WorldWideScience

Sample records for pteronarcys californica newport

  1. Newport Hydrographic Line - Newport Hydrograhic Line

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — We carry out oceanographic cruises every two weeks, and have done so for the past 20 years, in continental shelf and slope waters off Newport Oregon, along the...

  2. Newport Research Station

    Data.gov (United States)

    Federal Laboratory Consortium — The Newport Research Station is the Center's only ocean-port research facility. This station is located at Oregon State University's Hatfield Marine Science Center,...

  3. Newport Lab CTD Casts

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Newport Hydrographic (NH) Line along 44.65°N off central Oregon was sampled seasonally during two epochs: 1961-1971 through the TENOC program and 1997-2003...

  4. Studies on stoneflies (Plecoptera) of Colorado with eastern faunal affinities, including a new state record of the midwestern salmonfly, Pteronarcys pictetii hagen (Plecoptera: Pteronarcyidae)

    Science.gov (United States)

    Zuellig, R.E.; Kondratieff, B.C.; Hood, R.W.

    2006-01-01

    Pteronarcys pictetii Hagen nymphs were collected and reared from the South Platte River at Julesburg in eastern Colorado. Including P. pictetii, eight species are now known from Colorado that exhibit eastern North American affinities, Paracapnia angulata Hanson, Taeniopteryx burksi Ricker and Ross, Taeniopteryx parvula Banks, Acroneuria abnormis (Newman), Perlesta decipiens (Walsh), Isoperla bilineata (Say), and Isoperla marlynia (Needham and Claassen). A brief discussion of the dispersal of these species into Colorado is presented.

  5. 76 FR 59596 - Anchorage Regulations; Newport, RI

    Science.gov (United States)

    2011-09-27

    ... cruise ship visits to Newport and to improve navigation safety. DATES: Comments and related material..., Rhode Island, to better accommodate increasing cruise ship visits to Newport, and to improve navigation... years cruise ship visits to Newport, RI, have been more frequent. On occasion, there is a need to...

  6. Novel diterpene from Dollabella californica

    Energy Technology Data Exchange (ETDEWEB)

    Ireland, C. (Scripps Institution of Oceanography, La Jolla, CA); Faulkner, D.J.; Finer, J.; Clardy, J.

    1976-07-21

    The sea hare Dollabella californica Sterns, a large softbodied opistobranch mollusk, was collected at Isla Partida, Gulf of California. The digestive gland of Dollabella, contained a number of terpenoid compounds which are probably of dietary origin. The major components of the digestive gland extracts are a series of diterpenes which appear to be closely related. The structural determination has been obtained by single-crystal x-ray diffraction analysis for a diterpene 1 having a novel 5,11-bicyclic carbon skeleton. (DDA)

  7. Developmental transcriptome of Aplysia californica'

    KAUST Repository

    Heyland, Andreas

    2010-12-06

    Genome-wide transcriptional changes in development provide important insight into mechanisms underlying growth, differentiation, and patterning. However, such large-scale developmental studies have been limited to a few representatives of Ecdysozoans and Chordates. Here, we characterize transcriptomes of embryonic, larval, and metamorphic development in the marine mollusc Aplysia californica and reveal novel molecular components associated with life history transitions. Specifically, we identify more than 20 signal peptides, putative hormones, and transcription factors in association with early development and metamorphic stages-many of which seem to be evolutionarily conserved elements of signal transduction pathways. We also characterize genes related to biomineralization-a critical process of molluscan development. In summary, our experiment provides the first large-scale survey of gene expression in mollusc development, and complements previous studies on the regulatory mechanisms underlying body plan patterning and the formation of larval and juvenile structures. This study serves as a resource for further functional annotation of transcripts and genes in Aplysia, specifically and molluscs in general. A comparison of the Aplysia developmental transcriptome with similar studies in the zebra fish Danio rerio, the fruit fly Drosophila melanogaster, the nematode Caenorhabditis elegans, and other studies on molluscs suggests an overall highly divergent pattern of gene regulatory mechanisms that are likely a consequence of the different developmental modes of these organisms. © 2010 Wiley-Liss, Inc., A Wiley Company.

  8. Antibacterial activity of native California medicinal plant extracts isolated from Rhamnus californica and Umbellularia californica.

    Science.gov (United States)

    Carranza, Maria G; Sevigny, Mary B; Banerjee, Debashree; Fox-Cubley, Lacie

    2015-05-23

    Antimicrobial resistance (AMR) is a major threat to global public health. Medicinal plants have long been used as remedies for infectious diseases by native cultures around the world and have the potential for providing effective treatments for antibiotic-resistant infections. Rhamnus californica (Rhamnaceae) and Umbellularia californica (Lauraceae) are two indigenous California plant species historically used by Native Americans to treat skin, respiratory and gastrointestinal infections. This study aimed to assess the in vitro antimicrobial activity of methanolic extracts of leaves and bark of R. and U. californica against methicillin-resistant Staphylococcus aureus (MRSA) and other Gram-positive and Gram-negative bacteria. Methanolic extracts of leaves and bark of R. and U. californica were prepared by soxhlet extraction and evaluated for their antimicrobial activity against Bacillus cereus, Streptococcus pyogenes, Mycobacterium smegmatis, Staphylococcus aureus, MRSA, Escherichia coli and Pseudomonas aeruginosa using disc diffusion and minimal inhibitory concentration (MIC) assays. Chemical profiling of the extracts was performed using standard methods. All extracts inhibited the growth of MRSA and other Gram-positive bacteria with MICs of 3.3-6.0 mg/ml. Gram-negative organisms were unaffected by these extracts. U. californica extracts (leaves and bark) had the lowest MIC values. Chemical profiling detected the presence of quinones, alkaloids, flavonoids, cardenolides, tannins and saponins in these extracts. Our study is the first to report the antimicrobial properties of R. and U. californica and illustrates their promising anti-MRSA potential. Our results give scientific credence to the traditional medicinal uses of these plants by the indigenous peoples of California. Further investigation of the secondary metabolites responsible for the antimicrobial activity of these extracts against MRSA is warranted.

  9. 33 CFR 80.1112 - Newport Bay, CA.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Newport Bay, CA. 80.1112 Section 80.1112 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Pacific Coast § 80.1112 Newport Bay, CA. A line drawn from...

  10. 77 FR 22489 - Special Anchorage Regulations, Newport Bay Harbor, CA

    Science.gov (United States)

    2012-04-16

    ... Master Plan Subcommittee of the City of Newport Harbor Commission led an outreach campaign involving a... meetings, the City of Newport asked the Coast Guard to amend its anchorage regulations. The Coast Guard... incorporated into area A-11 under revised Sec. 110.95(k). An image of the anchorage areas is available in...

  11. Newport, Oregon 1/3 arc-second DEM

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 1/3-second Newport, Oregon Elevation Grid provides bathymetric data in ASCII raster format of 1/3-second resolution in geographic coordinates. This grid is...

  12. Encyclopedia of Autographa californica Nucleopolyhedrovirus Genes

    Institute of Scientific and Technical Information of China (English)

    David P. A. Cohen; Martin Marek; Bryn G. Davies; Just M. Vlak; Monique M. van Oers

    2009-01-01

    The Autographa californica multiple capsid nucleopolyhedrovirus (AcMNPV) was the first baculovirus for which the complete nucleotide sequence became known. Since then 15 years lapsed and much research has been performed to elucidate putative functions of the annotated open reading frames of this virus and this endeavour is still ongoing. AcMNPV is the most well-known and well-studied baculovirus species, not in the least for its application as a vector for the high-level expression of foreign genes in insect cells. This article is the first monograph of a single baculovirus and gives a current overview of what is known about the 151 AcMNPV ORFs, including (putative) function and temporal and spatial presence of transcripts and protein. To date 60 ORFs have a proven function, another 19 ORFs have homologs for which functions are known in other baculoviruses and 72 ORFs are still enigmatic. This paper should assist the reader in quickly finding the essentials of AcMNPV.

  13. Salmonella newport causing osteomyelitis in a patient with diabetes.

    Science.gov (United States)

    Weston, Natasha; Moran, Ed

    2015-11-24

    Salmonella is a foodborne pathogen that commonly causes intestinal symptoms. Bacteraemia and extraintestinal infections have been documented within the literature, and are more frequently associated with immunodeficiency and general debilitation. We discuss the case of a previously well 36-year-old man who presented with a septic knee and new-onset diabetes. Imaging confirmed osteomyelitis and a Brodie's abscess, with blood and tissue cultures revealing the isolate Salmonella enterica newport. He denied any previous gastrointestinal symptoms, recent travel, change in usual dietary habit or symptoms of diabetes. So far there have only been three reported cases of S. newport causing osteomyelitis. We discuss the incidence of Salmonella infections, including extraintestinal symptoms, its relation to immunodeficiency and the disease burden of S. newport.

  14. Renewable Energy Optimization Report for Naval Station Newport

    Energy Technology Data Exchange (ETDEWEB)

    Robichaud, R.; Mosey, G.; Olis, D.

    2012-02-01

    In 2008, the U.S. Environmental Protection Agency (EPA) launched the RE-Powering America's Land initiative to encourage the development of renewable energy (RE) on potentially contaminated land and mine sites. As part of this effort, EPA is collaborating with the U.S. Department of Energy's (DOE's) National Renewable Energy Laboratory (NREL) to evaluate RE options at Naval Station (NAVSTA) Newport in Newport, Rhode Island. NREL's Renewable Energy Optimization (REO) tool was utilized to identify RE technologies that present the best opportunity for life-cycle cost-effective implementation while also serving to reduce energy-related carbon dioxide emissions and increase the percentage of RE used at NAVSTA Newport. The technologies included in REO are daylighting, wind, solar ventilation preheating (SVP), solar water heating, photovoltaics (PV), solar thermal (heating and electric), and biomass (gasification and cogeneration). The optimal mix of RE technologies depends on several factors including RE resources; technology cost and performance; state, utility, and federal incentives; and economic parameters (discount and inflation rates). Each of these factors was considered in this analysis. Technologies not included in REO that were investigated separately per NAVSTA Newport request include biofuels from algae, tidal power, and ground source heat pumps (GSHP).

  15. 33 CFR 110.212 - Newport Bay Harbor, Calif.

    Science.gov (United States)

    2010-07-01

    ... at the east end of Lido Isle; north of a line parallel to and 250 feet north of a line bearing 268° from Newport Bay Channel Light 11, this line being the north line of the main fairway; northwest of a... parallel to the existing pierhead line, and adjoining and on the north side of Anchorage C-3 described...

  16. Neurogenesis of cephalic sensory organs of Aplysia californica

    DEFF Research Database (Denmark)

    Wollesen, Tim; Wanninger, Andreas; Klussmann-Kolb, Annette

    2007-01-01

    The opisthobranch gastropod Aplysia californica serves as a model organism in experimental neurobiology because of its simple and well-known nervous system. However, its nervous periphery has been less intensely studied. We have reconstructed the ontogeny of the cephalic sensory organs (labial te...

  17. Modulatory Effects of Eschscholzia californica Alkaloids on Recombinant GABAA Receptors

    Directory of Open Access Journals (Sweden)

    Milan Fedurco

    2015-01-01

    Full Text Available The California poppy (Eschscholzia californica Cham. contains a variety of natural compounds including several alkaloids found exclusively in this plant. Because of the sedative, anxiolytic, and analgesic effects, this herb is currently sold in pharmacies in many countries. However, our understanding of these biological effects at the molecular level is still lacking. Alkaloids detected in E. californica could be hypothesized to act at GABAA receptors, which are widely expressed in the brain mainly at the inhibitory interneurons. Electrophysiological studies on a recombinant α1β2γ2 GABAA receptor showed no effect of N-methyllaurotetanine at concentrations lower than 30 μM. However, (S-reticuline behaved as positive allosteric modulator at the α3, α5, and α6 isoforms of GABAA receptors. The depressant properties of aerial parts of E. californica are assigned to chloride-current modulation by (S-reticuline at the α3β2γ2 and α5β2γ2 GABAA receptors. Interestingly, α1, α3, and α5 were not significantly affected by (R-reticuline, 1,2-tetrahydroreticuline, codeine, and morphine—suspected (S-reticuline metabolites in the rodent brain.

  18. Genetic diversity of Salmonella pathogenicity islands SPI-5 and SPI-6 in Salmonella Newport.

    Science.gov (United States)

    Cao, Guojie; Allard, Marc; Strain, Errol; Stones, Robert; Zhao, Shaohua; Brown, Eric; Meng, Jianghong

    2014-10-01

    Salmonella enterica subspecies enterica serotype Newport is one of the common serotypes causing foodborne salmonellosis outbreaks in the United States. Salmonella Newport consists of three lineages exhibiting extensive genetic diversity. Due to the importance of Salmonella pathogenicity islands 5 and 6 (SPI-5 and SPI-6) in virulence of pathogenic Salmonella, the genetic diversity of these two SPIs may relate to different potentials of Salmonella Newport pathogenicity. Most Salmonella Newport strains from North America belong to Salmonella Newport lineages II and III. A total 28 Salmonella Newport strains of lineages II and III from diverse sources and geographic locations were analyzed, and 11 additional Salmonella genomes were used as outgroup in phylogenetic analyses. SPI-5 was identified in all Salmonella Newport strains and 146 single nucleotide polymorphisms (SNPs) were detected. Thirty-nine lineage-defining SNPs were identified, including 18 nonsynonymous SNPs. Two 40-kb genomic islands (SPI5-GI1 and SPI5-GI2) encoding bacteriophage genes were found between tRNA-ser and pipA. SPI5-GI1 was only present in Salmonella Newport multidrug-resistant strains of lineage II. SPI-6 was found in all strains but three Asian strains in Salmonella Newport lineage II, whereas the three Asian strains carried genomic island SPI6-GI1 at the same locus as SPI-6 in other Salmonella. SPI-6 exhibited 937 SNPs, and phylogenetic analysis demonstrated that clustering of Salmonella Newport isolates was a reflection of their geographic origins. The sequence diversity within SPI-5 and SPI-6 suggests possible recombination events and different virulence potentials of Salmonella Newport. The SNPs could be used as biomarkers during epidemiological investigations.

  19. Effects of Hypergravity on Statocyst Development in Embryonic Aplysia californica

    Science.gov (United States)

    Pedrozo, Hugo A.; Wiederhold, Michael L.

    1994-01-01

    Aplysia californica is a marine gastropod mollusc with bilaterally paired statocysts as gravity-reccptor organs. Data from three experiments in which embryonic Aplysia californica were exposed to 2 x g arc discussed. The experimental groups were exposed to excess gravity until hatching (9-12 day), whereas control groups were maintained at normal gravity. Body diameter was measured before exposure to 2 x g. Statocyst, statolith and body diameter were each determined for samples of 20 embryos from each group on successive days. Exposure to excess gravity led to an increase in body size. Statocyst size was not affected by exposure to 2 x g. Statolith size decreased with treatment as indicated by smaller statolith-to-body ratios observed in the 2 x g group in all three experiments. Mean statolith diameter was significantly smaller for the 2 x g group in Experiment 1 but not in Experiments 2 and 3. Defective statocysts, characterized by very small or no statoliths, were found in the 2 x g group in Experiments 1 and 2.

  20. Neurogenesis of cephalic sensory organs of Aplysia californica.

    Science.gov (United States)

    Wollesen, Tim; Wanninger, Andreas; Klussmann-Kolb, Annette

    2007-11-01

    The opisthobranch gastropod Aplysia californica serves as a model organism in experimental neurobiology because of its simple and well-known nervous system. However, its nervous periphery has been less intensely studied. We have reconstructed the ontogeny of the cephalic sensory organs (labial tentacles, rhinophores, and lip) of planktonic, metamorphic, and juvenile developmental stages. FMRFamide and serotonergic expression patterns have been examined by immunocytochemistry in conjunction with epifluorescence and confocal laser scanning microscopy. We have also applied scanning electron microscopy to analyze the ciliary distribution of these sensory epithelia. Labial tentacles and the lip develop during metamorphosis, whereas rhinophores appear significantly later, in stage 10 juveniles. Our study has revealed immunoreactivity against FMRFamides and serotonin in all major nerves. The common labial nerve develops first, followed by the labial tentacle base nerve, oral nerve, and rhinophoral nerve. We have also identified previously undescribed neuronal pathways and other FMRFamide-like-immunoreactive neuronal elements, such as peripheral ganglia and glomerulus-like structures, and two groups of conspicuous transient FMRFamide-like cell somata. We have further found two distinct populations of FMRFamide-positive cell somata located both subepidermally and in the inner regions of the cephalic sensory organs in juveniles. The latter population partly consists of sensory cells, suggesting an involvement of FMRFamide-like peptides in the modulation of peripheral sensory processes. This study is the first concerning the neurogenesis of cephalic sensory organs in A. californica and may serve as a basis for future studies of neuronal elements in gastropod molluscs.

  1. Phylogenetics and differentiation of Salmonella Newport lineages by whole genome sequencing.

    Directory of Open Access Journals (Sweden)

    Guojie Cao

    Full Text Available Salmonella Newport has ranked in the top three Salmonella serotypes associated with foodborne outbreaks from 1995 to 2011 in the United States. In the current study, we selected 26 S. Newport strains isolated from diverse sources and geographic locations and then conducted 454 shotgun pyrosequencing procedures to obtain 16-24 × coverage of high quality draft genomes for each strain. Comparative genomic analysis of 28 S. Newport strains (including 2 reference genomes and 15 outgroup genomes identified more than 140,000 informative SNPs. A resulting phylogenetic tree consisted of four sublineages and indicated that S. Newport had a clear geographic structure. Strains from Asia were divergent from those from the Americas. Our findings demonstrated that analysis using whole genome sequencing data resulted in a more accurate picture of phylogeny compared to that using single genes or small sets of genes. We selected loci around the mutS gene of S. Newport to differentiate distinct lineages, including those between invH and mutS genes at the 3' end of Salmonella Pathogenicity Island 1 (SPI-1, ste fimbrial operon, and Clustered, Regularly Interspaced, Short Palindromic Repeats (CRISPR associated-proteins (cas. These genes in the outgroup genomes held high similarity with either S. Newport Lineage II or III at the same loci. S. Newport Lineages II and III have different evolutionary histories in this region and our data demonstrated genetic flow and homologous recombination events around mutS. The findings suggested that S. Newport Lineages II and III diverged early in the serotype evolution and have evolved largely independently. Moreover, we identified genes that could delineate sublineages within the phylogenetic tree and that could be used as potential biomarkers for trace-back investigations during outbreaks. Thus, whole genome sequencing data enabled us to better understand the genetic background of pathogenicity and evolutionary history of S

  2. Salmonella Newport omphaloarteritis in a stranded killer whale (Orcinus orca) neonate.

    Science.gov (United States)

    Colegrove, Kathleen M; St Leger, Judy A; Raverty, Stephen; Jang, Spencer; Berman-Kowalewski, Michelle; Gaydos, Joseph K

    2010-10-01

    Salmonella enterica serovar Newport (Salmonella Newport) was isolated from multiple tissues in a neonate killer whale (Orcinus orca) that stranded dead in 2005 along the central coast of California, USA. Necrotizing omphaloarteritis and omphalophlebitis was observed on histologic examination suggesting umbilical infection was the route of entry. Genetic analysis of skin samples indicated that the neonate had an offshore haplotype. Salmonellosis has rarely been identified in free-ranging marine mammals and the significance of Salmonella Newport infection to the health of free-ranging killer whales is currently unknown.

  3. Oficinas de la Newport Beach- California - (EE. UU.

    Directory of Open Access Journals (Sweden)

    William L. Pereira Asociados, Arquitectos e ingenieros

    1974-11-01

    Full Text Available This building that houses the home office of one of the most important Insurance Companies in the country has been constructed in Newport Beach, California. It has seven storeys —two out of which below ground level— and displays a most original architectural design with its facades opening up towards the exterior. Great care has been taken as to the interior decoration, and the layout of almost all the departments, shaped into office landscapes, with movable wall systems, wall - to - wall carpeting consisting of exchangeable squares The aim of this planning is to achieve a maximum of flexibility in the office arrangement, thus providing a possibility to adjust according to the changing needs.Este edificio, que alberga la sede central de una de las Compañías de Seguros más importantes del país, ha sido construido en Newport Beach, California. Cuenta con siete plantas —dos de ellas por debajo del nivel del suelo— y presenta una original fisonomía con sus fachadas abriéndose hacia el exterior. Ha sido muy cuidada la decoración interior, el patio central con su columna ornamental y la disposición de casi todos los departamentos, tratados como oficinas-paisaje, a base de tabiquería móvil, moquetas despiezables, etc., destinado todo ello a lograr la máxima y más fácil flexibilidad de distribución, según las necesidades de cada momento.

  4. First case of synophthalmia and albinism in the Pacific angel shark Squatina californica.

    Science.gov (United States)

    Escobar-Sánchez, O; Moreno-Sánchez, X G; Aguilar-Cruz, C A; Abitia-Cárdenas, L A

    2014-08-01

    The first record in Mexican waters of albinism and synophthalmia (partial cyclopia) in the Pacific angel shark, Squatina californica is presented. Albinism is not lethal, but synophthalmia may cause the death of the individual immediately after birth.

  5. Sampling Buprestidae (Coleoptera in Washington state with Cerceris californica Cresson (Hymenoptera, Crabronidae

    Directory of Open Access Journals (Sweden)

    Chris Looney

    2014-09-01

    Full Text Available The beetle-hunting habits of ground nesting wasps in the genus Cerceris Latreille have been recently exploited as a survey technique for exotic and native Buprestidae, particularly Agrilus planipennis Fairmaire (the emerald ash-borer. While such methods have been developed for the wide-ranging eastern Cerceris fumipennis Say, the survey potential of western buprestid-hunting Cerceris spp. has not been explored. Cerceris californica Cresson is the most well-studied of the western buprestid feeders, and the only one known to occur in Washington state. Here we report the results of surveys conducted in Washington in 2012–2013 for C. californica colonies, and numbers of buprestid beetles collected from monitored colonies. Eight C. californica colonies were found through visual search of 228 baseball fields and sandy clearings, but only four were large enough to monitor. Fifty-four beetles were recovered from the four colonies, comprising five native species. Four of these are new prey records for C. californica, and one (Chrysobothris quadriimpressa Gory & Laporte is newly recorded from Washington. Cerceris californica colonies do not appear to be large or common enough in Washington to be a significant exotic buprestid survey strategy. However, even the limited monitoring resulted in more buprestid captures than nearby purple sticky traps, and monitoring C. californica nests may be a locally useful supplement for general buprestid surveys.

  6. STcontrol and NEWPORT Motion Controller Model ESP 301 Device

    CERN Document Server

    Kapanadze, Giorgi

    2015-01-01

    Pixel detectors are used to detect particle tracks in LHC experiments. This kind of detectors are built with silicon semiconductor diodes. Ionizing particles create charge in the diode and the reverse bias voltage creates electric field in the diode which causes effective charge collection by the drift of electrons [1]. One of the main parameter of tracker detectors is efficiency. The efficiency as a function of position in the pixel matrix can be evaluated by scanning the matrix with red and infrared lasers. It is important to know what is happening between pixels in terms of efficiency. We perform these measurements to test new type of pixel detectors for the LHC future upgrade in 2023. New type of detectors are needed because the radiation level will be much higher [2]. For the measurements we need to control a stage motion controller (NEWPORT Motion Controller Model ESP 301) with the existing software STcontrol, which is used for readout data from pixel detectors and to control other devices like the lase...

  7. Regulation of statoconia mineralization in Aplysia californica in vitro

    Science.gov (United States)

    Pedrozo, H. A.; Schwartz, Z.; Dean, D. D.; Wiederhold, M. L.; Boyan, B. D.

    1996-01-01

    Statoconia are calcium carbonate inclusions in the lumen of the gravity-sensing organ, the statocyst, of Aplysia californica. The aim of the present study was to examine the role of carbonic anhydrase and urease in statoconia mineralization in vitro. The experiments were performed using a previously described culture system (Pedrozo et al., J. Comp. Physiol. (A) 177:415-425). Inhibition of carbonic anhydrase by acetazolamide decreased statoconia production and volume, while inhibition of urease by acetohydroxamic acid reduced total statoconia number, but had no affect on statoconia volume. Inhibition of carbonic anhydrase initially increased and then decreased the statocyst pH, whereas inhibition of urease decreased statocyst pH at all times examined; simultaneous addition of both inhibitors also decreased pH. These effects were dose and time dependent. The results show that carbonic anhydrase and urease are required for statoconia formation and homeostasis, and for regulation of statocyst pH. This suggests that these two enzymes regulate mineralization at least partially through regulation of statocyst pH.

  8. Targeted oxidation of Torpedo californica acetylcholinesterase by singlet oxygen.

    Science.gov (United States)

    Weiner, Lev; Roth, Esther; Silman, Israel

    2011-01-01

    The photosensitizer, methylene blue (MB), is a strong reversible inhibitor of Torpedo californica acetylcholinesterase (AChE) in the dark. Under illumination it causes irreversible inactivation. Loss of fluorescence of the singlet oxygen ((1)O(2)) trap, 9,10-dimethylanthracene, was retarded in the presence of AChE, and the rate of photo-inactivation was increased in the presence of D(2)O, indicating that inactivation was due to (1)O(2) generated by the photosensitizer. CD revealed slightly reduced far-UV ellipticity, and slightly enhanced binding of an amphiphilic probe, indicating limited unfolding of the photo-oxidized AChE. However, both near-UV ellipticity and intrinsic fluorescence were markedly reduced, suggesting photo-oxidative damage to tryptophans, (Trp) supported by appearance of novel emission peaks ascribed to N'-formylkynurenine and/or kynurenine. Like other partially unfolded forms, the photo-oxidized AChE was sensitive to proteolysis. Photosensitized inactivation produced exclusively chemically cross-linked dimers, whereas irradiation of a partially unfolded state generated higher-order oligomers. The active-site gorge of AChE contains Trp in inhibitor-binding sites that might be targets for photo-oxidation. Indeed, reversible inhibitors retard photo-inactivation, and photo-inactivation destroys their binding sites. An excess of AChE protects paraoxonase from photo-inactivation by sequestering the photosensitizer. Affinity photo-oxidation of AChE by MB thus provides a valuable model for studying site-specific photo-inactivation of enzymes in both fundamental and clinical contexts. © 2010 The Authors. Photochemistry and Photobiology © 2010 The American Society of Photobiology.

  9. On the origin of the polyhedral protein of the nuclear polyhedrosis virus of Autographa californica

    NARCIS (Netherlands)

    Beek, van der C.P.

    1980-01-01

    The purpose of this study was to investigate the origin of the polyhedral protein of the nuclear polyhedrosis virus of the alfalfa looper, Autographa californica (AcNPV), one of the best characterized viruses of the family Baculoviridae. The present knowledge of the

  10. Modulation of CYPs, P-gp, and PXR by Eschscholzia californica (California poppy) and its alkaloids

    Science.gov (United States)

    Eschscholzia californica Cham., a native US plant, is traditionally used as a sedative, analgesic and anxiolytic herb. With the rapid rise in the use of herbal supplements together with over the counter (OTC) and prescription drugs, the risk for potential herb-drug interactions is also increasing. M...

  11. Composition of Pteryxia terebinthina var. californica (Coult. and Rose) Mathias essential oils

    Science.gov (United States)

    Beauchamp, Philip E.; Dev, Vasu; Munevar-Mendoza, Elsa; Moore, Peggy E.

    2000-01-01

    β-Pinene (35.0%, 53.8%) was the major component of both the aerial parts and the root oils of Pteryxia terebinthina var. californica, respectively. β-Phellandrene (12.2%) was the other most abundant component of the oil from aeial parts while δ-3-carene (14.2%) was the second abundant component of the root oil.

  12. Hybridization of cultivated Vitis vinifera with wild V. californica and V. girdiana in California

    Science.gov (United States)

    The native wild grape species of northern California, Vitis californica Benth. (California wild grape), and V. girdiana Munson (desert wild grape) in southern California are under increasing pressure from loss of habitat and from interbreeding with the domesticated grapevine, V. vinifera L. For its...

  13. Complete Sequences of Six IncA/C Plasmids of Multidrug-Resistant Salmonella enterica subsp. enterica Serotype Newport.

    Science.gov (United States)

    Cao, Guojie; Allard, Marc W; Hoffmann, Maria; Monday, Steven R; Muruvanda, Tim; Luo, Yan; Payne, Justin; Rump, Lydia; Meng, Kevin; Zhao, Shaohua; McDermott, Patrick F; Brown, Eric W; Meng, Jianghong

    2015-02-26

    Multidrug-resistant (MDR) Salmonella enterica subsp. enterica serotype Newport has been a long-standing public health concern in the United States. We present the complete sequences of six IncA/C plasmids from animal-derived MDR S. Newport ranging from 80.1 to 158.5 kb. They shared a genetic backbone with S. Newport IncA/C plasmids pSN254 and pAM04528. Copyright © 2015 Cao et al.

  14. Mercury Concentrations in Pacific Angel Sharks (Squatina californica) and Prey Fishes from Southern Gulf of California, Mexico.

    Science.gov (United States)

    Escobar-Sánchez, O; Ruelas-Inzunza, J; Moreno-Sánchez, X G; Romo-Piñera, A K; Frías-Espericueta, M G

    2016-01-01

    Concentrations of mercury (Hg) were quantified in muscle tissues of the Pacific angel shark, Squatina californica sampled from Southern Gulf of California, Mexico, considering total length, sex, diet and the dietary risk assessment. High Hg levels are typically associated with carnivorous fishes, however S. californica showed low Hg concentrations (shark (p > 0.05). Hg concentrations were highest in the darkedge mishipman: Porichthys analis (0.14 ± 0.08 µg g(-1)) and red-eye round herring Etrumeus teres (0.13 ± 0.05 µg g(-1)) relative to other prey species, which could suggest that Hg concentrations in S. californica were influenced by these species. Given the relatively low concentration of Hg across age-classes and sex, consumption of S. californica's muscle tissue poses limited risk to humans.

  15. Molecular detection assay of five Salmonella serotypes of public interest: Typhimurium, Enteritidis, Newport, Heidelberg, and Hadar.

    Science.gov (United States)

    Bugarel, M; Tudor, A; Loneragan, G H; Nightingale, K K

    2017-03-01

    Foodborne illnesses due to Salmonella represent an important public-health concern worldwide. In the United States, a majority of Salmonella infections are associated with a small number of serotypes. Furthermore, some serotypes that are overrepresented among human disease are also associated with multi-drug resistance phenotypes. Rapid detection of serotypes of public-health concern might help reduce the burden of salmonellosis cases and limit exposure to multi-drug resistant Salmonella. We developed a two-step real-time PCR-based rapid method for the identification and detection of five Salmonella serotypes that are either overrepresented in human disease or frequently associated with multi-drug resistance, including serotypes Enteritidis, Typhimurium, Newport, Hadar, and Heidelberg. Two sets of four markers were developed to detect and differentiate the five serotypes. The first set of markers was developed as a screening step to detect the five serotypes; whereas, the second set was used to further distinguish serotypes Heidelberg, Newport and Hadar. The utilization of these markers on a two-step investigation strategy provides a diagnostic specificity of 97% for the detection of Typhimurium, Enteritidis, Heidelberg, Infantis, Newport and Hadar. The diagnostic sensitivity of the detection makers is >96%. The availability of this two-step rapid method will facilitate specific detection of Salmonella serotypes that contribute to a significant proportion of human disease and carry antimicrobial resistance.

  16. Storage Effect on Phenols and on the Antioxidant Activity of Extracts from Anemopsis californica and Inhibition of Elastase Enzyme

    Directory of Open Access Journals (Sweden)

    Carmen Lizette Del-Toro-Sánchez

    2015-01-01

    Full Text Available The amount of total phenols and flavonoids and the antioxidant activity of leaf, stem, and rhizome methanolic extracts from a commonly consumed Anemopsis californica under different storage conditions were investigated. Storage conditions were at 50, 25, 4, and −20°C, protected or not from light, during 180 days. The inhibition of the elastase enzyme was also evaluated. The results demonstrated that leaf, stem, and rhizome methanolic extracts of Anemopsis californica maintain approximately up to 97 and 95% stability in phenolic content and antioxidant activity, respectively, when stored during 60 days at −20°C in the dark. Additionally, these extracts, principally from leaf and rhizome, showed an elastase inhibitory effect by 75 and 71.8%, respectively. Therefore, this study provides the basis for further research on the anti-inflammatory activity. On the other hand, Anemopsis californica could comprise a good alternative of use as antioxidant in foods.

  17. Survival of Salmonella Newport on Whole and Fresh-Cut Cucumbers Treated with Lytic Bacteriophages.

    Science.gov (United States)

    Sharma, Manan; Dashiell, Gwendolyn; Handy, Eric T; East, Cheryl; Reynnells, Russell; White, Chanelle; Nyarko, Esmond; Micallef, Shirley; Hashem, Fawzy; Millner, Patricia D

    2017-04-01

    Salmonella enterica associated with consumption of cucumbers ( Cucumis sativus ) has led to foodborne outbreaks in the United States. Whole and fresh-cut cucumbers are susceptible to S. enterica contamination during growing, harvesting, and postharvest handling. The application of lytic bacteriophages specific for S. enterica was evaluated to reduce Salmonella populations on cucumbers. Unwaxed cucumbers ('Lisboa' variety, or mini-cucumbers purchased at retail) were inoculated with Salmonella Newport (5 log CFU per cucumber) and were sprayed with 3.2 mL of phosphate-buffered saline (control) or 10 log PFU/ml of SalmoFresh, a Salmonella-specific bacteriophage preparation (phage), to deliver 4.76 × 10(7) PFU/cm(2). Cucumbers were stored at 10 or 22°C for 7 days. Inoculated mini-cucumbers were sliced with a sterile knife to investigate Salmonella transfer to mesocarp, and cut pieces were stored at 4°C for 2 days. Populations (log CFU per cucumber) of Salmonella Newport on phage-treated whole cucumbers were significantly (P cucumbers (4.27 ± 0.37) on day 0. Populations on phage-treated cucumbers stored at 10°C were 1.72 ± 0.77 and 1.56 ± 0.46, which were significantly lower than those on control-treated cucumbers (3.20 ± 0.48 and 2.33 ± 0.25) on days 1 and 4, respectively. Between days 0 and 1, populations on control-treated cucumbers stored at 10 and 22°C declined by 1.07 and 2.47 log CFU per cucumber, respectively. At 22°C, Salmonella Newport populations declined by 2.37 log CFU per cucumber between days 0 and 1. Phage application to whole cucumbers before slicing did not reduce the transfer of Salmonella Newport to fresh-cut slices. Lytic phage application may be a potential intervention to reduce Salmonella populations on whole cucumbers.

  18. Modulation of CYPs, P-gp, and PXR by Eschscholzia californica (California Poppy) and Its Alkaloids.

    Science.gov (United States)

    Manda, Vamshi K; Ibrahim, Mohamed A; Dale, Olivia R; Kumarihamy, Mallika; Cutler, Stephen J; Khan, Ikhlas A; Walker, Larry A; Muhammad, Ilias; Khan, Shabana I

    2016-04-01

    Eschscholzia californica, a native US plant, is traditionally used as a sedative, analgesic, and anxiolytic herb. With the rapid rise in the use of herbal supplements together with over-the-counter and prescription drugs, the risk for potential herb-drug interactions is also increasing. Most of the clinically relevant pharmacokinetic drug interactions occur due to modulation of cytochrome P450 enzymes (CYPs), P-glycoprotein, and the pregnane X receptor by concomitantly used herbs. This study aimed to determine the effects of an EtOH extract, aqueous extract (tea), basic CHCl3 fractions, and isolated major alkaloids, namely protopine (1), escholtzine (2), allocryptopine (3), and californidine (4), of E. californica on the activity of cytochrome P450s, P-glycoprotein and the pregnane X receptor. The EtOH extract and fractions showed strong time-dependent inhibition of CYP 3A4, CYP 2C9, and CYP 2C19, and reversible inhibition of CYP 2D6. Among the alkaloids, escholtzine (2) and allocryptopine (3) exhibited time-dependent inhibition of CYP 3A4, CYP 2C9, and CYP 2C19 (IC50 shift ratio > 2), while protopine (1) and allocryptopine (3) showed reversible inhibition of CYP 2D6 enzyme. A significant activation of the pregnane X receptor (> 2-fold) was observed with the EtOH extract, basic CHCl3 fraction, and alkaloids (except protopine), which resulted into an increased expression of mRNA and the activity of CYP 3A4 and CYP 1A2. The expression of P-glycoprotein was unaffected. However, aqueous extract (tea) and its main alkaloid californidine (4) did not affect cytochrome P450s, P-glycoprotein, or the pregnane X receptor. This data suggests that EtOH extract of E. californica and its major alkaloids have a potential of causing interactions with drugs that are metabolized by cytochrome P450s, while the tea seems to be safer.

  19. Localization and functional characterization of a novel adipokinetic hormone in the mollusk, Aplysia californica.

    Directory of Open Access Journals (Sweden)

    Joshua I Johnson

    Full Text Available Increasing evidence suggests that gonadotropin-releasing hormone (GnRH, corazonin, adipokinetic hormone (AKH, and red pigment-concentrating hormone all share common ancestry to form a GnRH superfamily. Despite the wide presence of these peptides in protostomes, their biological effects remain poorly characterized in many taxa. This study had three goals. First, we cloned the full-length sequence of a novel AKH, termed Aplysia-AKH, and examined its distribution in an opisthobranch mollusk, Aplysia californica. Second, we investigated in vivo biological effects of Aplysia-AKH. Lastly, we compared the effects of Aplysia-AKH to a related A. californica peptide, Aplysia-GnRH. Results suggest that Aplysia-AKH mRNA and peptide are localized exclusively in central tissues, with abdominal, cerebral, and pleural ganglia being the primary sites of Aplysia-AKH production. However, Aplysia-AKH-positive fibers were found in all central ganglia, suggesting diverse neuromodulatory roles. Injections of A. californica with Aplysia-AKH significantly inhibited feeding, reduced body mass, increased excretion of feces, and reduced gonadal mass and oocyte diameter. The in vivo effects of Aplysia-AKH differed substantially from Aplysia-GnRH. Overall, the distribution and biological effects of Aplysia-AKH suggest it has diverged functionally from Aplysia-GnRH over the course of evolution. Further, that both Aplysia-AKH and Aplysia-GnRH failed to activate reproduction suggest the critical role of GnRH as a reproductive activator may be a phenomenon unique to vertebrates.

  20. Localization and Functional Characterization of a Novel Adipokinetic Hormone in the Mollusk, Aplysia californica

    Science.gov (United States)

    Johnson, Joshua I.; Kavanaugh, Scott I.; Nguyen, Cindy; Tsai, Pei-San

    2014-01-01

    Increasing evidence suggests that gonadotropin-releasing hormone (GnRH), corazonin, adipokinetic hormone (AKH), and red pigment-concentrating hormone all share common ancestry to form a GnRH superfamily. Despite the wide presence of these peptides in protostomes, their biological effects remain poorly characterized in many taxa. This study had three goals. First, we cloned the full-length sequence of a novel AKH, termed Aplysia-AKH, and examined its distribution in an opisthobranch mollusk, Aplysia californica. Second, we investigated in vivo biological effects of Aplysia-AKH. Lastly, we compared the effects of Aplysia-AKH to a related A. californica peptide, Aplysia-GnRH. Results suggest that Aplysia-AKH mRNA and peptide are localized exclusively in central tissues, with abdominal, cerebral, and pleural ganglia being the primary sites of Aplysia-AKH production. However, Aplysia-AKH-positive fibers were found in all central ganglia, suggesting diverse neuromodulatory roles. Injections of A. californica with Aplysia-AKH significantly inhibited feeding, reduced body mass, increased excretion of feces, and reduced gonadal mass and oocyte diameter. The in vivo effects of Aplysia-AKH differed substantially from Aplysia-GnRH. Overall, the distribution and biological effects of Aplysia-AKH suggest it has diverged functionally from Aplysia-GnRH over the course of evolution. Further, that both Aplysia-AKH and Aplysia-GnRH failed to activate reproduction suggest the critical role of GnRH as a reproductive activator may be a phenomenon unique to vertebrates. PMID:25162698

  1. Effectiveness of cleaners and sanitizers in killing Salmonella Newport in the gut of a free-living nematode, Caenorhabditis elegans.

