siwang sa mga kurtinang-papel” sa kasaysayan;2 mga tala ng karanasan at pang-araw-araw na buhay, na madalas hindi naisusulat ng mga tradisyunal na historyador. Ito (ang mga tala, ayon kay Pierre Macherey, ang mga puwang o pinipi na boses na naisantabi ng maraming akdang pangkasaysayan (sinipi ni Eagleton Marxism and Literary Criticism 34-35.

  8. Draft Genome Sequence of Enterobacter sp. Sa187, an Endophytic Bacterium Isolated from the Desert Plant Indigofera argentea

    Science.gov (United States)

    Lafi, Feras F.; Alam, Intikhab; Geurts, Rene; Bisseling, Ton; Bajic, Vladimir B.

    2017-01-01

    ABSTRACT Enterobacter sp. Sa187 is a plant endophytic bacterium, isolated from root nodules of the desert plant Indigofera argentea, collected from the Jizan region of Saudi Arabia. Here, we report the genome sequence of Sa187, highlighting several genes involved in plant growth–promoting activity and environmental adaption. PMID:28209831

  9. G-LoSA: An efficient computational tool for local structure-centric biological studies and drug design.

    Science.gov (United States)

    Lee, Hui Sun; Im, Wonpil

    2016-04-01

    Molecular recognition by protein mostly occurs in a local region on the protein surface. Thus, an efficient computational method for accurate characterization of protein local structural conservation is necessary to better understand biology and drug design. We present a novel local structure alignment tool, G-LoSA. G-LoSA aligns protein local structures in a sequence order independent way and provides a GA-score, a chemical feature-based and size-independent structure similarity score. Our benchmark validation shows the robust performance of G-LoSA to the local structures of diverse sizes and characteristics, demonstrating its universal applicability to local structure-centric comparative biology studies. In particular, G-LoSA is highly effective in detecting conserved local regions on the entire surface of a given protein. In addition, the applications of G-LoSA to identifying template ligands and predicting ligand and protein binding sites illustrate its strong potential for computer-aided drug design. We hope that G-LoSA can be a useful computational method for exploring interesting biological problems through large-scale comparison of protein local structures and facilitating drug discovery research and development. G-LoSA is freely available to academic users at http://im.compbio.ku.edu/GLoSA/.

  10. 78 FR 47778 - Verizon Business Networks Services, Inc. Senior Analysts-Sales Impletmentation (SA-SI) Birmingham...

    Science.gov (United States)

    2013-08-06

    ... Employment and Training Administration Verizon Business Networks Services, Inc. Senior Analysts-Sales Impletmentation (SA-SI) Birmingham, Alabama; Verizon Business Networks Services, Inc. Senior Analysts-Sales Impletmentation (SA-SI) Service Program Delivery Division San Francisco, California; Verizon Business...

  11. 75 FR 9816 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ...

    Science.gov (United States)

    2010-03-04

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... information identified in this proposed AD, contact Empresa Brasileira de Aeronautica S.A. (EMBRAER... adding the following new AD: Empresa Brasileira de Aeronautica S.A. (EMBRAER): Docket No. FAA-...

  12. 76 FR 26959 - Airworthiness Directives; Embraer-Embraer-Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model...

    Science.gov (United States)

    2011-05-10

    ...--Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-500 Airplanes AGENCY: Federal Aviation... holidays. For service information identified in this proposed AD, contact EMBRAER Empresa Brasileira de... docket. Relevant Service Information Embraer--Empresa Brasileira de Aeronautica S.A. has issued...

  13. 75 FR 19193 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ...

    Science.gov (United States)

    2010-04-14

    ...-063-AD; Amendment 39-16257; AD 2010-08-02] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... the following new AD: 2010-08-02 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16257... Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170-100 LR, -100 STD, -100 SE, -100 SU, -200...

  14. 75 FR 42585 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ...

    Science.gov (United States)

    2010-07-22

    ...-186-AD; Amendment 39-16359; AD 2010-14-14] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... new AD: 2010-14-14 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16359. Docket No...)(2) of this AD, certificated in any category. (1) Empresa Brasileira de Aeronautica S.A....

  15. 76 FR 437 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135BJ Airplanes

    Science.gov (United States)

    2011-01-05

    ...-118-AD; Amendment 39-16554; AD 2011-01-01] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... the following new AD: 2011-01-01 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16554..., Amendment 39-15578. Applicability (c) This AD applies to all Empresa Brasileira de Aeronautica S.A....

  16. 75 FR 7929 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 190-100 LR...

    Science.gov (United States)

    2010-02-23

    ...-16201; AD 2010-04-08] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira de Aeronautica S.A... 2. The FAA amends Sec. 39.13 by adding the following new AD: 2010-04-08 Empresa Brasileira de... ADs (b) None. Applicability (c) This AD applies to Empresa Brasileira de Aeronautica S.A....

  17. 75 FR 68684 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-500 Airplanes

    Science.gov (United States)

    2010-11-09

    ...; AD 2010-23-16] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira de Aeronautica S.A... identified in this AD, contact EMBRAER Empresa Brasileira de Aeron[aacute]utica S.A., Phenom Maintenance... [Amended] 0 2. The FAA amends Sec. 39.13 by adding the following new AD: 2010-23-16 Empresa Brasileira...

  18. 75 FR 13689 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135ER...

    Science.gov (United States)

    2010-03-23

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... information identified in this proposed AD, contact Empresa Brasileira de Aeronautica S.A. (EMBRAER... 35904, June 25, 2008) and adding the following new AD: Empresa Brasileira de Aeronautica S.A....

  19. 75 FR 9811 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 Airplanes

    Science.gov (United States)

    2010-03-04

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... information identified in this proposed AD, contact Empresa Brasileira de Aeronautica S.A. (EMBRAER...: Empresa Brasileira De Aeronautica S.A. (EMBRAER): Docket No. FAA- 2010-0176; Directorate Identifier...

  20. 75 FR 27403 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135 and -145...

    Science.gov (United States)

    2010-05-17

    ...-041-AD; Amendment 39-16290; AD 2010-10-11] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... the following new AD: 2010-10-11 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16290... Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135BJ, -135ER, -135KE, -135KL, -135LR,...

  1. 75 FR 13684 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135BJ Airplanes

    Science.gov (United States)

    2010-03-23

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira.... For service information identified in this proposed AD, contact Empresa Brasileira de Aeronautica S.A... 35908, June 25, 2008) and adding the following new AD: Empresa Brasileira de Aeronautica S.A....

  2. 76 FR 37244 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-120, -120ER...

    Science.gov (United States)

    2011-06-27

    ...-215-AD; Amendment 39-16659; AD 2011-08-09] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... the following new AD: 2011-08-09 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16659... all Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-120, -120ER, -120FC, -120QC, and...

  3. 75 FR 63048 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-500 Airplanes

    Science.gov (United States)

    2010-10-14

    ...-039-AD; Amendment 39-16475; AD 2010-21-15] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... the following new AD: 2010-21-15 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16475... Empresa Brasileira de Aeron utica S.A. (EMBRAER) Service Bulletin 500-57-0001, dated April 28, 2010....

  4. 76 FR 52220 - Airworthiness Directives; Embraer-Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-500...

    Science.gov (United States)

    2011-08-22

    ...-072-AD; Amendment 39-16779; AD 2011-17-15] RIN 2120-AA64 Airworthiness Directives; Embraer--Empresa... Empresa Brasileira de Aeron utica S.A., Phenom Maintenance Support, Av. Brig. Farina Lima, 2170, Sao Jose...--Empresa Brasileira de Aeronautica S.A.: Amendment 39-16779; Docket No. FAA-2011-0088;...

  5. 75 FR 47184 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-135ER...

    Science.gov (United States)

    2010-08-05

    ...-116-AD; Amendment 39-16377; AD 2010-16-01] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... new AD: 2010-16-01 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16377. Docket No... 39-15577. Applicability (c) This AD applies to Empresa Brasileira de Aeronautica S.A. (EMBRAER)...

  6. 75 FR 63422 - Airworthiness Directives; Embraer-Empresa Brasileira de Aeronautica S.A. Model EMB-500 Airplanes

    Science.gov (United States)

    2010-10-15

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Embraer--Empresa... AD docket. Relevant Service Information Empresa Brasileira de Aeron utica S.A. (EMBRAER) has issued.... 39.13 by adding the following new AD: Empresa Brasileira de Aeronautica S.A. (EMBRAER): Docket...

  7. 75 FR 31332 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-120, -120ER...

    Science.gov (United States)

    2010-06-03

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira.... For service information identified in this proposed AD, contact Empresa Brasileira de Aeronautica S.A.... 39.13 by adding the following new AD: ] Empresa Brasileira de Aeronautica S.A. (EMBRAER): Docket...

  8. 76 FR 2279 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and ERJ...

    Science.gov (United States)

    2011-01-13

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira..., contact Empresa Brasileira de Aeronautica S.A. (EMBRAER), Technical Publications Section (PC 060), Av.... 39.13 by adding the following new AD: Empresa Brasileira de Aeronautica S.A. (EMBRAER): Docket...

  9. 76 FR 59240 - Airworthiness Directives; Empresa Brasileira de Aeronáutica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2011-09-26

    ... 2011-CE-023-AD; Amendment 39-16810; AD 2011-20-01] RIN 2120-AA64 Airworthiness Directives; Empresa... (AD) for Empresa Brasileira de Aeron utica S.A. (EMBRAER) Model EMB-505 airplanes. This AD results... the following new AD: 2011-20-01 Empresa Brasileira de Aeron utica S.A. (EMBRAER): Amendment...

  10. 75 FR 45558 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model EMB-500 Airplanes

    Science.gov (United States)

    2010-08-03

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira.... Relevant Service Information Empresa Brasileira de Aeron utica S.A. (EMBRAER) has issued Service Bulletin...: Empresa Brasileira de Aeronautica S.A. (EMBRAER): Docket No. FAA- 2010-0754; Directorate Identifier...