    Science.gov (United States)

    Kenney, Stephen J; Anderson, Gary L; Williams, Phillip L; Millner, Patricia D; Beuchat, Larry R

    2004-10-01

    Caenorhabditis elegans, a free-living nematode found in soil, has been shown to ingest human enteric pathogens, thereby potentially serving as a vector for preharvest contamination of fruits and vegetables. A study was undertaken to evaluate the efficacy of cleaners and sanitizers in killing Salmonella enterica serotype Newport in the gut of C. elegans. Adult worms were fed nalidixic acid-adapted cells of Escherichia coli OP50 (control) or Salmonella Newport for 24 h, washed, placed on paper discs, and incubated at temperatures of 4 or 20 degrees C and relative humidities of 33 or 98% for 24 h. Two commercial cleaners (Enforce and K Foam Lo) and four sanitizers (2% acetic acid, 2% lactic acid, Sanova, and chlorine [50 and 200 microg/ml]) were applied to worms for 0, 2, or 10 min. Populations of E. coli and Salmonella Newport (CFU per worm) in untreated and treated worms were determined by sonicating worms in 0.1% peptone and surface plating suspensions of released cells on tryptic soy agar containing nalidixic acid. Populations of Salmonella Newport in worms exposed to 33 or 98% relative humidity at 4 degrees or 33% relative humidity at 20 degrees C were significantly (P < or = 0.05) lower than the number surviving exposure to 98% relative humidity at 20 degrees C. In general, treatment of desiccated worms with cleaners and sanitizers was effective in significantly (P < or = 0.05) reducing the number of ingested Salmonella Newport. Results indicate that temperature and relative humidity influence the survival of Salmonella Newport in the gut of C. elegans, and cleaners and sanitizers may not eliminate the pathogen.

  2. Feasibility Study of Economics and Performance of Wind Turbine Generators at the Newport Indiana Chemical Depot Site

    Energy Technology Data Exchange (ETDEWEB)

    Roberts, Joseph Owen [National Renewable Energy Lab. (NREL), Golden, CO (United States); Mosey, Gail [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2013-11-01

    The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Newport Indiana Chemical Depot site in Newport, Indiana, for a feasibility study of renewable energy production. The National Renewable Energy Laboratory (NREL) was contacted to provide technical assistance for this project. The purpose of this report is to assess the sitefor possible wind turbine electrical generator installation and estimate the cost, performance, and site impacts of different wind energy options. In addition, the report recommends financing options that could assist in the implementation of a wind system at the site.

  3. Outbreak of Salmonella Newport infections linked to cucumbers--United States, 2014.

    Science.gov (United States)

    Angelo, Kristina M; Chu, Alvina; Anand, Madhu; Nguyen, Thai-An; Bottichio, Lyndsay; Wise, Matthew; Williams, Ian; Seelman, Sharon; Bell, Rebecca; Fatica, Marianne; Lance, Susan; Baldwin, Deanna; Shannon, Kyle; Lee, Hannah; Trees, Eija; Strain, Errol; Gieraltowski, Laura

    2015-02-20

    In August 2014, PulseNet, the national molecular subtyping network for foodborne disease surveillance, detected a multistate cluster of Salmonella enterica serotype Newport infections with an indistinguishable pulse-field gel electrophoresis (PFGE) pattern (XbaI PFGE pattern JJPX01.0061). Outbreaks of illnesses associated with this PFGE pattern have previously been linked to consumption of tomatoes harvested from Virginia's Eastern Shore in the Delmarva region and have not been linked to cucumbers or other produce items. To identify the contaminated food and find the source of the contamination, CDC, state and local health and agriculture departments and laboratories, and the Food and Drug Administration (FDA) conducted epidemiologic, traceback, and laboratory investigations. A total of 275 patients in 29 states and the District of Columbia were identified, with illness onsets occurring during May 20-September 30, 2014. Whole genome sequencing (WGS), a highly discriminating subtyping method, was used to further characterize PFGE pattern JJPX01.0061 isolates. Epidemiologic, microbiologic, and product traceback evidence suggests that cucumbers were a source of Salmonella Newport infections in this outbreak. The epidemiologic link to a novel outbreak vehicle suggests an environmental reservoir for Salmonella in the Delmarva region that should be identified and mitigated to prevent future outbreaks.

  4. Antimutagenicity of Methanolic Extracts from Anemopsis californica in Relation to Their Antioxidant Activity

    Directory of Open Access Journals (Sweden)

    Carmen Lizette Del-Toro-Sánchez

    2014-01-01

    Full Text Available Anemopsis californica has been used empirically to treat infectious diseases. However, there are no antimutagenic evaluation reports on this plant. The present study evaluated the antioxidant activity in relation to the mutagenic and antimutagenic activity properties of leaf (LME and stem (SME methanolic extracts of A. californica collected in the central Mexican state of Querétaro. Antioxidant properties and total phenols of extracts were evaluated using DPPH (1,1-diphenyl-2-picrylhydrazyl and Folin-Ciocalteu methods, respectively. Mutagenicity was evaluated using the Ames test employing Salmonella enterica serovar Typhimurium strains (TA98, TA100, and TA102, with and without an aroclor 1254 (S9 mixture. Antimutagenesis was performed against mutations induced on the Ames test with MNNG, 2AA, or 4NQO. SME presented the highest antioxidant capacity and total phenolic content. None of the extracts exhibited mutagenicity in the Ames test. The extracts produced a significant reduction in 2AA-induced mutations in S. typhimurium TA98. In both extracts, mutagenesis induced by 4NQO or methyl-N′-nitro-N-nitrosoguanidine (MNNG was reduced only if the exposure of strains was <10 μg/Petri dish. A. californca antioxidant properties and its capacity to reduce point mutations render it suitable to enhance medical cancer treatments. The significant effect against antimutagenic 2AA suggests that their consumption would provide protection against carcinogenic polycyclic aromatic compounds.

  5. Antimutagenicity of Methanolic Extracts from Anemopsis californica in Relation to Their Antioxidant Activity

    Science.gov (United States)

    Del-Toro-Sánchez, Carmen Lizette; Bautista-Bautista, Nereyda; Blasco-Cabal, José Luis; Gonzalez-Ávila, Marisela; Gutiérrez-Lomelí, Melesio; Arriaga-Alba, Myriam

    2014-01-01

    Anemopsis californica has been used empirically to treat infectious diseases. However, there are no antimutagenic evaluation reports on this plant. The present study evaluated the antioxidant activity in relation to the mutagenic and antimutagenic activity properties of leaf (LME) and stem (SME) methanolic extracts of A. californica collected in the central Mexican state of Querétaro. Antioxidant properties and total phenols of extracts were evaluated using DPPH (1,1-diphenyl-2-picrylhydrazyl) and Folin-Ciocalteu methods, respectively. Mutagenicity was evaluated using the Ames test employing Salmonella enterica serovar Typhimurium strains (TA98, TA100, and TA102), with and without an aroclor 1254 (S9 mixture). Antimutagenesis was performed against mutations induced on the Ames test with MNNG, 2AA, or 4NQO. SME presented the highest antioxidant capacity and total phenolic content. None of the extracts exhibited mutagenicity in the Ames test. The extracts produced a significant reduction in 2AA-induced mutations in S. typhimurium TA98. In both extracts, mutagenesis induced by 4NQO or methyl-N′-nitro-N-nitrosoguanidine (MNNG) was reduced only if the exposure of strains was <10 μg/Petri dish. A. californca antioxidant properties and its capacity to reduce point mutations render it suitable to enhance medical cancer treatments. The significant effect against antimutagenic 2AA suggests that their consumption would provide protection against carcinogenic polycyclic aromatic compounds. PMID:25152760

  6. Behavioural effects of the American traditional plant Eschscholzia californica: sedative and anxiolytic properties.

    Science.gov (United States)

    Rolland, A; Fleurentin, J; Lanhers, M C; Younos, C; Misslin, R; Mortier, F; Pelt, J M

    1991-06-01

    Eschsholzia californica Cham. is a traditional medicinal plant of the Indians used by the rural population of California for its analgesic and sedative properties. Our study on the aqueous extract shows that this plant reduced the behavioural parameters measured in a familiar environment test in mice (novelty preference, locomotion and rearings in two compartments test) at doses above 100 mg/kg and in non-familiar environment tests (staircase test) at doses above 200 mg/kg. This finding validates its traditional sedative properties confirmed by the sleeping induction at doses above 100 mg/kg. Furthermore, when administered at a dose a of 25 mg/kg, E. californica appeared to also have an anxiolytic action since it produced an increase of the number of steps climbed by mice in the staircase test (anticonflict effect) and that of the time spent by animals in the lit box when they were confronted with the light/dark choice situation. Before evaluation of the behavioural effects, it was verified that our aqueous extract did not induce any toxic effect when administered i.p. and p.o.

  7. Betabaculovirus F proteins showed different efficiencies when rescuing the infectivity of gp64-null Autographa californica nucleopolyhedrovirus

    NARCIS (Netherlands)

    Yin, F.; Wang, M.; Ying, T.; Deng, F.; Vlak, J.M.; Hu, Z.; Wang, H.

    2013-01-01

    The Agrotis segetum granulovirus (AgseGV) F protein was previously identified as the first betabaculovirus F protein with functional homology to Autographa californica nucleopolyhedrovirus (AcMNPV) GP64. In the current study, F proteins from Xestia c-nigrum granulovirus (XecnGV), Cydia pomonella gra

  8. Factors influencing Phytophthora ramorum infectivity on Umbellularia californica and testing of a defoliation-based control method

    Science.gov (United States)

    Christine Windsor Colijn; Michael Cohen; Steve Johnston; Whalen Dillon; Nathan Rank

    2013-01-01

    The primary foliar host for Phytophthora ramorum is California bay laurel, Umbellularia californica (Hook. & Arn.) Nutt., a main reservoir for the pathogen in California woodlands. We investigated environmental and pathogen-mediated influences on incidence and severity of P. ramorum infection of

  9. An outbreak of Salmonella Newport associated with mung bean sprouts in Germany and the Netherlands, October to November 2011.

    Science.gov (United States)

    Bayer, C; Bernard, H; Prager, R; Rabsch, W; Hiller, P; Malorny, B; Pfefferkorn, B; Frank, C; de Jong, A; Friesema, I; Stark, K; Rosner, Bm

    2014-01-09

    The largest Salmonella enterica serovar Newport outbreak (n=106) ever reported in Germany occurred in October and November 2011. Twenty associated cases were reported in the Netherlands. The outbreak investigation included an analytical epidemiological study, molecular typing of human and food isolates and food traceback investigations. Unspecified Salmonella had been detected in samples of mung bean sprouts at a sprout producer (producer A) in the Netherlands and mung bean sprouts contaminated with S. Newport had been found during routine sampling at a sprout distributor in Germany. Therefore, we tested the hypothesis of sprouts being the infection vehicle. In a case-control study, we compared 50 notified adult S. Newport cases with 45 Salmonella enterica serovar Enteritidis cases regarding their food consumption in the three days before illness. In multivariable logistic regression analysis, only sprout consumption was significantly associated with S. Newport infection (odds ratio: 18.4; 95% confidence interval: 2.2-150.2). Molecular typing patterns of human isolates were indistinguishable from a mung bean sprouts isolate. Traceback of sprouts led to distributors and producer A in the Netherlands. Since sprouts are frequently contaminated with microorganisms, consumers need to be aware that consumption of raw or insufficiently cooked sprouts may pose a health risk.

  10. An institutional outbreak of Salmonellosis due to lactose-fermenting Salmonella newport.

    Science.gov (United States)

    Anand, C M; Finlayson, M C; Garson, J Z; Larson, M L

    1980-11-01

    An institutional outbreak of salmonellosis predominantly due to a lactose-fermenting Salmonella newport is described. Control of the outbreak was hampered by delay in the initial recognition of the aberrant strain. On primary culture, salmonellae were detected on bismuth sulfite agar only; colonies that formed on MacConkey agar and Salmonella-Shigella agar could not be differentiated from lactose-fermenting nonpathogenic organisms. The reactions in triple sugar iron were atypical for Salmonella. The lactose-fermenting property was plasmid-mediated and was readily transferable. Phage typing suggested chicken as a possible source of the strain. The need for awareness of the occurrence of such strains of Salmonella that may not be recognized by cultural procedures in common use, the necessity of the routine use of bismuth sulfite agar in procedures for isolation of salmonellae, and the use of lysine iron agar in conjunction with the triple sugar iron agar are emphasized.

  11. Root internalization, transport and in-planta survival of Salmonella enterica serovar Newport in sweet basil.

    Science.gov (United States)

    Gorbatsevich, Elena; Sela Saldinger, Shlomo; Pinto, Riky; Bernstein, Nirit

    2013-02-01

    It is now acknowledged that food-borne pathogens present in the irrigation water or soil can become associated with crop plants in the field, penetrate internal plant tissues via the root, translocate and survive inside plants. Only little information is available concerning interaction between enteric pathogens and plants. The present study evaluated the potential for contamination of the aromatic plant, sweet basil during cultivation, by Salmonella enterica serovar Newport. Root internalization was plant-age-dependent, with the highest susceptibility occurring at the beginning of the rapid growth phase of the root. Higher incidence of internalization was detected in vegetative than reproductive plant organs, pointing at bacterial transport in the transpiration stream. Internalized Salmonella survived only basil.

  12. Biosynthesis of the Torpedo californica Acetylcholine Receptor α Subunit in Yeast

    Science.gov (United States)

    Fujita, Norihisa; Nelson, Nathan; Fox, Thomas D.; Claudio, Toni; Lindstrom, Jon; Riezman, Howard; Hess, George P.

    1986-03-01

    Yeast cells were transformed with a plasmid containing complementary DNA encoding the α subunit of the Torpedo californica acetylcholine receptor. These cells synthesized a protein that had the expected molecular weight, antigenic specificity, and ligand-binding properties of the α subunit. The subunit was inserted into the yeast plasma membrane, demonstrating that yeast has the apparatus to express a membrane-bound receptor protein and to insert such a foreign protein into its plasma membrane. The α subunit constituted approximately 1 percent of the total yeast membrane proteins, and its density was about the same in the plasma membrane of yeast and in the receptor-rich electric organ of Electrophorus electricus. In view of the available technology for obtaining large quantities of yeast proteins, it may now be possible to obtain amplified amounts of interesting membrane-bound proteins for physical and biochemical studies.

  13. Reduced expression of Autographa californica nucleopolyhedrovirus ORF34, an essential gene, enhances heterologous gene expression

    Energy Technology Data Exchange (ETDEWEB)

    Salem, Tamer Z. [Department of Entomology, Michigan State University, East Lansing, MI 48824 (United States); Department of Microbial Molecular Biology, AGERI, Agricultural Research Center, Giza 12619 (Egypt); Division of Biomedical Sciences, Zewail University, Zewail City of Science and Technology, Giza 12588 (Egypt); Zhang, Fengrui [Department of Entomology, Michigan State University, East Lansing, MI 48824 (United States); Thiem, Suzanne M., E-mail: smthiem@msu.edu [Department of Entomology, Michigan State University, East Lansing, MI 48824 (United States); Department of Microbiology and Molecular Genetics, Michigan State University, East Lansing, MI 48824 (United States)

    2013-01-20

    Autographa californica multiple nucleopolyhedrovirus ORF34 is part of a transcriptional unit that includes ORF32, encoding a viral fibroblast growth factor (FGF) and ORF33. We identified ORF34 as a candidate for deletion to improve protein expression in the baculovirus expression system based on enhanced reporter gene expression in an RNAi screen of virus genes. However, ORF34 was shown to be an essential gene. To explore ORF34 function, deletion (KO34) and rescue bacmids were constructed and characterized. Infection did not spread from primary KO34 transfected cells and supernatants from KO34 transfected cells could not infect fresh Sf21 cells whereas the supernatant from the rescue bacmids transfection could recover the infection. In addition, budded viruses were not observed in KO34 transfected cells by electron microscopy, nor were viral proteins detected from the transfection supernatants by western blots. These demonstrate that ORF34 is an essential gene with a possible role in infectious virus production.

  14. Aging in Sensory and Motor Neurons Results in Learning Failure in Aplysia californica.

    Directory of Open Access Journals (Sweden)

    Andrew T Kempsell

    Full Text Available The physiological and molecular mechanisms of age-related memory loss are complicated by the complexity of vertebrate nervous systems. This study takes advantage of a simple neural model to investigate nervous system aging, focusing on changes in learning and memory in the form of behavioral sensitization in vivo and synaptic facilitation in vitro. The effect of aging on the tail withdrawal reflex (TWR was studied in Aplysia californica at maturity and late in the annual lifecycle. We found that short-term sensitization in TWR was absent in aged Aplysia. This implied that the neuronal machinery governing nonassociative learning was compromised during aging. Synaptic plasticity in the form of short-term facilitation between tail sensory and motor neurons decreased during aging whether the sensitizing stimulus was tail shock or the heterosynaptic modulator serotonin (5-HT. Together, these results suggest that the cellular mechanisms governing behavioral sensitization are compromised during aging, thereby nearly eliminating sensitization in aged Aplysia.

  15. Number of conspecifics and reproduction in the invasive plant Eschscholzia californica (Papaveraceae): is there a pollinator-mediated Allee effect?

    Science.gov (United States)

    Anic, V; Henríquez, C A; Abades, S R; Bustamante, R O

    2015-05-01

    The component Allee effect has been defined as 'a positive relationship between any measure of individual fitness and the number or density of conspecifics'. Larger plant populations or large patches have shown a higher pollinator visitation rate, which may give rise to an Allee effect in reproduction of the plants. We experimentally tested the effect of number of conspecifics on reproduction and pollinator visitation in Eschscholzia californica Cham., an invasive plant in Chile. We then built patches with two, eight and 16 flowering individuals of E. californica (11 replicates per treatment) in an area characterised by dominance of the study species. We found that E. californica exhibits a component Allee effect, as the number of individuals of this species has a positive effect on individual seed set. However, individual fruit production was not affected by the number of plants examined. Pollinator visitation rate was also independent of the number of plants, so this factor would not explain the Allee effect. This rate was positively correlated with the total number of flowers in the patches. We also found that the number of plants did not affect the seed mass or proportion of germinated seeds in the patches. Higher pollen availability in patches with 16 plants and pollination by wind could explain the Allee effect. The component Allee effect identified could lead to a weak demographic Allee effect that might reduce the rate of spread of E. californica. Knowledge of this would be useful for management of this invasive plant in Chile. © 2014 German Botanical Society and The Royal Botanical Society of the Netherlands.

  16. Climatic niche conservatism and biogeographical non-equilibrium in Eschscholzia californica (Papaveraceae), an invasive plant in the Chilean Mediterranean region.

    Science.gov (United States)

    Peña-Gómez, Francisco T; Guerrero, Pablo C; Bizama, Gustavo; Duarte, Milén; Bustamante, Ramiro O

    2014-01-01

    Species climate requirements are useful for predicting their geographic distribution. It is often assumed that the niche requirements for invasive plants are conserved during invasion, especially when the invaded regions share similar climate conditions. California and central Chile have a remarkable degree of convergence in their vegetation structure, and a similar Mediterranean climate. Such similarities make these geographic areas an interesting natural experiment for testing climatic niche dynamics and the equilibrium of invasive species in a new environment. We tested to see if the climatic niche of Eschscholzia californica is conserved in the invaded range (central Chile), and we assessed whether the invasion process has reached a biogeographical equilibrium, i.e., occupy all the suitable geographic locations that have suitable conditions under native niche requirements. We compared the climatic niche in the native and invaded ranges as well as the projected potential geographic distribution in the invaded range. In order to compare climatic niches, we conducted a Principal Component Analysis (PCA) and Species Distribution Models (SDMs), to estimate E. californica's potential geographic distribution. We also used SDMs to predict altitudinal distribution limits in central Chile. Our results indicated that the climatic niche occupied by E. californica in the invaded range is firmly conserved, occupying a subset of the native climatic niche but leaving a substantial fraction of it unfilled. Comparisons of projected SDMs for central Chile indicate a similarity, yet the projection from native range predicted a larger geographic distribution in central Chile compared to the prediction of the model constructed for central Chile. The projected niche occupancy profile from California predicted a higher mean elevation than that projected from central Chile. We concluded that the invasion process of E. californica in central Chile is consistent with climatic niche

  17. Climatic niche conservatism and biogeographical non-equilibrium in Eschscholzia californica (Papaveraceae, an invasive plant in the Chilean Mediterranean region.

    Directory of Open Access Journals (Sweden)

    Francisco T Peña-Gómez

    Full Text Available Species climate requirements are useful for predicting their geographic distribution. It is often assumed that the niche requirements for invasive plants are conserved during invasion, especially when the invaded regions share similar climate conditions. California and central Chile have a remarkable degree of convergence in their vegetation structure, and a similar Mediterranean climate. Such similarities make these geographic areas an interesting natural experiment for testing climatic niche dynamics and the equilibrium of invasive species in a new environment. We tested to see if the climatic niche of Eschscholzia californica is conserved in the invaded range (central Chile, and we assessed whether the invasion process has reached a biogeographical equilibrium, i.e., occupy all the suitable geographic locations that have suitable conditions under native niche requirements. We compared the climatic niche in the native and invaded ranges as well as the projected potential geographic distribution in the invaded range. In order to compare climatic niches, we conducted a Principal Component Analysis (PCA and Species Distribution Models (SDMs, to estimate E. californica's potential geographic distribution. We also used SDMs to predict altitudinal distribution limits in central Chile. Our results indicated that the climatic niche occupied by E. californica in the invaded range is firmly conserved, occupying a subset of the native climatic niche but leaving a substantial fraction of it unfilled. Comparisons of projected SDMs for central Chile indicate a similarity, yet the projection from native range predicted a larger geographic distribution in central Chile compared to the prediction of the model constructed for central Chile. The projected niche occupancy profile from California predicted a higher mean elevation than that projected from central Chile. We concluded that the invasion process of E. californica in central Chile is consistent with

  18. Botrytis californica, a new cryptic species in the B. cinerea species complex causing gray mold in blueberries and table grapes.

    Science.gov (United States)

    Saito, S; Margosan, D; Michailides, T J; Xiao, C L

    2016-01-01

    The Botrytis cinerea species complex comprises two cryptic species, originally referred to Group I and Group II based on Bc-hch gene RFLP haplotyping. Group I was described as a new cryptic species B. pseudocinerea During a survey of Botrytis spp. causing gray mold in blueberries and table grapes in the Central Valley of California, six isolates, three from blueberries and three from table grapes, were placed in Group I but had a distinct morphological character with conidiophores significantly longer than those of B. cinerea and B. pseudocinerea We compared these with B. cinerea and B. pseudocinerea by examining morphological and physiological characters, sensitivity to fenhexamid and phylogenetic analysis inferred from sequences of three nuclear genes. Phylogenetic analysis with the three partial gene sequences encoding glyceraldehyde-3-phosate dehydrogenase (G3PDH), heat-shock protein 60 (HSP60) and DNA-dependent RNA polymerase subunit II (RPB2) supported the proposal of a new Botrytis species, B. californica, which is closely related genetically to B. cinerea, B. pseudocinerea and B. sinoviticola, all known as causal agents of gray mold of grapes. Botrytis californica caused decay on blueberry and table grape fruit inoculated with the fungus. This study suggests that B. californica is a cryptic species sympatric with B. cinerea on blueberries and table grapes in California.

  19. Tributyltin in environmental samples from the Former Derecktor Shipyard, Coddington Cove, Newport RI

    Energy Technology Data Exchange (ETDEWEB)

    Wade, Terry L.; Sweet, Stephen T.; Quinn, James G.; Cairns, Robert W.; King, John W

    2004-05-01

    Tributyltin (TBT) was detected in all 24 surface sediment (top 2 cm) samples collected from Coddington Cove, Newport, RI. TBT surface sediment concentrations ranged from 32 to 372 ng Sn/g with a mean concentration of 146 ng Sn/g. Analyses of selected core sections detected TBT in at least the top 18 cm at all 7 stations where cores were collected. No consistent TBT concentration trends with depth for these cores suggest mixing is an important process in the sediment column. In one core (station 28), TBT was found in the 76-86 cm section at a concentration of 141 ng Sn/g; thus sediments are a significant sink for TBT. However, sediment mixing processes can enhance releases of bioavailable TBT. Mussels, clams and fish from Coddington Cove contain TBT at concentrations ranging from 9.2 to 977 ng Sn/g. TBT concentrations in lobsters were below the detection limit (<6 ng Sn/g). Based on available screening criteria, TBT concentrations in Coddington Cove sediment is likely to be having an adverse effect on the biota at some locations. - TBT is likely to continue to be bioavailable for many years.

  20. Loss of genetic diversity and increased subdivision in an endemic Alpine Stonefly threatened by climate change

    Science.gov (United States)

    Jordan, Steve; Giersch, Jonathan J.; Muhlfeld, Clint C.; Hotalling, Scott; Fanning, Liz; Luikart, Gordon

    2016-01-01

    Much remains unknown about the genetic status and population connectivity of high-elevation and high-latitude freshwater invertebrates, which often persist near snow and ice masses that are disappearing due to climate change. Here we report on the conservation genetics of the meltwater stonefly Lednia tumana (Ricker) of Montana, USA, a cold-water obligate species. We sequenced 1530 bp of mtDNA from 116 L. tumana individuals representing “historic” (>10 yr old) and 2010 populations. The dominant haplotype was common in both time periods, while the second-most-common haplotype was found only in historic samples, having been lost in the interim. The 2010 populations also showed reduced gene and nucleotide diversity and increased genetic isolation. We found lower genetic diversity in L. tumana compared to two other North American stonefly species, Amphinemura linda (Ricker) and Pteronarcys californica Newport. Our results imply small effective sizes, increased fragmentation, limited gene flow, and loss of genetic variation among contemporary L. tumana populations, which can lead to reduced adaptive capacity and increased extinction risk. This study reinforces concerns that ongoing glacier loss threatens the persistence of L. tumana, and provides baseline data and analysis of how future environmental change could impact populations of similar organisms.

  1. Morphology, innervation, and peripheral sensory cells of the siphon of aplysia californica.

    Science.gov (United States)

    Carrigan, Ian D; Croll, Roger P; Wyeth, Russell C

    2015-11-01

    The siphon of Aplysia californica has several functions, including involvement in respiration, excretion, and defensive inking. It also provides sensory input for defensive withdrawals that have been studied extensively to examine mechanisms that underlie learning. To better understand the neuronal bases of these functions, we used immunohistochemistry to catalogue peripheral cell types and innervation of the siphon in stage 12 juveniles (chosen to allow observation of tissues in whole-mounts). We found that the siphon nerve splits into three major branches, leading ultimately to a two-part FMRFamide-immunoreactive plexus and an apparently separate tyrosine hydroxylase-immunoreactive plexus. Putative sensory neurons included four distinct types of tubulin-immunoreactive bipolar cells (one likely also tyrosine hydroxylase immunoreactive) that bore ciliated dendrites penetrating the epithelium. A fifth bipolar neuron type (tubulin- and FMRFamide-immunoreactive) occurred deeper in the tissue, associated with part of the FMRFamide-immunoreactive plexus. Our observations emphasize the structural complexity of the peripheral nervous system of the siphon, and the importance of direct tests of the various components to better understand the functioning of the entire organ, including its role in defensive withdrawal responses.

  2. Integrated genomics and proteomics of the Torpedo californica electric organ: concordance with the mammalian neuromuscular junction

    Directory of Open Access Journals (Sweden)

    Mate Suzanne E

    2011-05-01

    Full Text Available Abstract Background During development, the branchial mesoderm of Torpedo californica transdifferentiates into an electric organ capable of generating high voltage discharges to stun fish. The organ contains a high density of cholinergic synapses and has served as a biochemical model for the membrane specialization of myofibers, the neuromuscular junction (NMJ. We studied the genome and proteome of the electric organ to gain insight into its composition, to determine if there is concordance with skeletal muscle and the NMJ, and to identify novel synaptic proteins. Results Of 435 proteins identified, 300 mapped to Torpedo cDNA sequences with ≥2 peptides. We identified 14 uncharacterized proteins in the electric organ that are known to play a role in acetylcholine receptor clustering or signal transduction. In addition, two human open reading frames, C1orf123 and C6orf130, showed high sequence similarity to electric organ proteins. Our profile lists several proteins that are highly expressed in skeletal muscle or are muscle specific. Synaptic proteins such as acetylcholinesterase, acetylcholine receptor subunits, and rapsyn were present in the electric organ proteome but absent in the skeletal muscle proteome. Conclusions Our integrated genomic and proteomic analysis supports research describing a muscle-like profile of the organ. We show that it is a repository of NMJ proteins but we present limitations on its use as a comprehensive model of the NMJ. Finally, we identified several proteins that may become candidates for signaling proteins not previously characterized as components of the NMJ.

  3. Neurogenesis in Aplysia californica resembles nervous system formation in vertebrates. [Sponges

    Energy Technology Data Exchange (ETDEWEB)

    Jacob, M.H.

    1984-05-01

    The pattern of neurogenesis of the central nervous system of Aplysia californica was investigated by (/sup 3/H)thymidine autoradiography. Large numbers of animals at a series of early developmental stages were labeled with (/sup 3/H)thymidine for 24 or 48 hr and were subsequently sampled at specific intervals throughout the life cycle. I found that proliferative zones, consisting of columnar and placodal ectodermal cells, are established in regions of the body wall adjacent to underlying mesodermal cells. Mitosis in the proliferative zones generates a population of cells which leave the surface and migrate inward to join the nearby forming ganglia. Tracing specific (/sup 3/H)thymidine-labeled cells from the body wall to a particular ganglion and within the ganglion over time suggests that the final genomic replication of the neuronal precursors occurs before the cells join the ganglion while glial cell precursors and differentiating glial cells continue to divide within the ganglion for some time. Ultrastructural examination of the morphological features of the few mitosing cells observed within the Aplysia central nervous system supports this interpretation. The pattern of neurogenesis in the Aplysia central nervous system resembles the proliferation of cells in the neural tube and the migration of neural crest and ectodermal placode cells in the vertebrate nervous system but differs from the pattern described for other invertebrates.

  4. Reproductive parameters of the Pacific angel shark Squatina californica (Selachii: Squatinidae).

    Science.gov (United States)

    Romero-Caicedo, A F; Galván-Magaña, F; Hernández-Herrera, A; Carrera-Fernández, M

    2016-04-01

    Reproductive characteristics of the Pacific angel shark, Squatina californica, were evaluated from 420 specimens obtained from the artisanal fishery in La Paz Bay, Gulf of California, Mexico. Females (99 cm, 6000 g) were larger than males (95 cm, 5000 g) in terms of both total length (L(T)) and body mass (M(T)). The overall sex ratio was significantly different from the expected 1:1, suggesting sexual segregation of mature individuals in La Paz Bay. Males had developed reproductive organs and calcified claspers from 72 cm L(T); the median size at maturity (LT50 ) was 75.6 cm. In females, only the left ovary was functional and mature ovarian follicles were present from 77 cm L(T); the estimated LT50 was 77.7 cm. For the 10 gravid females sampled, uterine fecundity was between two and 10 embryos. Mature, non-gravid females with small and large ovarian follicles appeared simultaneously with gravid females with follicles that did not exceed 1.9 cm diameter.

  5. Effects of temperature and shear force on infectivity of the baculovirus Autographa californica M nucleopolyhedrovirus.

    Science.gov (United States)

    Michalsky, Ronald; Pfromm, Peter H; Czermak, Peter; Sorensen, Christopher M; Passarelli, A Lorena

    2008-11-01

    Virus stability and infectivity during stressful conditions was assessed to establish guidelines for future virus filtration experiments and to contribute to the body of knowledge on a widely used virus. A recombinant baculovirus of Autographa californica M nucleopolyhedrovirus (AcMNPV), vHSGFP, was incubated at 15-65 degrees C. A 2-log decrease in virus infectivity occurred after virus incubation above 45 degrees C. The activation energy of virus deactivation was circa 108 kJ/mol. Dynamic light scattering revealed an increase in apparent virus particle size from 150+/-19 to 249+/-13 nm at 55 degrees C. Protein and DNA concentrations in solution correlated well with virus aggregation as temperature was increased. Infectivity of vHSGFP stored for 5 months at 4 degrees C or exposed to shear stress from stirring (100 rpm, 1.02x10(-5) psi) and pumping (50-250 ml/min, 1.45x10(-5) to 7.25x10(-5) psi) did not change with time. Unlike temperature variations, cold storage and shear stress appeared to have little impact on infectivity.

  6. Segmentation Along the Newport-Inglewood Rose Canyon Fault Zone: Implications for Rupture Propagation

    Science.gov (United States)

    Sahakian, V. J.; Bormann, J. M.; Driscoll, N. W.; Harding, A. J.; Kent, G. M.; Wesnousky, S. G.

    2015-12-01

    The Newport-Inglewood/Rose Canyon fault zone (NIRC) is an active component of the southern California strike-slip fault system in the Pacific-North American plate boundary. Despite its close proximity to densely populated coastal regions of Southern California, the NIRC fault geometry and expected earthquake behavior are poorly constrained. As a result of these uncertainties, current hazard models lack critical information regarding potential earthquake magnitudes and ground shaking caused by rupture on the offshore portion of the fault. Here, we present an improved characterization of the NIRC fault zone's architecture and segmentation. We employ nested marine seismic reflection data of varying vertical resolutions to map the NIRC location, strike, dip, and stepovers based on subsurface observations. These reflection data were collected in 1979, 2006, 2008, 2009 and 2013. We identify four main geometrical fault segments separated along strike by three stepovers between 0.5 and 3 km in width, whereby width is measured as the horizontal distance between fault strands or termini. Empirical studies of rupture propagation show that past earthquake ruptures in other regions have propagated across discontinuities of this width. We additionally employ a quantitative approach to constrain the potential earthquake magnitude for the NIRC fault zone by modeling the coulomb stress changes that result from possible rupture initiation scenarios. Earthquakes initiated on the central fault strand by Carlsbad Canyon favor through-going rupture across the entire length of the NIRC fault zone. Additionally, the modeling results suggest that the southernmost stepover by La Jolla may act as an inhibitor to through-going rupture due to the strike and dip of the adjacent fault despite the stepover's short width. Finally, our stress modeling results suggest that the maximum potential magnitude of an earthquake rupturing all of the mapped offshore segments of the NIRC fault zone is Mw 7.5.

  7. Functional characterization of the ubiquitin variant encoded by the baculovirus Autographa californica.

    Science.gov (United States)

    Haas, A L; Katzung, D J; Reback, P M; Guarino, L A

    1996-04-30

    The marked evolutionary conservation of ubiquitin is assumed to arise from constraints imposed by folding, stability, and interaction of the polypeptide with various components of the ATP, ubiquitin-dependent degradative pathway. The present studies characterize the most divergent (75% identity) of the species-specific ubiquitin isoforms encoded as a late gene product of the baculovirus Autographa californica [Guarino, L. A. (1990) Proc. Natl. Acad. Sci. U.S.A. 87, 409-413]. Viral ubiquitin supports 40% of the rate of ATP-dependent degradation exhibited by eukaryotic ubiquitin. Inhibition of proteolysis correlated with a lower steady-state concentration of ubiquitin-conjugated degradative intermediates. Rate studies revealed that viral ubiquitin exerts its effect at the step of isopeptide ligase-catalyzed (E3) ubiquitin conjugation since viral and eukaryotic polypeptides are identical in their abilities to support ATP-coupled activation by E1 and transthiolation to E2 carrier proteins. Other studies demonstrated viral ubiquitin severely attenuated the rate of K48-linked multiubiquitin chain formation in E3-independent conjugation catalyzed by recombination yeast CDC34 or rabbit reticulocyte E232K but not chain elongation of alternate linkages formed by yeast RAD6 or human E2EPF. The latter observations suggest nonconserved positions on viral ubiquitin constitute recognition signals for K48-linked chain formation. Sequence comparison of species-specific ubiquitin isoforms indicates that nonconserved positions localized to a defined region on the polypeptide surface distinct from the basic face required for E1 binding. These results suggest this novel ubiquitin isoform may function in baculoviral replication to block destruction of a short-lived protein(s) by the host degradative pathway, targeted through either E2-catalyzed K48-linked multibiquitin chain formation or general E3-mediated conjugation.

  8. Localization of Biogenic Amines in the Foregut of Aplysia californica: Catecholaminergic and Serotonergic Innervation

    Science.gov (United States)

    Martínez-Rubio, Clarissa; Serrano, Geidy E.; Miller, Mark W.

    2009-01-01

    This study examined the catecholaminergic and serotonergic innervation of the foregut of Aplysia californica, a model system in which the control of feeding behaviors can be investigated at the cellular level. Similar numbers (15-25) of serotonin-like-immunoreactive (5HTli) and tyrosine hydroxylase-like-immunoreactive (THli) fibers were present in each (bilateral) esophageal nerve (En), the major source of pregastric neural innervation in this system. The majority of En 5HTli and THli fibers originated from the anterior branch (En2), which innervates the pharynx and the anterior esophagus. Fewer fibers were present in the posterior branch (En1), which innervates the majority of the esophagus and the crop. Backfills of the two En branches toward the central nervous system (CNS) labeled a single, centrifugally projecting serotonergic fiber, originating from the metacerebral cell (MCC). The MCC fiber projected only to En2. No central THli neurons were found to project to the En. Surveys of the pharynx and esophagus revealed major differences between their patterns of catecholaminergic (CA) and serotonergic innervation. Whereas THli fibers and cell bodies were distributed throughout the foregut, 5HTli fibers were present in restricted plexi, and no 5HTli somata were detected. Double-labeling experiments in the periphery revealed THli neurons projecting toward the buccal ganglion via En2. Other afferents received dense perisomatic serotonergic innervation. Finally, qualitative and quantitative differences were observed between the buccal motor programs (BMPs) produced by stimulation of the two En branches. These observations increase our understanding of aminergic contributions to the pregastric regulation of Aplysia feeding behaviors. PMID:19330814

  9. Shading decreases the abundance of the herbivorous California horn snail, Cerithidea californica

    Science.gov (United States)

    Lorda, Julio; Lafferty, Kevin D.

    2012-01-01

    Most of the intertidal zone in estuaries of California, USA and Baja California, Mexico is covered with vascular vegetation. Shading by these vascular plants influences abiotic and biotic processes that shape benthic community assemblages. We present data on the effects of shading on the California horn snail, Cerithidea californica. This species is important because it is the most common benthic macrofaunal species in these systems and acts as an obligate intermediate host of several species of rematode parasites that infect several other species. Using observational and experimental studies, we found a negative effect of shade on the distribution and abundance of the California horn snail. We hypothesized that shading reduces the abundance of the epipelic diatoms that the snails feeds on, causing snails to leave haded areas. We observed a negative relationship between vascular plant cover, sub-canopy light levels, and snail density in Mugu Lagoon. Then we experimentally manipulated light regimes, by clipping vegetation and adding shade structures, and found higher snail densities at higher light levels. In Goleta Slough, we isolated the effect of shade from vegetation by documenting a negative relationship between the shade created by two bridges and diatom and snail densities. We also found that snails moved the greatest distances over shaded channel banks compared to unshaded channel banks. Further, we documented the effect of water depth and channel bank orientation on shading in this system. An additional effect of shading is the reduction of temperature, providing an alternative explanation for some of our results. These results broaden our knowledge of how variation in the light environment influences the ecology of estuarine ecosystems.

  10. Purification of a recombinant baculovirus of Autographa californica M nucleopolyhedrovirus by ion exchange membrane chromatography.

    Science.gov (United States)

    Grein, Tanja A; Michalsky, Ronald; Vega López, Maria; Czermak, Peter

    2012-08-01

    Significant progress in the application of viral vectors for gene delivery into mammalian cells and the use of viruses as biopesticides requires downstream processing that can satisfy application-specific demands on performance. In the present work the stability and ion exchange membrane chromatography of a recombinant of Autographa californica M nucleopolyhedrovirus is studied. To adjust the degree of purification the effect of ionic conductivity or pH on the viral infectivity was assessed (0.77-78.00mS/cm, pH 3-8). Infectivity decreased rapidly by several orders of magnitude at below 5mS/cm (i.e., 0.49MPa osmotic pressure change) or at below pH 5.5 (rationalized with particle aggregation). The virus was concentrated and purified via adsorption (0.2-1.1×10(16)pfu/m(3) chromatographic bed volume, 0.6-1.1×10(12)pfu/m(2) membrane area facing the incident fluid flow) and elution at pH 6.1 and 6.35mS/cm from three strong anion exchange membranes. Virus recovery and concentration in accord with the volume reduction were obtained using a polyether sulfone-based membrane with quaternary ammonium ligands. The level of host cell protein (down to below the detection limit) and suspended DNA (below 93pg DNA per 10(6)pfu) are reported for each membrane employed, for the purpose of comparability, under equal adsorption or elution conditions respectively.