  11. 77 FR 24425 - Airworthiness Directives; Empresa Brasileria de Aeronáutica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2012-04-24

    ... Directives; Empresa Brasileria de Aeron utica S.A. (EMBRAER) Airplanes AGENCY: Federal Aviation...: We propose to adopt a new airworthiness directive (AD) for certain Empresa Brasileria de Aeron utica... proposed AD, contact Empresa Brasileira de Aeronautica S.A. (EMBRAER), Phenom Maintenance Support,...

  12. 77 FR 39159 - Airworthiness Directives; Empresa Brasileria de Aeronáutica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2012-07-02

    ...-011-AD; Amendment 39-17106; AD 2012-13-04] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileria... Empresa Brasileria de Aeron utica S.A. (EMBRAER) Model EMB-505 airplanes. This AD results from mandatory..., contact Empresa Brasileira de Aeronautica S.A. (EMBRAER), Phenom Maintenance Support, Av. Brigadeiro...

  13. 75 FR 14333 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 and...

    Science.gov (United States)

    2010-03-25

    ...-055-AD; Amendment 39-16248; AD 2010-07-04] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... by adding the following new AD: 2010-07-04 Empresa Brasileira de Aeronautica S.A. (EMBRAER... applies to Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170-100 LR, -100 STD, -100 SE,...

  14. Compiling the functional data-parallel language SaC for Microgrids of Self-Adaptive Virtual Processors

    NARCIS (Netherlands)

    Grelck, C.; Herhut, S.; Jesshope, C.; Joslin, C.; Lankamp, M.; Scholz, S.-B.; Shafarenko, A.

    2009-01-01

    We present preliminary results from compiling the high-level, functional and data-parallel programming language SaC into a novel multi-core design: Microgrids of Self-Adaptive Virtual Processors (SVPs). The side-effect free nature of SaC in conjunction with its data-parallel foundation make it an id

  15. SA-based concrete seismic stress monitoring: a case study for normal strength concrete

    Science.gov (United States)

    Hou, S.; Zhang, H. B.; Ou, J. P.

    2016-09-01

    The stress history of concrete structures that have survived an earthquake can serve as a critical index to evaluate the health of the structure. There are currently few reliable monitoring methods to assess concrete stress after a seismic event. Piezoelectric-based smart aggregate (SA) provides an innovative experimental approach to monitor stress on concrete. The principle of SA-based concrete seismic stress monitoring is based on the assumption that concrete stress can be reliably predicted by the average output voltages of limited SAs with an acceptable margin of error. In this study, the meso-scale randomness of concrete was evaluated throughout the overall stress range of concrete and the influence of different load paths was considered. Four cylindrical specimens of normal strength concrete were embedded with a total of 24 SAs. The SA output sensitivity curve in the paths of loading-unloading with different amplitudes and monotonic loading up to failure was obtained. Monitoring errors were analyzed during pre- and post-peak stages from the experimental results. This research suggests that SA-based concrete seismic stress monitoring for normal strength concrete is reliable.

  16. Propagandas de medicamentos: a saúde como produto de consumo

    Directory of Open Access Journals (Sweden)

    Elaine Teixeira Rabello

    2012-06-01

    Full Text Available O objetivo deste estudo foi discutir as propagandas televisivas de medicamentos como forma de transmissão e representação das concepções circulantes sobre saúde, funções e uso de medicamentos. Foi realizada uma análise de conteúdo qualitativa em dez propagandas televisivas, diretas ao consumidor, de medicamentos de comercialização livre no mercado brasileiro, e uma propaganda institucional de uma empresa farmacêutica. Os dados mostraram que a noção que entrelaça as ideias subjacentes às mensagens e as funções do medicamento anunciadas é a de que os "problemas de saúde" advêm de questões corporais, relacionais ou sociais, mas a solução apresentada é individual e consagra-se na compra e no uso do medicamento. A análise sugere, enfim, que noções de saúde e qualidade de vida podem estar marcadas por noções que fundamentam o ideal de saúde atrelado ao consumo.

  17. Propagandas de medicamentos: a saúde como produto de consumo

    Directory of Open Access Journals (Sweden)

    Elaine Teixeira Rabello

    Full Text Available O objetivo deste estudo foi discutir as propagandas televisivas de medicamentos como forma de transmissão e representação das concepções circulantes sobre saúde, funções e uso de medicamentos. Foi realizada uma análise de conteúdo qualitativa em dez propagandas televisivas, diretas ao consumidor, de medicamentos de comercialização livre no mercado brasileiro, e uma propaganda institucional de uma empresa farmacêutica. Os dados mostraram que a noção que entrelaça as ideias subjacentes às mensagens e as funções do medicamento anunciadas é a de que os "problemas de saúde" advêm de questões corporais, relacionais ou sociais, mas a solução apresentada é individual e consagra-se na compra e no uso do medicamento. A análise sugere, enfim, que noções de saúde e qualidade de vida podem estar marcadas por noções que fundamentam o ideal de saúde atrelado ao consumo.

  18. SaTool - a Software Tool for Structural Analysis of Complex Automation Systems

    DEFF Research Database (Denmark)

    Blanke, Mogens; Lorentzen, Torsten

    2006-01-01

    The paper introduces SaTool, a tool for structural analysis, the use of the Matlab (R)-based implementation is presented and special features are introduced, which were motivated by industrial users. Salient features of tool are presented, including the ability to specify the behavior of a comple...

  19. Hydrogen Storage Activities at HySA from (Nano)materials to Systems

    CSIR Research Space (South Africa)

    Langmi, Henrietta W

    2012-11-01

    Full Text Available One of HySA’s missions is to deliver technologies for hydrogen storage infrastructure that meet the set cost targets and provide the best balance of safety, reliability, robustness, quality and functionality. HySA aims to develop storage...

  20. SpringSaLaD: A Spatial, Particle-Based Biochemical Simulation Platform with Excluded Volume.

    Science.gov (United States)

    Michalski, Paul J; Loew, Leslie M

    2016-02-02

    We introduce Springs, Sites, and Langevin Dynamics (SpringSaLaD), a comprehensive software platform for spatial, stochastic, particle-based modeling of biochemical systems. SpringSaLaD models biomolecules in a coarse-grained manner as a group of linked spherical sites with excluded volume. This mesoscopic approach bridges the gap between highly detailed molecular dynamics simulations and the various methods used to study network kinetics and diffusion at the cellular level. SpringSaLaD is a standalone tool that supports model building, simulation, visualization, and data analysis, all through a user-friendly graphical user interface that should make it more accessible than tools built into more comprehensive molecular dynamics infrastructures. Importantly, for bimolecular reactions we derive an exact expression relating the macroscopic on-rate to the various microscopic parameters with the inclusion of excluded volume; this makes SpringSaLaD more accurate than other tools, which rely on approximate relationships between these parameters.

  1. Across the City, Toward the Nation: Philippine Poetry, Metropolitan Trains, and the Tulaan sa Tren Project

    Directory of Open Access Journals (Sweden)

    Oscar Tantoco Serquiña, Jr.

    2014-06-01

    Full Text Available In 2008 and 2010, the Philippine government’s National Book Development Board (NBDB and Light Railway Transit Authority (LRTA launched Tulaan sa Tren, a project “designed to provide train passengers with an appreciation for Philippine Literature as they listen to their favorite celebrities reading poems about Manila over the public announcement system of LRT Line 2 stations” (goodnewspilipinas.com. This project also initiated a poetry writing contest and produced poetry anthologies that predominantly depicted views of the city and city life. Part appreciation, part revaluation, part critique, this paper initiates a sensing of: (1 the train as a figure of modern life; (2 NBDB and LRTA’s enterprise as a state measure to bridge the disparity between the public’s reception to Philippine literature and the intelligentsia’s academic way of life; and (3 literary representations of the city in the poetry anthologies this project produced, namely Train of Thought: Poems from Tulaan sa Tren and Off the Beaten Track: Poems from Tulaan sa Tren 2. This paper argues that the institutional intervention of popularizing travel, literature, and the city may be seen as a way of generating a socio-political and literary consciousness among train commuters who are linked to and implicated in the issues and anxieties of their lives in the urban environment. By analyzing the poems in the anthologies, this essay ultimately critiques Tulaan sa Tren’s attempt at nation building, identity making, and city mapping.

  2. A categoria racionalidade médica e uma nova epistemologia em saúde

    Directory of Open Access Journals (Sweden)

    Marilene Cabral do Nascimento

    2013-12-01

    Full Text Available O artigo é um relato analítico da trajetória de 20 anos da categoria racionalidade médica, que emergiu no Campo da Saúde Coletiva, área das Ciências Sociais e Humanas em Saúde, no início da década de 1990, com o objetivo de estudar sistemas médicos complexos e terapêuticas tradicionais, complementares e alternativas. Com base em revisão crítica da literatura, apresentam-se aspectos do contexto cultural, político-institucional e social de seu surgimento, como também suas principais contribuições e desdobramentos nos planos teórico e das políticas e práticas sociais em saúde. Utiliza-se o conceito de epistemologia do sul de Boaventura de Sousa Santos, para a reflexão sobre a contribuição da categoria racionalidade médica à crítica da racionalidade científica pós-moderna e à construção de uma nova epistemologia em saúde.

  3. Remembering Londósa : mediator and counterpoint in a "violent" society

    NARCIS (Netherlands)

    Abbink, J.; Böll, V.