  11. Contaminants in sediment, food-chain biota, and bird eggs from the Newport Bay watershed, Orange County, California.

    Science.gov (United States)

    Santolo, Gary M; Byron, Earl R; Ohlendorf, Harry M

    2016-02-01

    Groundwater-related discharges in the San Diego Creek/Newport Bay watershed in Orange County, California have the potential to adversely affect the surface waters within the watershed and would likely not comply with the established total maximum daily loads (TMDLs) for the watershed. In 2004 and 2005, we studied the concentrations of contaminants of TMDL concern (particularly selenium [Se]) in birds that are at risk of exposure to contaminated food items because they feed and nest in the Newport Bay watershed. Most bioaccumulation is from elevated Se in groundwater downstream of a historic terminal swamp. Se bioaccumulation was observed in all biota tested, and DDE was found in fish and bird egg samples. Effects of contaminants on fish and birds are inconclusive due to the management disturbances in the watershed (e.g., flood control) and lack of bird nesting habitat. Although a significant relationship was observed between DDE concentrations and eggshell thinning in American avocet (Recurvirostra americana) eggs, the shell thinning in avocet and other species examined was not enough to result in hatching failure. Further focused monitoring efforts will be needed to characterize the exposure and risk levels.

  12. Autographa californica Multicapsid Nucleopolyhedrovirus efficiently infects Sf9 cells and transduces mammalian cells via direct fusion with the plasma membrane at low pH

    NARCIS (Netherlands)

    Dong, S.; Wang, M.; Qiu, Z.; Deng, F.; Vlak, J.M.; Hu, Z.H.; Wang, H.L.

    2010-01-01

    The budded virus (BV) of the Autographa californica multicapsid nucleopolyhedrovirus (AcMNPV) infects insect cells and transduces mammalian cells mainly through the endocytosis pathway. However, this study revealed that the treatment of the virus bound to Sf9 cells at low pH could efficiently rescue

  13. Measurements of slope currents and internal tides on the Continental Shelf and slope off Newport Beach, California

    Science.gov (United States)

    Rosenberger, Kurt J.; Noble, Marlene A.; Norris, Benjamin

    2014-01-01

    An array of seven moorings housing current meters and oceanographic sensors was deployed for 6 months at 5 sites on the Continental Shelf and slope off Newport Beach, California, from July 2011 to January 2012. Full water-column profiles of currents were acquired at all five sites, and a profile of water-column temperature was also acquired at two of the five sites for the duration of the deployment. In conjunction with this deployment, the Orange County Sanitation District deployed four bottom platforms with current meters on the San Pedro Shelf, and these meters provided water-column profiles of currents. The data from this program will provide the basis for an investigation of the interaction between the deep water flow over the slope and the internal tide on the Continental Shelf.

  14. A novel third chromosomal locus controls susceptibility to Autographa californica multiple nucleopolyhedrovirus in the silkworm, Bombyx mori.

    Science.gov (United States)

    Xu, Jian; Kusakabe, Takahiro; Yamamoto, Kimiko; Suetsugu, Yoshitaka; Mon, Hiroaki; Li, Zhiqing; Zhu, Li; Iiyama, Kazuhiro; Banno, Yutaka; Yoshimura, Kaito; Lee, Jae Man

    2014-04-01

    Baculovirus demonstrates specific infection spectrums and thus one certain host exhibits particular response to single baculovirus isolate. Autographa californica multiple nucleopolyhedrovirus (AcMNPV) is considered to be not an innate pathogen to Bombyx mori, but some silkworm strains have been identified to be permissive to AcMNPV, indicating the positive or negative involvement of certain host factors in baculovirus replications in vivo. To provide a fundamental knowledge of this process, we performed large-scale screening to investigate the responses of 448 silkworm strains against recombinant AcMNPV inoculation. By genetic analysis between permissive and resistant strains identified, we further confirmed that a potential corresponding locus on chromosome 3 regulates host responses to AcMNPV in silkworm. Additionally, we found that it is available for AcMNPV-silkworm baculovirus expression vector system to produce proteins of interest.

  15. Organochlorine contaminants and maternal offloading in the lecithotrophic Pacific angel shark (Squatina californica) collected from southern California.

    Science.gov (United States)

    Lyons, Kady; Lowe, Christopher G

    2015-08-15

    Pacific angel sharks (Squatina californica) are a benthic elasmobranch that occupy intermediate trophic level positions in coastal food webs. Angel sharks' life history characteristics make them susceptible to accumulating high amounts of contaminants. Four angel sharks were opportunistically captured in southern California and their liver and uterine contents were analyzed for PCBs, DDTs and other pesticides. High DDT:PCB ratios were found in the sharks indicating direct or indirect foraging near a local EPA Superfund Site. Organic contaminants were measured in ovulated eggs, indicating that females are able to maternally offload contaminants. Despite the potential mismatch between ovarian and uterine fecundity, we estimated females to offload approximately 13±5% of their total body load, which represents the upper limit of this capability. Although low in sample size, the initial findings from this study suggest that habitat use might play an important role in contaminant accumulation in this species.

  16. Myogenesis in Aplysia californica (Cooper, 1863) (Mollusca, Gastropoda, Opisthobranchia) with special focus on muscular remodeling during metamorphosis.

    Science.gov (United States)

    Wollesen, Tim; Wanninger, Andreas; Klussmann-Kolb, Annette

    2008-07-01

    To date only few comparative approaches tried to reconstruct the ontogeny of the musculature in invertebrates. This may be due to the difficulties involved in reconstructing three dimensionally arranged muscle systems by means of classical histological techniques combined with light or transmission electron microscopy. Within the scope of the present study we investigated the myogenesis of premetamorphic, metamorphic, and juvenile developmental stages of the anaspidean opisthobranch Aplysia californica using fluorescence F-actin-labeling in conjunction with modern confocal laser scanning microscopy. We categorized muscles with respect to their differentiation and degeneration and found three true larval muscles that differentiate during the embryonic and veliger phase and degenerate during or slightly after metamorphosis. These are the larval retractor, the accessory larval retractor, and the metapodial retractor muscle. While the pedal retractor muscle, some transversal mantle fibers and major portions of the cephalopedal musculature are continued and elaborated during juvenile and adult life, the buccal musculature and the anterior retractor muscle constitute juvenile/adult muscles which differentiate during or after metamorphosis. The metapodial retractor muscle has never been reported for any other gastropod taxon. Our findings indicate that the late veliger larva of A. californica shares some common traits with veligers of other gastropods, such as a larval retractor muscle. However, the postmetamorphic stages exhibit only few congruencies with other gastropod taxa investigated to date, which is probably due to common larval but different adult life styles within gastropods. Accordingly, this study provides further evidence for morphological plasticity in gastropod myogenesis and stresses the importance of ontogenetic approaches to understand adult conditions and life history patterns.

  17. Comparison of acetylcholine receptor-controlled cation flux in membrane vesicles from Torpedo californica and Electrophorus electricus: chemical kinetic measurements in the millisecond region.

    Science.gov (United States)

    Hess, G P; Pasquale, E B; Walker, J W; McNamee, M G

    1982-02-01

    In earlier studies with the acetylcholine receptor (AcChoR) of Electrophorus electricus the rate and equilibrium constants for a model that relates the ligand binding to ion translocation were determined, and the dependence of these constants on the concentrations of carbamoylcholine and acetylcholine, over a 200- and 5000-fold range, respectively, could be predicted. AcChoR-controlled cation flux has now been measured in Torpedo californica vesicles by using a pulsed-quench-flow technique with a 2-msec time resolution. Torpedo vesicles on a weight basis may contain several hundred times more receptor sites than do E. electricus vesicles. Techniques have been developed to (i) correct for the kinetic heterogeneity of the vesicle population; (ii) use the inactivation of the receptor by its natural ligand to reduce influx rates at high ligand concentrations to a measurable level (this permitted J(A), the influx rate coefficient before the onset of inactivation, to be measured); and (iii) determine the rate coefficients of two processes that lead to successive inactivations (desensitization) of the receptor and occur in different time regions. An extension of a model proposed for the E. electricus receptor accommodates the ion translocation in T. californica vesicles. The features in common are: (i) A rapid initial flux rate [J(A)(max) for T. californica is 310 sec(-1); for E. electricus it is 7.5 sec(-1)]. These differences in flux rates are consistent with a difference in AcChoR density. (ii) A rapid inactivation process [alpha(max) for T. californica is 2 sec(-1); for E. electricus it is 7 sec(-1)]. (iii) A slow AcChoR-controlled flux that continues after the rapid inactivation [J(I)(max) for T. californica is 1.3 sec(-1); for E. electricus it is 0.015 sec(-1)]. The main difference between the flux in the two types of vesicle is the existence of a second, slower, inactivation process in T. californica with a rate coefficient, beta, of 0.12 sec(-1). The second

  18. Comparison of acetylcholine receptor-controlled cation flux in membrane vesicles from Torpedo californica and Electrophorus electricus: Chemical kinetic measurements in the millisecond region

    OpenAIRE

    Hess, George P.; Pasquale, Elena B.; Walker, Jeffrey W.; McNamee, Mark G.

    1982-01-01

    In earlier studies with the acetylcholine receptor (AcChoR) of Electrophorus electricus the rate and equilibrium constants for a model that relates the ligand binding to ion translocation were determined, and the dependence of these constants on the concentrations of carbamoylcholine and acetylcholine, over a 200- and 5000-fold range, respectively, could be predicted. AcChoR-controlled cation flux has now been measured in Torpedo californica vesicles by using a pulsed-quench-flow technique wi...

  19. An Evaluation of the Attendance Policy and Program and Its Perceived Effects on High School Attendance in Newport News Public Schools

    OpenAIRE

    Smith, Wayne Keith

    1998-01-01

    The purpose of this quantitative study is to determine the effects of the attendance policy and attendance program after one year of implementation in Newport News Public Schools with a total high school population of approximately 5,820 students. The school district recently implemented a new attendance policy and program to address high school student absenteeism. This multi-faceted study examined the effects of this new policy by conducting statistical analyses of attendance data, pro...

  20. Comparison of the interactions of a specific neurotoxin (alpha-bungarotoxin) with the acetylcholine receptor in Torpedo californica and Electrophorus electricus membrane preparations.

    Science.gov (United States)

    Leprince, P; Noble, R L; Hess, G P

    1981-09-15

    alpha-Bungarotoxin, a snake neurotoxin, binds irreversibly and specifically to the acetylcholine receptor isolated from the electroplax of Electrophorus electricus and Torpedo species and has been an important tool in the study of the receptor-ligand binding mechanism. Two distinct kinetic processes have been observed in studies with membranes from E. electricus. A minimum mechanism for the toxin reaction involves (i) the reversible binding of two toxin molecules to the receptor prior to the irreversible formation of toxin receptor complexes and (ii) a toxin-induced conformational change of the receptor which leads to an increase in the affinity of the receptor binding sites for toxin [Hess, G. P., Bulger, J. E., Fu, J.-j. L., Hindy, E. F., & Silberstein, R. J. (1975) Biochem. Biophys. Res. Commun. 64, 1018-1027]. Only one process has been detected in Torpedo membranes. Here, we determine whether the receptors in Torpedo californica and E. electricus membranes have different properties or whether the measurements and their interpretation were responsible for the different results. Two methods which are frequently used in binding studies to separate free and bound toxin, a CM-52 cellulose minicolumn assay and DE-81 filter disk assay, have been compared. The results obtained indicate that the interaction of toxin with receptor from T. californica is similar to that observed with receptor from E. electricus. The apparent differences which have been reported in the literature are shown to have arisen from the design of the experiments in which T. californica membranes were used.

  1. Apple, carrot, and hibiscus edible films containing the plant antimicrobials carvacrol and cinnamaldehyde inactivate Salmonella Newport on organic leafy greens in sealed plastic bags.

    Science.gov (United States)

    Zhu, Libin; Olsen, Carl; McHugh, Tara; Friedman, Mendel; Jaroni, Divya; Ravishankar, Sadhana

    2014-01-01

    The objective of this study was to investigate the antimicrobial effects of carvacrol and cinnamaldehyde incorporated into apple, carrot, and hibiscus-based edible films against Salmonella Newport in bagged organic leafy greens. The leafy greens tested included organic Romaine and Iceberg lettuce, and mature and baby spinach. Each leafy green sample was washed, dip inoculated with S. Newport (10⁷ CFU/mL), and dried. Each sample was put into a Ziploc® bag. Edible films pieces were put into the Ziploc bag and mixed well. The bags were sealed and stored at 4 °C. Samples were taken at days 0, 3, and 7 for enumeration of survivors. On all leafy greens, 3% carvacrol films showed the best bactericidal effects against Salmonella. All 3 types of 3% carvacrol films reduced the Salmonella population by 5 log₁₀ CFU/g at day 0 and 1.5% carvacrol films reduced Salmonella by 1 to 4 log₁₀ CFU/g at day 7. The films with 3% cinnamaldehyde showed 0.5 to 3 log reductions on different leafy greens at day 7. The films with 0.5% and 1.5% cinnamaldehyde and 0.5% carvacrol also showed varied reductions on different types of leafy greens. Edible films were the most effective against Salmonella on Iceberg lettuce. This study demonstrates the potential of edible films incorporated with carvacrol and cinnamaldehyde to inactivate S. Newport on organic leafy greens.

  2. A multi-country outbreak of Salmonella Newport gastroenteritis in Europe associated with watermelon from Brazil, confirmed by whole genome sequencing: October 2011 to January 2012.

    Science.gov (United States)

    Byrne, L; Fisher, I; Peters, T; Mather, A; Thomson, N; Rosner, B; Bernard, H; McKeown, P; Cormican, M; Cowden, J; Aiyedun, V; Lane, C

    2014-08-07

    In November 2011, the presence of Salmonella Newport in a ready-to-eat watermelon slice was confirmed as part of a local food survey in England. In late December 2011, cases of S. Newport were reported in England, Wales, Northern Ireland, Scotland, Ireland and Germany. During the outbreak, 63 confirmed cases of S. Newport were reported across all six countries with isolates indistinguishable by pulsed-field gel electrophoresis from the watermelon isolate.A subset of outbreak isolates were whole-genome sequenced and were identical to, or one single nucleotide polymorphism different from the watermelon isolate.In total, 46 confirmed cases were interviewed of which 27 reported watermelon consumption. Further investigations confirmed the outbreak was linked to the consumption of watermelon imported from Brazil.Although numerous Salmonella outbreaks associated with melons have been reported in the United States and elsewhere, this is the first of its kind in Europe.Expansion of the melon import market from Brazil represents a potential threat for future outbreaks. Whole genome sequencing is rapidly becoming more accessible and can provide a compelling level of evidence of linkage between human cases and sources of infection,to support public health interventions in global food markets.

  3. Trichoplusia ni Kinesin-1 Associates with Autographa californica Multiple Nucleopolyhedrovirus Nucleocapsid Proteins and Is Required for Production of Budded Virus

    Science.gov (United States)

    Biswas, Siddhartha; Blissard, Gary W.

    2016-01-01

    ABSTRACT The mechanism by which nucleocapsids of Autographa californica multiple nucleopolyhedrovirus (AcMNPV) egress from the nucleus to the plasma membrane, leading to the formation of budded virus (BV), is not known. AC141 is a nucleocapsid-associated protein required for BV egress and has previously been shown to be associated with β-tubulin. In addition, AC141 and VP39 were previously shown by fluorescence resonance energy transfer by fluorescence lifetime imaging to interact directly with the Drosophila melanogaster kinesin-1 light chain (KLC) tetratricopeptide repeat (TPR) domain. These results suggested that microtubule transport systems may be involved in baculovirus nucleocapsid egress and BV formation. In this study, we investigated the role of lepidopteran microtubule transport using coimmunoprecipitation, colocalization, yeast two-hybrid, and small interfering RNA (siRNA) analyses. We show that nucleocapsid AC141 associates with the lepidopteran Trichoplusia ni KLC and kinesin-1 heavy chain (KHC) by coimmunoprecipitation and colocalization. Kinesin-1, AC141, and microtubules colocalized predominantly at the plasma membrane. In addition, the nucleocapsid proteins VP39, FP25, and BV/ODV-C42 were also coimmunoprecipitated with T. ni KLC. Direct analysis of the role of T. ni kinesin-1 by downregulation of KLC by siRNA resulted in a significant decrease in BV production. Nucleocapsids labeled with VP39 fused with three copies of the mCherry fluorescent protein also colocalized with microtubules. Yeast two-hybrid analysis showed no evidence of a direct interaction between kinesin-1 and AC141 or VP39, suggesting that either other nucleocapsid proteins or adaptor proteins may be required. These results further support the conclusion that microtubule transport is required for AcMNPV BV formation. IMPORTANCE In two key processes of the replication cycle of the baculovirus Autographa californica multiple nucleopolyhedrovirus (AcMNPV), nucleocapsids are

  4. Vertical surface displacements along a part of the Newport-Inglewood zone of folds and faults, Los Angeles and Orange counties, California

    Science.gov (United States)

    Castle, Robert O.; Buchanan-Banks, Jane M.

    1989-01-01

    During the past half century, the onshore section of the Newport- Inglewood zone of folds and faults between the Dominguez oil field and Corona del Mar (fig. 1) has been repeatedly leveled to geodetic standards. These essentially fortuitous surveys are unrelated to either the tectonic framework or the urbanization of the Los Angeles basin, but were established instead because the Newport-Inglewood zone southward from the Long Beach area is roughly coincident with the coastline--and, hence, is roughly coincident with a naturally defined leveling route. Although these have been several relevelings athwart this zone north of the long Beach area, notably in the Baldwin Hills area (Castle and Yerkes, 1976), about 25 km to the northwest, the survey density, in both space and time, diminishes markedly northward. Thus, the results of the indicated relevelings along the Los Angeles-Orange County coast have permitted the relatively detailed appraisal of historic vertical surface movements described in this report. The Newport-Inglewood zone of folds and faults forms the surface expression of a major crustal boundary separating the Peninsular Ranges province on the east from the Continental Borderland province on the west (Castle and others, 1984, p. 8-9, pl. 1). Transcurrent fault movement along this boundary has produced not only continuing seismic activity, for which this zone is justly famous, but also folds and other structural features within the sedimentary veneer that have entrapped the petroleum deposits for which the Newport-Inglewood zone is even more famous. Although the northeast boundary of the exceptionally prolific Wilmington oil field is roughly coincident with the southeast edge of the Newport-Inglewood zone, we have deliberately excluded this area from consideration--in other than a peripheral way--simply because compaction-induced subsidence centering on the Wilmington field is viewed as a singularly spectacular example of this phenomenon and, hence, has

  5. Effect of cholinergic ligands on the lipids of acetylcholine receptor-rich membrane preparations from Torpedo californica

    Energy Technology Data Exchange (ETDEWEB)

    Martinez-Carrion, M.; Raftery, M.A.; Thomas, J.K.; Sator, V.

    1976-01-01

    Ion permeation, triggered by ligand-receptor interaction, is associated with the primary events of membrane depolarization at the neuromuscular junction and synaptic connections. To explore the possible sites of ion permeation, the long-lived fluorescent probe pyrene (fluorescence lifetime approximately 400 nsec) has been inserted into the lipid phase of acetylcholine receptor-rich membrane (AcChR-M) preparations from Torpedo californica. The pyrene probe is susceptible to both fluidity and permeability changes in the lipid bilayer. These changes are detected by variations in the rate of decay of the excited singlet state of pyrene after pulsation with a 10-nsec ruby laser flash. Variations of these lifetimes in the membrane preparations alone or in the presence of quenchers show that binding of cholinergic agonists and antagonists, neurotoxins, and local anesthetics to AcChR-M produces varying effects on the properties of the pyrene probe in the lipid phase. It is concluded that binding of cholinergic ligands to the receptor does not significantly alter the fluidity or permeability of the lipids in the bilayer in contact with pyrene. On the other hand, local anesthetics do affect these properties.

  6. Cloning and Characterization of Sf9 Cell Lamin and the Lamin Conformational Changes during Autographa californica multiple nucleopolyhedrovirus Infection

    Directory of Open Access Journals (Sweden)

    Wenqiang Wei

    2016-05-01

    Full Text Available At present, the details of lamina alterations after baculovirus infection remain elusive. In this study, a lamin gene in the Sf9 cell line of Spodoptera frugiperda was cloned. The open reading frame (orf of the Sf9 lamin was 1860 bp and encoded a protein with a molecular weight of 70 kDa. A transfection assay with a red fluorescence protein (rfp-lamin fusion protein indicated that Sf9 lamin was localized in the nuclear rim. Transmission electron microscopy observations indicated that Autographa californica multiple nucleopolyhedrovirus (AcMNPV nucleocapsids may pass through the nuclear envelope. Immunofluorescence assay indicated that the lamina showed a ruffled staining pattern with the formation of invaginations in the Sf9 cells infected with AcMNPV, while it was evenly distributed at the nuclear periphery of mock-infected cells. Western blotting results indicated that the total amount of lamin in the baculovirus-infected Sf9 cells was significantly decreased compared with the mock-infected cells. These results imply that AcMNPV infection induces structural and biochemical rearrangements of lamina of Sf9 cells.

  7. Cloning and Characterization of Sf9 Cell Lamin and the Lamin Conformational Changes during Autographa californica multiple nucleopolyhedrovirus Infection.

    Science.gov (United States)

    Wei, Wenqiang; Wang, Hongju; Li, Xiaoya; Fang, Na; Yang, Shili; Liu, Hongyan; Kang, Xiaonan; Sun, Xiulian; Ji, Shaoping

    2016-05-07

    At present, the details of lamina alterations after baculovirus infection remain elusive. In this study, a lamin gene in the Sf9 cell line of Spodoptera frugiperda was cloned. The open reading frame (orf) of the Sf9 lamin was 1860 bp and encoded a protein with a molecular weight of 70 kDa. A transfection assay with a red fluorescence protein (rfp)-lamin fusion protein indicated that Sf9 lamin was localized in the nuclear rim. Transmission electron microscopy observations indicated that Autographa californica multiple nucleopolyhedrovirus (AcMNPV) nucleocapsids may pass through the nuclear envelope. Immunofluorescence assay indicated that the lamina showed a ruffled staining pattern with the formation of invaginations in the Sf9 cells infected with AcMNPV, while it was evenly distributed at the nuclear periphery of mock-infected cells. Western blotting results indicated that the total amount of lamin in the baculovirus-infected Sf9 cells was significantly decreased compared with the mock-infected cells. These results imply that AcMNPV infection induces structural and biochemical rearrangements of lamina of Sf9 cells.

  8. Identification of fragments from Autographa californica polyhedrin protein essential for self-aggregation and exogenous protein incorporation.

    Science.gov (United States)

    Sampieri, Alicia; Luz-Madrigal, Agustín; Zepeda, Jesus; Vaca, Luis

    2015-02-04

    Baculoviruses are widely used for the production of recombinant proteins, biopesticides and as gene delivery systems. One of the viral forms called polyhedra has been recently exploited as a scaffold system to incorporate or encapsulate foreign proteins or peptide fragments. However, an efficient strategy for foreign protein incorporation has not been thoroughly studied. Based on the crystal structure of polyhedrin, we conducted an in silico analysis of the baculovirus Autographa californica nucleopolyhedrovirus (AcMNPV) polyhedrin protein to select the minimum fragments of polyhedrin that could be incorporated into polyhedra. Using confocal and transmission electron microscopy we analyzed the expression and cellular localization of the different polyhedrin fragments fused to the green fluorescent protein (EGFP) used as reporter. The amino fragment 1-110 contains two repeats formed each of two β sheets followed by a α helix (amino acids 1-58 and 58-110) that are important for the formation and stability of polyhedra. These fragments 1-58, 58-110 and 1-110 could be incorporated into polyhedra. However, only fragments 1-110 and 58-110 can self-aggregate. These results demonstrate that 58-110 is the minimum fragment that contributes to the assembly of the recombinant polyhedra via self-aggregation. This is the minimum sequence that can be used to efficiently incorporate foreign proteins into polyhedra.

  9. Autographa californica multiple nucleopolyhedrovirus GP64 protein: Analysis of domain I and V amino acid interactions and membrane fusion activity

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Qianlong [State Key Laboratory of Crop Stress Biology for Arid Areas, Key Laboratory of Northwest Loess Plateau Crop Pest Management of Ministry of Agriculture, College of Plant Protection, Northwest A& F University, Yangling, Shaanxi 712100 (China); Blissard, Gary W. [Boyce Thompson Institute, Cornell University, Ithaca, NY 14853, United State (United States); Liu, Tong-Xian [State Key Laboratory of Crop Stress Biology for Arid Areas, Key Laboratory of Northwest Loess Plateau Crop Pest Management of Ministry of Agriculture, College of Plant Protection, Northwest A& F University, Yangling, Shaanxi 712100 (China); Li, Zhaofei, E-mail: zhaofeili73@outlook.com [State Key Laboratory of Crop Stress Biology for Arid Areas, Key Laboratory of Northwest Loess Plateau Crop Pest Management of Ministry of Agriculture, College of Plant Protection, Northwest A& F University, Yangling, Shaanxi 712100 (China)

    2016-01-15

    The Autographa californica multiple nucleopolyhedrovirus GP64 is a class III viral fusion protein. Although the post-fusion structure of GP64 has been solved, its pre-fusion structure and the detailed mechanism of conformational change are unknown. In GP64, domain V is predicted to interact with two domain I segments that flank fusion loop 2. To evaluate the significance of the amino acids involved in these interactions, we examined 24 amino acid positions that represent interacting and conserved residues within domains I and V. In several cases, substitution of a single amino acid involved in a predicted interaction disrupted membrane fusion activity, but no single amino acid pair appears to be absolutely required. We identified 4 critical residues in domain V (G438, W439, T452, and T456) that are important for membrane fusion, and two residues (G438 and W439) that appear to be important for formation or stability of the pre-fusion conformation of GP64. - Highlights: • The baculovirus envelope glycoprotein GP64 is a class III viral fusion protein. • The detailed mechanism of conformational change of GP64 is unknown. • We analyzed 24 positions that might stabilize the post-fusion structure of GP64. • We identified 4 residues in domain V that were critical for membrane fusion. • Two residues are critical for formation of the pre-fusion conformation of GP64.

  10. Modelling biofilm formation of Salmonella enterica ser. Newport as a function of pH and water activity.

    Science.gov (United States)

    Dimakopoulou-Papazoglou, Dafni; Lianou, Alexandra; Koutsoumanis, Konstantinos P

    2016-02-01

    The effect of pH and water activity (aw) on the formation of biofilm by Salmonella enterica ser. Newport, previously identified as a strong biofilm producer, was assessed. Biofilm formation was evaluated in tryptone soy broth at 37 °C and at different combinations of pH (3.3-7.8) and aw (0.894-0.997). In total, 540 biofilm formation tests in 108 pH and aw combinations were carried out in polystyrene microtiter plates using crystal violet staining and optical density (OD; 580 nm) measurements. Since the individual effects of pH and aw on biofilm formation had a similar pattern to that observed for microbial growth rate, cardinal parameter models (CPMs) were used to describe these effects. CPMs described successfully the effects of these two environmental parameters, with the estimated cardinal values of pHmin, pHopt, pHmax, awmin and awopt being 3.58, 6.02, 9.71, 0.894 and 0.994, respectively. The CPMs assumption of the multiplicative inhibitory effect of environmental factors was validated in the case of biofilm formation using additional independent data (i.e. 430 OD data at 86 different combinations of pH and aw). The validation results showed a good agreement (r(2) = 0.938) between observed and predicted OD with no systematic error. In the second part of this study, a probabilistic model predicting the pathogen's biofilm formation boundaries was developed, and the degree of agreement between predicted probabilities and observations was as high as 99.8%. Hence, the effect of environmental parameters on biofilm formation can be quantitatively expressed using mathematical models, with the latter models, in turn, providing useful information for biofilm control in food industry environments.

  11. The pnk/pnl gene (ORF 86) of Autographa californica nucleopolyhedrovirus is a non-essential, immediate early gene.

    Science.gov (United States)

    Durantel, D; Croizier, L; Ayres, M D; Croizier, G; Possee, R D; López-Ferber, M

    1998-03-01

    Autographa californica nucleopolyhedrovirus (AcMNPV) ORF 86, located within the HindIII C fragment, potentially encodes a protein which shares sequence similarity with two T4 bacteriophage gene products, RNA ligase and polynucleotide kinase. This AcMNPV gene has been designated pnk/pnl but has yet to be assigned a function in virus replication. It has been classified as an immediate early virus gene, since the promoter was active in uninfected insect cells and mRNA transcripts were detectable from 4 to 48 h post-infection and in the presence of cycloheximide or aphidicolin in virus-infected cells. The extremities of the transcript have been mapped by primer extension and 3' RACE-PCR to positions -18 from the translational start codon and +15 downstream of the stop codon. The function of pnk/pnl was investigated by producing a recombinant virus (Acdel86lacZ) with the coding region replaced with that of lacZ. This virus replicated normally in Spodoptera frugiperda (Sf 21) cells, indicating that pnk/pnl is not essential for propagation in these cells. Virus protein production in Acdel86lacZ-infected Sf 21 cells also appeared to be unaffected, with normal synthesis of the IE-1, GP64, VP39 and polyhedrin proteins. Shut-down of host protein synthesis was not abolished in recombinant infection. When other baculovirus genomes were examined for the presence of pnk/pnl by restriction enzyme digestion and PCR, a deletion was found in AcMNPV 1.2, Galleria mellonella NPV (GmMNPV) and Bombyx mori NPV (BmNPV), suggesting that in many isolates this gene has either never been acquired or has been lost during genome evolution. This is one of the first baculovirus immediate early genes that appears to be nonessential for virus survival.

  12. Clinal adaptation and adaptive plasticity in Artemisia californica: implications for the response of a foundation species to predicted climate change.

    Science.gov (United States)

    Pratt, Jessica D; Mooney, Kailen A

    2013-08-01

    Local adaptation and plasticity pose significant obstacles to predicting plant responses to future climates. Although local adaptation and plasticity in plant functional traits have been documented for many species, less is known about population-level variation in plasticity and whether such variation is driven by adaptation to environmental variation. We examined clinal variation in traits and performance - and plastic responses to environmental change - for the shrub Artemisia californica along a 700 km gradient characterized (from south to north) by a fourfold increase in precipitation and a 61% decrease in interannual precipitation variation. Plants cloned from five populations along this gradient were grown for 3 years in treatments approximating the precipitation regimes of the north and south range margins. Most traits varying among populations did so clinally; northern populations (vs. southern) had higher water-use efficiencies and lower growth rates, C : N ratios and terpene concentrations. Notably, there was variation in plasticity for plant performance that was strongly correlated with source site interannual precipitation variability. The high-precipitation treatment (vs. low) increased growth and flower production more for plants from southern populations (181% and 279%, respectively) than northern populations (47% and 20%, respectively). Overall, precipitation variability at population source sites predicted 86% and 99% of variation in plasticity in growth and flowering, respectively. These striking, clinal patterns in plant traits and plasticity are indicative of adaptation to both the mean and variability of environmental conditions. Furthermore, our analysis of long-term coastal climate data in turn indicates an increase in interannual precipitation variation consistent with most global change models and, unexpectedly, this increased variation is especially pronounced at historically stable, northern sites. Our findings demonstrate the

  13. Regulatory interaction of the Galpha protein with phospholipase A2 in the plasma membrane of Eschscholzia californica.

    Science.gov (United States)

    Heinze, Michael; Steighardt, Jörg; Gesell, Andreas; Schwartze, Wieland; Roos, Werner

    2007-12-01

    Plant heterotrimeric G-proteins are involved in a variety of signaling pathways, though only one alpha and a few betagamma isoforms of their subunits exist. In isolated plasma membranes of California poppy (Eschscholzia californica), the plant-specific Galpha subunit was isolated and identified immunologically and by homology of the cloned gene with that of several plants. In the same membrane, phospholipase A(2) (PLA(2)) was activated by yeast elicitor only if GTPgammaS (an activator of Galpha) was present. From the cholate-solubilized membrane proteins, PLA(2) was co-precipitated together with Galpha by a polyclonal antiserum raised against the recombinant Galpha. In this immunoprecipitate and in the plasma membrane (but not in the Galpha-free supernatant) PLA(2) was stimulated by GTPgammaS. Plasma membranes and immunoprecipitates obtained from antisense transformants with a low Galpha content allowed no such stimulation. An antiserum raised against the C-terminus (which in animal Galphas is located near the target coupling site) precipitated Galpha without any PLA(2) activity. Using non-denaturing PAGE, complexes of solubilized plasma membrane proteins were visualized that contained Galpha plus PLA(2) activity and dissociated at pH 9.5. At this pH, PLA(2) was no longer stimulated by GTPgammaS. It is concluded that a distinct fraction of the plasma membrane-bound PLA(2) exists in a detergent-resistant complex with Galpha that can be dissociated at pH 9.5. This complex allows the Galpha-mediated activation of PLA(2).

  14. New High-Resolution 3D Seismic Imagery of Deformation and Fault Architecture Along Newport-Inglewood/Rose Canyon Fault in the Inner California Borderlands

    Science.gov (United States)

    Holmes, J. J.; Bormann, J. M.; Driscoll, N. W.; Kent, G.; Harding, A. J.; Wesnousky, S. G.

    2014-12-01

    The tectonic deformation and geomorphology of the Inner California Borderlands (ICB) records the transition from a convergent plate margin to a predominantly dextral strike-slip system. Geodetic measurements of plate boundary deformation onshore indicate that approximately 15%, or 6-8 mm/yr, of the total Pacific-North American relative plate motion is accommodated by faults offshore. The largest near-shore fault system, the Newport-Inglewood/Rose Canyon (NI/RC) fault complex, has a Holocene slip rate estimate of 1.5-2.0 mm/yr, according to onshore trenching, and current models suggest the potential to produce an Mw 7.0+ earthquake. The fault zone extends approximately 120 km, initiating from the south near downtown San Diego and striking northwards with a constraining bend north of Mt. Soledad in La Jolla and continuing northwestward along the continental shelf, eventually stepping onshore at Newport Beach, California. In late 2013, we completed the first high-resolution 3D seismic survey (3.125 m bins) of the NI/RC fault offshore of San Onofre as part of the Southern California Regional Fault Mapping project. We present new constraints on fault geometry and segmentation of the fault system that may play a role in limiting the extent of future earthquake ruptures. In addition, slip rate estimates using piercing points such as offset channels will be explored. These new observations will allow us to investigate recent deformation and strain transfer along the NI/RC fault system.

  15. An outbreak due to peanuts in their shell caused by Salmonella enterica serotypes Stanley and Newport--sharing molecular information to solve international outbreaks.

    Science.gov (United States)

    Kirk, M D; Little, C L; Lem, M; Fyfe, M; Genobile, D; Tan, A; Threlfall, J; Paccagnella, A; Lightfoot, D; Lyi, H; McIntyre, L; Ward, L; Brown, D J; Surnam, S; Fisher, I S T

    2004-08-01

    Salmonellosis is a global problem caused by the international movement of foods and high incidence in exporting countries. In September 2001, in an outbreak investigation Australia isolated Salmonella Stanley from imported peanuts, which resulted in a wider investigation in Canada, England & Wales and Scotland. Patients infected with Salmonella serotypes known to be isolated from peanuts and reported to surveillance systems were interviewed to determine exposure histories. Tagged image file format (TIFF) images of pulsed-field gel electrophoresis (PFGE) patterns of Salmonella isolates were shared electronically amongst laboratories. Laboratories tested packets of 'Brand X' peanuts from various lots and product lines. In total, 97 cases of S. Stanley and 12 cases of S. Newport infection were found. Seventy-three per cent (71/97) of S. Stanley cases were in persons of Asian ethnicity. Twenty-eight per cent of cases recalled eating Brand X peanuts and a further 13% had peanuts in their house in the previous month or had eaten Asian-style peanuts. Laboratories isolated S. Stanley, S. Newport, S. Kottbus, S. Lexington and S. Unnamed from Brand X peanuts. Isolates of S. Stanley from peanuts and human patients were indistinguishable by PFGE. This international outbreak resulted from a product originating from one country affecting several others. Rapid sharing of electronic DNA images was a crucial factor in delineating the outbreak; multinational investigations would benefit from a harmonized approach.

  16. A gonadotropin-releasing hormone-like molecule modulates the activity of diverse central neurons in a gastropod mollusk, Aplysia californica

    Directory of Open Access Journals (Sweden)

    Biao eSun

    2011-09-01

    Full Text Available In vertebrates, gonadotropin-releasing hormone (GnRH is a crucial decapeptide that activates the hypothalamic-pituitary-gonadal (HPG axis to ensure successful reproduction. Recently, a GnRH-like molecule has been isolated from a gastropod mollusk, Aplysia californica. This GnRH (ap-GnRH is deduced to be an undecapeptide, and its function remains to be explored. Our previous study demonstrated that ap-GnRH did not stimulate a range of reproductive parameters. Instead, it affected acute behavioral and locomotive changes unrelated to reproduction. In this study, we used electrophysiology and retrograde tracing to further explore the central role of ap-GnRH. Sharp electrode intracellular recordings revealed that ap-GnRH had diverse effects on central neurons that ranged from excitatory, inhibitory, to the alteration of membrane potential. Unexpectedly, extracellular recordings revealed that ap-GnRH suppressed the onset of electrical afterdischarge (AD in bag cell neurons, suggesting an inhibitory effect on female reproduction. Lastly, using immunocytochemistry (ICC coupled with nickel-backfill, we demonstrated that some ap-GnRH neurons projected to efferent nerves known to innervate the foot and parapodia, suggesting ap-GnRH may directly modulate the motor output of these peripheral tissues. Overall, our results suggested that in A. californica, ap-GnRH more likely functioned as a central modulator of complex behavior and motor regulation rather than as a conventional reproductive stimulator.

  17. Optimization of DNA isolation and PCR protocol for analysis and evaluation of genetic diversity of the medicinal plant, Anemopsis californica using RAPD.

    Science.gov (United States)

    Lizette Del-Toro-Sánchez, C; Villaseñor-Alvarado, S; Zurita-Martínez, Florentina; Castellanos-Hernández, O A; Rodríguez-Sahagún, Araceli; Isabel Torres-Morán, M; Rojas-Bravo, D; Gutiérrez-Lomelí, M

    2013-06-01

    Anemopsis californica is a perennial herbaceous plant that has been utilized as a medicinal plant for the treatment of various diseases. The present work was carried out with the objective of optimizing a method of extraction of the genomic DNA of A. californica and a PCR protocol and later to evaluate the existing genetic diversity among the genotypes deriving from different origins. For DNA extraction, we tested four procedures: with the CTA B-2 protocol, we obtained the highest yield (61.5±2.2 μg DNA/g of leaf tissues) and the best quality (A260/280 1.83±0.022). To estimate genetic variability, we utilized the randomly amplified polymorphism DNA (RAPD) technique, employing 20 oligonucleotides, of which only 18 generated reproducible banding patterns, producing 123 polymorphic bands generated, thus obtaining a polymorphism rate of 93.93% among the genotypes analyzed. The Jaccard similarity coefficient generated a variation ranging from 0.325-0.921, indicating a high level of genetic variation among the studied genotypes. An Unweighted pair-group method with arithmetic mean (UPGMA) group analysis indicated six distinct groups. The present optimized method for DNA isolation and RAPD protocol may serve as an efficient tool for further molecular studies.

  18. Analysis of benzo[c]phenanthridine alkaloids in Eschscholtzia californica cell culture using HPLC-DAD and HPLC-ESI-MS/MS.

    Science.gov (United States)

    Son, Seok Young; Rhee, Hong Soon; Lee, Min Woo; Park, Jong Moon

    2014-01-01

    Effective HPLC-DAD and HPLC-ESI-MS/MS methods have been developed for the analysis of eight benzo[c]phenanthridine alkaloids (sanguinarine, chelirubine, macarpine, chelerythrine, dihydrosanguinarine, dihydrochelirubine, dihydromacarpine and dihydrochelerythrine), which are important metabolites in Eschscholtzia californica cell culture. By adopting a ternary gradient pump system, the dihydro-form alkaloids hardly separable from each other could be successfully separated, and all the target alkaloids could be simultaneously quantified with the LOD values of 0.01-0.79 μg/mL and the LOQ values of 0.03-3.59 μg/mL. This HPLC-DAD method was further confirmed by HPLC-ESI-MS/MS system in multiple reaction monitoring mode. Each separated HPLC peak was identified as the target alkaloid, showing its relevant ionized molecule and selected fragment ion. By applying the established method, alkaloid production during the E. californica cell culture could be successfully monitored and some valuable information on its metabolism could be deduced.

  19. The effects of low levels of light at night upon the endocrine physiology of western scrub-jays (Aphelocoma californica).

    Science.gov (United States)

    Schoech, Stephan J; Bowman, Reed; Hahn, Thomas P; Goymann, Wolfgang; Schwabl, Ingrid; Bridge, Eli S

    2013-11-01

    Florida scrub-jays (Aphelocoma coerulescens) in the suburbs breed earlier than jays in native habitat. Amongst the possible factors that influence this advance (e.g., food availability, microclimate, predator regime, etc.), is exposure to artificial lights at night (LAN). LAN could stimulate the reproductive axis of the suburban jays. Alternatively, LAN could inhibit pineal melatonin (MEL), thus removing its inhibitory influence on the reproductive axis. Because Florida scrub-jays are a threatened species, we used western scrub-jays (Aphelocoma californica) to investigate the effects of LAN upon reproductive hormones and melatonin. Jays were held under conditions in which the dark-phase of the light:dark cycle was without illumination and then under low levels of LAN. Under both conditions, birds were exposed first to short-days (9.5L:14.5D) that were gradually increased to long-days (14.5L:9.5D). At various times, blood samples were collected during the light part of the cycle to measure reproductive hormones (luteinizing hormone, LH; testosterone, T; and estradiol, E2 ). Similarly, samples to assess melatonin were collected during the dark. In males, LAN caused a depression in LH levels and levels were ∼4× greater under long- than short-days. In females, there was no effect of LAN or photoperiod upon LH. LAN resulted in depressed T levels in females, although there was no effect on T in males. E2 levels in both sexes were lower under LAN than under an unlighted dark-phase. Paradoxically, MEL was higher in jays under LAN, and under long-days. MEL did not differ by sex. LAN disrupted the extraordinarily strong correlation between T and E2 that existed under unlighted nocturnal conditions. Overall, our findings fail to support the hypothesis that LAN stimulates the reproductive axis. Rather, the data demonstrate that LAN tends to inhibit reproductive hormone secretion, although not in a consistent fashion between the sexes. © 2013 Wiley Periodicals, Inc.

  20. Persistence of Escherichia coli O157:H7, Salmonella Newport, and Salmonella Poona in the gut of a free-living nematode, Caenorhabditis elegans, and transmission to progeny and uninfected nematodes.

    Science.gov (United States)

    Kenney, Stephen J; Anderson, Gary L; Williams, Phillip L; Millner, Patricia D; Beuchat, Larry R

    2005-05-25

    A study was undertaken to determine the persistence of Escherichia coli O157:H7 and salmonellae in the gut of a free-living nematode, Caenorhabditis elegans, as affected by temperature and relative humidity and to determine if infected worms transmit Salmonella enterica serotype Newport to progeny and uninfected worms. Worms were fed cells of a non-pathogenic strain of E. coli (OP50), E. coli O157:H7, S. enterica serotype Newport, and S. enterica serotype Poona, followed by incubating at 4, 20, or 37 degrees C for up to 5 days. Initial populations of ingested pathogens significantly increased by up to 2.93 log(10) cfu/worm within 1 day at 20 degrees C on K agar and remained constant for an additional 4 days. When worms were placed on Bacto agar, populations of ingested pathogens remained constant at 4 degrees C, decreased significantly at 20 degrees C, and increased significantly at 37 degrees C within 3 days. Worms fed E. coli OP50 or S. Newport were incubated at 4 or 20 degrees C at relative humidities of 33%, 75%, or 98% to determine survival characteristics of ingested bacteria. Fewer cells of the pathogens survived incubation at 33% relative humidity compared to higher relative humidities. Populations of ingested E. coli OP50 and S. Newport decreased by up to 1.65 and 3.44 log(10) cfu/worm, respectively, in worms incubated at 20 degrees C and 33% relative humidity. Placement together on K agar of adult worms, labeled with green fluorescent protein (gfp) in the pharynx area, that had ingested gfp-labeled S. Newport and uninfected wild type worms resulted in transfer of the pathogen to gut of wild type worms. S. Newport was isolated from C. elegans two generations removed from exposure to the pathogen. Results of these studies show that C. elegans may serve as a temporary reservoir of foodborne pathogens, and could perhaps be a vector for contaminating preharvest fruits and vegetables, thus potentially increasing the risk of enteric infections associated with

  1. Effects of Historical Coal Mining and Drainage from Abandoned Mines on Streamflow and Water Quality in Newport and Nanticoke Creeks, Luzerne County, Pennsylvania, 1999-2000

    Science.gov (United States)

    Chaplin, Jeffrey J.; Cravotta, Charles A.; Weitzel, Jeffrey B.; Klemow, Kenneth M.

    2007-01-01

    This report characterizes the effects of historical mining and abandoned mine drainage (AMD) on streamflow and water quality and evaluates potential strategies for AMD abatement in the 14-square-mile Newport Creek Basin and 7.6-square-mile Nanticoke Creek Basin. Both basins are mostly within the Northern Anthracite Coal Field and drain to the Susquehanna River in central Luzerne County, Pa. The U.S. Geological Survey (USGS), in cooperation with the Earth Conservancy, conducted an assessment from April 1999 to September 2000 that included (1) continuous stage measurement at 7 sites; (2) synoptic water-quality and flow sampling at 21 sites on June 2-4, 1999, and at 24 sites on October 7-8, 1999; and (3) periodic measurement of flow and water quality at 26 additional sites not included in the synoptic sampling effort. Stream water and surface runoff from the unmined uplands drain northward to the valley, where most of the water is intercepted and diverted into abandoned underground mines. Water that infiltrates into the mine workings becomes loaded with acidity, metals, and sulfate and later discharges as AMD at topographically low points along lower reaches of Newport Creek, Nanticoke Creek, and their tributaries. Differences among streamflows in unmined and mined areas of the watersheds indicated that (1) intermediate stream reaches within the mined area but upgradient of AMD sites generally were either dry or losing reaches, (2) ground water flowing to AMD sites could cross beneath surface-drainage divides, and (3) AMD discharging to the lower stream reaches restored volumes lost in the upstream reaches. The synoptic data for June and October 1999, along with continuous stage data during the study period, indicated flows during synoptic surveys were comparable to average values. The headwaters upstream of the mined area generally were oxygenated (dissolved oxygen range was 4.7 to 11.0 mg/L [milligrams per liter]), near-neutral (pH range was 5.8 to 7.6), and net

  2. Synaptobrevin/vesicle-associated membrane protein (VAMP) of Aplysia californica: structure and proteolysis by tetanus toxin and botulinal neurotoxins type D and F.

    Science.gov (United States)

    Yamasaki, S; Hu, Y; Binz, T; Kalkuhl, A; Kurazono, H; Tamura, T; Jahn, R; Kandel, E; Niemann, H

    1994-01-01

    Synaptobrevin/vesicle-associated membrane protein (VAMP) and syntaxin are potential vesicle donor and target membrane receptors of a docking complex that requires N-ethylmaleimide-sensitive factor (NSF) and soluble NSF-attachment proteins as soluble factors for vesicle fusion with target membranes. Members of this docking complex are the target of clostridial neurotoxins that act as zinc-dependent proteases. Molecular cloning of the Aplysia californica synaptobrevin cDNA revealed a 180-residue polypeptide (M(r), 19,745) with a central transmembrane region and an atypically large C-terminal intravesicular domain. This polypeptide integrates into membranes at both the co- and posttranslational level, as shown by modification of an artificially introduced N-glycosylation site. The soluble and membrane-anchored forms of synaptobrevin are cleaved by the light chains of the botulinal toxins type D and F and by tetanus toxin involving the peptide bonds Lys49-Ile50, Gln48-Lys49, and Gln66-Phe67, respectively. The active center of teh tetanus toxin light chain was identified by site-specific mutagenesis. His233, His237, Glu234, and Glu270/271 are essential to this proteolytic activity. Modification of histidine residues resulted in loss of zinc binding, whereas a replacement of Glu234 only slightly reduced the zinc content. Images PMID:8197120

  3. Protection against Amoebic Liver Abscess in Hamster by Intramuscular Immunization with an Autographa californica Baculovirus Driving the Expression of the Gal-Lectin LC3 Fragment.

    Science.gov (United States)

    Meneses-Ruiz, Dulce María; Aguilar-Diaz, Hugo; Bobes, Raúl José; Sampieri, Alicia; Vaca, Luis; Laclette, Juan Pedro; Carrero, Julio César

    2015-01-01

    In a previous study, we demonstrated that oral immunization using Autographa californica baculovirus driving the expression of the Gal-lectin LC3 fragment (AcNPV-LC3) of Entamoeba histolytica conferred protection against ALA development in hamsters. In this study, we determined the ability of AcNPV-LC3 to protect against ALA by the intramuscular route as well as the liver immune response associated with protection. Results showed that 55% of hamsters IM immunized with AcNPV-LC3 showed sterile protection against ALA, whereas other 20% showed reduction in the size and extent of abscesses, resulting in some protection in 75% of animals compared to the sham control group. Levels of protection showed a linear correlation with the development and intensity of specific antiamoeba cellular and humoral responses, evaluated in serum and spleen of hamsters, respectively. Evaluation of the Th1/Th2 cytokine patterns expressed in the liver of hamsters showed that sterile protection was associated with the production of high levels of IFNγ and IL-4. These results suggest that the baculovirus system is equally efficient by the intramuscular as well as the oral routes for ALA protection and that the Gal-lectin LC3 fragment is a highly protective antigen against hepatic amoebiasis through the local induction of IFNγ and IL-4.

  4. Protection against Amoebic Liver Abscess in Hamster by Intramuscular Immunization with an Autographa californica Baculovirus Driving the Expression of the Gal-Lectin LC3 Fragment

    Science.gov (United States)

    Meneses-Ruiz, Dulce María; Aguilar-Diaz, Hugo; Bobes, Raúl José; Sampieri, Alicia; Laclette, Juan Pedro; Carrero, Julio César

    2015-01-01

    In a previous study, we demonstrated that oral immunization using Autographa californica baculovirus driving the expression of the Gal-lectin LC3 fragment (AcNPV-LC3) of Entamoeba histolytica conferred protection against ALA development in hamsters. In this study, we determined the ability of AcNPV-LC3 to protect against ALA by the intramuscular route as well as the liver immune response associated with protection. Results showed that 55% of hamsters IM immunized with AcNPV-LC3 showed sterile protection against ALA, whereas other 20% showed reduction in the size and extent of abscesses, resulting in some protection in 75% of animals compared to the sham control group. Levels of protection showed a linear correlation with the development and intensity of specific antiamoeba cellular and humoral responses, evaluated in serum and spleen of hamsters, respectively. Evaluation of the Th1/Th2 cytokine patterns expressed in the liver of hamsters showed that sterile protection was associated with the production of high levels of IFNγ and IL-4. These results suggest that the baculovirus system is equally efficient by the intramuscular as well as the oral routes for ALA protection and that the Gal-lectin LC3 fragment is a highly protective antigen against hepatic amoebiasis through the local induction of IFNγ and IL-4. PMID:26090442

  5. Effects of CO2-induced pH reduction on the exoskeleton structure and biophotonic properties of the shrimp Lysmata californica.

    Science.gov (United States)

    Taylor, Jennifer R A; Gilleard, Jasmine M; Allen, Michael C; Deheyn, Dimitri D

    2015-06-01

    The anticipated effects of CO2-induced ocean acidification on marine calcifiers are generally negative, and include dissolution of calcified elements and reduced calcification rates. Such negative effects are not typical of crustaceans for which comparatively little ocean acidification research has been conducted. Crustaceans, however, depend on their calcified exoskeleton for many critical functions. Here, we conducted a short-term study on a common caridean shrimp, Lysmata californica, to determine the effect of CO2-driven reduction in seawater pH on exoskeleton growth, structure, and mineralization and animal cryptic coloration. Shrimp exposed to ambient (7.99 ± 0.04) and reduced pH (7.53 ± 0.06) for 21 days showed no differences in exoskeleton growth (percent increase in carapace length), but the calcium weight percent of their cuticle increased significantly in reduced pH conditions, resulting in a greater Ca:Mg ratio. Cuticle thickness did not change, indicating an increase in the mineral to matrix ratio, which may have mechanical consequences for exoskeleton function. Furthermore, there was a 5-fold decrease in animal transparency, but no change in overall shrimp coloration (red). These results suggest that even short-term exposure to CO2-induced pH reduction can significantly affect exoskeleton mineralization and shrimp biophotonics, with potential impacts on crypsis, physical defense, and predator avoidance.

  6. Three-dimensional visualization of the Autographa californica multiple nucleopolyhedrovirus occlusion-derived virion envelopment process gives new clues as to its mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Shi, Yang; Li, Kunpeng [State Key Laboratory of Biocontrol, School of Life Sciences, Sun Yat-sen University, Guangzhou (China); Tang, Peiping [State Key Laboratory of Biocontrol, School of Life Sciences, Sun Yat-sen University, Guangzhou (China); Hefei National Laboratory for Physical Sciences at the Microscale, and School of Life Sciences, University of Science and Technology of China, Hefei, Anhui (China); Li, Yinyin; Zhou, Qiang; Yang, Kai [State Key Laboratory of Biocontrol, School of Life Sciences, Sun Yat-sen University, Guangzhou (China); Zhang, Qinfen, E-mail: lsszqf@mail.sysu.edu.cn [State Key Laboratory of Biocontrol, School of Life Sciences, Sun Yat-sen University, Guangzhou (China)

    2015-02-15

    Baculoviruses produce two virion phenotypes, occlusion-derived virion (ODV) and budded virion (BV). ODV envelopment occurs in the nucleus. Morphogenesis of the ODV has been studied extensively; however, the mechanisms underlying microvesicle formation and ODV envelopment in nuclei remain unclear. In this study, we used electron tomography (ET) together with the conventional electron microscopy to study the envelopment of Autographa californica multiple nucleopolyhedrovirus (AcMNPV) ODV. Our results demonstrate that not only the inner but also the outer nuclear membrane can invaginate and vesiculate into microvesicles and that intranuclear microvesicles are the direct source of the ODV membrane. Five main events in the ODV envelopment process are summarized, from which we propose a model to explain this process. - Highlights: • Both the inner and outer nuclear membranes could invaginate. • Both the inner and outer nuclear membranes could vesiculate into microvesicles. • Five main events in the ODV envelopment process are summarized. • A model is proposed to explain this ODV envelopment.

  7. Protection against Amoebic Liver Abscess in Hamster by Intramuscular Immunization with an Autographa californica Baculovirus Driving the Expression of the Gal-Lectin LC3 Fragment

    Directory of Open Access Journals (Sweden)

    Dulce María Meneses-Ruiz

    2015-01-01

    Full Text Available In a previous study, we demonstrated that oral immunization using Autographa californica baculovirus driving the expression of the Gal-lectin LC3 fragment (AcNPV-LC3 of Entamoeba histolytica conferred protection against ALA development in hamsters. In this study, we determined the ability of AcNPV-LC3 to protect against ALA by the intramuscular route as well as the liver immune response associated with protection. Results showed that 55% of hamsters IM immunized with AcNPV-LC3 showed sterile protection against ALA, whereas other 20% showed reduction in the size and extent of abscesses, resulting in some protection in 75% of animals compared to the sham control group. Levels of protection showed a linear correlation with the development and intensity of specific antiamoeba cellular and humoral responses, evaluated in serum and spleen of hamsters, respectively. Evaluation of the Th1/Th2 cytokine patterns expressed in the liver of hamsters showed that sterile protection was associated with the production of high levels of IFNγ and IL-4. These results suggest that the baculovirus system is equally efficient by the intramuscular as well as the oral routes for ALA protection and that the Gal-lectin LC3 fragment is a highly protective antigen against hepatic amoebiasis through the local induction of IFNγ and IL-4.

  8. Evidence for the involvement of carbonic anhydrase and urease in calcium carbonate formation in the gravity-sensing organ of Aplysia californica

    Science.gov (United States)

    Pedrozo, H. A.; Schwartz, Z.; Dean, D. D.; Harrison, J. L.; Campbell, J. W.; Wiederhold, M. L.; Boyan, B. D.

    1997-01-01

    To better understand the mechanisms that could modulate the formation of otoconia, calcium carbonate granules in the inner ear of vertebrate species, we examined statoconia formation in the gravity-sensing organ, the statocyst, of the gastropod mollusk Aplysia californica using an in vitro organ culture model. We determined the type of calcium carbonate present in the statoconia and investigated the role of carbonic anhydrase (CA) and urease in regulating statocyst pH as well as the role of protein synthesis and urease in statoconia production and homeostasis in vitro. The type of mineral present in statoconia was found to be aragonitic calcium carbonate. When the CA inhibitor, acetazolamide (AZ), was added to cultures of statocysts, the pH initially (30 min) increased and then decreased. The urease inhibitor, acetohydroxamic acid (AHA), decreased statocyst pH. Simultaneous addition of AZ and AHA caused a decrease in pH. Inhibition of urease activity also reduced total statoconia number, but had no effect on statoconia volume. Inhibition of protein synthesis reduced statoconia production and increased statoconia volume. In a previous study, inhibition of CA was shown to decrease statoconia production. Taken together, these data show that urease and CA play a role in regulating statocyst pH and the formation and maintenance of statoconia. CA produces carbonate ion for calcium carbonate formation and urease neutralizes the acid formed due to CA action, by production of ammonia.

  9. Detection of Salmonella enterica Serovar Montevideo and Newport in Free-ranging Sea Turtles and Beach Sand in the Caribbean and Persistence in Sand and Seawater Microcosms.

    Science.gov (United States)

    Ives, A-K; Antaki, E; Stewart, K; Francis, S; Jay-Russell, M T; Sithole, F; Kearney, M T; Griffin, M J; Soto, E

    2017-09-01

    Salmonellae are Gram-negative zoonotic bacteria that are frequently part of the normal reptilian gastrointestinal flora. The main objective of this project was to estimate the prevalence of non-typhoidal Salmonella enterica in the nesting and foraging populations of sea turtles on St. Kitts and in sand from known nesting beaches. Results suggest a higher prevalence of Salmonella in nesting leatherback sea turtles compared with foraging green and hawksbill sea turtles. Salmonella was cultured from 2/9 and identified by molecular diagnostic methods in 3/9 leatherback sea turtle samples. Salmonella DNA was detected in one hawksbill turtle, but viable isolates were not recovered from any hawksbill sea turtles. No Salmonella was detected in green sea turtles. In samples collected from nesting beaches, Salmonella was only recovered from a single dry sand sample. All recovered isolates were positive for the wzx gene, consistent with the O:7 serogroup. Further serotyping characterized serovars Montevideo and Newport present in cloacal and sand samples. Repetitive-element palindromic PCR (rep-PCR) fingerprint analysis and pulsed-field gel electrophoresis of the 2014 isolates from turtles and sand as well as archived Salmonella isolates recovered from leatherback sea turtles in 2012 and 2013, identified two distinct genotypes and four different pulsotypes, respectively. The genotyping and serotyping were directly correlated. To determine the persistence of representative strains of each serotype/genotype in these environments, laboratory-controlled microcosm studies were performed in water and sand (dry and wet) incubated at 25 or 35°C. Isolates persisted for at least 32 days in most microcosms, although there were significant decreases in culturable bacteria in several microcosms, with the greatest reduction in dry sand incubated at 35°C. This information provides a better understanding of the epizootiology of Salmonella in free-ranging marine reptiles and the potential

  10. The Protamine-like DNA-binding Protein P6.9 Epigenetically Up-regulates Autographa californica Multiple Nucleopolyhedrovirus Gene Transcription in the Late Infection Phase

    Institute of Scientific and Technical Information of China (English)

    Ying Peng; Kun Li; Rong-juan Pei; Chun-chen Wu; Chang-yong Liang; Yun Wang; Xin-wen Chen

    2012-01-01

    Protamines are a group of highly basic proteins first discovered in spermatozoon that allow for denser packaging of DNA than histones and will result in down-regulation of gene transcription[1].It is well recognized that the Autographa californica multicapsid nucleopolyhedrovirus (AcMNPV) encodes P6.9,a protamine-like protein that forms the viral subnucleosome through binding to the viral genome[29].Previous research demonstrates that P6.9 is essential for viral nucleocapsid assembly,while it has no influence on viral genome replication[31].In the present study,the role of P6.9 in viral gene transcription regulation is characterized.In contrast to protamines or other protamine-like proteins that usually down-regulate gene transcription,P6.9 appears to up-regulate viral gene transcription at 12-24 hours post infection (hpi),whereas it is non-essential for the basal level of viral gene transcription.Fluorescence microscopy reveals the P6.9's co-localization with DNA is temporally and spatially synchronized with P6.9's impact on viral gene transcription,indicating the P6.9-DNA association contributes to transcription regulation.Chromatin fractionation assay further reveals an unexpected co-existence of P6.9 and host RNA polymerase Ⅱ in the same transcriptionally active chromatin fraction at 24 hpi,which may probably contribute to viral gene transcription up-regulation in the late infection phase.

  11. Autographa californica multicapsid nucleopolyhedrovirus efficiently infects Sf9 cells and transduces mammalian cells via direct fusion with the plasma membrane at low pH.

    Science.gov (United States)

    Dong, Sicong; Wang, Manli; Qiu, Zhijuan; Deng, Fei; Vlak, Just M; Hu, Zhihong; Wang, Hualin

    2010-05-01

    The budded virus (BV) of the Autographa californica multicapsid nucleopolyhedrovirus (AcMNPV) infects insect cells and transduces mammalian cells mainly through the endocytosis pathway. However, this study revealed that the treatment of the virus bound to Sf9 cells at low pH could efficiently rescue the infectivity of AcMNPV in the presence of endocytosis pathway inhibitors. A colocalization assay of the major capsid protein VP39 with the early endosome marker EEA1 showed that at low pH, AcMNPV entered Sf9 cells via an endosome-independent pathway. Using a fluorescent probe (R18), we showed that at low pH, the viral nucleocapsid entered Sf9 cells via direct fusion at the cell surface. By using the myosin-specific inhibitor 2,3-butanedione monoxime (BDM) and the microtubule inhibitor nocodazole, the low pH-triggered direct fusion was demonstrated to be dependent on myosin-like proteins and independent of microtubules. The reverse transcription-PCR of the IE1 gene as a marker for viral entry showed that the kinetics of AcMNPV in cells triggered by low pH was similar to that of the normal entry via endocytosis. The low pH-mediated infection assay and VP39 and EEA1 colocalization assay also demonstrated that AcMNPV could efficiently transduce mammalian cells via direct membrane fusion at the cell surface. More importantly, we found that a low-pH trigger could significantly improve the transduction efficiency of AcMNPV in mammalian cells, leading to the potential application of this method when using baculovirus as a vector for heterologous gene expression and for gene therapy.

  12. Cloning and characterization of a Dim1-like mitosis gene of Spodoptera frugiperda cells (Sf9) induced by Autographa californica multiple nucleopolyhedrovirus.

    Science.gov (United States)

    Mehrabadi, Mohammad; Hussain, Mazhar; Asgari, Sassan

    2013-06-01

    Dim1 proteins are evolutionarily highly conserved throughout the eukaryotes and are present in numerous species. These proteins are essential for mitosis and pre-mRNA splicing. In this study, the full-length cDNA of Dim1-like gene from Spodoptera frugiperda cells (Sf9) was obtained. S. frugiperda Dim1 (SfDim1) cDNA is comprised of 975 bp including a 429 bp open reading frame (ORF), 225 bp 5' untranslated region (5' UTR), and 321 bp 3' untranslated region (3' UTR) with a poly A tail. The predicted polypeptide encoded by this gene is 142 aa with a molecular weight of 16.76 kDa and a PI of 5.53. Sequence alignment and phylogenetic analysis showed high similarities with Dim1 of other species. The evolutionary conserved site of Dim1 proteins ((35)Asp-Pro-Thr-Cys(38)) is also present in SfDim1. Silencing of SfDim1 gene decreased cell proliferation at 72 h post-treatment in comparison to mock and control transfected cells. Using RT-PCR, we found relatively higher SfDim1 transcript levels following Autographa californica multicapsid nucleopolyhedrovirus (AcMNPV) infection compared to mock-infected cells from 4h post-infection (hpi) up until 24 hpi. The expression level diminished dramatically at 36 hpi up to 120 hpi with no expression detected at 144 hpi. Silencing of SfDim1 resulted in lower levels of virus DNA production in comparison to mock-infected cells, which suggested that SfDim1 might benefit the virus and facilitate viral replication. Overall, the results showed that SfDim1 protein is involved in cell proliferation as well as cell-virus interaction.

  13. Removal of transposon target sites from the Autographa californica multiple nucleopolyhedrovirus fp25k gene delays, but does not prevent, accumulation of the few polyhedra phenotype.

    Science.gov (United States)

    Giri, Lopamudra; Li, Huarang; Sandgren, David; Feiss, Michael G; Roller, Richard; Bonning, Bryony C; Murhammer, David W

    2010-12-01

    Low-cost, large-scale production of the baculovirus Autographa californica multiple nucleopolyhedrovirus (AcMNPV) using continuous insect cell culture is seriously hindered by the accumulation of AcMNPV mutants. Specifically, few-polyhedra (FP) mutants, with a reduced yield of occluded virus (polyhedra) and decreased infectivity, usually accumulate upon passaging in cell culture. FP mutations result from transposon insertions in the baculovirus fp25k gene, leading to significantly reduced levels of FP25K protein synthesis. This study evaluated the effects of removing the transposon insertion sites from the wild-type baculovirus fp25k gene; the mutated virus was denoted Ac-FPm. Specifically, this study involved a detailed comparison of wild-type (WT) AcMNPV and Ac-FPm with regard to the proportion of cells having polyhedra, number of polyhedra per cell, the fraction of empty polyhedra, number of occlusion-derived viruses per polyhedron, number of nucleocapsids in the nuclei, FP25K protein synthesis and genetic analysis of the fp25k gene. Removal of TTAA transposon insertion sites from the fp25k gene stabilized FP25K protein synthesis and delayed the appearance of the FP phenotype from passage 5 to passage 10. Electron micrographs revealed that more virus particles were found inside the nuclei of cells infected with Ac-FPm than in the nuclei of cells infected with WT AcMNPV (at passage 10). Abnormalities, however, were observed in envelopment of nucleocapsids and virus particle occlusion within Ac-FPm polyhedra. Thus, the FP phenotype appeared in spite of continued FP25K protein synthesis, suggesting that mechanisms other than fp25k gene disruption can lead to the FP phenotype.

  14. Possible Connections Between the Coronado Bank Fault Zone and the Newport-Inglewood, Rose Canyon, and Palos Verdes Fault Zones Offshore San Diego County, California.

    Science.gov (United States)

    Sliter, R. W.; Ryan, H. F.

    2003-12-01

    Lasuen Knoll. The eastern strand trends toward the Newport-Inglewood fault zone (NIFZ) as imaged offshore near Dana Point. These connections suggest that the CBFZ is linked at depth with other prominent fault zones to the north (PVFZ and NIFZ) as well as to the south (RCFZ).

  15. Evidence of sub Kilometer-scale Variability in Stress Directions near Active Faults: An Example from the Newport-Inglewood Fault, Southern California

    Science.gov (United States)

    Persaud, P.; Stock, J. M.; Smith, D.

    2015-12-01

    The active Newport-Inglewood Fault (NIF) zone is a series of right-lateral, left-stepping en echelon segments and associated anticlines that produced the 1933 Long Beach Mw 6.4 earthquake. Seismic hazard estimates, dynamic earthquake rupture models, and earthquake simulations for Southern California rely on information on the stress field obtained from the Community Stress Model (CSM), though the latter still lacks observational constraints. This study provides much needed observational constraints on in-situ stress, which are useful for validating the CSM. Our results highlight the possibility of variations in stress directions near active faults at length-scales less than 1 km. We determined the orientation of stress-induced compressive failures or borehole breakouts, which are reliable indicators of the orientation of the maximum horizontal stress (SH) in over 40 wellbores in the Los Angeles basin near the NIF. The compressional jogs along the fault have long been drilled for oil in this major metropolitan area, and so provide the dataset of oriented caliper logs. This allowed us to investigate the variation of SH direction in three oil fields. In the Inglewood oil field, a dense dataset of 24 wells in ~2 km2, SH varies from N9°E to N32°E over a depth range of 1-3 km and within 400 m of the fault in the western fault block, with more variability occurring in wells father away. At depths below 2 km, SH takes on a more northerly orientation. In contrast, SH is oriented E-W in the eastern fault block, based on constraints from two wells. In the Wilmington oil field located between the Thums-Huntington Beach Fault and the NIF, data from 11 deviated wells yields a pattern of elongation directions, which differs from the more complex pattern obtained for the Huntington Beach wells located ~12 km to the southeast. The short-length-scale variations in SH direction are attributed to the proximity to faults or fault segmentation, and indicate the likely complexity that

  16. Dive and Explore: An Interactive Exhibit That Simulates Making an ROV Dive to a Submarine Volcano, Hatfield Marine Science Visitor Center, Newport, Oregon

    Science.gov (United States)

    Weiland, C.; Chadwick, W. W.; Hanshumaker, W.; Osis, V.; Hamilton, C.

    2002-12-01

    We have created a new interactive exhibit in which the user can sit down and simulate that they are making a dive to the seafloor with the remotely operated vehicle (ROV) named ROPOS. The exhibit immerses the user in an interactive experience that is naturally fun but also educational. This new public display is located at the Hatfield Marine Science Visitor Center in Newport, Oregon. The exhibit is designed to look like the real ROPOS control console and includes three video monitors, a PC, a DVD player, an overhead speaker, graphic panels, buttons, lights, dials, and a seat in front of a joystick. The dives are based on real seafloor settings at Axial seamount, an active submarine volcano on the Juan de Fuca Ridge (NE Pacific) that is also the location of a seafloor observatory called NeMO. The user can choose between 1 of 3 different dives sites in the caldera of Axial Volcano. Once a dive is chosen, then the user watches ROPOS being deployed and then arrives into a 3-D computer-generated seafloor environment that is based on the real world but is easier to visualize and navigate. Once on the bottom, the user is placed within a 360 degree panorama and can look in all directions by manipulating the joystick. By clicking on markers embedded in the scene, the user can then either move to other panorama locations via movies that travel through the 3-D virtual environment, or they can play video clips from actual ROPOS dives specifically related to that scene. Audio accompanying the video clips informs the user where they are going or what they are looking at. After the user is finished exploring the dive site they end the dive by leaving the bottom and watching the ROV being recovered onto the ship at the surface. The user can then choose a different dive or make the same dive again. Within the three simulated dives there are a total of 6 arrival and departure movies, 7 seafloor panoramas, 12 travel movies, and 23 ROPOS video clips. The exhibit software was created

  17. Expression patterns of STM-like KNOX and Histone H4 genes in shoot development of the dissected-leaved basal eudicot plants Chelidonium majus and Eschscholzia californica (Papaveraceae).

    Science.gov (United States)

    Groot, Edwin P; Sinha, Neelima; Gleissberg, Stefan

    2005-06-01

    Knotted-like homeobox (KNOX) genes encode important regulators of shoot development in flowering plants. In Arabidopsis, class I KNOX genes are part of a regulatory system that contributes to indeterminacy of shoot development, delimitation of leaf primordia and internode development. In other species, class I KNOX genes have also been recruited in the control of marginal blastozone fractionation during dissected leaf development. Here we report the isolation of class I KNOX genes from two species of the basal eudicot family Papaveraceae, Chelidonium majus and Eschscholzia californica. Sequence comparisons and expression patterns indicate that these genes are orthologs of SHOOTMERISTEMLESS (STM), a class I KNOX gene from Arabidopsis. Both genes are expressed in the center of vegetative and floral shoot apical meristems (SAM), but downregulated at leaf or floral organ initiating sites. While Eschscholzia californica STM (EcSTM) is again upregulated during acropetal pinna formation, in situ hybridization could not detect Chelidonium majus STM (CmSTM) transcripts at any stage of basipetal leaf development, indicating divergent evolution of STM gene function in leaves within Papaveraceae. Immunolocalization of KNOX proteins indicate that other gene family members may control leaf dissection in both species. The contrasting direction of pinna initiation in the two species was also investigated using Histone H4 expression. Leaves at early stages of development did not reveal notable differences in cell division activity of the elongating leaf axis, suggesting that differential meristematic growth may not play a role in determining the observed dissection patterns.

  18. Floral homeotic C function genes repress specific B function genes in the carpel whorl of the basal eudicot California poppy (Eschscholzia californica

    Directory of Open Access Journals (Sweden)

    Yellina Aravinda L

    2010-12-01

    Full Text Available Abstract Background The floral homeotic C function gene AGAMOUS (AG confers stamen and carpel identity and is involved in the regulation of floral meristem termination in Arabidopsis. Arabidopsis ag mutants show complete homeotic conversions of stamens into petals and carpels into sepals as well as indeterminacy of the floral meristem. Gene function analysis in model core eudicots and the monocots rice and maize suggest a conserved function for AG homologs in angiosperms. At the same time gene phylogenies reveal a complex history of gene duplications and repeated subfunctionalization of paralogs. Results EScaAG1 and EScaAG2, duplicate AG homologs in the basal eudicot Eschscholzia californica show a high degree of similarity in sequence and expression, although EScaAG2 expression is lower than EScaAG1 expression. Functional studies employing virus-induced gene silencing (VIGS demonstrate that knock down of EScaAG1 and 2 function leads to homeotic conversion of stamens into petaloid structures and defects in floral meristem termination. However, carpels are transformed into petaloid organs rather than sepaloid structures. We also show that a reduction of EScaAG1 and EScaAG2 expression leads to significantly increased expression of a subset of floral homeotic B genes. Conclusions This work presents expression and functional analysis of the two basal eudicot AG homologs. The reduction of EScaAG1 and 2 functions results in the change of stamen to petal identity and a transformation of the central whorl organ identity from carpel into petal identity. Petal identity requires the presence of the floral homeotic B function and our results show that the expression of a subset of B function genes extends into the central whorl when the C function is reduced. We propose a model for the evolution of B function regulation by C function suggesting that the mode of B function gene regulation found in Eschscholzia is ancestral and the C-independent regulation as

  19. Effect of osmotic stress and post-stress recovery on the content of phenolics and properties of antioxidants in germinating seeds of grapevine Vitis californica

    Directory of Open Access Journals (Sweden)

    Stanisław Weidner

    2011-05-01

    Full Text Available The tested material consisted of grapevine Vitis californica stratified seeds germinated under optimum conditions (+25°C in water, under osmotic stress (-0.2 MPa in PEG solution and submitted to recovery after stress (+25°C in water. The germinating seeds were determined to contain tannins, catechins and the following phenolic acids: gallic, caffeic, p-coumaric and ferulic. The acids occurred in free, ester- and glycoside-bound forms. The dominant form of phenolic acids was the ester-bound fraction. Gallic acid was the most abundant phenolic acid in germinating seeds, while ferulic acid appeared in the smallest amounts. Our analysis of tannins demonstrated that osmotic stress depressed their concentration. Presence of catechin group compounds such as catechin and epicatechin was also determined. In each sample epicatechin was dominant. The total concentration of catechin increased under stress conditions and declined during post-stress recovery. Catechins are a constituent of tannins and their increase under osmotic stress is most probably caused by the breakdown of some tannins in seeds germinating under stress conditions. Samples submitted to osmotic stress were also found to contain less of total phenolic compounds, whereas in samples which underwent post-stress recovery the total level of phenolic compounds increased. Compared to extracts from seeds germinating under optimum conditions, osmotic stress depressed the capacity of extract to scavenge DPPH● (2,2-diphenyl-1-picrylhydrazyl and ABTS●+ – 2,2-Azino-bis (3-etylbenzothiazoline-6-sulfonic acid free radicals, but the antioxidant activity rose in seeds submitted to recovery after stress. Positive correlation was therefore demonstrated between the total content of phenolic acids in germinating grapevine seeds and the reducing power of extracts obtained from these seeds and their free radical scavenging activity. The results suggest that osmotic stress inhibits the activity of

  20. SURVEY, Newport News City, VA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — The field survey data for this coastal study includes a field report that exhibits photos and transect information collected in the field survey phase of the study....

  1. Naval Station Newport Wind Resource Assessment. A Study Prepared in Partnership with the Environmental Protection Agency for the RE-Powering America's Land Initiative: Siting Renewable Energy on Potentially Contaminated Land and Mine Sites, and The Naval Facilities Engineering Service Center

    Energy Technology Data Exchange (ETDEWEB)

    Robichaud, R.; Fields, J.; Roberts, J. O.

    2012-02-01

    The U.S. Environmental Protection Agency (EPA) launched the RE-Powering America's Land initiative to encourage development of renewable energy (RE) on potentially contaminated land and mine sites. EPA is collaborating with the U.S. Department of Energy's (DOE's) National Renewable Energy Laboratory (NREL) to evaluate RE options at Naval Station (NAVSTA) Newport in Newport, Rhode Island where multiple contaminated areas pose a threat to human health and the environment. Designated a superfund site on the National Priorities List in 1989, the base is committed to working toward reducing the its dependency on fossil fuels, decreasing its carbon footprint, and implementing RE projects where feasible. The Naval Facilities Engineering Service Center (NFESC) partnered with NREL in February 2009 to investigate the potential for wind energy generation at a number of Naval and Marine bases on the East Coast. NAVSTA Newport was one of several bases chosen for a detailed, site-specific wind resource investigation. NAVSTA Newport, in conjunction with NREL and NFESC, has been actively engaged in assessing the wind resource through several ongoing efforts. This report focuses on the wind resource assessment, the estimated energy production of wind turbines, and a survey of potential wind turbine options based upon the site-specific wind resource.

  2. [Synthesis and acceptor properties of 11-[(9'-anthracenyl)methoxy]undecyl phosphate and P1-{11-[(9'-anthracenyl)methoxy]undecyl}-P2-(alpha-D-galactopyranosyl) diphosphate in the enzymic reactions catalyzed by galactosylphosphotransferase and mannosyltransferase from Salmonella newport].

    Science.gov (United States)

    Vinnikova, A N; Utkina, N S; Danilov, L L; Torgov, V I; Druzhinina, T N; Veselovskiĭ, V V

    2013-01-01

    Fluorescent 11-[(9'-anthracenyl)methoxy]undecyl phosphate and P1-{11-[(9'-anthracenyl)methoxy]undecyl}-P2-(alpha-D-galactopyranosyl) diphosphate were chemically synthesized for the first time. The ability of the first compound to serve as substrate-acceptor ofgalactosyl phosphate residue and the second compound of mannosyl residue in enzymic reactions catalyzed by galactosylphosphotransferase and mannosyltransferase from Salmonella newport membrane preparation was demonstrated.

  3. Application of an integrated LC-UV-MS-NMR platform to the identification of secondary metabolites from cell cultures: benzophenanthridine alkaloids from elicited Eschscholzia californica (california poppy) cell cultures().

    Science.gov (United States)

    Gathungu, Rose M; Oldham, John T; Bird, Susan S; Lee-Parsons, Carolyn W T; Vouros, Paul; Kautz, Roger

    2012-01-01

    Plant cell and tissue cultures are a scalable and controllable alternative to whole plants for obtaining natural products of medical relevance. Cultures can be optimized for high yields of desired metabolites using rapid profiling assays such as HPLC. We describe an approach to establishing a rapid assay for profiling cell culture expression systems using a novel microscale LC-UV-MS-NMR platform, designed to acquire both MS and NMR each at their optimal sensitivity, by using nanosplitter MS from 4 mm analytical HPLC columns, and offline microdroplet NMR. The approach is demonstrated in the analysis of elicited Eschscholzia californica cell cultures induced with purified yeast extract to produce benzophenanthridine alkaloids. Preliminary HPLC-UV provides an overview of the changes in the production of alkaloids with time after elicitation. At the time point corresponding to the production of the most alkaloids, the integrated LC-MS-microcoil NMR platform is used for structural identification of extracted alkaloids. Eight benzophenanthridine alkaloids were identified at the sub-microgram level. This paper demonstrates the utility of the nanosplitter LC-MS/microdroplet NMR platform when establishing cell culture expression systems.

  4. Chemical kinetic measurements of the effect of trans- and cis-3,3'-Bis[(trimethylammonio)methyl]azobenzene bromide on acetylcholine receptor mediated ion translocation in Electrophorus electricus and Torpedo californica.