    2004-01-01

    This chapter briefly presents the biography of Londósa, a ritual leader or 'komoru' of the Chari Suri people in southwestern Ethiopia and shows how a personal case study can highlight the social problems of an ethnic group. Suri face a crisis of security and of social continuity. Both their physical

  4. Do real ao ideal - o (descuidar da saúde dos idosos longevos

    Directory of Open Access Journals (Sweden)

    Tatiane Michel

    2015-06-01

    Full Text Available RESUMOObjetivo:analisar semelhanças e dessemelhanças nos significados do cuidado à saúde de idosos longevos atribuídos por eles e pelos profi ssionais de enfermagem no cenário de uma unidade básica de saúde.Método:pesquisa qualitativa etnográfica, alicerçada no método de Spradley e McCurdy e na antropologia interpretativa de Geertz e Kleinman. Participaram 20 informantes-chaves, as informações foram coletadas por meio da observação participante e entrevista etnográfica no período de março a outubro de 2013 e analisadas em domínios, taxonomias e tema cultural.Resultados:emergiram seis domínios e taxonomias culturais que mostraram razões, atributos e recursos para cuidar, na perspectiva dos idosos e dos profissionais de enfermagem e, por fim, o tema cultural: do real ao ideal - o (descuidar da saúde dos idosos longevos.Conclusão:o estudo mostrou o distanciamento entre o cuidado almejado e o realizado à saúde das pessoas com idade mais avançada no cenário estudado.

  5. 77 FR 73557 - Airworthiness Directives; Turbomeca S.A. Turboshaft Engines

    Science.gov (United States)

    2012-12-11

    ... proposed AD, contact Turbomeca S.A., 40220 Tarnos, France; phone: 33 (0) 5 59 74 40 00; telex: 570 042; fax... Tarnos, France; phone: 33 (0) 5 59 74 40 00; telex: 570 042; fax: 33 (0) 5 59 74 45 15. You may view...

  6. 78 FR 48824 - Airworthiness Directives; Turbomeca S.A. Turboshaft Engines

    Science.gov (United States)

    2013-08-12

    ... 59 74 40 00; telex: 570 042; fax: 33 (0)5 59 74 45 15. You may view this service information at the... Turbomeca, S.A., 40220 Tarnos, France; phone: 33 (0)5 59 74 40 00; telex: 570 042; fax: 33 (0)5 59 74 45...

  7. Sentimentos e percepções da equipe de saúde frente ao paciente terminal

    Directory of Open Access Journals (Sweden)

    Alberto Manuel Quintana

    2006-12-01

    Full Text Available O atendimento a pacientes terminais pelas equipes de saúde, comprovadamente apontado por evidências na literatura, mostra a grande dificuldade que esses profissionais têm em lidar com o tema "morte". O presente estudo objetivou compreender como as equipes de saúde definem e vivenciam o paciente terminal. Para tanto, utilizou-se uma abordagem qualitativa que empregou a pesquisa etnográfica através de observação não-participativa, além de entrevistas semi-estruturadas nas unidades de hemato-oncologia e de infectologia de um hospital público. Os resultados certificaram as dificuldades por parte da equipe em lidar com pacientes terminais, bem como em defini-los como tais e comunicar aos mesmos a sua condição. Dessa forma, percebeu-se a intensa necessidade da realização de um trabalho direto com as equipes de saúde com o intuito de lhes proporcionar um espaço de reflexão e de entendimento, propiciando a continência das emoções suscitadas na equipe de saúde perante a situação da morte.

  8. Data of evolutionary structure change: 3GD5D-3D7SA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 3GD5D-3D7SA 3GD5 3D7S D A --TRFRPDLLSLDDLDEAQLHALLTLAHQLKRGERVANL...HGKVLGLVFLKASTRTRVSFTVAMYQLGGQVIDL------------EPVRDTARVLGRYVDGLAIRTFAQTELEEYAHYAG-IPVINALTD-HEHPCQVVADLLTIRENFGRLAGLKLAYVGD...ANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSFETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFSGNVPVLNAGD...GSNQHPTQTLLDLFTIQETQGRLDNLHVAMVGDLKYGRTVHSLTQALAKFDGNRFYFIAPDALAMPQYILDMLDEK----GIAWSLH.../index> 3GD5 D 3GD5D

  9. Data of evolutionary structure change: 1A7SA-2GDDC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A7SA-2GDDC 1A7S 2GDD A C IVGGRKARPRQFPFLASIQNQ---GRHFCGGALIHARFV...FPRFVNVTVTPEDQC-----------------RPNNVCTGVLTRRGGICNGDGGTPLVCE----GLAHGVASFSLGPCGR--GPDFFTRVALFRDWIDGVLNNPGPGP...Y----QDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGD...n14> 2GDD C 2GDDC ARG CA 404 PHE CA 422 VAL CA 380

  10. Resisting Colonial Education: Zitkala-Sa and Native Feminist Archival Refusal

    Science.gov (United States)

    Terrance, Laura L.

    2011-01-01

    This paper examines resistance through a Native Feminist lens, employing the boarding school memoirs of Zitkala-Sa. Within a "story" of appropriation in methodology, it considers protest and parody, and presents archival refusal as modes of resistance to colonial education. (Contains 1 figure.)

  11. Grupo Tutorial e a Saúde Mental no Ensino Médico

    Directory of Open Access Journals (Sweden)

    Marcia Braga Cliquet

    Full Text Available RESUMO Esta pesquisa objetivou investigar a presença de conteúdos de saúde mental no currículo real do ensino médico nos quatro primeiros anos da Faculdade de Ciências Médicas e da Saúde da Pontifícia Universidade Católica de São Paulo. Trata-se de um estudo quantitativo e documental de caráter descritivo que avaliou esses conteúdos nos objetivos de aprendizagem dos problemas utilizados na estratégia de ensino-aprendizagem denominada tutoria nos quatro primeiros anos do curso. Como resultado, menos de 15% dos problemas estudados apresentou conteúdos de saúde mental em seus objetivos de aprendizagem no primeiro, segundo e quarto anos do curso. No terceiro ano, 36% dos problemas apresentaram tais conteúdos. A pesquisa não permite concluir o nível de exploração desses temas, bem como o aprendizado sobre eles, porém diagnostica o empobrecimento da exploração dos temas de saúde mental que permeiam o ensino médico das doenças clínicas e cirúrgicas.

  12. Adolescência e trabalho: significados, dificuldades e repercussões na saúde

    Directory of Open Access Journals (Sweden)

    Cibele Almeida Torres

    2010-12-01

    Full Text Available Foram investigadas experiências de trabalho de adolescentes trabalhadores e as repercussões na saúde. A pesquisa foi desenvolvida em uma escola de Fortaleza, Ceará, em 2008, com dez adolescentes trabalhadores. O estudo foi exploratório, com abordagem qualitativa, tendo o grupo focal e o diário de campo como instrumentos de coleta de dados. A análise dos dados seguiu a análise de conteúdo. Foram respeitados os aspectos legais e éticos. Com o desenvolvimento do estudo, surgiram quatro categorias: características dos sujeitos participantes do estudo; significados das experiências de trabalho para os adolescentes; adolescentes trabalhadores e dificuldades enfrentadas nas situações de trabalho; repercussões da situação de trabalho no campo da saúde dos adolescentes. Percebeu-se que há toda uma conjuntura que leva os adolescentes a serem cercados por vulnerabilidades, sendo fundamental a preparação dos profissionais de saúde para atender tal público, proporcionando uma atenção integral e promovendo a saúde desses adolescentes.

  13. Transcriptome Analysis in Haematococcus pluvialis: Astaxanthin Induction by Salicylic Acid (SA) and Jasmonic Acid (JA).

    Science.gov (United States)

    Gao, Zhengquan; Li, Yan; Wu, Guanxun; Li, Guoqiang; Sun, Haifeng; Deng, Suzhen; Shen, Yicheng; Chen, Guoqiang; Zhang, Ruihao; Meng, Chunxiao; Zhang, Xiaowen

    2015-01-01

    Haematococcus pluvialis is an astaxanthin-rich microalga that can increase its astaxanthin production by salicylic acid (SA) or jasmonic acid (JA) induction. The genetic transcriptome details of astaxanthin biosynthesis were analyzed by exposing the algal cells to 25 mg/L of SA and JA for 1, 6 and 24 hours, plus to the control (no stress). Based on the RNA-seq analysis, 56,077 unigenes (51.7%) were identified with functions in response to the hormone stress. The top five identified subcategories were cell, cellular process, intracellular, catalytic activity and cytoplasm, which possessed 5600 (~9.99%), 5302 (~9.45%), 5242 (~9.35%), 4407 (~7.86%) and 4195 (~7.48%) unigenes, respectively. Furthermore, 59 unigenes were identified and assigned to 26 putative transcription factors (TFs), including 12 plant-specific TFs. They were likely associated with astaxanthin biosynthesis in Haematococcus upon SA and JA stress. In comparison, the up-regulation of differential expressed genes occurred much earlier, with higher transcript levels in the JA treatment (about 6 h later) than in the SA treatment (beyond 24 h). These results provide valuable information for directing metabolic engineering efforts to improve astaxanthin biosynthesis in H. pluvialis.

  14. Direito à saúde: demanda por suplementos no Tribunal de Justiça

    Directory of Open Access Journals (Sweden)

    Leandro Felipe Mufato

    2012-03-01

    Full Text Available Buscou-se compreender como o Tribunal de Justiça de Mato Grosso contribui na efetivação do direito à saúde, ao atuar como mediador na demanda de pessoas e/ou famílias por suplementos. Objetivou conhecer a origem, o motivo, o objeto, o sujeito demandante e a resolutividade das decisões judiciais. Trata-se de estudo qualitativo baseado em pesquisa documental. Das 28 decisões analisadas, 92,8% (26 demandaram compostos alimentares e 7,1% (2, fitas de controle glicêmico. O magistrado acolheu o pedido em 96,5% (27 das decisões, recorrendo estritamente à Constituição Federal, em seu discurso sobre o direito à saúde, e à prescrição médica como prova jurídica. Tais prescrições impõem marcas comerciais em 100% (28 dos casos, e a alergia alimentar pediátrica constitui principal motivo da demanda, 17,8% (5. A maioria dos adoecimentos, considerados condições crônicas de saúde, demanda cuidados continuados e prolongados, frente aos quais o caráter pontual das decisões judiciais pouco contribui para efetivação da equidade e integralidade em saúde.

  15. Programa Saúde da Família no Brasil: uma agenda incompleta?

    Directory of Open Access Journals (Sweden)

    Maria Fátima de Sousa

    Full Text Available Este artigo trata de uma análise longitudinal da experiência brasileira com o Programa Saúde da Família (PSF, ao longo dos doze anos da sua implantação e implementação. Toma como ponto de partida o propósito fundamental desta estratégia, que é a reorganização da atenção básica de saúde, contextualizando à luz da experiência que é única e peculiar ao Sistema Único de Saúde (SUS. Evidencia os avanços e desafios do PSF, apontando nesse sentido as necessidades mais urgentes em termos de incorporação tecnológica, formação da força de trabalho, estabelecimento de novos mecanismos e pactos em torno do financiamento da atenção básica e encaminhamento de novas estratégias e tecnologias nos processos de monitoramento e avaliação. Finaliza apontando elementos para subsidiar um debate sobre as questões em pauta, o qual deve ser permanente e lúcido na perspectiva da construção do SUS e do direito à saúde.

  16. Processo comunicativo e humanização em saúde

    Directory of Open Access Journals (Sweden)

    Suely Ferreira Deslandes

    2009-01-01

    Full Text Available O artigo aborda o processo comunicacional como um dos desafios enfrentados na humanização em saúde. Reflete sobre potencialidades e requisitos para a produção do agir comunicativo e aponta alguns obstáculos, baseando-se em estudos antropológicos sobre a cultura biomédica. Com base no conceito de entendimento, discute sobre os encontros em saúde e a relevância da validação e do reconhecimento do discurso dos diferentes atores. Aponta para a importância de se relativizarem marcas identitárias associadas à cultura biomédica, desconstruírem-se alguns conceitos, criticarem seus contextos de aplicabilidade e até mesmo se propor novas marcas por meio da humanização. Discute-se a relação entre as tecnologias biomédicas e o processo comunicacional. O desafio colocado é o de aprender, reconhecer e negociar com o outro, que detém direitos, autonomia e estoque cultural peculiares. Finalmente, discute os esforços teóricos para que a humanização das práticas em saúde venha a fazer parte do ethos ou visão do mundo dos profissionais de saúde.

  17. 78 FR 77569 - Airworthiness Directives; Turbomeca S.A. Turboshaft Engines

    Science.gov (United States)

    2013-12-24

    ... Turbomeca S.A. Arriel 1 engine. We are issuing this AD to prevent a loss of FT bearing lubrication... after receipt. FOR FURTHER INFORMATION CONTACT: Robert Morlath, Aerospace Engineer, Engine Certification.... Following the event, which resulted from Free Turbine front bearing deterioration, the...

  18. Data of evolutionary structure change: 1A7SA-2IOTA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A7SA-2IOTA 1A7S 2IOT A A IVGGRKARPRQFPFLASIQNQ----GRHFCGGALIHARF...ain> 2IOT A 2IOTA CV...in> 1.7549999952316284 13.41100025177002 27.16900062561035 ...73 0.5460000038146973 0.7860000133514404 tion> 3.8209950923919678 2IOT A 2IOTA

  19. Lech Wałęsa - kangelane või reetur? / Zygmunt Dzieciolowski ; intervjueerinud Taavi Minnik

    Index Scriptorium Estoniae

    Dzieciolowski, Zygmunt

    2016-01-01

    Intervjuu Poola politoloogi ja ajakirjaniku Zygmunt Dzieciolowskiga Solidaarsuse liikumise juhi Lech Wałęsa elu tumedatest varjudest, käimasolevast skandaalist seoses tema sidemetega kommunistliku režiimi salapolitsei SBga ning kohast Poola ühiskonnas ja ajaloos

  20. Novel Castellaniella denitrificans SA13P as a Potent Malachite Green Decolorizing Strain

    Directory of Open Access Journals (Sweden)

    Ankita Chawla

    2014-01-01

    Full Text Available Triphenylmethane dyes represent a major group of dyes causing serious environmental hazards. Malachite Green is one of the commonly and extensively used triphenylmethane dyes although it is carcinogenic and mutagenic in nature. Various physicochemical methods have been employed for its elimination but are highly expensive, coupled with the formation of huge amount of sludge. Hence, biological methods being ecofriendly are good alternatives. In the present study, the novel bacterial isolate SA13P was isolated from UASB tank of tannery effluent treatment plant. Phylogenetic characterization of 1470 bp fragment of SA13P has revealed its similarity with Castellaniella denitrificans. This strain has been found to decolorize the dye (malachite green at a concentration of 100 mg L−1 (80.29%. Decolorization was done by living bacterial cells rather than adsorption. Growth conditions have also been optimized for the decolorization. Maximum decolorization was observed at a temperature of 37°C and pH 8.0. Also, it has been found that bacterization of seeds of Vigna radiata with Castellaniella denitrificans SA13P increases germination rate. We have reported for the first time that Castellaniella denitrificans SA13P may be used as a novel strain for dye decolorization (malachite green and biological treatment of tannery effluent.

  1. Remembering Londósa : mediator and counterpoint in a "violent" society

    NARCIS (Netherlands)

    Abbink, J.; Böll, V.

    2004-01-01

    This chapter briefly presents the biography of Londósa, a ritual leader or 'komoru' of the Chari Suri people in southwestern Ethiopia and shows how a personal case study can highlight the social problems of an ethnic group. Suri face a crisis of security and of social continuity. Both their physical

  2. Advanced hydrogen technologies for FC applications and PGM beneficiation in SA: Presentation

    CSIR Research Space (South Africa)

    Langmi, Henrietta W

    2013-03-01

    Full Text Available in South Africa Thomas P. Fluri – nominal capacity for CSP in South Africa is 547.6 GW, Energy Policy, v 37, Issue 12, December 2009, 5075–5080 Slide 5 Mineral Resources in South Africa Rank in the World SA Mineral Resource 1 Gold 1 Platinum 1...

  3. Phillips SA8016BW 2.5 GHz Synthesizer SEE Testing

    Science.gov (United States)

    Carts, Marty; Ladbury, Ray; Marshall, Paul W.; Mackey, Susan

    2008-01-01

    This viewgraph presentation reviews the Single Event Effects (SEE) testing of the Phillips SA8016BW 2.5 GHz Synthesizer that was chose by the GLAST Program for Frequency Generation. Included in this are diagrams of the phased-locked loop (PLL), the synthesizer, and heater.

  4. Data of evolutionary structure change: 1A7SA-1HFDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A7SA-1HFDA 1A7S 1HFD A A IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTA...pdbChain>A 1HFDA HCLEDAADGKVQVL 1HFD A 1HFDA RAVPHPDS...A 1HFDA VCGNRKKPGIYT EEEE...1HFD A 1HFDA LSQPE-PSKRL

  5. Fenomenologia heideggeriana como referencial para estudos sobre formação em saúde

    Directory of Open Access Journals (Sweden)

    Alberto Durán González

    2012-09-01

    Full Text Available Reflete-se sobre as possibilidades da fenomenologia heideggeriana como referência na análise da educação na saúde. Heidegger propõe, em "Ser e tempo", a investigação sobre o sentido do ser, fundamental para o conhecimento que o homem possa ter de si mesmo como ser finito. Suas ideias provocaram transformações na concepção humanista moderna e na prática em educação. O indivíduo é sempre ator, sendo na medida em que existe, experimentando a si próprio na existência. O modo de ser privativo da saúde, o padecimento, é acompanhado sempre de uma limitação da possibilidade de viver. Assim, a fenomenologia heideggeriana nos ajuda a questionar a educação em saúde. Compreende-se que o homem se encontra sempre em copresença, entre a preocupação substitutiva e a libertadora. Este caminho se mostra possível quando contemplados os diversos modos de ser-professor e de ser-estudante. Possibilita-se, assim, aprofundar o ensinar-aprender na formação em saúde.

  6. Marcadores de saúde do homem em um município de pequeno porte

    Directory of Open Access Journals (Sweden)

    Maria Cristina Pinto de Jesus

    2014-12-01

    Full Text Available Objetivo: Identificar marcadores de saúde do homem. Métodos: Pesquisa descritiva, exploratória com abordagem quantitativa realizada em um município de pequeno porte de Minas Gerais. A coleta de dados ocorreu de outubro a dezembro de 2013, utilizando-se 217 formulários estruturados com informações de homens. Resultados: 134 (62% formulários foram preenchidos durante o atendimento na Unidade de Atenção Primária à Saúde e o restante no dia da chamada nutricional realizada pelo município; 58% dos homens apresentaram sobrepeso e obesidade e a prevalência de hipertensão arterial sistêmica e diabetes mellitus foi de 17,5% e 4,6%, respectivamente. As doenças cardiovasculares mostraram-se mais presentes entre os homens, e sua alimentação inclui um grande percentual de alimentos processados. Conclusão: Os marcadores de saúde identificados no homem apontam a necessidade de operacionalização de estratégias que fortaleçam a participação do público masculino nas ações de promoção da saúde.

  7. 77 FR 24342 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2012-04-24

    ...-250-AD; Amendment 39-17014; AD 2012-07-08] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... (75 FR 30284, June 1, 2010), and adding the following new AD: 2012-07-08 Empresa Brasileira de...) Applicability (1) This AD applies to all Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170-100...

  8. 76 FR 64785 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2011-10-19

    ...-159-AD; Amendment 39-16838; AD 2011-21-15] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira...: 2011-21-15 Empresa Brasileira de Aeronautica S.A. (EMBRAER): Amendment 39-16838. Docket No. FAA-2011...) becomes effective November 23, 2011. Affected ADs (b) None. Applicability (c) This AD applies to...

  9. 77 FR 16155 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2012-03-20

    ...-035-AD; Amendment 39-16980; AD 2012-05-08] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... directive (AD) for all Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170 airplanes. This AD... amends Sec. 39.13 by adding the following new AD: 2012-05-08 Empresa Brasileira de Aeronautica...