    Science.gov (United States)

    Delcour, A H; Hess, G P

    1986-04-08

    A quench-flow technique was used to study the effect of trans- and cis-3,3'-bis[(trimethylammonio)methyl]azobenzene bromide (trans- and cis-Bis-Q), photoisomerizable ligands, on the acetylcholine receptor in vesicles prepared from the electric organ of Electrophorus electricus and of Torpedo californica. In E. electricus, two rate coefficients of the receptor-mediated translocation of 86Rb+ induced with trans-Bis-Q were measured: JA, the rate coefficient for ion flux, and alpha, the rate coefficient for receptor inactivation (desensitization). Both rate coefficients increase with increasing concentrations of Bis-Q up to 50 microM. At higher concentrations JA decreases in a concentration-dependent manner while alpha remains unchanged. This effect was previously observed with suberyldicholine [Pasquale, E. B., Takeyasu, K., Udgaonkar, J., Cash, D.J., Severski, M.C., & Hess, G. P. (1983) Biochemistry 22, 5967-5973] and with acetylcholine [Takeyasu, K., Udgaonkar, J., & Hess, G. P. (1983) Biochemistry 22, 5973-5978] and was analyzed in terms of a minimum mechanism that accounts for the properties of activation, desensitization, and inhibition of the receptor. Two molecules of trans-Bis-Q must be bound for the channel to open, but at concentrations greater than 50 microM the population of open channels decreases because of the additional binding of one molecule of trans-Bis-Q to a regulatory inhibitory site, independent of the activating sites. cis-Bis-Q does not induce transmembrane ion flux, but it does inhibit the response of the receptor to acetylcholine and induces inactivation (desensitization) in the micromolar range.(ABSTRACT TRUNCATED AT 250 WORDS)

  5. Reduction of polyhedrin mRNA and protein expression levels in Sf9 and Hi5 cell lines, but not in Sf21 cells, infected with Autographa californica multiple nucleopolyhedrovirus fp25k mutants.

    Science.gov (United States)

    Cheng, Xin-Hua; Hillman, Christopher C; Zhang, Chuan-Xi; Cheng, Xiao-Wen

    2013-01-01

    During cell infection, the fp25k gene of baculoviruses frequently mutates, producing the few polyhedra (FP) per cell phenotype with reduced polyhedrin (polh) expression levels compared with wild-type baculoviruses. Here we report that the fp25k gene of the model baculovirus, Autographa californica multiple nucleopolyhedrovirus (AcMNPV), contains two hypermutable seven-adenine (A7) mononucleotide repeats (MNRs) that were mutated to A8 MNRs and a TTAA site that had host DNA insertions, producing fp25k mutants during Sf21 cell infection. The FP phenotype in Sf9 and Hi5 cells was more pronounced than in Sf21 cells. AcMNPV fp25k mutants produced similar levels of polyhedra or enhanced GFP, which were both under the control of the AcMNPV polh promoter for expression, in Sf21 cells but lower levels in Sf9 and Hi5 cells compared with AcMNPV with an intact fp25k gene. This correlated with the polh mRNA levels detected in each cell line. The majority of Sf21 cells infected with fp25 mutants showed high polh promoter-mediated GFP expression levels. Two cell lines subcloned from Sf21 cells that were infected with fp25k mutants showed different GFP expression levels. Furthermore, a small proportion of Hi5 cells infected with fp25k mutants showed higher production of polyhedra and GFP expression than the rest, and the latter was not correlated with increased m.o.i. Therefore, these data suggest that AcMNPV polh promoter-mediated gene expression activities differ in the three cell lines and are influenced by different cells within the cell line.

  6. The chemistry of escapin: identification and quantification of the components in the complex mixture generated by an L-amino acid oxidase in the defensive secretion of the sea snail Aplysia californica.

    Science.gov (United States)

    Kamio, Michiya; Ko, Ko-Chun; Zheng, Shilong; Wang, Binghe; Collins, Stacy L; Gadda, Giovanni; Tai, Phang C; Derby, Charles D

    2009-01-01

    Escapin is an L-amino acid oxidase in the ink of a marine snail, the sea hare Aplysia californica, which oxidizes L-lysine (1) to produce a mixture of chemicals which is antipredatory and antimicrobial. The goal of our study was to determine the identity and relative abundance of the constituents of this mixture, using molecules generated enzymatically with escapin and also using products of organic syntheses. We examined this mixture under the natural range of pH values for ink-from approximately 5 at full strength to approximately 8 when fully diluted in sea water. The enzymatic reaction likely forms an equilibrium mixture containing the linear form alpha-keto-epsilon-aminocaproic acid (2), the cyclic imine Delta(1)-piperidine-2-carboxylic acid (3), the cyclic enamine Delta(2)-piperidine-2-carboxylic acid (4), possibly the linear enol 6-amino-2-hydroxy-hex-2-enoic acid (7), the alpha-dihydroxy acid 6-amino-2,2-dihydroxy-hexanoic acid (8), and the cyclic aminol 2-hydroxy-piperidine-2-carboxylic acid (9). Using NMR and mass spectroscopy, we show that 3 is the major component of this enzymatic product at any pH, but at more basic conditions, the equilibrium shifts to produce relatively more 4, and at acidic conditions, the equilibrium shifts to produce relatively more 2, 7, and/or 9. Studies of escapin's enzyme kinetics demonstrate that because of the high concentrations of escapin and L-lysine in the ink secretion, millimolar concentrations of 3, H(2)O(2), and ammonia are produced, and also lower concentrations of 2, 4, 7, and 9 as a result. We also show that reactions of this mixture with H(2)O(2) produce delta-aminovaleric acid (5) and delta-valerolactam (6), with 6 being the dominant component under the naturally acidic conditions of ink. Thus, the product of escapin's action on L-lysine contains an equilibrium mixture that is more complex than previously known for any L-amino acid oxidase.

  7. Health assessment of pine forest as affected by geothermal activities: Presence of Monterey pine aphid, Essigella californica (Essig (Homoptera: Aphidae associated with higher concentrations of boron on pine needles

    Directory of Open Access Journals (Sweden)

    Adolfo Arturo Del Rio Mora

    2014-06-01

    Full Text Available Studies on assessments of the air pollution and deposition caused by geothermal fields on the forest health and presence of pests have been few documented to date. In the geothermal field "Los Humeros", located between the borders of the states of Puebla and Veracruz, Mexico was realized a forest health monitoring to know the assessment could have these emissions of sulphur (S and other two chemical elements measured by their concentrations on leaf tissues in the surrounding forests. For it were evaluated the forest healthy and pest insects registered at 20 stands of which were chosen completely at random 40 trees in total/site of the species Pinus montezumae and P. teocotein natural stands and plantations and picked up leaf tissue samples representatives per stand to determine the contents of sulphur (S, boron (B and arsenic (As representing each forest stand. The results of the study revealed that the presence of forest pests are not related to the proximity of the sites to emissions from stationary sources of emissions and moreover the amount of these 3 chemical substances monitored do not have none influence on the forest healthy sites condition, except for the Monterey pine aphid Essigella californica Essig, which seems to be directly associated with higher Boron content in the needles (mean=167.47±32.15, and peak 635.46 ppm and proximity of emission sources geothermal vents or where it is believed all these chemical elements are carried down by air currents to specific points and deposited in the stands. The general model obtained and with significance of R2=56.6 and P value 0.0033 for the presence of Monterey Pine aphid and the three main pollutants released from smoke plumes in geothermal systems is [D: Essigella]= -0.2088 + 1.880E-0.5 (A:SO4+ 0.002245 (B:B + 1.248 (C:As. The results suggest the use of aphid species as bioindicators of polluted sites.

  8. Environmental Assessment Newport Research Facility Irish Hill

    Science.gov (United States)

    2011-09-12

    pasture to that has been recently seeded as a hay field. The northern portion of this parcel is primarily a moderately to steeply sloped forested...Name ANIMALS American burying beetle Canada lynx Eastern cougar Gray wolf Scientific Name Nicrophorus americanus Lynx canadensis Puma (=Felis...concolor couguar Canis lupus Northeastern beach tiger beetle Cincindela dorsalis dorsalis PLANTS Northeastern bulrush Swamp pink Scirpus

  9. Green Park School, Newport Pagnell, UK

    Energy Technology Data Exchange (ETDEWEB)

    Lomas, K. [De Montfort University, Leicester (United Kingdom). Inst. of Energy and Sustainable Development

    1999-07-01

    This school for 5-12 year olds is built around a courtyard to provide good levels of daylight, solar gains and natural ventilation. Glazing on three south-facing pitched roofs converts these roof spaces into solar collectors, sometimes called a hot attic. Because the collectors are unoccupied, high operating temperatures are possible. Outside air enters through the caves into the glazed attic collectors, is sun-warmed then further heated by the gas-fired warm air auxiliary heating system. The solar air system is built from conventional building components and so is easy to design, construct, operate and maintain. The collector glazing forms the weather barrier and has minimal impact on the architectural design. Most importantly, the roof-space collectors are not shaded by the surrounding. A thermal simulation program predicted that the system designed for this school would reduce auxiliary heating energy use by about 6%. Further optimization could have increased the savings to around 14%. (author)

  10. BASEMAP, CITY OF NEWPORT NEWS, VIRGINIA, USA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — FEMA Framework Basemap datasets comprise six of the seven FGDC themes of geospatial data that are used by most GIS applications (Note: the seventh framework theme,...

  11. Consultorios médicos, en Newport

    Directory of Open Access Journals (Sweden)

    Neutra, Richard J.

    1965-05-01

    Full Text Available This building is occupied by a number of coproprietor surgeons, some of whom are specialists of the same branch. As the building has only one level, the architect had the problem of providing suitable separation between the various consulting rooms and their access rooms. A further need was that the general atmosphere of the building should be pleasant and relaxing. There is a central patio, surrounded by the various elements of the building. This facilitates the independence of each surgery and gives a very satisfying central element of unity and contrast. The project is an outstanding example the functional success that deriven from a design over which good taste, care and wisdom have been generously expended.Como el grupo de médicos-copropietarios que ocupa este edificio de una planta está integrado por varios especialistas, algunos de ellos de la misma especialidad, uno de los requisitos que se le plantearon al arquitecto fue el lograr una adecuada separación entre sus respectivas consultas que asegurase una independencia de la clientela individual. Otro de los requisitos fue el que los pacientes pudieran disfrutar de una atmósfera agradable y relajante. El conjunto edificado está constituido por una serie de cuerpos que dan a un patio común. Es un claro ejemplo de los efectos psicomáticos beneficiosos que puede llegar a producir, sobre los pacientes, un edificio proyectado con sabiduría, exquisitez y cuidado, y pensando siempre en el fin a que se destina.

  12. 77 FR 6010 - Anchorage Regulations; Newport, RI

    Science.gov (United States)

    2012-02-07

    ... Order 12630, Governmental Actions and Interference with Constitutionally Protected Property Rights... route in the East Passage of Narragansett Bay, a securite call notifying mariners of the vessel's exact...

  13. Spodoptera litura Multicapsid Nucleopolyhedrovirus Blocks Autographa californica Multicapsid Nucleopolyhedrovirus-induced Spodoptera litura Cell Apoptosis%斜纹夜蛾核多角体病毒抑制苜蓿丫纹夜蛾核多角体病毒诱导的斜纹夜蛾细胞凋亡

    Institute of Scientific and Technical Information of China (English)

    张萍; 杨凯; 代小江; 庞义; 苏德明

    2002-01-01

    野生型苜蓿丫纹夜蛾核多角体病毒(Autographa californica multicapsid nucleopolyhedrovirus, AcMNPV)感染斜纹夜蛾(Spodoptera litura)细胞系Sl-zsu-1,可引起典型的细胞凋亡;但可以在草地夜蛾(Spodoptera frugiperda)细胞Sf-9中复制并形成多角体.比较了AcMNPV p35基因在病毒感染两种细胞的复制和转录情况,认为p35在非受纳细胞中及时有效的表达能阻止细胞发生凋亡;共感染实验结果表明,斜纹夜蛾核多角体病毒(Spodoptera litura multicapsid nucleopolyhedrovirus, SpltMNPV)可以抑制AcMNPV诱导的细胞凋亡并可帮助病毒进行复制,推测SpltMNPV基因组中与p35同源的p49基因挽救了细胞的自杀行为.

  14. Analysis on Marine Fouling-organism to Hull Surface of River/coastal Ship from Wuhan Newport to Yangshan Port%武汉新港至洋山港江海直达船海洋污损生物附着分析

    Institute of Scientific and Technical Information of China (English)

    常江凡; 白秀琴; 袁成清

    2016-01-01

    For the river/coastal ships which are sailing in the typical route from Wuhan Newport to Yangshan port , the dif-ferent water salinity in this typical route and the main marine fouling-organism around Yangshan port , the bio-fouling occurrence status at the hull surface of the river/coastal ship along the shipping route is investigated , combining with the characteristics of different hull immersed parts .The growth features and adhesion mechanisms of the main marine fouling organism , including dia-tom, amphibalanus reticulatus and saccostrea cucullata are analyzed as well to provide some theoretical references for anti -fouling of the river/coastal ship .%针对武汉新港至洋山港这一典型航线的江海直达运输船,调查船舶航行水域盐度的差异和洋山港水域的主要海洋污损生物种类,结合船舶浸水部位的区域特性以及江海直达船的结构特点,得出江海直达船不同部位海洋污损生物的附着情况,并对硅藻、网纹藤壶和僧帽牡蛎这三种主要污损生物的生长特性和附着机理进行了分析,以期为江海直达船的防污损提供一些理论依据。

  15. or_newport1_3navd.grd

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NGDC builds and distributes high-resolution, coastal digital elevation models (DEMs) that integrate ocean bathymetry and land topography to support NOAA's mission to...

  16. 33 CFR 110.95 - Newport Bay Harbor, Calif.

    Science.gov (United States)

    2010-07-01

    ... east end of Lido Isle. Note: This area is reserved for recreational and other small craft. Fore and aft... north side of Via Barcelona, on Lido Isle, extended. Note: This area is reserved for recreational and... off the south shore of Lido Isle. Note: This area is reserved for recreational and other small craft...

  17. Innovation in Carrier Aviation (Naval War College Newport Papers, 37)

    Science.gov (United States)

    2011-08-01

    surface ships (mostly cruisers and battleships), and even on aircraft- carrying rigid airships . After 1943, however, BuAer lost its commanding...minimum of 2,250 miles in all types, and more effective and powerful offensive weapons.” They also believed that “advances in power plants and aerodynam ... Aerodynamics .12 Spangenberg also held Heinemann in high regard. As he said in his oral history, “Heinemann’s real strength was a good understanding of the

  18. International Environmental Law and Naval War Newport paper no. 15

    Science.gov (United States)

    2000-12-01

    Biodiversity Convention that was adopted at the same conference, by con- trast, attempts to combine both anthropocentric and ecocentric values.49 While...reflected in many (peacetime) environmental instruments. The 1972 Stockholm Declaration seems anthropocentric because of its focus on the protection of...nature for the ben- efit of mankind.44 By contrast, the 1982 World Charter for Nature is seen as ecocentric , for it emphasises the protection of nature

  19. DIGITAL FLOOD INSURANCE RATE MAP DATABASE, NEWPORT COUNTY, RHODE ISLAND

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — The Digital Flood Insurance Rate Map (DFIRM) Database depicts flood risk information and supporting data used to develop the risk data. The primary risk...

  20. EMFR HRA of the Newport Antenna Measurement Facility

    Science.gov (United States)

    2015-07-15

    1600 has upper and lower transmit bays. The upper transmit bay houses four antennas, and the lower transmit bay houses three antennas. These...MPE at 73 feet in front of the antenna (2) Readings for the 6-foot antenna: • 5.0% of upper tier MPE within 1 foot of the ray dome • 50.0% of...lower tier MPE within 1 foot of the ray dome b. Evaluation of Engineering Control Measures: Various engineering controls are utilized to include key

  1. Newporter Apartments. Deep Energy Retrofit Short Term Results

    Energy Technology Data Exchange (ETDEWEB)

    Gordon, Andrew [BA-PIRC, Cocoa, FL (United States); Howard, Luke [BA-PIRC, Cocoa, FL (United States); Kunkle, Rick [BA-PIRC, Cocoa, FL (United States); Lubliner, Michael [BA-PIRC, Cocoa, FL (United States); Auer, Dan [BA-PIRC, Cocoa, FL (United States); Clegg, Zach [BA-PIRC, Cocoa, FL (United States)

    2012-12-01

    This project demonstrates a path to meet the goal of the Building America program to reduce home energy use by 30% in multi-family buildings. The project demonstrates cost-effective energy savings targets as well as improved comfort and indoor environmental quality (IEQ) associated with deep energy retrofits by a large public housing authority as part of a larger rehabilitation effort. The project focuses on a typical 1960’s vintage low-rise multi-family apartment community (120 units in three buildings).

  2. Newporter Apartments: Deep Energy Retrofit Short-Term Results

    Energy Technology Data Exchange (ETDEWEB)

    Gordon, A.; Howard, L.; Kunkle, R.; Lubliner, M.; Auer, D.; Clegg, Z.

    2012-12-01

    This project demonstrates a path to meet the goal of the Building America program to reduce home energy use by 30% in multi-family buildings. The project demonstrates cost effective energy savings targets as well as improved comfort and indoor environmental quality (IEQ) associated with deep energy retrofits by a large public housing authority as part of a larger rehabilitation effort. The project focuses on a typical 1960's vintage low-rise multi-family apartment community (120 units in three buildings).

  3. Newporter Apartments. Deep Energy Retrofit Short Term Results

    Energy Technology Data Exchange (ETDEWEB)

    Gordon, Andrew [BA-PIRC, Cocoa, FL (United States); Howard, Luke [BA-PIRC, Cocoa, FL (United States); Kunkle, Rick [BA-PIRC, Cocoa, FL (United States); Lubliner, Michael [BA-PIRC, Cocoa, FL (United States); Auer, Dan [BA-PIRC, Cocoa, FL (United States); Clegg, Zach [BA-PIRC, Cocoa, FL (United States)

    2012-12-01

    This project demonstrates a path to meet the goal of the Building America program to reduce home energy use by 30% in multi-family buildings. The project demonstrates cost-effective energy savings targets as well as improved comfort and indoor environmental quality (IEQ) associated with deep energy retrofits by a large public housing authority as part of a larger rehabilitation effort. The project focuses on a typical 1960’s vintage low-rise multi-family apartment community (120 units in three buildings).

  4. Newporter Apartments: Deep Energy Retrofit Short-Term Results

    Energy Technology Data Exchange (ETDEWEB)

    Gordon, A.; Howard, L.; Kunkle, R.; Lubliner, M.; Auer, D.; Clegg, Z.

    2012-12-01

    This project demonstrates a path to meet the goal of the Building America program to reduce home energy use by 30% in multi-family buildings. The project demonstrates cost effective energy savings targets as well as improved comfort and indoor environmental quality (IEQ) associated with deep energy retrofits by a large public housing authority as part of a larger rehabilitation effort. The project focuses on a typical 1960's vintage low-rise multi-family apartment community (120 units in three buildings).

  5. 78 FR 48609 - Safety Zone; James River; Newport News, VA

    Science.gov (United States)

    2013-08-09

    .... Protection of Children We have analyzed this rule under Executive Order 13045, Protection of Children from... upon being directed to do so by any commissioned, warrant or petty officer on shore or on board a..., warrant or petty officer on shore or on board a vessel that is displaying a U.S. Coast Guard Ensign....

  6. 76 FR 38018 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-06-29

    ... standards are technical standards (e.g., specifications of materials, performance, design, or operation... in the Federal Register (33 FR 165). We received no comments on the proposed rule. No public meeting... Transportation awarded a contract to Astron General Contracting Company of Jacksonville, NC to perform...

  7. Shaping the Security Environment Newport paper no. 29

    Science.gov (United States)

    2006-11-29

    cajoling, and writing. First and foremost, Joan Johnson-Freese and Tom Fedyszyn in the National Security Decision Making Department at the U.S. Naval War...Kathleen Mahoney-Norris, Judith Stiehm, Chris Costa , Chris Fettweis, Andy Stigler, Tom Fedyszyn, Mike Morris, and Gene Christy provided important

  8. 76 FR 18669 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-04-05

    ... Interference with Constitutionally Protected Property Rights. Civil Justice Reform This proposed rule meets...) Persons or vessels requiring entry into or passage through any portion of the safety zone must first...

  9. 76 FR 29645 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-05-23

    ... Order 12630, Governmental Actions and Interference with Constitutionally Protected Property Rights... vessels requiring entry into or passage through any portion of the safety zone must first request...

  10. 33 CFR 165.504 - Newport News Shipbuilding and Dry Dock Company Shipyard, James River, Newport News, Va.

    Science.gov (United States)

    2010-07-01

    ...″ W, thence southeasterly to latitude 36°59′12.9″ N, longitude 76°26′52.4″ W, thence easterly to... 76°26′26.3″ W, thence easterly to latitude 36°58′43.5″ N, longitude 76°26′13.7″ W, thence northerly..., longitude 76°27′16.7″ W, thence easterly to the shoreline at latitude 36°59′58.5″ N, longitude 76°27′11.6″...

  11. 苜蓿丫纹夜蛾核型多角体病毒fp25k基因的改造及用于稳定转化Sf9昆虫细胞系%Modification and use offp25k gene from Autographa californica multicapsid nucleopolyhedrovirus in stably transforming insect cell line Sf9

    Institute of Scientific and Technical Information of China (English)

    谷琳珠; 张传溪

    2014-01-01

    [目的]苜蓿丫纹夜蛾核型多角体病毒(Autographa californica muhicapsid nucleopolyhedrovirus,AcMNPV)在昆虫细胞中连续传代以后,会出现从多多角体表型到少多角体表型的转变,这种转变与一个编码25 kDa蛋白的基因(few polyhedra,fp25k)突变失活有关.杆状病毒的fp25k基因突变后产生的包涵体(多角体)衍生病毒粒子变少而出芽型病毒粒子增加,会降低外源基因在杆状病毒表达系统中的表达.本研究拟改造fp25k并构建能持续表达FP25K蛋白的转基因昆虫细胞,以克服杆状病毒fp25k基因易突变导致的表达系统缺陷.[方法]本实验通过改造杆状病毒fp25k基因在细胞传代过程中容易产生突变的位点,得到mfp25k,并将mfp25k构建到pIZT/V5-His载体上,重组载体转染Sf9细胞,通过Zeocin抗性筛选逐步淘汰未成功转化的Sf9细胞.[结果]成功改造AcMNPV的fp25k基因的TTAA位点,得到pIZT-mfp25k重组载体.重组载体成功转染Sf9细胞,通过Zeocin抗性筛选后获得基因组中带有mfp25k的Sf9-mfp25k稳定的转基因细胞系.用AcMNPV的fp25k突变型病毒AcP2感染转基因Sf9mfp25k昆虫细胞系与正常Sf9细胞,发现转基因Sf9-mfp25k昆虫细胞系表达的FP25K蛋白可弥补病毒fp25k基因突变的缺陷.[结论]建立的Sf9-mfp25k转基因昆虫细胞系通过细胞表达FP25K蛋白,可以弥补因杆状病毒fp25k基因突变产生的缺陷.研究结果为构建稳定的杆状病毒-昆虫细胞表达系统提供了新途径.

  12. 杆状病毒AcMNPV包膜蛋白GP64胞外区的原核表达、纯化及多克隆抗体的制备%Prokaryotic expression, purification and preparation of polyclonal antibody of extracellular domain of Autographa californica multiple nucleopolyhedrovirus envelope protein GP64

    Institute of Scientific and Technical Information of China (English)

    王奔; 王宁; 周思杭; 李静; 佟雪莲; 唐玉龙; 王玉琳

    2013-01-01

    目的 原核表达、纯化苜蓿银纹夜蛾核型多角体病毒(Autographa californica multiple nucleopolyhedrovirus,AcMNPV)包膜糖蛋白GP64胞外区,并制备多克隆抗体.方法 根据GenBank中登录的AcMNPV GP64基因全长序列,采用DNAStar软件设计去除GP64基因信号肽和跨膜区的引物,PCR扩增GP64胞外区基因,插入原核表达载体pET-21b(+)中,转化大肠埃希菌Rosetta(DE3),IPTG诱导表达.表达的重组蛋白经His Trap FF crude纯化后,进行SDS-PAGE和Wester blot分析.将纯化的重组蛋白经背部皮下免疫家兔,制备多克隆抗体,采用免疫染色法检测多克隆抗体对AcMNPV的中和作用.结果 重组表达质粒pET-21b(+)-GP64经双酶切及测序证实构建正确;表达的重组蛋白相对分子质量约为52 000,表达量占菌体总蛋白的46.8%,主要以包涵体形式表达;纯化的重组蛋白纯度可达95%以上,可与鼠抗AcMNPV GP64蛋白单克隆抗体特异性结合;制备的兔抗GP64蛋白多克隆抗体能与纯化的重组蛋白和杆状病毒发生特异性反应,抗体效价高于1∶1 000 000,其可中和100TCID50/ml的AcMNPV,使AcMNPV无法感染昆虫细胞Sf9,中和效价为1∶8.结论 成功原核表达了AcMNPV GP64蛋白胞外区,并制备了对AcMNPV有完全中和能力的多克隆抗体,为昆虫细胞/杆状病毒表达系统的应用研究及杆状病毒毒株的检定等提供了材料.

  13. Notes on species of the genus Brachyptera newport (Plecoptera) from the Netherlands and Switzerland

    NARCIS (Netherlands)

    Tol, van J.

    1985-01-01

    A re-examination of the Dutch material of the stonefly genus Brachyptera resulted in the establishment of B. braueri (Klapálek, 1900) (new to the Netherlands) and B. risi (Morton, 1896) as indigenous species, although both are now locally extinct. The occurrence of B. trifasciata (Pictet) in this co

  14. Characterization of resistance to powdery mildew in the Hop cultivars Newport and Comet

    Science.gov (United States)

    Hop powdery mildew, caused by Podosphaera macularis, is an important disease in the Northwestern U.S. Outbreaks of powdery mildew on cultivars previously resistant to the disease have been reported increasingly with the emergence of virulent pathogen strains capable of overcoming a commonly deployed...

  15. Effects of temperature differential and immersion time on internalization of Salmonella Newport in tomatoes

    Science.gov (United States)

    Introduction: Food-borne illness outbreaks associated with Salmonella enterica have been traced back to tomatoes contaminated through bacterial attachment and possible internalization during post-harvest handling. However, no scientific information is available regarding the effect of current tomato...

  16. Environmental Assessment for Alternate Water Supply System, Joint Base Langley-Eustis, Newport News, Virginia

    Science.gov (United States)

    2013-06-01

    maple Acer rubrum eastern redcedar Juniperus viginianus Other oak species Quercus spp. The primary objective of Fort Eustis’s forest management program...consists of 2,450 linear feet of buried 12-inch water main extending through a forested area on both JBLE-FE and adjacent private land. The 12-inch main...hardwood forest . The portion that is on private land is located near the boundary between two industrial facilities. Approximately half of the portion

  17. Similarities between Students Receiving Dress Code Violations and Discipline Referrals at Newport Junior High School

    Science.gov (United States)

    Nicholson, Nikki

    2007-01-01

    Background: Looking at dress code violations and demographics surrounding kids breaking the rules. Purpose: To see if there is a connection between dress code violations and discipline referrals. Setting: Jr. High School; Study Sample: Students with dress code violations for one week; Intervention: N/A; Research Design: Correlational; and Control…

  18. An Archeological Overview and Management Plan for the Newport Army Ammunition Plant, Vermillion County, Indiana

    Science.gov (United States)

    1984-05-21

    lies within the "warm temperate montane moist for- est" bioclimatic formation (Sawyer and Lindsey 1963). This is the cli- matic zone associated with...summer agricultural villages and winter hunting camps. Villages probably were situated in larger stream valleys, spaced perhaps 30 to 100 miles apart ...University of Wisconsin Press. Sawyer, John 0., Jr., and Alton A. Lindsey. 1963. The Holdridge Bioclimatic Formations of the Eastern and Central United

  19. 76 FR 78185 - Anchorage Regulations: Subpart A-Special Anchorage Regulations, Newport Bay Harbor, CA

    Science.gov (United States)

    2011-12-16

    ....gov and will include any personal information you have provided. Submitting Comments If you submit a... would be incorporated into area A-11 under revised Sec. 110.95(k). An image of the proposed anchorage... rule under Executive Order 13045, Protection of Children from Environmental Health Risks and...

  20. Proceedings of the NUWC Division Newport Seminar Series on Swimming and Flying in Nature

    Science.gov (United States)

    1994-08-16

    any particular point - Red muscle system functions in hydro- static skeleton, whereas white muscle belongs to the lever type - Cinematically low...Generally, initial conditions are chosen to: (a) Satisfy continuity equation (b) Possess the desired energy spectrum (in particular, kinetic energy

  1. 75 FR 6360 - Information on Surplus Land at a Military Installation Designated for Disposal: Newport Naval...

    Science.gov (United States)

    2010-02-09

    ... surface areas (i.e. parking areas, sidewalks, etc). (7) Utility facilities (approximately 2 structures... concrete underground fuel storage tanks (2.56 million-gallon capacity), 6 steel underground fuel storage... capacity), 1 underground water tank (1 million-gallon capacity), and 3 support facilities (22,738...

  2. DIGITAL FLOOD INSURANCE RATE MAP DATABASE, CITY OF NEWPORT NEWS, VIRGINIA

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — The Digital Flood Insurance Rate Map (DFIRM) Database depicts flood risk information and supporting data used to develop the risk data. The primary risk...

  3. H09468: NOS Hydrographic Survey , Upper Newport Bay, California, 1974-10-23

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The National Oceanic and Atmospheric Administration (NOAA) has the statutory mandate to collect hydrographic data in support of nautical chart compilation for safe...

  4. October 2003 Lidar Point Data of Southern California Coastline: Newport Beach to US/Mexican Border

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains lidar point data (Geodetic Coordinates) from a strip of Southern California coastline (including water, beach, cliffs, and top of cliffs) from...

  5. 2011 Organometallic Chemistry (July 10-15, 2011, Salve Regina University, Newport, RI)

    Energy Technology Data Exchange (ETDEWEB)

    Dr. Emilio Bunel

    2011-07-15

    Organometallic chemistry has played and will continue to play a significant role in helping us understand the way bonds are made or broken in the presence of a transition metal complex. Current challenges range from the efficient exploitation of energy resources to the creative use of natural and artificial enzymes. Most of the new advances in the area are due to our extended understanding of processes at a molecular level due to new mechanistic studies, techniques to detect reaction intermediates and theory. The conference will bring the most recent advances in the field including nanocatalysis, surface organometallic chemistry, characterization techniques, new chemical reactivity and theoretical approaches along with applications to organic synthesis and the discovery of new materials. The Conference will bring together a collection of investigators who are at the forefront of their field, and will provide opportunities for junior scientists and graduate students to present their work in poster format and exchange ideas with leaders in the field. Six outstanding posters will be selected for short talks. The collegial atmosphere of this Conference, with programmed discussion sessions as well as opportunities for informal gatherings in the afternoons and evenings, provides an avenue for scientists from different disciplines to brainstorm and promotes cross-disciplinary collaborations in the various research areas represented. Graduate students and postdoctoral fellows should also consider participating in the Gordon Research Seminar on Organometallic Chemistry (July 9-10, same location) which is specially designed to promote interaction and discussion between junior scientists.

  6. Soil amendments and Listeria monocytogenes and Salmonella newport survival on cucurbits

    Science.gov (United States)

    EMFSL conducts research on a variety of produce safety related issues. EMFSL is involved in determining what the appropriate interval is between application of manure and harvest of crops grown in manure-amended soils. EMFSL has also investigated commodities associated with recent outbreaks (canta...

  7. Defeating the U-boat. Inventing Antisubmarine Warfare (Newport Papers Number 36)

    Science.gov (United States)

    2010-08-01

    an unknown. No one knew whether it would work, the risks of failure seemed substantial, and if stubbornness was one trait of Jellicoe’s, caution and...Innovation in the U.S. Navy’s Silent Cold War Struggle with Soviet Sub- marines, by Owen R. Cote , Jr. (no. 16, 2003). International Law and Naval War: The

  8. 2013 NOAA Ortho-rectified Color Mosaic of Virginia: Norfolk, Hampton Roads,and Newport News

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains ortho-rectified mosaic tiles, created as a product from the NOAA Integrated Ocean and Coastal Mapping (IOCM) initiative. The source imagery...

  9. 77 FR 63725 - Drawbridge Operation Regulation; Atlantic Intracoastal Waterway (AIWW), Newport River, Morehead...

    Science.gov (United States)

    2012-10-17

    ... upgrading the obsolete drive system. The current regulations, under the general requirements set out at 33... 13563, Improving Regulation and Regulatory Review, and does not require an assessment of potential costs... rule has implications for federalism under Executive Order 13132, Federalism, if it has a...

  10. October 2003 Lidar Point Data of Southern California Coastline: Newport Beach to US/Mexican Border

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains lidar point data (Geodetic Coordinates) from a strip of Southern California coastline (including water, beach, cliffs, and top of cliffs)...

  11. Servicio de incendios.Oficinas - Newport Beach, California (EE.UU.

    Directory of Open Access Journals (Sweden)

    Ficker, -

    1975-11-01

    Full Text Available This 2-storeyed firestation contains on the second floor the crew bedroom and a library. The first floor houses: the bedroom of the fire brigade captain, dining room and kitchen. The largest floor area is occupied by the garage of the fire engine cars and the hose-drying tower. The construction has been carried out by means of a combination of concrete cast in situ and prefabricated members that cover the great spans of the garage. The basic material —concrete— is being alternated with large glass surfaces that make the interior premises and equipments visible. The exterior of this building with its varying volumes clearly expresses the spacial requirements of the interior departments at the same time as the salients and reentrants provide a vivid play of light and shadows. All the above mentioned factors have made it possible to adapt this construction adequately to the remaining buildings of an urban site of high quality.Este cuartel de bomberos, de una y dos plantas, distribuye en el nivel superior los dormitorios del personal y una biblioteca. El nivel inferior lo ocupan: el dormitorio de los jefes, un comedor y la cocina. Los volúmenes más grandes son la sala para los coches y la torre para el secado de las mangueras. La construcción se hizo mediante una combinación de hormigón vertido in situ y elementos prefabricados que cubren las grandes luces de la sala de coches. El hormigón, material base, se complementa con grandes superficies acristaladas que permiten visualizar los espacios '.' equipos interiores. La fisonomía exterior del edificio, con sus variados volúmenes, expresa, de manera clara, las necesidades de espacio de las dependencias interiores, a la vez que, con sus entrantes y salientes, proporciona un animado juego de luces y sombras. Todo ello ha permitido integrar, adecuadamente, esta construcción, con los restantes edificios de un emplazamiento urbano de gran calidad.

  12. Distribution trends & antibiogram pattern of Salmonella enterica serovar Newport in India

    Directory of Open Access Journals (Sweden)

    Y Kumar

    2016-01-01

    Interpretation & conclusions: Considering distribution of this important serovar of Salmonalla and its wide range of reservoirs, steps towards formulation and execution of efficient surveillance programmes should be taken.

  13. H09467: NOS Hydrographic Survey , Upper Newport Bay, California, 1974-10-24

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The National Oceanic and Atmospheric Administration (NOAA) has the statutory mandate to collect hydrographic data in support of nautical chart compilation for safe...

  14. Consequences and mechanisms of spike broadening of R20 cells in Aplysia californica.

    Science.gov (United States)

    Ma, M; Koester, J

    1995-10-01

    We studied frequency-dependent spike broadening in the two electrically coupled R20 neurons in the abdominal ganglion of Aplysia. The peptidergic R20 cells excite the R25/L25 interneurons (which trigger respiratory pumping) and inhibit the RB cells. When fired at 1-10 Hz, the duration of the falling phase of the action potential in R20 neurons increases 2-10 fold during a spike train. Spike broadening recorded from the somata of the R20 cells affected synaptic transmission to nearby follower cells. Chemically mediated synaptic output was reduced by approximately 50% when recorded trains of nonbroadened action potentials were used as command signals for a voltage-clamped R20 cell. Electrotonic EPSPs between the R20 cells, which normally facilitated by two- to fourfold during a high frequency spike train, showed no facilitation when spike broadening was prevented under voltage-clamp control. To examine the mechanism of frequency-dependent spike broadening, we applied two-electrode voltage-clamp and pharmacological techniques to the somata of R20 cells. Several voltage-gated ionic currents were isolated, including INa, a multicomponent ICa, and three K+ currents--a high threshold, fast transient A-type K+ current (IAdepol), a delayed rectifier K+ current (IK-V), and a Ca(2+)-sensitive K+ current (IK-Ca), made up of two components. The influences of different currents on spike broadening were determined by using the recorded train of gradually broadening action potentials as the command for the voltage clamp. We found the following. (1) IAdepol is the major outward current that contributes to repolarization of nonbroadened spikes. It undergoes pronounced cumulative inactivation that is a critical determinant of spike broadening. (2) Activity-dependent changes in IK-V, IK-Ca, and ICa have complex effects on the kinetics and extent of broadening. (3) The time integral of ICa during individual action potentials increases approximately threefold during spike broadening.

  15. Efficient perturbation analysis of elastic network models - Application to acetylcholinesterase of T. californica

    Science.gov (United States)

    Hamacher, K.

    2010-09-01

    Elastic network models in their different flavors have become useful models for the dynamics and functions of biomolecular systems such as proteins and their complexes. Perturbation to the interactions occur due to randomized and fixated changes (in molecular evolution) or designed modifications of the protein structures (in bioengineering). These perturbations are modifications in the topology and the strength of the interactions modeled by the elastic network models. We discuss how a naive approach to compute properties for a large number of perturbed structures and interactions by repeated diagonalization can be replaced with an identity found in linear algebra. We argue about the computational complexity and discuss the advantages of the protocol. We apply the proposed algorithm to the acetylcholinesterase, a well-known enzyme in neurobiology, and show how one can gain insight into the "breathing dynamics" of a structural funnel necessary for the function of the protein. The computational speed-up was a 60-fold increase in this example.

  16. Proteotoxic stress induced by Autographa californica nucleopolyhedrovirus infection of Spodoptera frugiperda Sf9 cells

    Energy Technology Data Exchange (ETDEWEB)

    Lyupina, Yulia V.; Abaturova, Svetlana B.; Erokhov, Pavel A. [N.K. Koltzov Institute of Developmental Biology, Russian Academy of Sciences, 26 Vavilova Str., Moscow 119334 (Russian Federation); Orlova, Olga V.; Beljelarskaya, Svetlana N. [V.A. Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, 32 Vavilova Str., Moscow 119334 (Russian Federation); Mikhailov, Victor S., E-mail: mikhailov48@mail.ru [N.K. Koltzov Institute of Developmental Biology, Russian Academy of Sciences, 26 Vavilova Str., Moscow 119334 (Russian Federation)

    2013-02-05

    Baculovirus AcMNPV causes proteotoxicity in Sf9 cells as revealed by accumulation of ubiquitinated proteins and aggresomes in the course of infection. Inhibition of proteasomes by lactacystin increased markedly the stock of ubiquitinated proteins indicating a primary role of proteasomes in detoxication. The proteasomes were present in Sf9 cells as 26S and 20S complexes whose protease activity did not change during infection. Proteasome inhibition caused a delay in the initiation of viral DNA replication suggesting an important role of proteasomes at early stages in infection. However, lactacystin did not affect ongoing replication indicating that active proteasomes are not required for genome amplification. At late stages in infection (24-48 hpi), aggresomes containing the ubiquitinated proteins and HSP/HSC70s showed gradual fusion with the vacuole-like structures identified as lysosomes by antibody to cathepsin D. This result suggests that lysosomes may assist in protection against proteotoxicity caused by baculoviruses absorbing the ubiquitinated proteins.

  17. Proteotoxic stress induced by Autographa californica nucleopolyhedrovirus infection of Spodoptera frugiperda Sf9 cells.

    Science.gov (United States)

    Lyupina, Yulia V; Abaturova, Svetlana B; Erokhov, Pavel A; Orlova, Olga V; Beljelarskaya, Svetlana N; Mikhailov, Victor S

    2013-02-05

    Baculovirus AcMNPV causes proteotoxicity in Sf9 cells as revealed by accumulation of ubiquitinated proteins and aggresomes in the course of infection. Inhibition of proteasomes by lactacystin increased markedly the stock of ubiquitinated proteins indicating a primary role of proteasomes in detoxication. The proteasomes were present in Sf9 cells as 26S and 20S complexes whose protease activity did not change during infection. Proteasome inhibition caused a delay in the initiation of viral DNA replication suggesting an important role of proteasomes at early stages in infection. However, lactacystin did not affect ongoing replication indicating that active proteasomes are not required for genome amplification. At late stages in infection (24-48 hpi), aggresomes containing the ubiquitinated proteins and HSP/HSC70s showed gradual fusion with the vacuole-like structures identified as lysosomes by antibody to cathepsin D. This result suggests that lysosomes may assist in protection against proteotoxicity caused by baculoviruses absorbing the ubiquitinated proteins.

  18. Connecting Model Species to Nature: Predator-Induced Long-Term Sensitization in "Aplysia Californica"

    Science.gov (United States)

    Mason, Maria J.; Watkins, Amanda J.; Wakabayashi, Jordann; Buechler, Jennifer; Pepino, Christine; Brown, Michelle; Wright, William G.