  10. 76 FR 81894 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2011-12-29

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira..., except Federal holidays. For service information identified in this proposed AD, contact Empresa... the following new AD: Empresa Brasileira de Aeronautica S.A. (EMBRAER): Docket No. FAA-...

  11. 75 FR 19201 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 170...

    Science.gov (United States)

    2010-04-14

    ...-212-AD; Amendment 39-16261; AD 2010-08-06] RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... 2. The FAA amends Sec. 39.13 by adding the following new AD: 2010-08-06 Empresa Brasileira de...)(2) of this AD; certificated in any category. (1) Empresa Brasileira de Aeronautica S.A....

  12. 76 FR 72855 - Airworthiness Directives; Empresa Brasileira de Aeronautica S.A. (EMBRAER) Airplanes

    Science.gov (United States)

    2011-11-28

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Empresa Brasileira... all Empresa Brasileira de Aeronautica S.A. (EMBRAER) Model ERJ 190 airplanes. This proposed AD results... Friday, except Federal holidays. For service information identified in this proposed AD, contact...

  13. Mulher, direito e saúde: repensando o nexo coesivo Women, rights and health

    Directory of Open Access Journals (Sweden)

    Rosa Maria Godoy Serpa da Fonseca

    1999-12-01

    Full Text Available Esse artigo é construído a partir de três elementos básicos: mulher, direito e saúde, articulados entre si a partir de: 1 considerações acerca das condições objetivas de constituição das mulheres enquanto sujeitos sociais na sociedade contemporânea; 2 direitos das mulheres como direitos humanos e 3 direito das mulheres à saúde no contexto da implementação do PAISM (Programa de Atenção Integral à Saúde da Mulher, como focalização do SUS (Sistema Único de Saúde.That article is built from three basic elements: women, rights and health, articulated to each other starting from: 1 considerations concerning the objective conditions of the women's constitution as social subjects in contemporary society; 2 women's rights as human rights and 3 women's rights to health in the context of PAISM (Program of Integral Attention to the Woman's Health, as part of SUS (Unified System of Health.

  14. Sammenhænge mellem Produktivitet og Psykosocialt Arbejdsmiljø, SaPPA

    DEFF Research Database (Denmark)

    Edwards, Kasper; Møller, Niels; Kristensen, Tage Søndergård;

    Nykredit har i perioden 2008 til 2012 deltaget i et forskningsprojekt i samarbejde med DTU, CBS og NFA. Projektets formål har været at undersøge sammenhænge mellem produktivitet og psykisk arbejdsmiljø i Nykredits privatkundecentre (i daglig tale SaPPA-projektet). Projektet har benyttet et...

  15. Estresse, coping e estado de saúde entre enfermeiros hospitalares

    Directory of Open Access Journals (Sweden)

    Laura de Azevedo Guido

    2011-12-01

    Full Text Available Estudo quantitativo com o objetivo de identificar estressores, nível de estresse dos enfermeiros, estado geral de saúde e formas de enfrentamento utilizadas pelos enfermeiros no ambiente de trabalho. Os dados foram coletados utilizando-se três instrumentos: formulário para levantamento de atividades diárias; inventário de estratégias de coping; inventário sobre o estado geral de saúde. A população deste estudo foi composta de 143 enfermeiros e a maioria encontra-se com baixo nível de estresse (55,25% e com estado regular de saúde (50,35%. Em relação às formas de enfrentamento, identificou-se resolução de problemas como o fator de maior média. Concluindo, ações educativas devem ser incentivadas, a fim de disponibilizar ferramentas para que o profissional desenvolva estratégias de coping resolutivas em seu dia a dia, minimizando o efeito do estresse no seu estado de saúde e no seu trabalho.

  16. Almanaque da Dengue: leituras e narrativas de Agentes Comunitários de Saúde

    Directory of Open Access Journals (Sweden)

    Helena Maria Scherlowski Leal David

    2012-12-01

    Full Text Available Apresenta-se um estudo de leitura e apropriação como metodologia de aproximação ao universo narrativo de Agentes Comunitários de Saúde (ACS, usando um dispositivo de informação e comunicação - o Almanaque da Dengue (AD. O objetivo foi o de perceber as formas de construção e apropriação de saberes sobre dengue e saúde por parte dos ACS, além de avaliar a serventia do AD como um dispositivo info-comunicacional. Foram realizadas oficinas com agentes do Rio de Janeiro, com vistas à desconstrução e leitura relacional do AD. A análise das narrativas gerou três categorias temáticas: abundância informacional nos ciclos epidêmicos; culpabilização da vítima; contradições e ambiguidades no trabalho dos ACS como mediadores. O AD mostrou-se um instrumento útil na discussão e apropriação de informações sobre a saúde, devido ao caráter textual relacional e não linear dos seus conteúdos, e ao seu formato interativo e não impositivo de formulações sobre a dengue e saúde.

  17. Almanaque da Dengue: leituras e narrativas de Agentes Comunitários de Saúde

    Directory of Open Access Journals (Sweden)

    Helena Maria Scherlowski Leal David

    Full Text Available Apresenta-se um estudo de leitura e apropriação como metodologia de aproximação ao universo narrativo de Agentes Comunitários de Saúde (ACS, usando um dispositivo de informação e comunicação - o Almanaque da Dengue (AD. O objetivo foi o de perceber as formas de construção e apropriação de saberes sobre dengue e saúde por parte dos ACS, além de avaliar a serventia do AD como um dispositivo info-comunicacional. Foram realizadas oficinas com agentes do Rio de Janeiro, com vistas à desconstrução e leitura relacional do AD. A análise das narrativas gerou três categorias temáticas: abundância informacional nos ciclos epidêmicos; culpabilização da vítima; contradições e ambiguidades no trabalho dos ACS como mediadores. O AD mostrou-se um instrumento útil na discussão e apropriação de informações sobre a saúde, devido ao caráter textual relacional e não linear dos seus conteúdos, e ao seu formato interativo e não impositivo de formulações sobre a dengue e saúde.

  18. Saúde mental e trabalho: levantamento das publicações na SCIELO e PEPSIC

    Directory of Open Access Journals (Sweden)

    Maria Célia Bruno Mundim

    2012-01-01

    Full Text Available Considerando-se a importância do tema saúde do trabalhador, o objetivo deste estudo foi o de fazer um levantamento das publicações acerca da saúde mental e trabalho nos periódicos das bases Scielo e PePSIC, sem limitação de período. Foram selecionados 57 trabalhos, nos quais foram levantados os seguintes aspectos: a temática, o período de publicação, setores pesquisados e regiões de publicação. Os resultados indicaram aumento nas publicações sobre o tema nos últimos seis anos e prevalência das pesquisas teóricas seguidas pela empírica qualitativa. Também se verificou que a temática mais pesquisada é a saúde/doença mental, há predominância de publicações na região sudeste e os setores mais pesquisados são da saúde, saúde mental e policial. Concluiu-se que o interesse pelo tema saúde mental e trabalho vêm aumentando, porém há necessidade de mais estudos sobre intervenções e políticas de saúde do trabalhador. Abstract The aim of this study was to conduct a review of publications on mental health and work in Scielo and PePSIC journals, without limitation of time. 57 articles were selected and analyzed regarding methodology, theme, date of publication, surveyed sectors and regions of publication. The results showed an increase in publications on the subject over the past six years and the prevalence of theoretical research followed by the qualitative empirical papers. Also it was found that the prevailing subject is health/mental illness and there are more publications in the Southeast. The sectors more surveyed are health, mental health and police. In conclusion, the interest in mental health and work has increased, but there is a need for further studies on interventions and policies for worker health.

  19. Desenvolvimento, complexo industrial da saúde e política industrial

    Directory of Open Access Journals (Sweden)

    Carlos Augusto Grabois Gadelha

    2006-08-01

    Full Text Available O artigo situa a questão da saúde no contexto do desenvolvimento nacional e da política industrial. Tomou-se a idéia de corte estruturalista, marxista e schumpeteriano, onde a indústria e as inovações constituem os elementos determinantes do dinamismo das economias capitalistas e de sua posição relativa na economia mundial. Todos os países que se desenvolveram e passaram a competir em melhores condições com os países avançados associaram uma indústria forte com uma base endógena de conhecimento, de aprendizado e de inovação. Todavia, na área da saúde essa visão é problemática, uma vez que os interesses empresariais se movem pela lógica econômica do lucro e não para o atendimento das necessidades da saúde. A noção de complexo industrial da saúde constitui uma tentativa e fornecer um referencial teórico que permita articular duas lógicas distintas: a sanitária e a do desenvolvimento econômico. O trabalho procurou mostrar, com base em dados de comércio exterior, como a desconsideração da lógica do desenvolvimento nas políticas de saúde levou a uma situação de vulnerabilidade econômica do setor que pode limitar os objetivos de universalidade, eqüidade e integralidade. Nesse contexto, propõe-se uma ruptura cognitiva e política com as visões antagônicas que colocam, de um lado, as necessidades da saúde e, de outro, da indústria. Um país que pretende chegar a uma condição de desenvolvimento e de independência requer, ao mesmo tempo, indústrias fortes e inovadoras, e um sistema de saúde inclusivo e universal.

  20. Perilaku Wirausaha Industri Keramik Berskala Kecil untuk Meningkatkan Daya Saing Produk di Malang

    Directory of Open Access Journals (Sweden)

    Sri Hadiati

    2008-01-01

    Full Text Available The purposes of the study was to find out the explanation of ceramic entrepreneurs’ respond to the environment factors affecting competitiveness of small scale ceramic industries (SSCIs. The environment factors are internal and external then form a strategy. The research was carried out in Malang using a survey and case study. Data were collected using questionnaire and in-depth interview from 107 SSCIs that was chosen randomly chosen from 180 registered SSCIs. Structural Equation Modeling (SEM with AMOS software was used to analyze data. The research results showed that environment factors were both directly and indirectly affecting SSCI’s competitiveness through strategy. In order to increase competitiveness then SSCIs need to empower the existing producers’ association in some aspects such as provision of raw material, pricing the products, and marketing. Training, education, and research need to be developed and improved by local government and higher education institutions. Abstract in Bahasa Indonesia: Penelitian ini bertujuan mencari penjelasan tentang perilaku wirausaha keramik terhadap faktor-faktor lingkungan yang mempengaruhi daya saing industri keramik berskala kecil di Malang. Secara spesifik penelitian ini bertujuan mempelajari pengaruh faktor internal dan eksternal terhadap strategi dan daya saing serta pengaruh strategi terhadap daya saing industri keramik berskala kecil di Malang. Faktor-faktor lingkungan tersebut dapat dikelompokkan kedalam faktor internal dan eksternal perusahaan. Penelitian diambil dari 107 industri keramik berskala kecil yang dipilih secara acak sederhana dari 180 unit usaha yang ada di Malang. Data dikumpulkan menggunakan kuesioner dan wawancara mendalam. Variabel dalam penelitian dibagi menjadi 4 kelompok yaitu, faktor lingkungan internal dan eksternal dari usaha kecil, strategi dan daya saing industri keramik berskala kecil. Data yang diperoleh selanjutnya dianalisis menggunakan Structural Equation

  1. Modelo(s) de Saúde de base à Prática Clínica dos Fisioterapeutas

    OpenAIRE

    Santos, Liane Raquel Pinho dos

    2015-01-01

    Introdução: A evolução dos modelos de saúde ocorreu juntamente com as mudanças da definição do conceito de saúde e reabilitação, mas ainda é desconhecido o modelo predominante de saúde em que se enquadra a prática clínica dos fisioterapeutas que trabalham em terapia manual. Objetivo(s): Criação de um questionário para avaliação do modelo de saúde em que se enquadra a prática clínica dos fisioterapeutas e após a aplicação, verificar o conhecimento dos modelos de saúde, o grau de concordânci...

  2. Conflito de deveres do médico de saúde ocupacional face à entidade patronal no Brasil

    OpenAIRE

    2010-01-01

    O artigo faz reflexão ética e bioética da atuação do médico enquanto profissional de saúde ocupacional. Seja qual for o ramo da medicina ela estará abordando: saúde, doença e doente, cabendo análises individuais ou coletivas. É função do médico trabalhar a saúde ocupacional dentro da empresa. A medicina do trabalho existe pelo fato da saúde ser um direito imprescíndivel ao cidadão. Nesta perspectiva, os sistemas empresariais contratam médicos para cuidarem da saúde de seus trabalhadores, prim...

  3. Turismo de saúde em Portugal: turismo médico e turismo de bem-estar

    OpenAIRE

    Ferreira, Ricardo

    2013-01-01

    Mestre em Gestão de Serviços de Saúde O turismo de saúde engloba duas subcategorias, o turismo médico (cirurgias e serviços de saúde no estrangeiro) e o turismo de bem-estar (viajar para locais específicos para promoção da saúde de uma forma preventiva). Na vertente de bem-estar, há vários aspectos a considerar e diversas formas de promoção da saúde de forma preventiva, uma delas é o turismo termal (com um longo histórico em Portugal mas actualmente numa situação premente de reforma). A...

  4. Experiência de ensino em medicina e enfermagem: promovendo a saúde da criança

    OpenAIRE

    Bruna Brenha Ribeiro; Juliane Beatrice Eckert; Figueiredo,Anna Carolina de Miranda e; Wania Maria Papile Galhardi; Célia Martins Campanaro

    2012-01-01

    Diante das mudanças curriculares do ensino médico e da importância da promoção de saúde e da atenção primária, este trabalho, fruto do PET-Saúde, possui como objetivo relatar uma experiência dos alunos do curso de Medicina e Enfermagem na integração entre ensino e serviço na Atenção Básica à Saúde. Além disso, mostra a importância do trabalho educativo na promoção de saúde e prevenção de doenças e evidencia os determinantes sociais no processo saúde-doença no território estudado. Este projeto...

  5. Comparison between hybridized algorithm of GA–SA and ABC, GA, DE and PSO for vertical-handover in heterogeneous wireless networks

    Indian Academy of Sciences (India)

    SHIDROKH GOUDARZI; WAN HASLINA HASSAN; MOHAMMAD HOSSEIN ANISI; SEYED AHMAD SOLEYMANI

    2016-07-01

    Genetic algorithms (GAs) and simulated annealing (SA) have emerged as leading methods for search and optimization problems in heterogeneous wireless networks. In this paradigm, various access technologies need to be interconnected; thus, vertical handovers are necessary for seamless mobility. In this paper, the hybrid algorithm for real-time vertical handover using different objective functions has been presented to find the optimal network to connect with a good quality of service in accordance with the user’s preferences. As it is, the characteristics of the current mobile devices recommend using fast andefficient algorithms to provide solutions near to real-time. These constraints have moved us to develop intelligent algorithms that avoid slow and massive computations. This was to, specifically, solve two major problems in GA optimization, i.e. premature convergence and slow convergence rate, and the facilitation of simulated annealing in the merging populations phase of the search. The hybrid algorithm was expected to improve on the pure GA in two ways, i.e., improved solutions for a given number of evaluations, and more stability over many runs. This paper compares the formulation and results of four recent optimization algorithms: artificial bee colony (ABC), genetic algorithm(GA), differential evolution (DE), and particle swarm optimization (PSO). Moreover, a cost function is used to sustain the desired QoS during the transition between networks, which is measured in terms of the bandwidth, BER, ABR, SNR, and monetary cost. Simulation results indicated that choosing the SA rules would minimize the cost function and the GA– SA algorithm could decrease the number of unnecessary handovers, and thereby prevent the ‘Ping-Pong’ effect.

  6. Development of a linear motion antenna for the JT-60SA ECRF system

    Energy Technology Data Exchange (ETDEWEB)

    Moriyama, Shinichi, E-mail: moriyama.shinichi@jaea.go.jp [Fusion Research and Development Directorate, Japan Atomic Energy Agency, Mukoyama 801-1, Naka, Ibaraki 311-0193 (Japan); Kobayashi, Takayuki; Isayama, Akihiko; Hoshino, Katsumichi; Suzuki, Sadaaki; Hiranai, Shinichi; Yokokura, Kenji; Sawahata, Masayuki; Terakado, Masayuki; Hinata, Jun; Wada, Kenji; Sato, Yoshikatsu [Fusion Research and Development Directorate, Japan Atomic Energy Agency, Mukoyama 801-1, Naka, Ibaraki 311-0193 (Japan)

    2013-10-15

    Highlights: ► Development of an antenna featuring linear motion (LM) concept for long pulse electron cyclotron range of frequency (ECRF) heating and current drive in JT-60SA is in progress. ► A mock-up using a metallic sliding bearing with solid lubricant was fabricated. ► A vacuum pumping test with mass analyzer showed evidence of some hydrocarbons during shaft motion. ► Injection beam profile in toroidal beam scan was checked by low power measurement with mock-up. ► Current drive characteristics with the LM antenna for typical experimental scenarios of JT-60SA have been investigated by calculation. -- Abstract: Development of an antenna that features the linear motion (LM) concept for long-pulse electron-cyclotron range of frequency heating and current drive for the JT-60SA is in progress. Combining a linearly movable first mirror and a fixed curved second mirror allows the injection-beam angle to be controlled. Cooling water is fed through the drive shaft for the first mirror and through the fixed support for the second mirror. The shaft support structure uses a metallic sliding bearing with a solid lubricant. The sliding bearing supports combined linear and rotational motion, whereas a conventional ball bearing supports either linear or rotational motion. Therefore, the sliding bearing offers the advantage of reducing the support-structure volume, which is important in the design of the relatively narrow port duct of the JT-60SA. Recently, the sliding bearing has been installed into the mockup. Results of a vacuum test with a mass analyzer indicate the presence of hydrocarbons during shaft motion. The injection-beam profile obtained from a toroidal beam scan is checked against low-power measurements taken on the mockup. Finally, for typical JT-60SA experimental scenarios, heating- and current-drive characteristics of the LM antenna are investigated theoretically.

  7. Narrativas na formação comum de profissionais de saúde

    Directory of Open Access Journals (Sweden)

    Angela Aparecida Capozzolo

    Full Text Available Este texto relata a experiência de formação comum que ocorre desde 2007 no campus Baixada Santista da Universidade Federal de São Paulo, no terceiro semestre de graduação, do eixo curricular trabalho em saúde. A experiência articula estudantes e docentes de diferentes áreas profissionais: educação física, fisioterapia, nutrição, psicologia e terapia ocupacional. São apresentadas as diretrizes e estratégias de organização do módulo 'Prática clínica integrada: análise de demandas e necessidades de saúde', que adota a produção de narrativas de histórias de vida e de questões de saúde de pessoas selecionadas por docentes em conjunto com as equipes da rede de serviços do município de Santos, São Paulo. As narrativas foram produzidas em encontros quinzenais dos estudantes com as pessoas acompanhadas em suas residências e de supervisões com os docentes. Realizouse análise de conteúdo de 120 relatórios de conclusão do módulo elaborados pelos estudantes nos anos de 2007 e 2008 visando identificar efeitos dessa proposta de formação. A elaboração de narrativas favoreceu aos estudantes ampliar a capacidade de escuta e a percepção da complexidade do processo saúdedoençacuidado, bem como de outros aspectos do que se tem denominado de 'clínica comum' às diversas profissões em saúde.