    2014-01-01

    Previous research on sensitization in "Aplysia" was based entirely on unnatural noxious stimuli, usually electric shock, until our laboratory found that a natural noxious stimulus, a single sublethal lobster attack, causes short-term sensitization. We here extend that finding by demonstrating that multiple lobster attacks induce…

  19. Habituation in the tail withdrawal reflex circuit is impaired during aging in Aplysia californica

    Directory of Open Access Journals (Sweden)

    Andrew T Kempsell

    2016-02-01

    Full Text Available The relevance of putative contributors to age-related memory loss are poorly understood. The tail withdrawal circuit of the sea hare, a straightforward neural model, was used to investigate the aging characteristics of rudimentary learning. The simplicity of this neuronal circuit permits attribution of declines in the function of specific neurons to aging declines. Memory was impaired in advanced age animals compared to their performance at the peak of sexual maturity, with habituation training failing to attenuate the tail withdrawal response or to reduce tail motoneuron excitability, as occurred in peak maturity siblings. Baseline motoneuron excitability of aged animals was significantly lower, perhaps contributing to a smaller scope for attenuation. Conduction velocity in afferent fibers to tail sensory neurons decreased during aging. The findings suggest that age-related changes in tail sensory and motor neurons result in deterioration of a simple form of learning in Aplysia.

  20. Circadian Rhythm of Neuron R15 of Aplysia californica: In Vivo Photoentrainment.

    Science.gov (United States)

    Audesirk, G; Strumwasser, F

    1975-06-01

    (1) The neuron R15 in the parietovisceral ganglion of Aplysia has a circadian rhythm of spiking activity when recorded in the isolated ganglion. The rhythm is entrained in vivo by light-dark cycles. (2) The phase of the R15 rhythm is a function not only of the entraining light schedule, but also of the time of dissection. Changes in the dissection time during the light portion of the light-dark cycle yield little change in the subsequent R15 peak time. Dissections during the dark portion produce peak times that vary with dissection time with a slope that is approximately one. (3) The circadian rhythm of R15 can be phase-shifted in vivo by changes in the phase of the entraining light-dark cycle in one to two weeks. R15 neurons of blinded Aplysia, however, show little or no phase shift in this time. (4) It is concluded that the eyes are important as receptors for the photoentrainment of the R15 rhythm in vivo, but that neural connections from the eyes to R15 are not required.

  1. Taxonomy Icon Data: Pacific electric ray [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available Pacific electric ray Torpedo californica Chordata/Vertebrata/Pisciformes Torpedo_californica_L.png Torpedo..._californica_NL.png Torpedo_californica_S.png Torpedo_californica_NS.png http://biosc...iencedbc.jp/taxonomy_icon/icon.cgi?i=Torpedo+californica&t=L http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Torpedo...+californica&t=NL http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Torpedo...+californica&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Torpedo+californica&t=NS ...

  2. Multibeam collection for TN311: Multibeam data collected aboard Thomas G. Thompson from 2014-06-10 to 2014-06-14, departing from Newport, OR and returning to Newport, OR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  3. Multibeam collection for TN330: Multibeam data collected aboard Thomas G. Thompson from 2015-09-22 to 2015-09-27, departing from Newport, OR and returning to Newport, OR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  4. VT Lidar Slope (0.7 meter) - 2014 - Swaths of Area from Burlington to Newport to portion of Killington

    Data.gov (United States)

    Vermont Center for Geographic Information — (Link to Metadata) This metadata applies to the following collection area(s): Eastern VT 2014 0.7m and related SLOPE datasets. Created using ArcGIS "SLOPE" command...

  5. All Prime Contract Awards by State or Country, Place, and Contractor. Part 16 (Albany Oregon-Newport Rhode Isld)

    Science.gov (United States)

    1990-01-01

    I.- In n r-- P7 "!C1) P-4 00. -A c’)0)(00)0-4 L-itI M00-4 110 nN 21- 044 z l, L V w00 1-- 0 0) -4m1 leln0)00)(O ) C, -10- 1- 0, U1 44 00 WO o - L4o...0 u0 u00 4UU( CAI (A)0 W U n CA I ACCA (AU) C U I(044<I 00 -)4~’ 0 *VM C (0 C) (Y) (D q*CO(00 00-4 t U O(-4N4 MI 0-4 C S NNNNNc C’) 0 (D( to D (0c(0

  6. MORS/ITEA Mini-Symposium Emphasizing the E in T and E Held in Newport, Rhode Island

    Science.gov (United States)

    1991-10-01

    interoperability and protocols, increases in continuous and comprehensive process. operational burden, changes to electro /optical signatures, etc. Evaluation...interference, increases to operational burden, changes to visual and electro /optical RECOMMENDATION 14: Institutionalize signatures, operational...ELEMENT OF THE TEST AND EVALUATION OF EVOLUTIONARY ACQUISITIONS Co-chais: Dr. Hank Dubin Chief Scientist US Army Operational Test and Evaluation

  7. Soil Survey Geographic (SSURGO) Soil Polygons for the State of Rhode Island: Bristol, Kent, Newport, Providence, and Washington Counties

    Data.gov (United States)

    University of Rhode Island Geospatial Extension Program — 2013 VERSION 6 Spatial: This data set is a digital soil survey and generally is the most detailed level of soil geographic data developed by the National Cooperative...

  8. Fisheries Online Information System - Fishing vessel based survey of young-of-year groundfish along the Newport Hydrographic Line

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Northwest Fisheries Science Center (NWFSC) conducts a comprehensive groundfish bottom trawl survey encompassing the U.S. West Coast between the borders with...

  9. 2013 NOAA Ortho-rectified Near-Infrared Mosaic of Virginia: Norfolk, Hampton Roads,and Newport News

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set contains ortho-rectified mosaic tiles, created as a product from the NOAA Integrated Ocean and Coastal Mapping (IOCM) initiative. The source imagery...

  10. A Doctrine Reader: The Navies of United States, Great Britain France, Italy, and Spain (Newport Paper, Number 9)

    Science.gov (United States)

    1995-12-01

    Chaves, Qulltri partitu en cosmografia prlletiell, also known as Espejo de navegantes (Madri: Instituto de Historia y Cultura Navar, 1 983 [original...dated 9 June 1994. 2. Alonso de Chaves, QuAtri partitu en wsmografia practiaJ, also known as Espejo de navegantes (Madrid: Instituto de Historia y...Society], 1 993), pp. 86-7. 9. Padfield, pp. 47-8. 10. Flotas de Nueva Espana (Mexico) and Tierra Firme (Colombia and Venezuela) escorted by the Armada

  11. 77 FR 14032 - John H. Chafee Coastal Barrier Resources System; Lee County, FL, and Newport County, RI...

    Science.gov (United States)

    2012-03-08

    ... by Lee County, and 1 restaurant. The Service's assessment of 2011 aerial imagery estimates that the... Unit FL-70P. A new discrete segment is proposed for inclusion within Unit FL-70P to add lands owned by the Gasparilla Island Conservation and Improvement Association. This new discrete segment is located...

  12. Effectiveness of Cleaners and Sanitizers in Killing Salmonella Newport in the Gut of a Free-Living Nematode, Caenorhabditis elegans

    National Research Council Canada - National Science Library

    Stephen J. Kenney; Gary L. Anderson; Phillip L. Williams; Patricia D. Millner; Larry R. Beuchat

    2004-01-01

    Caenorhabditis elegans, a free-living nematode found in soil, has been shown to ingest human enteric pathogens, thereby potentially serving as a vector for preharvest contamination of fruits and vegetables...

  13. Langley AFB, Newport News, Virginia. Revised Uniform Summary of Surface Weather Observations (RUSSWO). Parts A-F

    Science.gov (United States)

    1979-06-01

    i1 1 "+ ’I"+ " *+ +" ENVI-77E 74 4, +, + ~ P CATON C UTER +"+,, :+ PARTO SURFACE WINDS , jr..,+ + -, + +"C reenedi tispatar vriu ta.ltins...frequency distribution of wet-bulb ) depression in 17 classes spread ho izontally; by 2-degree intervals of dry-bulb temperature spread vertically ...humidity and total number of observations in two tables. a. Table 1 is prepared by month and annual, all years combined, with montb being the vertical

  14. 2011 Dynamics at Surfaces Gordon Research Conference (August 7-12, 2011, Salve Regina University, Newport, Rhode Island)

    Energy Technology Data Exchange (ETDEWEB)

    Greg Sitz

    2011-08-12

    The 2011 Gordon Conference on Dynamics at Surfaces is the 32nd anniversary of a meeting held every two years that is attended by leading researchers in the area of experimental and theoretical dynamics at liquid and solid surfaces. The conference focuses on the dynamics of the interaction of molecules with either liquid or solid surfaces, the dynamics of the outermost layer of liquid and solid surfaces and the dynamics at the liquid-solid interface. Specific topics that are featured include state-to-state scattering dynamics, chemical reaction dynamics, non-adiabatic effects in reactive and inelastic scattering of molecules from surfaces, single molecule dynamics at surfaces, surface photochemistry, ultrafast dynamics at surfaces, and dynamics at water interfaces. The conference brings together investigators from a variety of scientific disciplines including chemistry, physics, materials science, geology, biophysics, and astronomy.

  15. The antimicrobial effects of cinnamon oil against multi-drug resistant Salmonella Newport on organic leafy greens

    Science.gov (United States)

    There is generally no kill-step when preparing salad vegetables, so there is a risk for foodborne illness outbreaks due to consumption of these vegetables. Some essential oils have antimicrobial activities and could provide a natural way to reduce pathogens on fresh produce. The use of a cinnamon ...

  16. Soil Survey Geographic (SSURGO) Special Point Features for the State of Rhode Island: Bristol, Kent, Newport, Providence, and Washington Counties

    Data.gov (United States)

    University of Rhode Island Geospatial Extension Program — This data set is a digital soil survey and generally is the most detailed level of soil geographic data developed by the National Cooperative Soil Survey. The...

  17. Soil Survey Geographic (SSURGO) Special Line Features for the State of Rhode Island: Bristol, Kent, Newport, Providence, and Washington County

    Data.gov (United States)

    University of Rhode Island Geospatial Extension Program — This data set is a digital soil survey and generally is the most detailed level of soil geographic data developed by the National Cooperative Soil Survey. The...

  18. Myogenesis in Aplysia californica (Cooper, 1863) (Mollusca, Gastropoda, Opisthobranchia) with special focus on muscular remodeling during metamorphosis

    DEFF Research Database (Denmark)

    Wollesen, Tim; Wanninger, Andreas; Klussmann-Kolb, Annette

    2008-01-01

    To date only few comparative approaches tried to reconstruct the ontogeny of the musculature in invertebrates. This may be due to the difficulties involved in reconstructing three dimensionally arranged muscle systems by means of classical histological techniques combined with light or transmissi...

  19. Cloning and Characterization of Sf9 Cell Lamin and the Lamin Conformational Changes during Autographa californica multiple nucleopolyhedrovirus Infection

    OpenAIRE

    Wenqiang Wei; Hongju Wang; Xiaoya Li; Na Fang; Shili Yang; Hongyan Liu; Xiaonan Kang; Xiulian Sun; Shaoping Ji

    2016-01-01

    At present, the details of lamina alterations after baculovirus infection remain elusive. In this study, a lamin gene in the Sf9 cell line of Spodoptera frugiperda was cloned. The open reading frame (orf) of the Sf9 lamin was 1860 bp and encoded a protein with a molecular weight of 70 kDa. A transfection assay with a red fluorescence protein (rfp)-lamin fusion protein indicated that Sf9 lamin was localized in the nuclear rim. Transmission electron microscopy observations indicated that Autogr...

  20. Age-related deficits in synaptic plasticity rescued by activating PKA or PKC in sensory neurons of Aplysia californica

    Directory of Open Access Journals (Sweden)

    Andrew T Kempsell

    2015-09-01

    Full Text Available Brain aging is associated with declines in synaptic function that contribute to memory loss, including reduced postsynaptic response to neurotransmitters and decreased neuronal excitability. To understand how aging affects memory in a simple neural circuit, we studied neuronal proxies of memory for sensitization in mature versus advanced age Aplysia. Glutamate- (L-Glu- evoked excitatory currents were facilitated by the neuromodulator serotonin (5-HT in sensory neurons (SN isolated from mature but not aged animals. Activation of PKA and PKC signaling rescued facilitation of L-Glu currents in aged SN. Similarly, PKA and PKC activators restored increased excitability in aged tail SN. These results suggest that altered synaptic plasticity during aging involves defects in second messenger systems

  1. Botrytis californica, a new cryptic species in the B. cinerea species complex causing gray mold in blueberries and table grapes

    Science.gov (United States)

    Botrytis cinerea consists of two cryptic species, referred to as Group I and Group II based on Bc-hch gene RFLP haplotyping, and Group I has been described as a new cryptic species B. pseudocinerea. During a survey for Botrytis spp. causing gray mold in blueberries and table grapes in the Central Va...

  2. Transforming Growth Factor ß Recruits Persistent MAPK Signaling to Regulate Long-Term Memory Consolidation in "Aplysia Californica"

    Science.gov (United States)

    Shobe, Justin; Philips, Gary T.; Carew, Thomas J.

    2016-01-01

    In this study, we explore the mechanistic relationship between growth factor signaling and kinase activity that supports the protein synthesis-dependent phase of long-term memory (LTM) consolidation for sensitization of "Aplysia." Specifically, we examine LTM for tail shock-induced sensitization of the tail-elicited siphon withdrawal…

  3. Egress of budded virions of Autographa californica nucleopolyhedrovirus does not require activity of Spodoptera frugiperda HSP/HSC70 chaperones.

    Science.gov (United States)

    Lyupina, Yulia V; Orlova, Olga V; Abaturova, Svetlana B; Beljelarskaya, Svetlana N; Lavrov, Andrey N; Mikhailov, Victor S

    2014-11-04

    The induction of heat shock proteins in baculovirus infected cells is well documented. However a role of these chaperones in infection cycle remains unknown. The observation that HSP70s are associated with virions of different baculoviruses reported by several researchers suggests that HSPs might be structural components of viruses or involved in virion assembly. These hypotheses were examined by using a novel inhibitor of the ATPase and chaperoning activity of HSP/HSC70s, VER-155008. When VER-155008 was added early in infection, the synthesis of viral proteins, genome replication and the production of budded virions (BV) were markedly inhibited indicating the dependence of virus reproduction on host chaperones. However, BV production was unaffected when VER-155008 was added in the mid-replication phase which is after accumulation of products required for completion of the viral DNA replication. These results suggest that the final stages in assembly of BV and their egress from cells do not depend on chaperone activity of host HSP/HSC70s.

  4. Distribution and mapping of the snail Cerithideopsis (Cerithidea) californica at Carpinteria Salt Marsh, California USA, June to August 2012

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — We collected detailed spatial data on the density and size distribution of intertidal snails as part of a broader effort to understand food webs in California...

  5. Monthly trematode infections of the snail Cerithideopsis (Cerithidea) californica at Carpinteria Salt Marsh, California USA, February 2012 to January 2014

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Each month (except March 2012), we collected detailed data on the infection status of intertidal snails from ten fixed sites as part of a broader effort to...

  6. Monthly densities of the snail Cerithideopsis (Cerithidea) californica at Carpinteria Salt Marsh, California USA, February 2012 to January 2014

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Each month (except March 2012), we collected detailed data on the density, size distribution, and infection status of intertidal snails from ten fixed sites as part...

  7. Proceedings of the U.S. Army Symposium on Gun Dynamics (7th) Held in Newport, Rhode Island on 11-13 May 1993

    Science.gov (United States)

    1993-09-01

    the 120 mm M256 evacuator. Then, using equilibrium thermochemistry , we perform shock tube analyses that predict l’t round ignition in the evacuator...Detection of Burning Case Residue." PAST EXPERIENCE: gas dynamics and thermochemistry of bore evacuator flows; emission spectroscopy of flames in a shock...Fngineering University of Illinois at Urbana - Champaign PAST EXPERIENCE: Research and Teaching Assistant California Institute of Technology DEGREES HIELD

  8. Position Papers for the First Workshop on Principles and Practice of Constraint Programming Held in Newport, Rhode Island on April 28-30, 1993

    Science.gov (United States)

    1993-04-30

    Sciences, pendant l’ann~e 1824, Partie math~matique". Histoire de I’Acaditnie Royale des Sciences de I’institut de France 7 1827, xlvii- lv . (Partial...satisfaction problems. In KR-91, pages 186 - 195, 1991. [8] L.G. Gubin, B.T. Polyak , and E.V. Raik. The method of projections for finding the common point of

  9. VT Lidar Hydro-enforced DEM (0.7 meter) - 2014 - Swaths of Area from Burlington to Newport to portion of Killington

    Data.gov (United States)

    Vermont Center for Geographic Information — (Link to Metadata) This metadata applies to the following collection area(s): Eastern VT 2014 0.7m and Hydro Enforced Digital Elevation Model (DEMHE) dataset. This...

  10. Proceedings of the Army Symposium on Solid Mechanics. Advances in Solid Mechanics for Design and Analysis Held at Newport, Rhode Island on 1-3 October 1984.

    Science.gov (United States)

    1984-10-01

    calibration station, located in Albuquerque, New Mexico . This solar furnace facility, illustrated in Figure 1, consists of a 24-foot square heliostat and a 22...fastener loading mechanisms are poorly understood and knowledge of load extremes is incomplete. Consequently, current track fastening system research at 3PL ...require added safeguards , against reuse of permanently deformed parts. Currently, 3PL is in the process of designing and fabricating several promising

  11. Proceedings of the Symposium on Interfacial Phenomena in Composites: Processing, Characterization and Mechanical Properties Held in Newport, Rhode Island on 1-3 June 1988

    Science.gov (United States)

    1988-06-03

    control, grain refine- development of nickel aluminide matrix compo- ment, microalloying , macroalloying, and rapid sites based upon Ni3AL. NiAI will...solution hardening .EMPOATURE , effects. Microalloying with boron enhances grain 200 400 O $00 000 boundary cohesive strength and increases duc- 2 SIM...early stages of gold, copper, and palladium react relatively processing tend to persist to the final product in virorously with SiC [1051; the form

  12. Proceedings of the Air Force High Energy Density Materials Contractors Conference (2nd) Held in Newport Beach, CA, on 28 Feb-2 Mar 1988

    Science.gov (United States)

    1988-05-27

    and Wahl, A.C., J. Chem. Phys., 68, 4917 (1978). 7. Matcha , R.L. and Milleur, M.B., J. Chem. Phys., 69, 3016 (1978). 8. Theodorakopoulos, G. Farantos...2.51 29 925 2736 62.5 Present3 2.44 33 216 2728 56.0 Matcha and Milleur4 2.57 21 940 2771 -- Chupka and Russell5 2.53 33 635 -- 1 The basis set of ref

  13. Proceedings of the International Conference on II-VI Compounds and Related Optoelectronic Materials (6th) Held in Newport, Rhode Island on 13-17 September 1993

    Science.gov (United States)

    1993-09-17

    almost complete intermixing 0 AA of the well and barrier materials. 250 900 :350 400 45%0 500 For quantum wells annealed at temperatures Anealhrng...versus the reciprocal tempera- based quantum wells , where a almost complete tUre tor (dTe,-CdNnTe. (’dTe/CdMgTe and lli (’dTe/’ intermixing is...periodic solids. Of course, one requires t , Output DBR Y reflectors Ouantujm I Wells "Oupu 0.5 " 0 0.5 Output d Fig. 3.Schematic drawings of a quantum

  14. Prime Contract Awards by State or Country, Place and Contractor. Part 8 (Newport Army Ammunition Plant, Indiana - Dorsey, Maryland), FY1991

    Science.gov (United States)

    1991-01-01

    cm 10) c"o go in 0) to r.- r- -4 In Cj <> tD (0 _4 o m I.- M00c), 6 < C’j 11 co -4 -4 4 m -4 Q4D (0 cli r-_ -4 C’J -- 4 -4 C-4 c,4 (1) im In Cl) C, C...4-4-4-4 0) K X2I-Zx K VN00C~4(C1))C) c’ 0) 4 14 M C In 0) ’UC14 P-K. 04 K . 4 00 0 0 0 0 -4 -4 0 40- 0KK -K K 0K ,44 K10 22 Z Z ZZ Z Z x V > 2 0 K 00...Ntt I I 00(04 i 4 " C1 Nl (0(0( (0 (0! 10 000C I .-4 0 C CION (14O CIO I0 M 0(D4 < :1 .0) CNC 1 NN C14 CN4 cNNNN" td - f -400 inNC- L W ( U) C> of wco

  15. Proceedings of the International Symposium on Subtypes of Muscarinic Receptors (5th), Held in Newport Beach, California, October 22-24, 1992.

    Science.gov (United States)

    1993-02-22

    development of new therapeutic strategies in asthma. References 1. A.F. ROFFEL, C.R.S. ELZINGA AND J. ZAAGSMA, Pulmon . Pharmacol. 3 47-51. (1990). 2. A.D...Nutritional Influences on Aging and Cancer . S t G.M. Martin. Clonal attenuation and cell senescence: The next 30 years. J.P. Phelan. Review article...age-associated cancers . E.R. Stadtman, Biochemical markers of aging. J. Meltes. Neuroendocrine biomarkers of aging in the rat. Subscription

  16. Autographa californica Multiple Nucleopolyhedrovirus Ac34 Protein Retains Cellular Actin-Related Protein 2/3 Complex in the Nucleus by Subversion of CRM1-Dependent Nuclear Export

    NARCIS (Netherlands)

    Mu, Jingfang; Zhang, Yongli; Hu, Yangyang; Hu, Xue; Zhou, Yuan; Zhao, He; Pei, Rongjuan; Wu, Chunchen; Chen, Jizheng; Zhao, Han; Yang, Kai; Oers, van Monique; Chen, Xinwen; Wang, Yun

    2016-01-01

    Actin, nucleation-promoting factors (NPFs), and the actin-related protein 2/3 complex (Arp2/3) are key elements of the cellular actin polymerization machinery. With nuclear actin polymerization implicated in ever-expanding biological processes and the discovery of the nuclear import mechanisms of ac

  17. Functional and structural analysis of GP64, the major envelope glycoprotein of the budded virus phenotype of Autographa californica and Orgyia pseudotsugata multicapsid nucleopolyhedroviruses

    NARCIS (Netherlands)

    Oomens, A.G.P.

    1999-01-01

    The Baculoviridae are a family of large, enveloped, double-stranded DNA viruses, that cause severe disease in the larvae of mostly lepidopteran insects. Baculoviruses have been studied with the aim of developing alternatives to chemical pest control, and later for their potential as systems for fore

  18. Flood Insurance Rate Maps and Base Flood Elevations, FIRM, DFIRM, BFE, Newport County Digital Flood Insurance Rate Map Database (DFIRM); DFIRM_Newport10; The Digital Flood Insurance Rate Map (DFIRM) Database depicts flood risk information and supporting data used to develop the risk data., Published in 2011, 1:4800 (1in=400ft) scale, State of Rhode Island and Providence Plantations.

    Data.gov (United States)

    NSGIC GIS Inventory (aka Ramona) — This Flood Insurance Rate Maps and Base Flood Elevations, FIRM, DFIRM, BFE dataset, published at 1:4800 (1in=400ft) scale, was produced all or in part from Other...

  19. Predation Risk versus Pesticide Exposure: Consequences of Fear and Loathing in the Life of Stream Shredders

    Science.gov (United States)

    Pestana, J. T.; Baird, D. J.; Soares, A. M.

    2005-05-01

    Stream invertebrates are exposed to complex stressor regimes including both biotic and abiotic factors. Species living in streams in agricultural landscapes are often subjected to episodic or continuous exposures to low levels of agrochemicals, which may approach or exceed specific substance guidelines. Sublethal effects of pesticides may result in direct effects on organisms (e.g. reduced physiological performance), which may in turn contribute to indirect effects relating to survival (e.g. increased predation risk). Here, we investigate the possibility that predator-release kairomones can act additively with low-level pesticide exposure to reduce physiological performance and survival of stream invertebrates in previously unforeseen ways. Feeding, metabolic and behavioural responses of two shredder insects, the North American stonefly Pteronarcys comstockii and the European caddisfly Sericostoma vittatum were measured under exposure to the insecticide imidacloprid at different levels of indirect predation stress using predator-release kairomones from Brown Trout (Salmo trutta). Pteronarcys feeding was measured in terms of mass of naturally conditioned alder leaf discs consumed over a 6-day and 10 -day period in animals held in cages in stream mesocosms. Pteronarcys feeding was impaired at 1 ppb in the 6-day trial and at 0,5 ppb in the 10-day trial relatively to unexposed controls. Metabolic rate was measured in the lab in terms of oxygen consumption of Pteronarcys. Animals exposed to 0.5 and 1 ppb imidacloprid showed elevated respiratory rates compared to controls. Laboratory experiments with Sericostoma, currently in progress, are examining the separate and combined effects of imidacloprid and predator kairomone on similar endpoints. These preliminary results are discussed in relation to the development of the Mechanistic Unifying Stressor Effects (MUSE) model which can be used to predict combined ecological effects of multiple stressors at the population level.

  20. Writing to Think: The Intellectual Journey of a Naval Career

    Science.gov (United States)

    2014-02-01

    being passed on to their children . If it does not kill you, the Navy makes you strong. 6 the newport papers meyers$:___WIP from C 032812:_Newport...economic growth. Capital, goods and people can flow freely around the globe, generating systemic behaviour . A key element of American military...functions that are needed. By divorcing the 164 the newport papers meyers$:___WIP from C 032812:_Newport Papers:_NP_41 Rubel:_InDesign:NP_41 13

  1. Inter-noise 89 - Engineering for environmental noise control; Proceedings of the International Conference on Noise Control Engineering, Newport Beach, CA, Dec. 4-6, 1989. Vols. 1 & 2

    Science.gov (United States)

    Maling, George C., Jr.

    Recent advances in noise analysis and control theory and technology are discussed in reviews and reports. Topics addressed include noise generation; sound-wave propagation; noise control by external treatments; vibration and shock generation, transmission, isolation, and reduction; multiple sources and paths of environmental noise; noise perception and the physiological and psychological effects of noise; instrumentation, signal processing, and analysis techniques; and noise standards and legal aspects. Diagrams, drawings, graphs, photographs, and tables of numerical data are provided.

  2. Multibeam collection for RB9702: Multibeam data collected aboard Ronald Brown from 1997-10-10 to 1997-10-24, departing from Newport, OR and returning to San Francisco, CA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  3. Multibeam collection for RB0002: Multibeam data collected aboard Ronald Brown from 2000-03-25 to 2000-04-04, departing from Newport, OR and returning to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  4. Multibeam collection for MGL1409: Multibeam data collected aboard Marcus G. Langseth from 2014-10-25 to 2014-10-26, departing from Norfolk, VA and returning to Newport, RI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  5. Multibeam collection for MGL1218: Multibeam data collected aboard Marcus G. Langseth from 2012-11-25 to 2012-11-25, departing from Astoria, OR and returning to Newport, OR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  6. Multibeam collection for CNTL15RR: Multibeam data collected aboard Roger Revelle from 2003-09-04 to 2003-09-22, departing from Newport, OR and returning to San Diego, CA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  7. Multibeam collection for CNTL14RR: Multibeam data collected aboard Roger Revelle from 2003-08-25 to 2003-09-02, departing from Honolulu, HI and returning to Newport, OR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  8. Multibeam collection for TN312: Multibeam data collected aboard Thomas G. Thompson from 2014-06-22 to 2014-07-06, departing from Newport, OR and returning to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  9. Multibeam collection for EW9904: Multibeam data collected aboard Maurice Ewing from 1999-04-17 to 1999-05-02, departing from San Diego, CA and returning to Newport, OR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  10. LEOS Summer Topical Meetings (1991) on Spaceborne Photonics: Aerospace Applications of Lasers and Electro-Optics and Optical Millimeter-Wave Interactions: Measurements, Generation, Transmission and Control Held in Newport Beach, California on July 22-26, 1991

    Science.gov (United States)

    1992-02-29

    4267 FAX: (512) 471-357 ThD Ucaenci= Lawe Raqgin Systei (MLM) is am acthe law romot sensig system desiged to -e= ipeot of globa change. purtouailY...addition, the flashlamp may be expected to operate differently after having been warmed up by the first pulse. Both of these factors can contribute...the second pulse forming network from 32 p.F to 26.5 I±F. Further details of the pulse forming network and the warm up effects of the first pulse will

  11. FINAL–REPORT NO. 2: INDEPENDENT CONFIRMATORY SURVEY SUMMARY AND RESULTS FOR THE ENRICO FERMI ATOMIC POWER PLANT, UNIT 1, NEWPORT, MICHIGAN (DOCKET NO. 50 16; RFTA 10-004)

    Energy Technology Data Exchange (ETDEWEB)

    Erika Bailey

    2011-07-07

    The Enrico Fermi Atomic Power Plant, Unit 1 (Fermi 1) was a fast breeder reactor design that was cooled by sodium and operated at essentially atmospheric pressure. On May 10, 1963, the Atomic Energy Commission (AEC) granted an operating license, DPR-9, to the Power Reactor Development Company (PRDC), a consortium specifically formed to own and operate a nuclear reactor at the Fermi 1 site. The reactor was designed for a maximum capability of 430 megawatts (MW); however, the maximum reactor power with the first core loading (Core A) was 200 MW. The primary system was filled with sodium in December 1960 and criticality was achieved in August 1963.

  12. Revised FINAL–REPORT NO. 2: INDEPENDENT CONFIRMATORY SURVEY SUMMARY AND RESULTS FOR THE ENRICO FERMI ATOMIC POWER PLANT, UNIT 1, NEWPORT, MICHIGAN (DOCKET NO. 50 16; RFTA 10-004) 2018-SR-02-1

    Energy Technology Data Exchange (ETDEWEB)

    Erika Bailey

    2011-10-27

    The Enrico Fermi Atomic Power Plant, Unit 1 (Fermi 1) was a fast breeder reactor design that was cooled by sodium and operated at essentially atmospheric pressure. On May 10, 1963, the Atomic Energy Commission (AEC) granted an operating license, DPR-9, to the Power Reactor Development Company (PRDC), a consortium specifically formed to own and operate a nuclear reactor at the Fermi 1 site. The reactor was designed for a maximum capability of 430 megawatts (MW); however, the maximum reactor power with the first core loading (Core A) was 200 MW. The primary system was filled with sodium in December 1960 and criticality was achieved in August 1963. The reactor was tested at low power during the first couple years of operation. Power ascension testing above 1 MW commenced in December 1965 immediately following the receipt of a high-power operating license. In October 1966 during power ascension, zirconium plates at the bottom of the reactor vessel became loose and blocked sodium coolant flow to some fuel subassemblies. Two subassemblies started to melt and the reactor was manually shut down. No abnormal releases to the environment occurred. Forty-two months later after the cause had been determined, cleanup completed, and the fuel replaced, Fermi 1 was restarted. However, in November 1972, PRDC made the decision to decommission Fermi 1 as the core was approaching its burn-up limit. The fuel and blanket subassemblies were shipped off-site in 1973. Following that, the secondary sodium system was drained and sent off-site. The radioactive primary sodium was stored on-site in storage tanks and 55 gallon (gal) drums until it was shipped off-site in 1984. The initial decommissioning of Fermi 1 was completed in 1975. Effective January 23, 1976, DPR-9 was transferred to the Detroit Edison Company (DTE) as a 'possession only' license (DTE 2010a). This report details the confirmatory activities performed during the second Oak Ridge Institute for Science and Education (ORISE) site visit to Fermi 1 in November 2010. The survey was strategically planned during a Unit 2 (Fermi 2) outage to take advantage of decreased radiation levels that were observed and attributed to Fermi 2 from the operating unit during the first site visit. However, during the second visit there were elevated radiation levels observed and attributed to the partially dismantled Fermi 1 reactor vessel and a waste storage box located on the 3rd floor of the Fermi 1 Turbine Building. Confirmatory surveys (unshielded) performed directly in the line of sight of these areas were affected. The objective of the confirmatory survey was to verify that the final radiological conditions were accurately and adequately described in Final Status Survey (FSS) documentation, relative to the established release criteria. This objective was achieved by performing document reviews, as well as independent measurements and sampling. Specifically, documentation of the planning, implementation, and results of the FSS were evaluated; side-by-side FSS measurement and source comparisons were performed; site areas were evaluated relative to appropriate FSS classification; and areas were assessed for residual, undocumented contamination.

  13. An Analysis of Wuhan Newport Mode to Advance Rise of Central China%武汉新港推进中部崛起的亮点模式分析

    Institute of Scientific and Technical Information of China (English)

    张晓骏; 邹旖

    2011-01-01

    在港口的现代化建设中,港口的功能一体化,供销和服务系统化,才能提高港城一体的新经济发展速度。武汉新港作为现代港口的新枢纽.正在发挥着现代港口和现代物流的协同作用,跨区域布局的合理性和科学化为其在管理和运营上都显现出独特的优势。通过分析武汉新港的亮点模式:项目库管理、综合信息平台、长江流域经济走廊,认为武汉新港推动的港城一体化,利用先进的现代港口服务技术,将作为“第四代港口”奠定中部崛起的新格局和新模式,成为推动中部崛起的经济引擎。%In the modernization construction of the port, the port's function integration, supply and marketing and service systematization can improve new economic development speed of port-city as a whole. Wnhan new port as a new hub of the modern port is playing a modern port and logistics synergies role, and cross-regional distribution of rationality and scientific management and operations show a unique advantage. Through analyzing the Wuhan new port's highlight pattern: project library management, integrated infornlation platform, the Yangtze River economic corridor. This paper accounts that Wuhan new port promotes the integration of port-city, by utilizing advanced modern port services technology, which will lay new structure and new pattern for the rise of central China as the "fourth-generation port" and promote the rise of central China as economic engine.

  14. Summary of the Defense Science Board 1978 Summer Study on ’Achieving Improved NATO Effectiveness Through Armaments Collaboration’ Held 31 July-11 August 1978, Naval War College, Newport, Rhode Island

    Science.gov (United States)

    1978-12-01

    of air-to-air missiles. There are acknowledged difficulties with the concept which is still in embrionic stages: (1) Should a "family" be defined...dealing only with the IEPG. But it is far from clear whether this would be effective or put far too much strain on an embrionic institution. Extra-NATO

  15. Multibeam collection for EX0904: Multibeam data collected aboard Okeanos Explorer from 2009-06-03 to 2009-06-12, departing from San Francisco, CA and returning to Newport, OR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  16. Multibeam collection for MGL1302: Multibeam data collected aboard Marcus G. Langseth from 2013-02-27 to 2013-03-21, departing from Newport, OR and returning to Galveston, TX

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  17. Multibeam collection for EX0905: Multibeam data collected aboard Okeanos Explorer from 2009-06-17 to 2009-06-27, departing from Newport, OR and returning to Astoria, OR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  18. Health assessment of pine forest as affected by geothermal activities: Presence of Monterey pine aphid, Essigella californica (Essig) (Homoptera: Aphidae) associated with higher concentrations of boron on pine needles

    National Research Council Canada - National Science Library

    Adolfo Arturo Del Rio Mora

    2014-01-01

    .... In the geothermal field "Los Humeros", located between the borders of the states of Puebla and Veracruz, Mexico was realized a forest health monitoring to know the assessment could have these emissions of sulphur...

  19. Injurious Effects of Acridine on Spodoptera Frugiperda 9 Cells and Autographa Californica Multiple Nucleopolyhedrovirus%吖啶橙对草地贪夜蛾sf9细胞和AcMNPV病毒的损伤效应

    Institute of Scientific and Technical Information of China (English)

    邓平建; 房师松; 李喜梅; 倪惠波; 王叶元; 林健荣

    2007-01-01

    背景与目的:探索吖啶橙对昆虫细胞的遗传损伤.材料与方法:用不同浓度的吖啶橙处理草地贪夜蛾Sf9细胞、AcMNPV病毒,观察其对细胞生长发育,微核发生率,AcMNPV感染力的影响.结果:sf9细胞经5μg/ml的吖啶橙处理后,细胞分裂生长速度减慢,细胞表面粗糙,微核发生率为10.4‰,10 μg/ml时可引起细胞膜破碎或死亡,微核发生率为22‰,出现三核,多核甚至核裂现象.当AcMNPV经吖啶橙处理后再感染sf9细胞,AcMNPV可在细胞内增殖,形成多角体,并出现一些类似三角形或四角形的异常多角体.结论:用一定剂量的吖啶橙处理草地贪夜蛾sf9细胞和AcMNPV病毒,可对细胞产生损伤和引起AcMNPV发生异常多角体.

  20. Women's Health Among the Chumash

    Directory of Open Access Journals (Sweden)

    James D. Adams

    2006-01-01

    Full Text Available Plants were, and still are, widely used for a number of conditions affecting women in California. This article discusses traditional remedies of the Chumash for dysmenorrhea, premenstrual syndrome, feminine hygiene, heavy menstruation, urinary tract infections, parturition, lactation, infant care, menopause, sexually transmitted diseases, fertility, contraception and abortions. Many plants are presented including Artemisia douglasiana, Paeonia californica, Trichostema lanatum, Salvia apiana, Ephedra viridis, Leymus condensatus, Vitis californica, Eschscholzia californica, Rosa californica, Scirpus acutus, Anemopsis californica and Phoradendron macrophyllum. By providing the specific uses of plants for specific diseases and discussing chemistry, efficacy and safety concerns for each plant, we hope that this article gives direction to women seeking to use plants in their health care.

  1. The Navy Unmanned Undersea Vehicle (UUV) Master Plan

    Science.gov (United States)

    2004-11-09

    Proceedings, October 2002, ADM Vern Clark, USN. Sea Shield: Projecting Global Defensive Assurance, Naval Instititute Proceedings, November 2002, VADM Mike...Goodman, Naval Undersea Warfare Center, Newport Julio Gutierrez, Naval Undersea Warfare Center, Newport LT Harper, Office of Naval Intelligence...Center, Panama City William Girodet, Locheed Martin Maritime Sensors & Systems Anthony Griffin, Office of Naval Intelligence Julio Gutierrez, Naval

  2. Effects of age on the acquisition of agreement inflection

    NARCIS (Netherlands)

    Blom, E.; Polišenská, D.; Weerman, F.

    2007-01-01

    Grammaticality judgement tasks show that second language learners who started during childhood are significantly more accurate on judging inflection than learners who started after puberty [Johnson, J., & Newport, E. (1989). Cognitive Psychology, 21, 60-99; Johnson, J., & Newport, E. (1991). Cogniti

  3. Learning from Experience, Volume 2: Lessons from the U.S. Navy’s Ohio, Seawolf, and Virginia Submarine Programs

    Science.gov (United States)

    2011-01-01

    contract. New drawings were issued for com- 21 Jones, Kronenberg , and Scherer, 2009, p. 4. 90 Learning from Experience, Volume II plex electrical...Newport, R. I.: Naval War College, Newport Papers No. 33, 2008. Jones, Mike, Eric Kronenberg , and Kurt Scherer, ISSR: What Drives Your Program Costs

  4. NCBI nr-aa BLAST: CBRC-MLUC-01-0326 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-0326 ref|ZP_02701339.2| paraquat-inducible protein A [Salmonella enter...ica subsp. enterica serovar Newport str. SL317] gb|EDX48757.1| paraquat-inducible protein A [Salmonella enterica subsp. enterica serovar Newport str. SL317] ZP_02701339.2 3.0 23% ...

  5. Multi-Element Patch Antenna and Method

    Science.gov (United States)

    2010-03-13

    WAX /SEA WARFARE CENTERS NEWPORT DEPARTMENT OF THE NAVY NAVAL UNDERSEA WARFARE CENTER DIVISION NEWPORT OFFICE OF COUNSEL PHONE: 401 832...mounted in different ways, as desired. Instead of air, dielectric material may be utilized as layers 27 such as PTFE or the like, or low-loss honey

  6. Effects of age on the acquisition of agreement inflection

    NARCIS (Netherlands)

    Blom, E.; Polišenská, D.; Weerman, F.

    2007-01-01

    Grammaticality judgement tasks show that second language learners who started during childhood are significantly more accurate on judging inflection than learners who started after puberty [Johnson, J., & Newport, E. (1989). Cognitive Psychology, 21, 60-99; Johnson, J., & Newport, E. (1991). Cogniti

  7. 76 FR 61738 - Notice of Lodging of Consent Decree Under the Clean Water Act

    Science.gov (United States)

    2011-10-05

    ... against Newport Sand & Gravel Company, Inc., and Carroll Concrete Company, Inc. (``Defendants'') for..., 2011, a proposed Consent Decree in United States v. Newport Sand & Gravel Company, Inc., and Carroll Concrete Company, Inc., Civil Action No. 2:11-cv-228, was lodged with the United States District Court...

  8. 75 FR 36069 - Notice of a Regional Project Waiver of Section 1605 (Buy American) of the American Recovery and...

    Science.gov (United States)

    2010-06-24

    ... treatment system for the Easton Beach Project in Newport, Rhode Island. This is a project specific waiver... Engineer, (617) 918-1658, or David Chin, Environmental Engineer, (617) 918-1764, Municipal Assistance Unit... part of its proposed Easton Beach Project in Newport, RI. Trojan Technologies has a U.S....

  9. Teaching MA-TESOL Courses Online: Challenges and Rewards.

    Science.gov (United States)

    Nunan, David

    2002-01-01

    Draws on experience developing a Web-based master's program in TESOL for Newport Asia Pacific University (NAPU), a relatively new virtual university based in Newport Beach, California that offers graduate programs in TESOL, teaching Japanese as a second language, intercultural communication, and business administration. Discusses the challenges…

  10. Teaching MA-TESOL Courses Online: Challenges and Rewards.

    Science.gov (United States)

    Nunan, David

    2002-01-01

    Draws on experience developing a Web-based master's program in TESOL for Newport Asia Pacific University (NAPU), a relatively new virtual university based in Newport Beach, California that offers graduate programs in TESOL, teaching Japanese as a second language, intercultural communication, and business administration. Discusses the challenges…

  11. From Numbers to Action: A Preliminary Study of Retention.

    Science.gov (United States)

    Greenlee, Shelia Parker; Greenlee, Harry

    This study examined retention at Christopher Newport University (CNU) in Newport News, Virginia, focusing on the demographic characteristics of those students who left the university as well as the reasons why they left. A total of 159 students who had attended CNU during the 1994-95 academic year but who did not re-enroll in the fall of 1995 were…

  12. Identification of a human homologue of the vesicle-associated membrane protein (VAMP)-associated protein of 33 kDa (VAP-33): a broadly expressed protein that binds to VAMP.

    Science.gov (United States)

    Weir, M L; Klip, A; Trimble, W S

    1998-01-01

    We report the identification of a human homologue of the vesicle-associated membrane protein (VAMP)-associated protein (hVAP-33) that has been implicated in neuronal exocytosis in Aplysia californica. This hVAP-33 shared 50% amino acid identity with the A. californica form and had similar length, structural organization and VAMP-binding abilities. However, in contrast with the neuron-specific expression seen in A. californica, hVAP-33 was broadly expressed, suggesting possible roles in vesicle fusion in both neuronal and non-neuronal cells. PMID:9657962

  13. Partial pressure of carbon dioxide, pH, dissolved oxygen and other variables collected from time series observations using SAMI-CO2, SAMI-pH, and other instruments from Buoy NH-20 off the coast of Newport, Oregon, United States, at the near bottom depth of ~125 meters from 2014-01-15 to 2015-08-25 (NCEI Accession 0145163)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Subset of moored data from Benthic Boundary Layer near shelfbreak at 44.65N off OR coast. Hydro stattion NH20, at ~124.5W. Approximate water depth ~127m. Sensors ~2...

  14. U.S. Naval Weather Service Command. Summary of Synoptic Meteorological Observations, North American Coastal Marine Areas - Revised. Pacific Coast. Volume 6. Area 36 - Point Arena, Area 37 - Eureka, Area 38 - Cape Blanco, Area 39 - Newport, Area 40 - Astoria, Area 41 - Vancouver Island SW

    Science.gov (United States)

    1976-05-01

    FE«CENT»6E ««EOUENCV OF CEILlNC HEIGHTS IFT>NH >*/•) »NO DCCL’MENCE OF NH ɡ/l »V VINO OUECTION 000 190 300 600 1000 2000 3900 5000 6500...IO0: (D»I»-»IL1 l»»J-l*7> JUNE Tlill II (CONTI PrT FKEO OF VINO SPEED IKTSI »ND DIRECTION VEHSuS $E« HEICHTS (FT) •HE« 001» POINT ««EN» M.SN...1.3 1.9 .a 16,6 •6.9 VINO SPEED IKTSI VS SE« HEIGHT (FTI 0-1 6-10 11-21 22-13 36-67 61» PCT (1 19.2 7.1 .0 .0

  15. Protein Tyrosine Phosphatase-Induced Hyperactivity Is a Conserved Strategy of a Subset of BaculoViruses to Manipulate Lepidopteran Host Behavior

    NARCIS (Netherlands)

    Houte, van S.; Ros, V.I.D.; Mastenbroek, T.G.; Vendrig, N.J.; Hoover, K.; Spitzen, J.; Oers, van M.M.

    2012-01-01

    Many parasites manipulate host behavior to increase the probability of transmission. To date, direct evidence for parasitic genes underlying such behavioral manipulations is scarce. Here we show that the baculovirus Autographa californica nuclear polyhedrovirus (AcMNPV) induces hyperactive behavior

  16. Spontaneous excision of BAC vector sequences from bacmid-derived baculovirus expression vectors upon passage in insect cells

    NARCIS (Netherlands)

    Pijlman, G.P.; Schijndel, van J.; Vlak, J.M.

    2003-01-01

    Repeated baculovirus infections in cultured insect cells lead to the generation of defective interfering viruses (DIs), which accumulate at the expense of the intact helper virus and compromise heterologous protein expression. In particular, Autographa californica multicapsid nucleopolyhedovirus (Ac

  17. Absence of psilocybin in species of fungi previously reported to contain psilocybin and related tryptamine derivatives

    NARCIS (Netherlands)

    Stijve, T.; Kuyper, Th.W.

    1988-01-01

    Seven taxa of agarics reported in literature to contain psilocybin (viz. Psathyrella candolleana, Gymnopilus spectabilis, G. fulgens, Hygrocybe psittacina var. psittacina and var. californica, Rickenella fibula, R. swartzii) have been analysed for psilocybin and related tryptamines with negative

  18. South Fork of the Santa Clara River, Santa Clarita Valley, California. Supplement.

    Science.gov (United States)

    1985-01-01

    Santa Eriodictyon trichocalyx Eucrypta Eucrypta chrysanthemifolia LAMIACEAE Purple Sage Salvia leucophylla PAEONIACEAE Peony Paeonia californica...Bush Lupine Lupinus ex-cubitus HYDROPHYLLACEAE Yerba Santa Eriodictyon trichocaLx Eucrypta Eucrypta chrysanthemifolia LAMIACEAE Purple Sage Salvia

  19. Absence of psilocybin in species of fungi previously reported to contain psilocybin and related tryptamine derivatives

    NARCIS (Netherlands)

    Stijve, T.; Kuyper, Th.W.

    1988-01-01

    Seven taxa of agarics reported in literature to contain psilocybin (viz. Psathyrella candolleana, Gymnopilus spectabilis, G. fulgens, Hygrocybe psittacina var. psittacina and var. californica, Rickenella fibula, R. swartzii) have been analysed for psilocybin and related tryptamines with negative res

  20. Cercosporoid leaf pathogens from whorled milkweed and spineless safflower in California

    NARCIS (Netherlands)

    Koike, S.K.; Baameur, A.; Groenewald, J.Z.; Crous, P.W.

    2011-01-01

    Two cercosporoid species are respectively described from Mexican whorled milkweed (Asclepias fascicularis), and spineless safflower (Carthamus tinctorius) from California. Passalora californica represents a new pathogen on Asclepias fascicularis, while Ramularia cynarae is confirmed on Carthamus

  1. Environmental Assessment for Perimeter Security Lighting at Fort MacArthur, California

    Science.gov (United States)

    2007-07-01

    salt marsh communities. Typical species include California sagebrush (Artemesia californica), deerweed ( Lotus scoparius), pickleweed (Salicornia...affected by regional birth and death rates as well as net migration. Economic activity typically comprises employment, personal income, and industrial

  2. Affection of Infection of Autographa californica nucleopolyhe- drovirus on Sf9 Cell Cycle%苜蓿银纹夜蛾核型多角体病毒的感染对Sf9细胞周期的影响

    Institute of Scientific and Technical Information of China (English)

    王颖; 余泽华; 姚汉超; 陶德定; 陈曲侯

    2002-01-01

    病毒的感染导致细胞内部发生一系列变化.应用流式细胞仪FACS的荧光检测,测出Sf9细胞完成整个周期循环大约需要18h,G\\-1、S、G\\-2/M各时相的时间间隔约为6h;AcNPV感染Sf9细胞12-18h,细胞被抑制于G\\-2/M期;Sf9细胞同步于G\\-1/S期后释放细胞并用AcNPV感染,12h后,2/3的细胞处于G\\-2/M期,1/3的细胞处于S期.

  3. EST Table: BP121593 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP121593 ceN-5053 10/09/28 94 %/117 aa ref|NP_054119.1| major viral capsid protein ...[Autographa californica nucleopolyhedrovirus] sp|P17499.1|VP39_NPVAC RecName: Full=Major capsid protein gb|A...AA02580.1| capsid protein [Autographa californica nucleopolyhedrovirus] gb|AAA66719.1| major viral capsid pr

  4. Extracts of Phenolic Compounds from Seeds of Three Wild Grapevines—Comparison of Their Antioxidant Activities and the Content of Phenolic Compounds

    Directory of Open Access Journals (Sweden)

    Ryszard Amarowicz

    2012-03-01

    Full Text Available Phenolic compounds were extracted from three wild grapevine species: Vitis californica, V. riparia and V. amurensis seeds using 80% methanol or 80% acetone. The total content of phenolic compounds was determined utilizing the Folin-Ciocalteu’s phenol reagent while the content of tannins was assayed with the vanillin and BSA precipitation methods. Additionally, the DPPH free radical scavenging activity and the reduction power of the extracts were measured. The RP-HPLC method was applied to identify the phenolic compounds in the extracts, such as phenolic acids and catechins. The seeds contained large amounts of tannins, catechins and gallic acid and observable quantities of p-coumaric acid. The total content of phenolic compounds and tannins was similar in the extracts from V. californica and V. riparia seeds. However, the total content of total phenolic compounds and tannins in the extracts from V. californica and V. riperia seeds were about two-fold higher than that in the extracts from V. amurensis seeds. Extracts from seeds of the American species (V. californica and V. riparia contained similarly high concentrations of tannins, whereas extracts from seeds of V. amurensis had approximately half that amount of these compounds. The content of catechin and epicatechin was similar in all extracts. The highest DPPH• anti-radical scavenging activity was observed in the acetonic and methanolic extracts of V. californica and V. riparia seeds—while the acetonic extract from the V. californica seeds was the strongest reducing agent.

  5. Interdicting Pakistani Cross Border Sanctuary

    Science.gov (United States)

    2009-05-04

    Department Naval War College 686 Cushing Road Newport, RI 02841-1207 9. SPONSORING...example from Vietnam of population security. The CAP was the brain child of General Walt, the USMC commander in the northern zone of Vietnam, and

  6. 1933 Long Beach, USA Images

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — 5 kilometers southwest of Newport Beach. Seriously affected area: 1,200 square kilometers. Damage: $40 million. Schools were among the buildings most severely...

  7. Ecological periodic tables for nekton and benthic macrofaunal community usage of estuarine habitats Slides

    Science.gov (United States)

    Ecological periodic tables for nekton and benthic macrofaunal community usage of estuarine habitats Steven P. Ferraro, U.S. Environmental Protection Agency, Newport, OR Background/Questions/Methods The chemical periodic table, the Linnaean system of classification, and the Her...

  8. Comparative virulence genotyping and antimicrobial susceptibility profiling of environmental and clinical Salmonella enterica from Cochin, India

    Digital Repository Service at National Institute of Oceanography (India)

    Parvathi, A.; Vijayan, J.; Murali, G.; Chandran, P.

    Newport isolated from a backwater environment were compared with Salmonella Typhi from clinical cases in the same region where salmonellosis is endemic. Genotyping was done by PCR screening for virulence markers associated with Salmonella pathogenicity...

  9. LANTHANIDE ENHANCE LUMINESCENCE (LEL) WITH ONE AND TWO PHOTON EXCITATION OF QUANTUM DYES LANTHANIDE (III) - MACROCYCLES

    Science.gov (United States)

    Title: Lanthanide Enhance Luminescence (LEL) with one and two photon excitation of Quantum Dyes? Lanthanide(III)-Macrocycles Principal Author:Robert C. Leif, Newport InstrumentsSecondary Authors:Margie C. Becker, Phoenix Flow Systems Al Bromm, Virginia Commonw...

  10. Stillbirth FAQ

    Science.gov (United States)

    ... and keep track of your baby’s movements (kicks, twists, turns, swishes or rolls). This will help you ... a week, 8am - 6pm First Candle, 9 Newport Drive, Suite 200, Forest Hill, MD 21050M ©2016 First ...

  11. Ecological periodic tables for nekton and benthic macrofaunal community usage of estuarine habitats Slides

    Science.gov (United States)

    Ecological periodic tables for nekton and benthic macrofaunal community usage of estuarine habitats Steven P. Ferraro, U.S. Environmental Protection Agency, Newport, OR Background/Questions/Methods The chemical periodic table, the Linnaean system of classification, and the Her...

  12. LANTHANIDE ENHANCE LUMINESCENCE (LEL) WITH ONE AND TWO PHOTON EXCITATION OF QUANTUM DYES LANTHANIDE (III) - MACROCYCLES

    Science.gov (United States)

    Title: Lanthanide Enhance Luminescence (LEL) with one and two photon excitation of Quantum Dyes? Lanthanide(III)-Macrocycles Principal Author:Robert C. Leif, Newport InstrumentsSecondary Authors:Margie C. Becker, Phoenix Flow Systems Al Bromm, Virginia Commonw...

  13. Experimental Investigations of Transport and Optical Properties of 3-5 Quantum Well Structures Grown Via Molecular Beam Epitaxy under Optimal Growth Conditions

    Science.gov (United States)

    1989-04-18

    Mariott Hotel , CA), SPIE Vol. 946, p.1 5 0 (1988). 13. W.C. Tang, Pudong Lao, and A. Madhukar, "Optical Investigation of Resonant Mixing Between...Superconductors; Physics and Device Applications", (13-18 March, 1988, Newport Beach Mariott Hotel , CA), SPIE Vol. 943, p.170 (1988). 14. F.J. Grunthaner...Newport Beach Mariott Hotel , CA). 4. W.C. Tang, Pudong Lao, and A. Madhukar, "Optical Investigation of Resonant Mixing Between Electronic and Optical

  14. Characterization and Evolution of Salmonella CRISPR-Cas Systems

    Science.gov (United States)

    2014-01-01

    DRV, direct repeat variant; LCA , last common ancestor. Three supplementary tables and five supplementary figures are available with the online...a conserved anchor group of the three oldest spacers is also shared between these three serovars. CRISPR1 ser. Enteritidis LCA 1 2 15 66^ 69 70 67 ser...Newport-II LCA ser. Newport-III LCA ser. Heidelberg LCA ser. Typhimurium LCA 121 181 124 161 111 123 128 180 116 103 109 126 110 119 114 125 122 112

  15. Ohio River Environmental Assessment Cultural Resources Reconnaissance Technical Report for the State of Kentucky Portion,

    Science.gov (United States)

    1977-09-15

    Pusey, William Allen 124. 1921 The Wilderness Road to Kentuck: Its Location and Features. George H. Owen. New York. Putman , Frederick Ward 125. 1875...102. New York. Putman , Frederick Ward 271. 1875 Archaeological Exploration in Kentucky and Indiana. American Naturalist, 9:410-415. Salem. 272. 1875...34Memorandum Relative To Gen. James Taylor Mansion In Newport, Ky." The Christopher Gist Historical Society, Newport. Turner, Justin G., and Linda Levitt Turner

  16. 33 CFR 110.168 - Hampton Roads, Virginia and adjacent waters (Datum: NAD 83).

    Science.gov (United States)

    2010-07-01

    ... Bay, Thimble Shoals Channel Anchorages. (i) Anchorage B . The waters bounded by a line connecting the... center located at: Latitude Longitude 36°58′54.9″ N 76°20′03.2″ W (viii) Anchorage H, Newport News Bar....7″ N 76°24′10.1″ W (4) James River Anchorages. (i) Anchorage I, Newport News. The waters bounded...

  17. Zeta potential of selected bacteria in drinking water when dead, starved, or exposed to minimal and rich culture media.

    Science.gov (United States)

    Soni, Kamlesh A; Balasubramanian, Ashwin K; Beskok, Ali; Pillai, Suresh D

    2008-01-01

    The zeta potentials of E. coli, GFP (green fluorescence protein)-labeled E. coli, Salmonella Newport, and Pseudomonas sp. in different states (nutrient-starved and dead) and grown in rich and minimal media were measured. Capillary electrophoresis experiments were conducted to measure the zeta potential of the different cells suspended in a drinking water sample. Salmonella Newport strain showed a lower zeta potential compared to E. coli, GFP-labeled E. coli, and Pseudomonas sp. Starved E. coli cells had a lower zeta potential compared to E. coli cells grown under rich media conditions. Salmonella Newport cells grown in minimal media also had a lower zeta potential compared to rich, starved, and dead cells. The different bacterial cell types exhibited differences in size as well. These results suggest that when bacterial cells are present in drinking water they can exhibit significant heterogeneity in the size and zeta potential, depending on their physiological state.

  18. Using stable isotopes to track biomagnification of polychlorinated biphenyls (PCBs) through stream food webs

    Science.gov (United States)

    Walters, D. M.; Fritz, K. M.; Johnson, B. R.; Lazorchak, J. M.

    2005-05-01

    Biomagnification studies of PCBs in streams are rare, even though PCBs are known to biomagnify and persist in aquatic ecosystems. We investigated PCB contamination in Twelvemile Creek (Clemson, SC, USA), a stream that received >400,000 lbs of PCBs from 1955-1978. Our goals were to determine if PCBs biomagnify in streams and to measure the relative importance of heterotrophic and autotrophic pathways for biomagnification. Sites were sampled during spring (n=6) and fall (n=4) 2003-04. Major components of the foodweb were analyzed for total PCBs, δ13C and δ15N. Biomagnification was apparent as mean δ15N strongly predicted PCBs (r2 = 0.58), and PCBs consistently increased with trophic level. We found no consistent patterns related to carbon pathways. δ13C and PCBs were uncorrelated, suggesting that carbon source was unrelated to biomagnification. However, mean PCB tissue concentration in grazers were double those in shredders (Stenonema modestum, 970 ppb versus Tipula and Pteronarcys spp, 370 ppb) even though concentrations were similar for periphyton and conditioned leaves. Our results show that PCBs biomagnify and persist in streams but the importance of autotrophic and heterotrophic pathways are unclear. Although this work was reviewed by EPA and approved for publication, it may not necessarily reflect official Agency policy.

  19. Structural and functional responses of benthic invertebrates to imidacloprid in outdoor stream mesocosms

    Energy Technology Data Exchange (ETDEWEB)

    Pestana, J.L.T., E-mail: jpestana@ua.p [CESAM and Departamento de Biologia, Universidade de Aveiro, Campus Universitario de Santiago, 3810-193 Aveiro (Portugal); Environment Canada at Canadian Rivers Institute, Department of Biology, University of New Brunswick, 10 Bailey Drive, Fredericton, NB (Canada); Alexander, A.C., E-mail: alexa.alexander@unb.c [Environment Canada at Canadian Rivers Institute, Department of Biology, University of New Brunswick, 10 Bailey Drive, Fredericton, NB (Canada); Culp, J.M., E-mail: jculp@unb.c [Environment Canada at Canadian Rivers Institute, Department of Biology, University of New Brunswick, 10 Bailey Drive, Fredericton, NB (Canada); Baird, D.J., E-mail: djbaird@unb.c [Environment Canada at Canadian Rivers Institute, Department of Biology, University of New Brunswick, 10 Bailey Drive, Fredericton, NB (Canada); Cessna, A.J., E-mail: asoares@ua.p [Environment Canada, National Hydrology Research Centre, 11 Innovation Boulevard, Saskatoon, SK (Canada); Soares, A.M.V.M., E-mail: asoares@ua.p [CESAM and Departamento de Biologia, Universidade de Aveiro, Campus Universitario de Santiago, 3810-193 Aveiro (Portugal)

    2009-08-15

    Structural and functional responses of a benthic macroinvertebrate assemblage to pulses of the insecticide imidacloprid were assessed in outdoor stream mesocosms. Imidacloprid pulses reduced invertebrate abundance and community diversity in imidacloprid-dosed streams compared to control streams. These results correlated well with effects of imidacloprid on leaf litter decomposition and feeding rates of Pteronarcys comstocki, a stonefly, in artificial streams. Reductions in oxygen consumption of stoneflies exposed to imidacloprid were also observed in laboratory experiments. Our findings suggest that leaf litter degradation and single species responses can be sensitive ecotoxicological endpoints that can be used as early warning indicators and biomonitoring tools for pesticide contamination. The data generated illustrates the value of mesocosm experiments in environmental assessment and how the consideration of functional and structural endpoints of natural communities together with in situ single species bioassays can improve the evaluation and prediction of pesticide effects on stream ecosystems. - Combining organism-level responses with community-level processes for the evaluation and prediction of pesticide effects on stream ecosystems.

  20. Competitive inhibition bacteria of bovine origin against Salmonella serovars.

    Science.gov (United States)

    Danyluk, Michelle D; Zhao, Tong; Doyle, Michael P

    2007-08-01

    Studies were conducted to isolate bacteria inhibitory to Salmonella enterica serovar Typhimurium definitive type (DT) 104 in vitro from cattle not carrying Salmonella and to determine the inhibitory activity of the isolated bacteria through competitive growth in cattle feces artificially contaminated with Salmonella Typhimurium DT104 and S. enterica serovar Newport. Fecal samples (108) were obtained from dairy and beef cows. S. enterica serovars were isolated from 9.25% of the samples and included Salmonella Newport (4), Salmonella Bareilly (1), Salmonella Mbandaka (1), Salmonella Montevideo (1), Salmonella Meleagridis (1), and monophasic Salmonella (2). All four Salmonella Newport isolates were resistant to at least nine antibiotics. Of 1,097 bacterial isolates from cattle feces screened, 30 were inhibitory to Salmonella Typhimurium DT104 in vitro. The inhibitory isolates included 22 Escherichia coli, 6 Bacillus circulans, 1 Serratia fonticola, and 1 Enterobacter cloacae. Typing by pulsed-field gel electrophoresis showed 17 distinguishable profiles among the 22 E. coli. Competitive inhibition isolates did not significantly reduce Salmonella Typhimurium DT104 during 21 days of storage at 37 degrees C in cattle feces. B. circulans (10(5) CFU/g of inoculum) significantly reduced Salmonella Newport on days 3 and 5 and on day 21 with 10(8) CFU/g of inoculum at 37 degrees C. At 21degrees C, significant reductions of Salmonella Typhimurium DT104 occurred with 10(8) CFU of gram-negative competitive inhibition bacteria per g and 10(5) CFU of B. circulans per g on day 5 only. No significant reductions were observed with Salmonella Newport at 21 degrees C. The 25 competitive inhibition bacteria identified in this study offer a first step in identifying competitive inhibition bacteria that may reduce the level of intestinal carriage and fecal shedding of Salmonella Typhimurium DT104 and Salmonella Newport in cattle.

  1. Open reading frame 94 of Helicoverpa armigera single nucleocapsid nucleopolyhedrovirus encodes a novel conserved occlusion-derived virion protein, ODV-EC43

    NARCIS (Netherlands)

    Fang, M.; Wang, H.; Yuan, L.; Chen Xinwen,; Vlak, J.M.; Hu, Z.

    2003-01-01

    Open reading frame 94 (Ha94) of Helicoverpa armigera single nucleocapsid nucleopolyhedrovirus (HaSNPV) is 1086 bp long and a homologue of Autographa californica multiple NPV ORF109. The gene is conserved among all baculoviruses whose genomes have been completely sequenced so far and is thus

  2. Baculovirus envelope fusion proteins F and GP64 exploit distinct receptors to gain entry into cultured insect cells

    NARCIS (Netherlands)

    Westenberg, M.; Uijtdewilligen, P.; Vlak, J.M.

    2007-01-01

    Group II nucleopolyhedroviruses (NPVs), e.g. Helicoverpa armigera (Hear) NPV and Spodoptera exigua (Se) MNPV (multiple NPV), lack a GP64-like protein that is present in group I NPVs, e.g. Autographa californica (Ac)MNPV, but have an unrelated envelope fusion protein named F. Three AcMNPV viruses wer

  3. Baculovirus envelope fusion proteins F and GP64 exploit distinct receptors to gain entry into cultured insect cells.

    NARCIS (Netherlands)

    Westenberg, M.; Uijtdewilligen, P.J.E.; Vlak, J.M.

    2007-01-01

    Group II nucleopolyhedroviruses (NPVs), e.g. Helicoverpa armigera (Hear) NPV and Spodoptera exigua (Se) MNPV (multiple NPV), lack a GP64-like protein that is present in group I NPVs, e.g. Autographa californica (Ac)MNPV, but have an unrelated envelope fusion protein named F. Three AcMNPV viruses wer

  4. Detection of antibodies against porcine parvovirus nonstructural protein NS1 may distinguish between vaccinated and infected pigs

    DEFF Research Database (Denmark)

    Madsen, Eva Smedegaard; Madsen, Knud Gert; Nielsen, Jens

    1997-01-01

    was inserted into the baculovirus Autographa californica nuclear polyhedrosis virus (AcNPV) genome resulting in two recombinant baculoviruses AcNPV-NS1 and AcNPV-VP2, respectively. Sf9 cells (Spodoptora frugidiperda) inoculated with AcNPV-NS1 producing recombinant nonstructural protein (rNS1) and AcNPV-VP2...

  5. Effects of population size on virus evolution: a baculovirus perspective

    NARCIS (Netherlands)

    Zwart, M.P.

    2008-01-01

    This thesis explores the population genetics of the baculovirus infection process and the consequences for virus evolution. Using Autographa californica multicapsid nucleopolyhedrovirus (AcMNPV) and lepidopteran insect larvae as a model system, we attempt to characterize (1) elemental virus-host and

  6. Identification and characterization of mutations in housefly (Musca domestica) acetylcholinesterase involved in insecticide resistance

    DEFF Research Database (Denmark)

    Walsh, Sinead B.; Dolden, Tracey A.; Moores, Graham D.

    2001-01-01

    Acetylcholinesterase (AChE) insensitive to organophosphate and carbamate insecticides has been identified as a major resistance mechanism in numerous arthropod species. However, the associated genetic changes have been reported in the AChE genes from only three insect species; their role in confe...... of the AChE protein from Torpedo californica and D. melanogaster....

  7. Western scrub-jays conceal auditory information when competitors can hear but cannot see

    NARCIS (Netherlands)

    Stulp, Gert; Emery, Nathan J.; Verhulst, Simon; Clayton, Nicola S.

    2009-01-01

    Western scrub-jays (Aphelocoma californica) engage in a variety of cache-protection strategies to reduce the chances of cache theft by conspecifics. Many of these strategies revolve around reducing visual information to potential thieves. This study aimed to determine whether the jays also reduce

  8. Spatial variation in effects of temperature on Phenotypic characteristics of Phytophthora ramorum isolates from eastern Sonoma county

    Science.gov (United States)

    Valerie Sherron; Nathan E. Rank; Michael Cohen; Brian L. Anacker; Ross K. Meentemeyer

    2008-01-01

    Quantifying the growth rates of plant pathogens in the laboratory can be useful for predicting rates of disease spread and impact in nature. The purpose of this study was to examine phenotypic variation among isolates of Phytophthora ramorum collected from a foliar host plant species, Umbellularia californica (California bay laurel...

  9. Effect of environmental conditions and lesion age on sporulation of Phytophthora ramorum on California bay laurel, rhododendron, and camellia

    Science.gov (United States)

    Steve Tjosvold; David Chambers; Sylvia Mori

    2013-01-01

    The objective of our research was to determine the environmental conditions and lesion age favorable for Phytophthora ramorum sporulation under field conditions. For 2 years, new camellia, rhododendron, and California bay laurel (Umbellaria californica (Hook. & Arn.) Nutt.) nursery stock were seasonally inoculated (every 3 months) on foliage....

  10. Proposed Closure of Los Angeles Air Force Base, California and Relocation of Space Systems Division

    Science.gov (United States)

    1990-07-01

    californica), black sage ( Salvia mellifera), purple sage ( Salvia leucophylla), deerweed (Lotus scoparius), and poison oak (Toxicodendron diversilobum...Masticophis lateralis var. lateralis), western terrestrial garter snake (Thamnophis elegans var. terrestris) and possibly the western skink (Eumeces...tern Sterna elegans (2)Swainson’s Hawk Buted swainsoni (2) California Yellow-Billed Cuckoo Coccyzus americanus occidentalis (2) U Reptiles Western

  11. Studies of the silencing of Baculovirus DNA binding protein

    NARCIS (Netherlands)

    Quadt, I.; Lent, van J.W.M.; Knebel-Morsdorf, D.

    2007-01-01

    Baculovirus DNA binding protein (DBP) binds preferentially single-stranded DNA in vitro and colocalizes with viral DNA replication sites. Here, its putative role as viral replication factor has been addressed by RNA interference. Silencing of DBP in Autographa californica multiple

  12. Studies of the silencing of Baculovirus DNA binding protein

    NARCIS (Netherlands)

    Quadt, I.; Lent, van J.W.M.; Knebel-Morsdorf, D.

    2007-01-01

    Baculovirus DNA binding protein (DBP) binds preferentially single-stranded DNA in vitro and colocalizes with viral DNA replication sites. Here, its putative role as viral replication factor has been addressed by RNA interference. Silencing of DBP in Autographa californica multiple nucleopolyhedrovir

  13. Sleep Supports Inhibitory Operant Conditioning Memory in "Aplysia"

    Science.gov (United States)

    Vorster, Albrecht P. A.; Born, Jan

    2017-01-01

    Sleep supports memory consolidation as shown in mammals and invertebrates such as bees and "Drosophila." Here, we show that sleep's memory function is preserved in "Aplysia californica" with an even simpler nervous system. Animals performed on an inhibitory conditioning task ("learning that a food is inedible") three…

  14. Essential C-Terminal region of the baculovirus minor capsid protein VP80 binds DNA

    NARCIS (Netherlands)

    Marek, M.; Merten, O.W.; Francis-Devaraj, F.; Oers, van M.M.

    2012-01-01

    The essential Autographa californica multicapsid nucleopolyhedrovirus (AcMNPV) minor capsid protein VP80 has been recently shown to interact with the virus-triggered, nuclear F-actin cytoskeleton. A role for VP80 in virus morphogenesis has been proposed in the maturation of progeny nucleocapsids and

  15. California bay laurel susceptibility to Phythophthora ramorum depends upon season, leaf age, and fungal load

    Science.gov (United States)

    Steve Johnston; Nathan Rank; Michael Cohen; Ross Meentemeyer

    2010-01-01

    Phytophthora ramorum can produce spores on dozens of native California plant species, but the most important vector for infection of oak (Quercus) is California bay laurel (Umbellularia californica). Presence of bay laurel is associated with increased infection of oaks and it is the most common tree...

  16. Cercosporoid leaf pathogens from whorled milkweed and spineless safflower in California.

    Science.gov (United States)

    Koike, Steven T; Baameur, Aziz; Groenewald, Johannes Z; Crous, Pedro W

    2011-06-01

    Two cercosporoid species are respectively described from Mexican whorled milkweed (Asclepias fascicularis), and spineless safflower (Carthamus tinctorius) from California. Passalora californica represents a new pathogen on Asclepias fascicularis, while Ramularia cynarae is confirmed on Carthamus tinctorius and Cynara cardunculus (Asteraceae), and an epitype designated. Pathogenicity is also established for both pathogens based on Koch's postulate.

  17. Recombinant, catalytically inactive juvenile hormone esterase enhances efficacy of baculovirus insecticides

    NARCIS (Netherlands)

    Meer, van M.M.M.; Bonning, B.C.; Ward, V.K.; Vlak, J.M.; Hammock, B.D.

    2000-01-01

    The insecticidal efficacy of baculoviruses can be enhanced by engineering the viral genome to express proteins that disrupt the physiology of the host insect. Here we describe the development of a genetically engineered Autographa californica multicapsid nucleopolyhedrovirus (AcMNPV) which expresses

  18. The roots of defense: plant resistance and tolerance to belowground herbivory.

    Directory of Open Access Journals (Sweden)

    Sean M Watts

    Full Text Available BACKGROUND: There is conclusive evidence that there are fitness costs of plant defense and that herbivores can drive selection for defense. However, most work has focused on above-ground interactions, even though belowground herbivory may have greater impacts on individual plants than above-ground herbivory. Given the role of belowground plant structures in resource acquisition and storage, research on belowground herbivores has much to contribute to theories on the evolution of plant defense. Pocket gophers (Geomyidae provide an excellent opportunity to study root herbivory. These subterranean rodents spend their entire lives belowground and specialize on consuming belowground plant parts. METHODOLOGY AND PRINCIPAL FINDINGS: We compared the root defenses of native forbs from mainland populations (with a history of gopher herbivory to island populations (free from gophers for up to 500,000 years. Defense includes both resistance against herbivores and tolerance of herbivore damage. We used three approaches to compare these traits in island and mainland populations of two native California forbs: 1 Eschscholzia californica populations were assayed to compare alkaloid deterrents, 2 captive gophers were used to test the palatability of E. californica roots and 3 simulated root herbivory assessed tolerance to root damage in Deinandra fasciculata and E. californica. Mainland forms of E. californica contained 2.5 times greater concentration of alkaloids and were less palatable to gophers than island forms. Mainland forms of D. fasciculata and, to a lesser extent, E. californica were also more tolerant of root damage than island conspecifics. Interestingly, undamaged island individuals of D. fasciculata produced significantly more fruit than either damaged or undamaged mainland individuals. CONCLUSIONS AND SIGNIFICANCE: These results suggest that mainland plants are effective at deterring and tolerating pocket gopher herbivory. Results also suggest

  19. Enlisted Women at Sea: A Quantitative Analysis

    Science.gov (United States)

    1994-03-09

    Crisis. Cambridge, Mass.: Massachusetts Institute of Technology, Center for Advanced Engineering Study, 1989. Devilbiss , M. C., Ph.D., Women and Militarv...from Deborah Eitelberg and Mike Dove, Defense Manpower Data Center, Monterey, California to LCDR E.A. Rowe, USN, Naval War College, Newport, R.I., 7

  20. Ordered Short-Term Memory Differs in Signers and Speakers: Implications for Models of Short-Term Memory

    Science.gov (United States)

    Bavelier, Daphne; Newport, Elissa L.; Hall, Matt; Supalla, Ted; Boutla, Mrim

    2008-01-01

    Capacity limits in linguistic short-term memory (STM) are typically measured with forward span tasks in which participants are asked to recall lists of words in the order presented. Using such tasks, native signers of American Sign Language (ASL) exhibit smaller spans than native speakers ([Boutla, M., Supalla, T., Newport, E. L., & Bavelier, D.…

  1. All Stirred Up

    Science.gov (United States)

    Borja, Rhea R.

    2004-01-01

    This article describes the growth and popularity of Newport Harbor's culinary arts program, which reflects a nationwide trend. The trend is occurring in part, because more Americans are eating out. As the number of people eating out increases, their appetite for learning about food also increases. Over the past few years, Dukes has expanded…

  2. Aliquid novi ex Africa? Lamyctes africanus (Porath, 1871) found in Europe (Chilopoda: Lithobiomorpha: Henicopidae)

    DEFF Research Database (Denmark)

    Enghoff, Henrik; Akkari, Nesrine; Pedersen, Jan

    2013-01-01

    emarginatus (Newport, 1844). Several previous records of L. africanus are shown probably to concern other species. An account of species distribution and habitats suggests a typical pioneering species. The taxonomy of the genus Lamyctes is discussed, including a detailed account of the use of antennomere...

  3. From Fog to Friction: The Impact of Network-Enabled Command and Control on Operational Leadership

    Science.gov (United States)

    2012-05-04

    Operations Department Naval War College 686 Cushing Road Newport, RI 02841-1207 8. PERFORMING ORGANIZATION REPORT...they receive enough subsequent information to raise their confidence level. 46 Closely related to this phenomenon is the fact that the brain is...wired to acknowledge information that changes rather than information that is constant, regardless of the perceived quality. 47 The brain has a

  4. Northern Command: A Relevant and Necessary Partner to Increase Security in Mexico

    Science.gov (United States)

    2010-10-27

    Department Naval War College 686 Cushing Road Newport, RI 02841-1207 9. SPONSORING/MONITORING...Capable of Providing? Since the terrorist attacks on 11 September 2001, the U.S. has built a significant brain trust with regard to counter

  5. Fleet Cyber Command/TENTH Fleet: Enabling Cyber Unity of Effort

    Science.gov (United States)

    2010-05-03

    Cushing Road Newport, RI 02841-1207 9. SPONSORING/MONITORING AGENCY NAME(S) AND ADDRESS(ES...conventional seapower in their physical struggle with the U-boats--to put teeth into the anti- U-boat campaign by fusing brain and brawn." 25 Today’s

  6. War in the Information Age: A Primer for Cyberspace Operations in 21st Century Warfare

    Science.gov (United States)

    2010-01-01

    ADDRESS(ES) Naval War College,686 Cushing Road,Newport,RI,02841-1207 8. PERFORMING ORGANIZATION REPORT NUMBER 9. SPONSORING/MONITORING AGENCY NAME(S...7 Oxford English Dictionary, 11 th ed. Wetware is defined as human brain cells viewed as counterparts of computer systems. 8 U.S. Office of

  7. Demand Reduction: Reducing the Demand for Illegal Drugs in the United States

    Science.gov (United States)

    2011-10-28

    War College 686 Cushing Road Newport, RI 02841-1207 9. SPONSORING/MONITORING AGENCY NAME(S) AND...cause of death.18 Our demand for illegal drugs is a significant part of the problem. Prevention and Education: Research on adolescent brain

  8. Civil Discourse or Civil War? The Influence of Civil-Military Relations on Iraq and Afghanistan War Strategy

    Science.gov (United States)

    2011-05-04

    Hopkins Univ. Press, 2009), 44. 10 Mackubin T. Owens (professor, Naval War College, Newport, RI), interview by the author, 5 April 2011. 11 Risa A...www.esquire.com/features/fox-fallon (accessed 18 March 2011). Brooks, Risa A. Shaping Strategy: The Civil-Military Politics of Strategic Assessment

  9. Manufacturing Methods and Technology Measure for Fabrication of Silicon Transcalent Rectifier.

    Science.gov (United States)

    1979-10-01

    Reduced Baro - metric Pressure test for half wave voltaue iu ] cation to the DUT in the vacuum chamber. F. Thermal Resistance Test Set The thermal...Mr. Kenneth Lipman Newport Beach, CA 92663 Box 109 South Windsor, CT 06074 Silicon Transistor Corp. ATTN: Mr. P. Fitzgerald Martin Marietta Katrina

  10. 75 FR 62810 - Twenty-Fourth Update of the Federal Agency Hazardous Waste Compliance Docket

    Science.gov (United States)

    2010-10-13

    ... number of Federal facilities that appear on the Docket is 2,358. Dated: September 29, 2010. John E... Facility name Address City State code Agency mechanism Code US NAVY NUWC Div Newport 419 Dalton Highway... Meridian, N. Bank of Kuskokwim Rivr. USDOI BLM John Rishel Mineral 100 Savikko Rd, Douglas AK 99824...

  11. Mainstreaming the Sustainably Designed School.

    Science.gov (United States)

    Weintraub, Deborah; Pierce, Tony

    This paper documents a school building energy efficiency and sustainability project involving the Newport Mesa Unified School District, Southern California Edison's Design and Engineering Services (D&ES), and the architectural firm Perkins and Will. The paper first examines the project design objectives and then discusses each of the project…

  12. Inactivation of Salmonella on tomato stem scars by edible chitosan and organic acid coatings

    Science.gov (United States)

    This study investigated the efficacy of antimicrobial coatings on inactivation of Salmonella on the surface of tomato stem scars, which was inoculated with a four-strain cocktail of Salmonella (S. Montevideo. S. Newport. S. Saintpaul, and S. Typhimurium) and coated with acid-chitosan solutions. The ...

  13. [Synthesis of 11-[(2-pyridyl)amino]- and 11-[(9-anthracenylcarbonyl)amino]undecyl phosphate and investigation of their acceptor properties in the enzymic reaction catalyzed by galactosylphosphotransferases from Salmonella].