  8. Gestão da ergonomia para a saúde ocupacional dos gerentes hoteleiros

    Directory of Open Access Journals (Sweden)

    Cyntia Maria de Gois Leite

    2011-09-01

    Full Text Available Os estudos em saúde e segurança do trabalho estão relacionados predominantemente com trabalhadores operacionais assalariados. Há poucos estudos abordando a saúde e a segurança de gerentes de organizações, embora pareça haver um consenso de que esta categoria profissional, a quem normalmente se atribui o protagonismo pelas constantes mudanças organizacionais e pelas pressões e sobrecargas de trabalho decorrentes, sofra também com elas. Este artigo apresenta uma abordagem da Ergonomia como vertente de análise da atividade dos gerentes, especialmente de hotéis, e dos impactos na sua segurança e saúde ocupacional. Nos hotéis de grande porte são os gerentes os responsáveis pelas tomadas de decisões em favor de uma maior eficiência do sistema. Muitas vezes suas decisões entram em conflito com as decisões globais da organização, trazendo implicações e contradições nas ações de sua competência, vindo a repercutir em sua saúde, provocando doenças e sofrimento. Eles também buscam mobilizar as pessoas que trabalham na organização para mantê-las permanentemente produtivas, eficientes e eficazes, mas nem sempre esta mobilização é adequada e, portanto, provoca impactos na eficiência produtiva e na saúde, tanto dos trabalhadores quanto dos próprios gerentes.

  9. Partial Activation of SA- and JA-Defensive Pathways in Strawberry upon Colletotrichum acutatum Interaction.

    Science.gov (United States)

    Amil-Ruiz, Francisco; Garrido-Gala, José; Gadea, José; Blanco-Portales, Rosario; Muñoz-Mérida, Antonio; Trelles, Oswaldo; de Los Santos, Berta; Arroyo, Francisco T; Aguado-Puig, Ana; Romero, Fernando; Mercado, José-Ángel; Pliego-Alfaro, Fernando; Muñoz-Blanco, Juan; Caballero, José L

    2016-01-01

    Understanding the nature of pathogen host interaction may help improve strawberry (Fragaria × ananassa) cultivars. Plant resistance to pathogenic agents usually operates through a complex network of defense mechanisms mediated by a diverse array of signaling molecules. In strawberry, resistance to a variety of pathogens has been reported to be mostly polygenic and quantitatively inherited, making it difficult to associate molecular markers with disease resistance genes. Colletotrichum acutatum spp. is a major strawberry pathogen, and completely resistant cultivars have not been reported. Moreover, strawberry defense network components and mechanisms remain largely unknown and poorly understood. Assessment of the strawberry response to C. acutatum included a global transcript analysis, and acidic hormones SA and JA measurements were analyzed after challenge with the pathogen. Induction of transcripts corresponding to the SA and JA signaling pathways and key genes controlling major steps within these defense pathways was detected. Accordingly, SA and JA accumulated in strawberry after infection. Contrastingly, induction of several important SA, JA, and oxidative stress-responsive defense genes, including FaPR1-1, FaLOX2, FaJAR1, FaPDF1, and FaGST1, was not detected, which suggests that specific branches in these defense pathways (those leading to FaPR1-2, FaPR2-1, FaPR2-2, FaAOS, FaPR5, and FaPR10) were activated. Our results reveal that specific aspects in SA and JA dependent signaling pathways are activated in strawberry upon interaction with C. acutatum. Certain described defense-associated transcripts related to these two known signaling pathways do not increase in abundance following infection. This finding suggests new insight into a specific putative molecular strategy for defense against this pathogen.

  10. Partial activation of SA- and JA-defensive pathways in strawberry upon Colletotrichum acutatum interaction

    Directory of Open Access Journals (Sweden)

    FRANCISCO AMIL-RUIZ

    2016-07-01

    Full Text Available Understanding the nature of pathogen host interaction may help improve strawberry (Fragaria × ananassa cultivars. Plant resistance to pathogenic agents usually operates through a complex network of defense mechanisms mediated by a diverse array of signaling molecules. In strawberry, resistance to a variety of pathogens has been reported to be mostly polygenic and quantitatively inherited, making it difficult to associate molecular markers with disease resistance genes. Colletotrichum acutatum spp. is a major strawberry pathogen, and completely resistant cultivars have not been reported. Moreover, strawberry defense network components and mechanisms remain largely unknown and poorly understood. Assessment of the strawberry response to C. acutatum included a global transcript analysis, and acidic hormones SA and JA measurements were analyzed after challenge with the pathogen. Induction of transcripts corresponding to the SA and JA signaling pathways and key genes controlling major steps within these defense pathways was detected. Accordingly, SA and JA accumulated in strawberry after infection. Contrastingly, induction of several important SA, JA, and oxidative stress-responsive defense genes, including FaPR1-1, FaLOX2, FaJAR1, FaPDF1, and FaGST1, was not detected, which suggests that specific branches in these defense pathways (those leading to FaPR1-2, FaPR2-1, FaPR2-2, FaAOS, FaPR5 and FaPR10 were activated. Our results reveal that specific aspects in SA and JA dependent signaling pathways are activated in strawberry upon interaction with C. acutatum. Certain described defense-associated transcripts related to these two known signaling pathways do not increase in abundance following infection. This finding suggests new insight into a specific putative molecular strategy for defense against this pathogen.

  11. Gestão do conhecimento em instituições de saúde portuguesas

    Directory of Open Access Journals (Sweden)

    Sofia Gaspar Cruz

    2016-06-01

    Full Text Available RESUMO A gestão do conhecimento impõe-se como uma necessidade premente para as organizações de vários setores da economia, inclusive do setor da saúde. Objetivo: avaliar a perceção dos colaboradores de instituições de saúde relativamente à gestão do conhecimento na instituição onde atuam e analisar a existência de diferenças nessa perceção, em função do modelo de gestão da instituição. Método: estudo realizado numa amostra de 671 colaboradores de dez instituições de saúde portuguesas, com diferentes modelos de gestão. Para avaliar a perceção de gestão do conhecimento, utilizamos uma escala construída a partir de itens de escalas disponíveis na literatura. Resultados: evidenciam perceção de moderada gestão do conhecimento nas instituições de saúde e diferenças estatisticamente significativas na perceção de gestão do conhecimento, em cada modelo de gestão. Conclusão: a gestão do conhecimento ocorre nas instituições de saúde, e o modelo de gestão vigente influencia a forma como elas gerenciam o seu conhecimento.

  12. As representações da saúde bucal na mídia impressa

    Directory of Open Access Journals (Sweden)

    Aline Guio Cavaca

    2012-12-01

    Full Text Available Buscou-se compreender como as informações sobre Saúde Bucal são veiculadas pela mídia impressa no estado do Espírito Santo - Brasil, por meio de uma pesquisa qualitativa, com análise de conteúdo de 66 matérias relacionadas à temática, veiculadas no período de março de 2004 a junho de 2009, nos jornais A Gazeta e A Tribuna.O material empírico originou sete categorias analíticas: responsabilização do indivíduo; realidades extremas; imaginário popular do dentista e do consultório dentário; patologização da halitose; valorização estética; determinantes da saúde bucal; prevenção e hábitos. A abordagem midiática da saúde bucal perpassa uma complexidade de fatores sociais, culturais, políticos, biológicos e econômicos, que destaca a importância de uma comunicação contextualizada com os interesses da sociedade, que seja interativa e dialógica e explore sua potência crítica na educação e promoção da saúde, veiculando, de maneira consciente, o consumismo em Saúde Bucal.

  13. Partial Activation of SA- and JA-Defensive Pathways in Strawberry upon Colletotrichum acutatum Interaction

    Science.gov (United States)

    Amil-Ruiz, Francisco; Garrido-Gala, José; Gadea, José; Blanco-Portales, Rosario; Muñoz-Mérida, Antonio; Trelles, Oswaldo; de los Santos, Berta; Arroyo, Francisco T.; Aguado-Puig, Ana; Romero, Fernando; Mercado, José-Ángel; Pliego-Alfaro, Fernando; Muñoz-Blanco, Juan; Caballero, José L.

    2016-01-01

    Understanding the nature of pathogen host interaction may help improve strawberry (Fragaria × ananassa) cultivars. Plant resistance to pathogenic agents usually operates through a complex network of defense mechanisms mediated by a diverse array of signaling molecules. In strawberry, resistance to a variety of pathogens has been reported to be mostly polygenic and quantitatively inherited, making it difficult to associate molecular markers with disease resistance genes. Colletotrichum acutatum spp. is a major strawberry pathogen, and completely resistant cultivars have not been reported. Moreover, strawberry defense network components and mechanisms remain largely unknown and poorly understood. Assessment of the strawberry response to C. acutatum included a global transcript analysis, and acidic hormones SA and JA measurements were analyzed after challenge with the pathogen. Induction of transcripts corresponding to the SA and JA signaling pathways and key genes controlling major steps within these defense pathways was detected. Accordingly, SA and JA accumulated in strawberry after infection. Contrastingly, induction of several important SA, JA, and oxidative stress-responsive defense genes, including FaPR1-1, FaLOX2, FaJAR1, FaPDF1, and FaGST1, was not detected, which suggests that specific branches in these defense pathways (those leading to FaPR1-2, FaPR2-1, FaPR2-2, FaAOS, FaPR5, and FaPR10) were activated. Our results reveal that specific aspects in SA and JA dependent signaling pathways are activated in strawberry upon interaction with C. acutatum. Certain described defense-associated transcripts related to these two known signaling pathways do not increase in abundance following infection. This finding suggests new insight into a specific putative molecular strategy for defense against this pathogen. PMID:27471515

  14. Atos & autores: o lúdico na educação em saúde

    Directory of Open Access Journals (Sweden)

    Eduardo Gomes de Araújo

    1996-09-01

    Full Text Available Uma das formas que o capitalismo encontrou para perpetuar sua ideologia foi fazer da instituição escolar seu aparelho ideológico. Neste espaço disciplinado, não raramente se opõem educadores e educandos, e a prática pedagógica é imputada através de esquemas preestabelecidos e alienantes. Na esfera da saúde, este esquema se repete, pois as concepções de saúde/doença dos profissionais de saúde apontam a população como subordinados e transmitem a educação para a saúde calcada em conselhos e normas para os indivíduos, num processo de culpabilidade por suas doenças. Pretendemos neste trabalho relatar nossa experiência com o Psicodrama Pedagógico de ROMANÃ (1987 no levantamento de demandas referentes a informações sobre Primeiros Socorros entre adolescentes matriculados no Curso de Patrulheirismo da Rocinha(R.J., onde os dados levantados, no ano de 1995, foram sujeitos a uma análise qualitativa do discurso. No decorrer da experiência, percebemos que a utilização de uma metodologia que não exclui o contexto social dos sujeitos da aprendizagem, contribui para que esses compreendam seu papel e compromisso com a transformação individual e coletiva. Esperamos contribuir com a Enfermagem, mostrando possibilidades pedagógicas, humanizantes e criativas para a Educação em saúde.

  15. Educação em saúde: uma nova abordagem

    Directory of Open Access Journals (Sweden)

    Solange L'Abbate

    1994-12-01

    Full Text Available Este artigo desenvolve reflexão sobre um conjunto de experiências na área de Educação em Saúde, entendida como campo privilegiado de práticas que ocorrem no nível das relações sociais estabelecidas cotidianamente pelos profissionais de saúde, no âmbito institucional, envolvendo os diversos atores presentes. Assumindo que é sobretudo por meio dessas práticas que se presta o atendimento de saúde ao usuário, torna-se necessário colocar à disposição do profissional de saúde. Capacitação didático-pedagógica específica e a possibilidade de participação em estratégias, visando ao desenvolvimento do papel profissional. Nesse sentido, as experiências analisadas apontam para a importância de se dispor de abordagens teórico-metodológicas adequadas, como a do Psicodrama Pedagógico e da Metodologia Arvoredo, mediante as quais tem sido possível instrumentalizar os profissionais interessados em aperfeiçoar-se nesse campo. Ao mesmo tempo, dados os pressupostos das abordagens referidas, tem sido possível demonstrar ser imprescindível adotar postura ética de busca constante da autonomia como pressuposto básico do processo de construção de sujeitos\\cidadãos, sejam eles outros profissionais ou usuários. Entre as possibilidades trazidas por tal abordagem e os limites da atual constituição dos serviços de saúde, situa-se a proposta em pauta.

  16. Educação em saúde: uma nova abordagem

    Directory of Open Access Journals (Sweden)

    L'Abbate Solange

    1994-01-01

    Full Text Available Este artigo desenvolve reflexão sobre um conjunto de experiências na área de Educação em Saúde, entendida como campo privilegiado de práticas que ocorrem no nível das relações sociais estabelecidas cotidianamente pelos profissionais de saúde, no âmbito institucional, envolvendo os diversos atores presentes. Assumindo que é sobretudo por meio dessas práticas que se presta o atendimento de saúde ao usuário, torna-se necessário colocar à disposição do profissional de saúde. Capacitação didático-pedagógica específica e a possibilidade de participação em estratégias, visando ao desenvolvimento do papel profissional. Nesse sentido, as experiências analisadas apontam para a importância de se dispor de abordagens teórico-metodológicas adequadas, como a do Psicodrama Pedagógico e da Metodologia Arvoredo, mediante as quais tem sido possível instrumentalizar os profissionais interessados em aperfeiçoar-se nesse campo. Ao mesmo tempo, dados os pressupostos das abordagens referidas, tem sido possível demonstrar ser imprescindível adotar postura ética de busca constante da autonomia como pressuposto básico do processo de construção de sujeitoscidadãos, sejam eles outros profissionais ou usuários. Entre as possibilidades trazidas por tal abordagem e os limites da atual constituição dos serviços de saúde, situa-se a proposta em pauta.

  17. Total synthesis and evaluation of iso-duocarmycin SA and iso-yatakemycin.

    Science.gov (United States)

    MacMillan, Karen S; Nguyen, Trinh; Nguyen, Trihn; Hwang, Inkyu; Boger, Dale L

    2009-01-28

    The total synthesis and evaluation of iso-duocarmycin SA (5) and iso-yatakemycin (6), representing key analogues of the corresponding natural products incorporating an isomeric alkylation subunit, are detailed. This pyrrole isomer of the natural alkylation subunit displayed an enhanced reaction regioselectivity and a 2-fold diminished stability. Although still exceptionally potent, the iso-duocarmycin SA derivatives and natural product analogues exhibited a corresponding approximate 3-5-fold reduction in cytotoxic activity [L1210 IC(50) for (+)-iso-duocarmycin SA = 50 pM and for (+)-iso-yatakemycin = 15 pM] consistent with their placement on a parabolic relationship correlating activity with reactivity. The DNA alkylation selectivity of the resulting key natural product analogues was unaltered by the structure modification in spite of the minor-groove presentation of a potential H-bond donor. Additionally, a unique ortho-spirocyclization with such derivatives was explored via the preparation, characterization, and evaluation of 34 that is incapable of the more conventional para-spirocyclization. Although 34 proved sufficiently stable for isolation and characterization, it displayed little stability in protic solvents (t(1/2) = 0.19 h at pH 3, t(1/2) = 0.20 h at pH 7), a pH-independent (H(+) independent) solvolysis rate profile at pH 3/4-7, and a much reduced cytotoxic potency, but a DNA alkylation selectivity and efficiency comparable to those of duocarmycin SA and iso-duocarmycin SA. The implications of these observations on the source of the DNA alkylation selectivity and catalysis for this class of natural products are discussed.

  18. Repercussões da variabilidade na saúde do enfermeiro intensivista

    Directory of Open Access Journals (Sweden)

    Élissa Jôse Erhardt Rollemberg Cruz

    2008-12-01

    Full Text Available Estudo qualitativo e descritivo, que teve como objeto a influência das situações de variabilidade na saúde do enfermeiro intensivista. Objetivou-se identificar situações de variabilidade e discutir as repercussões da variabilidade na saúde do enfermeiro intensivista. As informações foram coletadas num centro de terapia intensiva (CTI de um hospital da rede privada de saúde no Rio de Janeiro. Os sujeitos foram 13 enfermeiros intensivistas em atuação neste CTI há pelo menos um ano. O instrumento de coleta foi entrevista semi-estruturada, realizada entre Setembro/2006 e Outubro/2006. O método de análise caracterizou-se na análise de conteúdo. O tratamento das informações demonstrou que os enfermeiros conhecem as situações de variabilidade e que estas alteram o processo saúde-doença, resultando em irritabilidade, elevação da pressão arterial, cansaço, dores, tensão muscular e estresse. Entretanto, as ocorrências de algumas são passíveis de serem restringidas. Estratégias de enfrentamento foram apontadas e perpassam desde a sistematização da assistência, até melhores salários, condições de trabalho e o auto-conhecimento. Concluiu-se que os enfermeiros vivenciam em sua rotina laboral muitas situações de variabilidade, implicando na rápida mobilização de suas potencialidades psicofísicas e cognitivas, repercutindo negativamente em sua saúde.

  19. Saúde organizacional e síndrome de burnout em escolas e hospitais

    Directory of Open Access Journals (Sweden)

    Etienne Andrade de Medeiros Dantas

    2012-04-01

    Full Text Available Estudou-se a prevalência da síndrome de burnout em instituições hospitalares e escolares em conformidade com a saúde organizacional dessas instituições. A pesquisa empírica foi realizada em três escolas públicas de ensino médio e em três hospitais públicos, sendo um geral, um especializado e outro militar. Contou-se com amostra acidental de 168 participantes. Para avaliação da prevalência da síndrome de burnout, aplicaram-se o Inventário de Burnout de Maslach (MBI e uma ficha sociodemográfica. Para análise de saúde organizacional, foram realizadas entrevistas semi-estruturadas com pessoas-chave das organizações, utilizando um roteiro baseado nos fatores-componentes do construto. Os resultados corroboram a expectativa de alta prevalência da síndrome de burnout. Entretanto, não se encontraram diferenças de prevalência entre as instituições participantes, embora os participantes das escolas apresentem escores mais elevados no fator de Diminuição da Realização Pessoal. Em relação à variação da saúde organizacional, observou-se uma precária saúde organizacional em todas as instituições pesquisadas.  No entanto, considerando a alta prevalência da síndrome de burnout, é adequado assinalar que os resultados corroboram a previsão de que um ambiente de saúde organizacional deficiente amplia a probabilidade de desenvolvimento da síndrome pelos trabalhadores.

  20. A judicialização da saúde: breves comentários

    Directory of Open Access Journals (Sweden)

    Sephora Luyza Marchesini Stival

    2016-05-01

    Full Text Available O artigo tem como escopo apresentar a judicialização da saúde, tema que vem tomando espaço nas discussões doutrinárias e jurisprudenciais, onde indivíduos que necessitam de remédios ou tratamentos (simples ou de alto valor, recorrem ao judiciário para terem a concretização do seu direito à saúde. Os magistrados nessas demandas comumente colocam a questão da saúde, como sinônimo de vida, acima de qualquer outra questão, condenando com frequência ao fornecimento de tratamentos/medicamentos, mesmo quando não há a real comprovação dessa necessidade, nem mesmo atentando-se para o dano causado ao coletivo, ao obrigar o Poder Público a gastar uma grande quantia com um só individuo, que já se encontra debilitado. Ocorre que a concessão nessas demandas individuais leva à desarticulação das políticas públicas voltadas para saúde, as quais são propostas e aprovadas pelos Poderes Legislativo e Executivo, valorizando o direito de poucos – os que têm acesso ao judiciário – em detrimento da maioria. Por ser um direito social, o direito à saúde depende das escolhas políticas feitas pelos entes políticos, tendo a sua limitação por questões financeiras ou mesmo técnicas, não cabendo ao Judiciário fazer essas escolhas, nem mesmo impor aos outros Poderes tal fornecimento.