    Science.gov (United States)

    Danilov, L L; Balagurova, N M; Vinnikova, A N; Utkina, N S; Torgov, V I; Kalinchuk, N A; Druzhinina, T N; Veselovsky, V V

    2014-01-01

    11-[(2-Pyridyl)amino]undecyl phosphate and 11-[(9-anthracenylcarbonyl)amino]undecyl phosphate were chemically synthesized. The abiliy of these new fluorescent derivatives of undecyl phosphate to serve as acceptor substrate of galactosyl phosphate residue in the enzymic reaction catalyzed by galactosylphosphotransferase from Salmonella anatum or Salmonella newport membrane preparation was demonstrated.

  14. Fouled Anchors: The CONSTELLATION Question Answered

    Science.gov (United States)

    1991-09-01

    1711804 87AU 73 89-1-3401 11. TITLE (kcn e S.cE) Caut,.cawn) Fouled Anchors: The Constellation Question Answered IL. PERSONA .. AUTHOPS) Wegner, Dana M...was familia , with the unaltered Constellation in Newport and, unknown to the Committee, had indeed visited the ship once in Baltimore (see p. 45). It is

  15. Quasi-Square Hole with Optimum Shape in an Infinite Plate Subjected to In-Plane Loading. Optimization of Inner and Outer Boundaries of Beams and Plates with Holes,

    Science.gov (United States)

    1982-04-01

    Division 045 Administracion Naval Ship Resarc; and Development 14114 (Technical Library) Structures Research Division Center Langley Research Center...Undereerer Systeos CtKirtland Air Force Bess Port Hueneme, Californis 93041 Navel Rnderater Systm Center Albuquerque. New Mexico 87117Newport, Rhode

  16. 76 FR 43993 - Army Science Board Summer Study Meeting

    Science.gov (United States)

    2011-07-22

    ... Department of the Army Army Science Board Summer Study Meeting AGENCY: Department of the Army, DoD. ACTION... following committee meeting: Name of Committee: Army Science Board (ASB). Date(s) of Meeting: August 10, 2011. Time(s) of Meeting: 0800-1200. Location: Newport News Marriott at City Center, 740 Town Center...

  17. When Do Memory Limitations Lead to Regularization? An Experimental and Computational Investigation

    Science.gov (United States)

    Perfors, Amy

    2012-01-01

    The Less is More hypothesis suggests that one reason adults and children differ in their ability to learn language is that they also differ in other cognitive capacities. According to one version of this hypothesis, children's relatively poor memory may make them more likely to regularize inconsistent input (Hudson Kam & Newport, 2005, 2009). This…

  18. 75 FR 71736 - In the Matter of: Certain Data Storage Products and Components Thereof; Notice of Investigation

    Science.gov (United States)

    2010-11-24

    ... behalf of Data Network Storage, LLC of Newport Beach, California. A supplement to the complaint was filed...., 855 Riverside Parkway, Suite 40, West Sacramento, CA 95605. Xyratex (Malaysia) Sdn Bhd, No. C-7-2 (Level 2) Bay Avenue, Lorong Bayan Indah 3, 1900 Penang, Malaysia. Dot Hill Systems Corp., 1351 S. Sunset...

  19. The Information Barber Pole: Integrating White Information and Red Intelligence in Emerging Conflicts

    Science.gov (United States)

    2013-12-01

    afghanistan. 3 Hans J. Morgenthau , “The Future of Diplomacy,” in Strategy and Force Planning, ed. Hans J. Morgenthau and Kenneth W. Thomson (Newport... Morgenthau , Hans J. “The Future of Diplomacy.” in Strategy and Force Planning, edited by Hans J. Morgenthau and Kenneth W. Thomson, 267–277

  20. A Lack Of Grand Strategy: Ramifications for the U.S. in Asia

    Science.gov (United States)

    2013-06-01

    1 Yarger, ix. 2 Ibid, 1. 3 Henry C. Bartlett, G. Paul Holman Jr., and Timothy E. Somes, “The... Holman Jr., and Timothy E. Somes. “The Art of Strategy and Force Planning.” In Strategy and Force Planning, 4th ed. Newport, RI: Naval War College

  1. Keeping your seed head above water - EPA's research on the effects of sea level rise on sea grasses and emergent marshes in the Pacific Northwest

    Science.gov (United States)

    Global climate change, including sea-level rise (SLR), will have profound effects on estuarine fish, shellfish, and wildlife populations and their habitats. To develop an understanding of these potential impacts, the U.S. EPA at Newport, Oregon is participating in a joint researc...

  2. James Wessell Gerdemann, 1921-2008

    Science.gov (United States)

    James M. Trappe

    2010-01-01

    Jim Gerdemann died peacefully of natural causes on December 19, 2008, at the age of 87. Janice, his wife of nearly 60 y, was at his hospital bedside in Newport, Oregon. He was a pioneer in the modern taxonomy of Glomeromycota, a world recognized authority on arbuscular mycorrhizae (AM), and a revered teacher.

  3. Military Justice Study Guide

    Science.gov (United States)

    1990-07-01

    Island Paralegal (Student) Command Division N/A TAD from/to until (give date) Naval Justice School, Newport, Rhode Island 3255 Whereabouts for next 30...If a lesser forum is desired, handle according to procedures set out elsewhere in this book. I IV-41 LEGAL OFFICER RELIEVING CHECKLIST A. GEN t . One

  4. Senior Service School Teaching Methods

    Science.gov (United States)

    1989-05-01

    4b CHAPTER VI FINDINGS AND RECOMMENDATIONS Introduction Was Marshall McLuhan right when he penned "Societies have always been shaped more by the...Newport, Rhode Island: Naval War College, 3 August 1988. 73. McLuhan , Marshall , and Quentin Fiore. The Medium is the Massage. New York: Random House

  5. Effects of integrated treatment of nonthermal UV-C light and different antimicrobial wash on Salmonella enterica on plum tomatoes

    Science.gov (United States)

    Produce contamination by foodborne pathogens remains a serious threat. This study investigated synergistic effects of ultraviolet-C and various active sanitizers’ washes against Salmonella enterica on plum tomatoes. A bacterial cocktail containing three serotypes of Salmonella enterica (S. Newport H...

  6. 77 FR 43866 - Notice of Intent To Grant a Partially Exclusive License

    Science.gov (United States)

    2012-07-26

    ... LLC having its principal place of business in Newport News, Virginia. The license may be limited to... Administration. The prospective partially exclusive license will comply with the terms and conditions of 35 U.S.C. 209 and 37 CFR 404.7. DATES: The prospective partially exclusive license may be granted unless, within...

  7. Sulfur Dioxide and Nitrogen Dioxide Adsorption on Zinc Oxide and Zirconium Hydroxide Nanoparticles and the Effect on Photoluminescence

    Science.gov (United States)

    2012-01-01

    shaped Schwartz drying tube, with glass beads added to increase the sur- face area and facilitate enhanced contact with the flowing gas. To remove...of ZnO, Hoya U340 and Newport CGA-345 filters, and for Zr(OH)4 PL measurements, Hoya U340 and Schott GG385 filters, were used in the excitation and

  8. NASA Langley/CNU Distance Learning Programs.

    Science.gov (United States)

    Caton, Randall; Pinelli, Thomas E.

    NASA Langley Research Center and Christopher Newport University (CNU) provide, free to the public, distance learning programs that focus on math, science, and/or technology over a spectrum of education levels from K-adult. The effort started in 1997, and currently there are a suite of five distance-learning programs. This paper presents the major…

  9. The Icarus challenge - Predicting vulnerability to climate change using an algorithm-based species' trait approach

    Science.gov (United States)

    The Icarus challenge - Predicting vulnerability to climate change using an algorithm-based species’ trait approachHenry Lee II, Christina Folger, Deborah A. Reusser, Patrick Clinton, and Rene Graham1 U.S. EPA, Western Ecology Division, Newport, OR USA E-mail: lee.henry@ep...

  10. Sustaining Military Operations in the Arctic -- The U.S. Cannot do it Alone

    Science.gov (United States)

    2012-05-04

    islands, and the airspace above in order to achieve a desired end state.” Walter Berbrick, Christopher Gray, Leif Bergey , Fleet Arctic Operations Game...Berbrick, Walter, Christopher Gray, Leif Bergey . Fleet Arctic Operations Game Report 2011. Naval War College War Gaming Department, Newport, RI

  11. 75 FR 67317 - Proposed Flood Elevation Determinations

    Science.gov (United States)

    2010-11-02

    ... County Courthouse, 208 Main Street, Newport, AR 72112. Hernando County, Florida, and Incorporated Areas... Unincorporated Areas Pond Road (at Junction of Hernando County. 1NP0170). Approximately 100 feet None +236... +56 City of Brooksville, downstream of Unincorporated Areas Weatherly Road (at of Hernando...

  12. Antibacterial activity of oregano oil against antibiotic resistant Salmonella enterica on organic leafy greens at varying exposure times and storage temperatures

    Science.gov (United States)

    The objective of this study was to evaluate the effectiveness of oregano oil on four organic leafy greens (iceberg and romaine lettuces and mature and baby spinaches) inoculated with Salmonella Newport as a function of treatment exposure times as well as storage temperatures. Leaf samples were wash...

  13. A Strategic Approach to Joint Officer Management: Analysis and Modeling Results

    Science.gov (United States)

    2009-01-01

    rules. 5 Johnson and Wichern, 2002, p. 643. 6 Sullivan and Perry, 2004, p. 370. 7 Francesco Mola and Raffaele Miele , “Evolutionary Algorithms for...in Military Affairs, Newport, R.I.: Center for Naval Warfare Studies, 2003. Mola, Francesco, and Raffaele Miele , “Evolutionary Algorithms for

  14. Advanced Methods for Passive Acoustic Detection, Classification, and Localization of Marine Mammals

    Science.gov (United States)

    2015-09-30

    Classification, and Localization of Marine Mammals Jonathan Klay NOAA Pacific Marine Environmental Laboratory (PMEL) 2115 SE OSU Dr. Newport, OR...classify marine mammal vocalizations and ultimately, in some cases, provide data for estimating the population density of the species present. In...types of marine mammal sounds. OBJECTIVES We are developing advanced real-time passive acoustic marine mammal detection, classification, and

  15. Proceedings of the 1978 symposium on instrumentation and control for fossil demonstration plants

    Energy Technology Data Exchange (ETDEWEB)

    1978-01-01

    The 1978 symposium on instrumentation and control for fossil demonstration plants was held at Newport Beach, California, June 19--21, 1978. It was sponsored by Argonne National Laboratory, the U.S. Department of Energy - Fossil Energy, and the Instrument Society of America - Orange County Section. Thirty-nine papers have been entered individually into the data base. (LTN)

  16. The Temporal Dynamics of Regularity Extraction in Non-Human Primates

    Science.gov (United States)

    Minier, Laure; Fagot, Joël; Rey, Arnaud

    2016-01-01

    Extracting the regularities of our environment is one of our core cognitive abilities. To study the fine-grained dynamics of the extraction of embedded regularities, a method combining the advantages of the artificial language paradigm (Saffran, Aslin, & Newport, [Saffran, J. R., 1996]) and the serial response time task (Nissen & Bullemer,…

  17. 2009 Joint CBRN Conference

    Science.gov (United States)

    2009-06-25

    MD RDECOM, AMC Suffolk, VA VA M&S Cen er Ft Monroe , VA TRADOC HQ Chem Demil Tooele, UT Umatilla, OR Newport, In Blue Grass, KY Under construction...Maintenance Joe Pecoraro, Parsons Protective Equipment Marilyn Ripin, Smiths Detection Filter Technology David Yokota, Honeywell Decontamination Tim Henry

  18. 75 FR 36360 - New England Fishery Management Council; Public Hearings

    Science.gov (United States)

    2010-06-25

    ... Portland, ME; Fairhaven, MA; Chatham, MA; New London, CT; Cape May, NJ and Newport News, VA. For specific... Statement include: (1) implementation and specification of annual catch limits (ACLs) and accountability... p.m. - Radisson Hotel, 35 Governor Winthrop Boulevard, New London, CT 06320; telephone: (860)...

  19. Issues and Challenges in Student Affairs and Services Around the ...

    African Journals Online (AJOL)

    Dr Kathleen Callahan is Lecturer for Leadership Studies at Christopher Newport ... world. IASAS was formed from the awareness of and need for a global ... such as JSAA, the field of student affairs and services is starting to hear more voices of.

  20. DESICCATION IS A LIMITING FACTOR FOR EELGRASS (ZOSTERA MARINA L.) DISTRIBUTION IN THE INTERTIDAL ZONE OF A NORTHEASTERN P{ACIFIC (USA) ESTUARY

    Science.gov (United States)

    Intertidal irradiance, temperature, and aerial exposure were measured for two years in intertidal Zostera marina beds located in Yaquina Bay (Newport, OR, USA). These physical data were correlated with plant growth and other metrics measured at intervals during the study. Pho...

  1. Low Contribution of PbO2-Coated Lead Service Lines to Water Lead Contamination at the Tap

    Science.gov (United States)

    To determine if field experience corroborates that formation of stable PbO2 coatings on lead service lines (LSLs) provides an effective lead contamination control strategy, lead profile sampling was undertaken at eight home kitchen taps in three US cities (Newport, Rhode Island; ...

  2. Ordered Short-Term Memory Differs in Signers and Speakers: Implications for Models of Short-Term Memory

    Science.gov (United States)

    Bavelier, Daphne; Newport, Elissa L.; Hall, Matt; Supalla, Ted; Boutla, Mrim

    2008-01-01

    Capacity limits in linguistic short-term memory (STM) are typically measured with forward span tasks in which participants are asked to recall lists of words in the order presented. Using such tasks, native signers of American Sign Language (ASL) exhibit smaller spans than native speakers ([Boutla, M., Supalla, T., Newport, E. L., & Bavelier, D.…

  3. MACROALGAL VOLUME: A SURROGATE FOR BIOMASS IN SOME GREEN ALGAE

    Science.gov (United States)

    Two green algal morphotypes, filamentous species (e.g., Chaetomorpha spp.) and flattened or tubular (e.g.,Ulva spp. and Enteromorpha spp.) were collected from 63 sites within the Yaquina Bay estuary (Newport, OR) and used to compare an in situ volumetric biomass estimator to the...

  4. A Numerical Study of Automated Dynamic Relaxation for Nonlinear Static Tensioned Structures.

    Science.gov (United States)

    1987-10-01

    RS Munn). New London. C F; Code TA131 (De lit Crui7). New Londonl. CT: Lib (Code 4533), Newport, RI OCNR Code 1121 (EA Silva ). Arlington. VA; Code...WELLSPRING (C0MM IL iZarecor. Nlarshall. VA WESTERN INSTRUMENT (CORP Ventura . (A WESTINGHOUSE ELE-(’TRIC(𔃺OR’ librars . Pgittsbu, . P’A: ( xtec Di\\) I it

  5. Mecistocephalidae), with the description of a new species with unusually elongate denticles

    NARCIS (Netherlands)

    Bonato, L.; Minelli, A.

    2009-01-01

    As a contribution to investigate the interspecific diversity in the large genus Mecistocephalus Newport, 1843 with respect to these centipedes’ predatorial role in soil tropical communities, we compared the patterns of maxillipede denticles in 32 species of the genus, and studied all published relev

  6. Deep Ultraviolet Laser Imaging for Biology

    Science.gov (United States)

    2008-08-15

    camera. Light was coupled into a UV multi-mode fiber (ThorLabs, Newton NJ), directed to a fused silica collector lens ( Esco Products, Oak Ridge NJ), and...beam combiner, held in a beamsplitter cube holder (Newport CH- 0.5) with fused silica collector lenses ( Esco Products) mounted in lens holders

  7. Mainstreaming the Sustainably Designed School.

    Science.gov (United States)

    Weintraub, Deborah; Pierce, Tony

    This paper documents a school building energy efficiency and sustainability project involving the Newport Mesa Unified School District, Southern California Edison's Design and Engineering Services (D&ES), and the architectural firm Perkins and Will. The paper first examines the project design objectives and then discusses each of the project…

  8. Defense Health Care: 2008 Access to Care Surveys Indicate Some Problems, but Beneficiary Satisfaction Is Similar to Other Health Plans

    Science.gov (United States)

    2010-03-01

    Sierra Vista, Tucson, Yuma 4. California – Los Angeles, Newport Beach 5. Colorado – Denver, Fort Collins 6. Delaware – Camden, Dover, Wilmington...the 2008 Beneficiary and Provider Surveys Non-Prime Service Area 1. California – Chico, Fresno, Modesto , Napa, Redding, Sacramento, Santa Rosa

  9. Biology of Pyemotes parviscolyti (acarina: pyemotidae)

    Science.gov (United States)

    John c. Moser; E.A. Cross

    1971-01-01

    Pyemotes parviscolyti Cross & Moser is phoretic only on Pityophthorus bisulcatus Eichhoff; it attacks all stages of this insect except the adult. Females, which contain little or no venom, prey on other scolytids if galleries overlap. Males copulate with females of Pyemotes ventricosus Newport and vice versa...

  10. A Comparative Analysis of Teenagers Who Smoke Different Cigarette Brands.

    Science.gov (United States)

    Enomoto, Carl E.

    2000-01-01

    Analyzes and compares the survey responses of teenagers who smoke different cigarette brands, specifically Marlboro, Camel, and Newport. Differences were seen across brands but teen smokers had similar opinions about quitting. Given the differences across brands, more flexible approaches may be needed to address teenage smoking. (Author/MKA)

  11. 77 FR 32571 - Marine Mammals; File No. 14856

    Science.gov (United States)

    2012-06-01

    ...., Hatfield Marine Science Center, Oregon State University, Newport, OR 97365, has applied in due form for a permit to take marine mammals world-wide for the purposes of scientific research. DATES: Written... identified species of marine mammals species world-wide. The purposes of the proposed research are to: (1...

  12. 7 CFR 29.8001 - Designation of tobacco markets.

    Science.gov (United States)

    2010-01-01

    ... Newport Oct. 27, 1954 19 FR 6878. (rr) Georgia ......do Alma and Pearson May 13, 1955 20 FR 3252. (ss... Tennessee Knoxville, Tenn. Kentucky Maysville, Ky Paris, Ky Springfield, Ky Ohio Ripley, Ohio (l) Georgia...) Kentucky All Shelbyville, Ky July 17, 1940 5 FR 2607. (q) Georgia Flue-cured Danville, Va Aug. 16, 1941...

  13. Small ICBM Area Narrowing Report. Volume 1. Hard Mobile Launcher in Random Movement Basing Mode

    Science.gov (United States)

    1986-01-01

    AF 4 NM MELROSE AIR FORCE RANGE AF 3 NM SACRAMENTO PEAK JARS AF 3 NM WHITE SANDS MISSILE RANGE ARMY NV FALLON NAVAL AIR STATION NAVY 4 NV HAWTHORNE ...STATION NAVY 4 RI NEWPORT EDUCATION & TRAINING CENTER NAVY 3 RI DAVISVILLE CONST. BATTALION CTR NAVY 4 RI FORT NATHANIEL GREEN ARMY 4 RI PROVIDENCE NAVAL

  14. Evaluation of State-of-the-Art High Speed Deluge Systems Presently in Service at Various U.S. Army Ammunition Plants

    Science.gov (United States)

    1993-09-01

    Goedeke, G.A. Fadorsen Donmar Limited TIC 901 Dover Drive, Suite 120 ¶ LEC I r Newport Beach CA 92660 .11994f SEPTEMBER 1993 Final Report for...01CLASSIFIAT1o i ooWNGRAoING sO4EO4JLE distribution. 4. PERFORMING ORGANIZATION REPORT NUMSER(S) S. MONITORING ORGANIZACION REPORT NUMSER(S) WL-TR-93

  15. Naval War College Review. Volume 65, Number 2, Spring 2012

    Science.gov (United States)

    2012-01-01

    trust and confidence through their shared experiences in the classroom and in travel, in Newport and as far as the Golden Gate Bridge. {LINE-SPACE...Southwest Pacific campaign, and the Mediter - ranean and European campaigns. By war’s conclusion, the amphibious assault, even of the magnitude and complexity

  16. 78 FR 26215 - Jewish American Heritage Month, 2013

    Science.gov (United States)

    2013-05-03

    ..., from women's rights to workers' rights to the end of segregation. That story is still unfolding today... wrote a letter to the Touro Synagogue in Newport, Rhode Island--one of our Nation's first Jewish houses of worship--and reaffirmed our country's commitment to religious freedom. He noted that...

  17. 75 FR 68605 - Marine Mammals

    Science.gov (United States)

    2010-11-08

    ... National Oceanic and Atmospheric Administration RIN 0648-XX23 Marine Mammals AGENCY: National Marine... Marine Science Center, Newport, OR has been issued a permit to conduct research on marine mammals... authority of the Marine Mammal Protection Act of 1972, as amended (16 U.S.C. 1361 et seq.), the regulations...

  18. 33 CFR 165.501 - Chesapeake Bay entrance and Hampton Roads, VA and adjacent waters-Regulated Navigation Area.

    Science.gov (United States)

    2010-07-01

    ... across the James River along the eastern side of U.S. Route 17 highway bridge, between Newport News and.... Thimble Shoal Channel consists of the waters bounded by a line connecting Thimble Shoal Channel Lighted... Auxiliary Channel consists of the waters in a rectangular area 450 feet wide adjacent to the north side...

  19. 77 FR 33089 - OPSAIL 2012 Virginia, Port of Hampton Roads, VA

    Science.gov (United States)

    2012-06-05

    ... 9500), thence to Newport News Channel Lighted Buoy 2 (LLNR 10840), thence to Old Point Comfort Light... Channel, Hampton Roads, James River and Elizabeth River during these events, that restriction is limited... transit or anchor in portions of the Chesapeake Bay, Thimble Shoals Channel, Hampton Roads, James...

  20. 77 FR 19957 - OPSAIL 2012 Virginia, Port of Hampton Roads, VA

    Science.gov (United States)

    2012-04-03

    ... 9520), thence to Elizabeth River Channel Lighted Buoy 8 (LLNR 9500), thence to Newport News Channel... Channel will be waived for OPSAIL 2012 Virginia vessels; and vessels will be required to proceed at the... the Chesapeake Bay, Thimble Shoals Channel, Hampton Roads, James River and Elizabeth River...

  1. Child-Adult Differences in Implicit and Explicit Second Language Learning

    Science.gov (United States)

    Lichtman, Karen Melissa

    2012-01-01

    Mainstream linguistics has long held that there is a fundamental difference between adult and child language learning (Bley-Vroman, 1990; Johnson & Newport, 1989; DeKeyser, 2000; Paradis, 2004). This difference is often framed as a change from implicit language learning in childhood to explicit language learning in adulthood, which is…

  2. Electron Donor Acceptor Interactions. Final Progress Report

    Energy Technology Data Exchange (ETDEWEB)

    None

    2002-08-16

    The Gordon Research Conference (GRC) on Electron Donor Acceptor Interactions was held at Salve Regina University, Newport, Rhode Island, 8/11-16/02. Emphasis was placed on current unpublished research and discussion of the future target areas in this field.

  3. Judgments of Information Structure in L2 French: Nativelike Performance and the Critical Period Hypothesis

    Science.gov (United States)

    Reichle, Robert V.

    2010-01-01

    Previous studies using judgments of morphosyntactic errors have shown mixed evidence for a critical period for L2 acquisition (e.g., Birdsong & Molis, Journal of Memory and Language 44: 235-249, 2001, Johnson & Newport, Cognitive Psychology 21: 60-99, 1989). This study uses anomalies in the domain of information structure, the interface…

  4. EMAP: MYTHS, HOBGOBLINS AND CRUSAES

    Science.gov (United States)

    Paulsen, Steve and Kevin Summers. In press. EMAP: Myths, Hobgoblins and Crusades (Abstract). To be presented at EMAP Symposium 2004: Integrated Monitoring and Assessment for Effective Water Quality Management, 3-7 May 2004, Newport, RI. 1 p. (ERL,GB R980). The Environment...

  5. 76 FR 24575 - General Working Conditions in Shipyard Employment

    Science.gov (United States)

    2011-05-02

    ... work a common practice on vessels under construction and repair, maintaining dry work surfaces at all... docks. James Thornton, of Northrop Grumman--Newport News, commented: ``Shipbuilding and repair, by... consider that these vessels do ongoing maintenance work, not just at the dock, but while they move to other...

  6. 2004 Electron Donor Acceptor Interactions Gordon Conference - August 8-13, 2004

    Energy Technology Data Exchange (ETDEWEB)

    GUILFORD JONES; S ST

    2005-09-14

    The 2004 Gordon Conference on Donor/Acceptor Interactions will take place at Salve Regina University in Newport, Rhode Island on August 8-13, 2004. The conference will be devoted to the consequences of charge interaction and charge motion in molecular and materials systems.

  7. Antimicrobial activity of oregano oil against antibiotic-resistant Salmonella enterica on organic leafy greens at varying exposure times and storage temperatures.

    Science.gov (United States)

    Moore-Neibel, Katherine; Gerber, Colin; Patel, Jitendra; Friedman, Mendel; Jaroni, Divya; Ravishankar, Sadhana

    2013-05-01

    The objective of this study was to evaluate the effectiveness of oregano oil on four organic leafy greens (Iceberg and Romaine lettuces and mature and baby spinaches) inoculated with Salmonella Newport as a function of treatment exposure times as well as storage temperatures. Leaf samples were washed, dip inoculated with S. Newport (6-log CFU/ml) and dried. Oregano oil was prepared at 0.1, 0.3, and 0.5% concentrations in sterile phosphate buffered saline (PBS). Inoculated leaves were immersed in the treatment solution for 1 or 2 min, and individually incubated at 4 or 8 °C. Samples were taken at day 0, 1, and 3 for enumeration of survivors. The results showed that oregano oil was effective against S. Newport at all concentrations. S. Newport showed reductions from the PBS control of 0.7-4.8 log CFU/g (Romaine lettuce), 0.8-4.8 log CFU/g (Iceberg lettuce), 0.8-4.9 log CFU/g (mature spinach), and 0.5-4.7 log CFU/g (baby spinach), respectively. The antibacterial activity also increased with exposure time. Leaf samples treated for 2 min generally showed greater reductions (by 1.4-3.2 log CFU/g), than those samples treated for 1 min; however, there was minimal difference in antimicrobial activity among samples stored under refrigeration and abuse temperatures. This study demonstrates the potential of oregano oil to inactivate S. Newport on organic leafy greens.

  8. Radioimmunoassay analysis of baculovirus granulins and polyhedrins

    Energy Technology Data Exchange (ETDEWEB)

    Summers, M.D.; Hoops, P.

    1980-05-01

    Granulin and polyhedrin proteins were purified by preparative sodium dodecyl sulfate (SDS)-polyacrylamide gel electrophoresis from the baculoviruses Autographa californica, Rachiplusia ou, Heliothis zea, Heliothis armigera. Trichoplusia ni, and Spodoptera frugiperda. Antisera were raised against Autographa californica (Ac) polyhedrin and Trichoplusia ni (Tn) granulin and analyzed for homologous and heterologous immunoreactivity by immunodiffusion and radioimmunoassay (RIA). Ac polyhedrin and Tn granulin antisera recognized antigenic determinants on several baculovirus polyhedrin and granulin proteins even though the heterologous proteins had different immunoreactivities when compared by competition radioimmunoassay. Antigenic differences among granulin and polyhedrin proteins were also detected by altered slopes of the competition reaction curves. Antiserum raised against Ac polyhedrin which was purified in the presence of SDS was tested by competition RIA for its ability to detect and react with native polyhedrin produced in the infected TN-368 cells. Ac polyhedrin antiserum had similar if not identical ability to bind to native polyhedrin and to polyhedrin purified in the presence of SDS.

  9. Acetylcholine Receptors in Model Membranes: Structure/Function Correlates.

    Science.gov (United States)

    1985-12-01

    sodium channel: Inferences derived from computer aided analysis of the Electrophorus electricus channel primary structure. FEBS Lett. 193:125-134. 19...from Torpedo californica and the voltage- sensitive sodium channel from Electrophorus electricus and rat brain provide an opportunity to pursue this...Agnew, W.S. and Levinson, S.R. (1983) Principal glycopeptide of the tetrodotoxin/saxitoxin binding protein from Electrophorus electricus :Isolation

  10. Precocious progression of tissue maturation instructs basipetal initiation of leaflets in Chelidonium majus subsp. asiaticum (Papaveraceae).

    Science.gov (United States)

    Ikeuchi, Momoko; Tatematsu, Kiyoshi; Yamaguchi, Takahiro; Okada, Kiyotaka; Tsukaya, Hirokazu

    2013-06-01

    On a compound leaf, leaflet primordia are repetitively formed along the apical-basal axis, with the direction varying among taxa. Why and how the directions vary among species is yet to be solved, although a change in a single factor was proposed to cause the variation. In this study, we compared two species in the Papaveraceae with different directions of leaflet initiation, Chelidonium majus subsp. asiaticum (basipetal) and Eschscholzia californica (acropetal). Because E. californica has been studied in some detail, we focused on C. majus and asked how basipetal pattern is achieved. • Since only immature leaf primordial tissue has leaflet-generating competency, we performed histological and gene expression analyses on markers of the tissue maturation state. In addition, we performed a time-course analysis of leaf primordial growth. • Quantitative reverse transcription-PCR analysis demonstrated that a putative regulator of tissue maturation in C. majus, the CINCINNATA homolog, had higher expression in apical parts than in basal parts during the organogenetic phase. In contrast, expression of the CIN homolog was not elevated in either the apical or basal parts in E. californica during the organogenetic phase. • In C. majus, apical parts of leaf primordia have already lost leaflet-generating competency during the organogenetic phase. We propose that precocious progression of the maturation process instructs basipetal progression of leaflet initiation in C. majus. This is not the mirror image of data on E. californica, which shows the opposite direction in leaflet formation, indicating that variation in direction is not attributable to a change in a single factor.

  11. Dicty_cDB: SFG307 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .1 EST536061 P. infestans-challenged leaf Solanum tuberosum cDNA clone PPCBC84 5' sequence, mRNA sequence. 5...EST594838 P. infestans-challenged potato leaf, incompatible reaction Solanum tuberosum cDNA clone BPLI12N15 ...Eca01 Eschscholzia californica cDNA clone eca01-7ms1-f05 5', mRNA sequence. 72 1e-08 1 BQ045720 |BQ045720.1

  12. Expression of the glycoprotein gene from a fish rhabdovirus by using baculovirus vectors

    Energy Technology Data Exchange (ETDEWEB)

    Koener, J.F.; Leong, J.A.C. (Oregon State Univ., Corvallis (United States))

    1990-01-01

    A cDNA fragment containing the gene encoding the glycoprotein of infectious hematopoietic necrosis virus was inserted into Autographa californica baculovirus vectors under the control of the polyhedrin promoter. A 66-kilodalton protein, identical in size to the glycosylated glycoprotein of infectious hematopoietic necrosis virus, was expressed at high levels in Spodoptera frugiperda cells infected with the recombinant viruses. The expressed protein reacted with antiserum to the glycoprotein on Western blots.

  13. Mucosal Delivery of ACNPV Baculovirus Driving Expression of the Gal-Lectin LC3 Fragment Confers Protection against Amoebic Liver Abscess in Hamster

    OpenAIRE

    Meneses-Ruiz, DM; Laclette, JP; Aguilar-Díaz, H; Hernández-Ruiz, J; Luz-Madrigal, A.; Sampieri, A.; Vaca, L; Carrero, JC

    2011-01-01

    Mucosal vaccination against amoebiasis using the Gal-lectin of E. histolytica has been proposed as one of the leading strategies for controlling this human disease. However, most mucosal adjuvants used are toxic and the identification of safe delivery systems is necessary. Here, we evaluate the potential of a recombinant Autographa californica baculovirus driving the expression of the LC3 fragment of the Gal-lectin to confer protection against amoebic liver abscess (ALA) in hamsters following...

  14. Studies of the silencing of Baculovirus DNA binding protein

    OpenAIRE

    Quadt, I.; Lent, van, J.W.M.; Knebel-Morsdorf, D.

    2007-01-01

    Baculovirus DNA binding protein (DBP) binds preferentially single-stranded DNA in vitro and colocalizes with viral DNA replication sites. Here, its putative role as viral replication factor has been addressed by RNA interference. Silencing of DBP in Autographa californica multiple nucleopolyhedrovirus-infected cells increased expression of LEF-3, LEF-4, and P35. In contrast, expression of the structural genes coding for P39 and polyhedrin was suppressed while expression of genes coding for P1...

  15. Characterization of a Crabs Claw Gene in Basal Eudicot Species Epimedium sagittatum (Berberidaceae)

    OpenAIRE

    Wei Sun; Wenjun Huang; Zhineng Li; Haiyan Lv; Hongwen Huang; Ying Wang

    2013-01-01

    The Crabs Claw (CRC) YABBY gene is required for regulating carpel development in angiosperms and has played an important role in nectary evolution during core eudicot speciation. The function or expression of CRC-like genes has been explored in two basal eudicots, Eschscholzia californica and Aquilegia formosa. To further investigate the function of CRC orthologous genes related to evolution of carpel and nectary development in basal eudicots, a CRC ortholog, EsCRC, was isolated and character...

  16. Photosynthetic responses of field-grown Pinus radiata trees to artificial and aphid-induced defoliation.

    Science.gov (United States)

    Eyles, Alieta; Smith, David; Pinkard, Elizabeth A; Smith, Ian; Corkrey, Ross; Elms, Stephen; Beadle, Chris; Mohammed, Caroline

    2011-06-01

    The phloem-feeding aphid Essigella californica represents a potential threat to the productivity of Pinus radiata plantations in south-eastern Australia. Five- and nine-year-old field trials were used to characterize the effects of artificial and natural aphid-induced (E. californica) defoliation, respectively, on shoot photosynthesis and growth. Photosynthetic capacity (A(max)) was significantly greater following a 25% (D25) (13.8 µmol m(-2) s(-1)) and a 50% (D50) (15.9 µmol m(-2) s(-1)) single-event upper-crown artificial defoliation, 3 weeks after defoliation than in undefoliated control trees (12.9 µmol m(-2) s(-1)). This response was consistently observed for up to 11 weeks after the defoliation event; by Week 16, there was no difference in A(max) between control and defoliated trees. In the D50 treatment, this increased A(max) was not sufficient to fully compensate for the foliage loss as evidenced by the reduced diameter increment (by 15%) in defoliated trees 36 weeks after defoliation. In contrast, diameter increment of trees in the D25 treatment was unaffected by defoliation. The A(max) of trees experiencing upper-crown defoliation by natural and repeated E. californica infestations varied, depending on host genotype. Despite clear differences in defoliation levels between resistant and susceptible genotypes (17 vs. 35% of tree crown defoliated, respectively), growth of susceptible genotypes was not significantly different from that of resistant genotypes. The observed increases in A(max) in the lower crown of the canopy following attack suggested that susceptible genotypes were able to partly compensate for the loss of foliage by compensatory photosynthesis. The capacity of P. radiata to regulate photosynthesis in response to natural aphid-induced defoliation provides evidence that the impact of E. californica attack on stem growth will be less than expected, at least for up to 35% defoliation.

  17. A Brain-Machine-Brain Interface for Rewiring of Cortical Circuitry after Traumatic Brain Injury

    Science.gov (United States)

    2014-09-01

    Task 1 (Electronics Testing/Microsystem Packaging) 1.1 Conduct in vivo experiments in brain-injured monkeys using a fully assembled microsystem...rodent studies in constructing the microsystem for non- human primate (squirrel monkey ) studies. This is because the capabilities of the rat ASIC (e.g...Aplysia californica (see Appendix II). In Year 4, the SAR algorithm was integrated on an ASIC that combined spike recording, electrical microstimulation

  18. Poblaciones de lombrices de tierra en sitios de acumulación de desechos orgánicos en el Valle Central de Costa Rica.

    Directory of Open Access Journals (Sweden)

    Sandra León

    2016-03-01

    Full Text Available A study was made on the density of earthworms in eight different sites of the Valle Central in Costa Rica, abundant with animal manure, city and coffee bean pulp wastes. Edaphological condition were determined in each site. Four species were found: Pontoscolex corethrurus, Metaphire californica, Amynthas corticis y Polypheretima elongata. P. corethrurus was the most abundant species found. Soils having abundant cattle manure were the most favorable for this species.

  19. Floral visitation by the Argentine ant reduces pollinator visitation and seed set in the coast barrel cactus, Ferocactus viridescens.

    Science.gov (United States)

    LeVan, Katherine E; Hung, Keng-Lou James; McCann, Kyle R; Ludka, John T; Holway, David A

    2014-01-01

    Mounting evidence indicates that trade-offs between plant defense and reproduction arise not only from resource allocation but also from interactions among mutualists. Indirect costs of plant defense by ants, for example, can outweigh benefits if ants deter pollinators. Plants can dissuade ants from occupying flowers, but such arrangements may break down when novel ant partners infiltrate mutualisms. Here, we examine how floral visitation by ants affects pollination services when the invasive Argentine ant (Linepithema humile) replaces a native ant species in a food-for-protection mutualism with the coast barrel cactus (Ferocactus viridescens), which, like certain other barrel cacti, produces extrafloral nectar. We compared the effects of floral visitation by the Argentine ant with those of the most prevalent native ant species (Crematogaster californica). Compared to C. californica, the Argentine ant was present in higher numbers in flowers. Cactus bees (Diadasia spp.), the key pollinators in this system, spent less time in flowers when cacti were occupied by the Argentine ant compared to when cacti were occupied by C. californica. Presumably as a consequence of decreased duration of floral visits by Diadasia, cacti occupied by L. humile set fewer seeds per fruit and produced fewer seeds overall compared to cacti occupied by C. californica. These data illustrate the importance of mutualist identity in cases where plants balance multiple mutualisms. Moreover, as habitats become increasingly infiltrated by introduced species, the loss of native mutualists and their replacement by non-native species may alter the shape of trade-offs between plant defense and reproduction.

  20. Dicty_cDB: Contig-U11481-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AY279095 |pid:none) Aplysia californica vanilloid rece... 35 6.2 DQ390461_1( DQ390461 |pid:none) Transmissible gastroenteritis... Bacillus cereus 03BB102, comple... 35 6.2 DQ201447_1( DQ201447 |pid:none) Transmissible gastroenteritis...34093_1( Z34093 |pid:none) Transmissible gastroenteritis virus (P... 35 6.2 >(Q8T638) RecName: Full=Des-meth

  1. Tryptophan and cystein residues of the acetylcholine receptors of Torpedo species. Relationship to binding of cholinergic ligands.

    Science.gov (United States)

    Eldefrawi, M E; Eldefrawi, A T; Wilson, D B

    1975-09-23

    Several methods were used to analyze for tryptophan in the acetylcholine (ACh) receptors purified from the electric organs of the electric rays, Torpedo californica and Torpedo marmorata. The best value of tryptophan was 2.4 mol %. When excited at 290 nm, both receptors fluoresced with a maximum at 336, but there was no change in the fluorescence emission spectra upon binding of carbamylcholine, d-tubocurarine, ACh, or decamethonium. The free SH content of the Torpedo receptors varied in different preparations, and was highest in that purified from fresh T. californica using deaerated solutions and dialysis under nitrogen, and lowest in that prepared from the aged lyophilized membranes of T. marmorata. The maximum free SH content was 20 nmol/mg of protein or 0.22 mol %, equal to at most 18% of the total cysteic acid residues. Reaction of either 33% or of all the SH residues with p-chloromercuribenzoate reduced maximum ACh binding to the pure receptor prepared from fresh T. californica by only 23%.

  2. Susceptibility to Phytophthora ramorum in a key infectious host: landscape variation in host genotype, host phenotype, and environmental factors.

    Science.gov (United States)

    Anacker, Brian L; Rank, Nathan E; Hüberli, Daniel; Garbelotto, Matteo; Gordon, Sarah; Harnik, Tami; Whitkus, Richard; Meentemeyer, Ross

    2008-01-01

    Sudden oak death is an emerging forest disease caused by the invasive pathogen Phytophthora ramorum. Genetic and environmental factors affecting susceptibility to P. ramorum in the key inoculum-producing host tree Umbellularia californica (bay laurel) were examined across a heterogeneous landscape in California, USA. Laboratory susceptibility trials were conducted on detached leaves and assessed field disease levels for 97 host trees from 12 225-m(2) plots. Genotype and phenotype characteristics were assessed for each tree. Effects of plot-level environmental conditions (understory microclimate, amount of solar radiation and topographic moisture potential) on disease expression were also evaluated. Susceptibility varied significantly among U. californica trees, with a fivefold difference in leaf lesion size. Lesion size was positively related to leaf area, but not to other phenotypic traits or to field disease level. Genetic diversity was structured at three spatial scales, but primarily among individuals within plots. Lesion size was significantly related to amplified fragment length polymorphism (AFLP) markers, but local environment explained most variation in field disease level. Thus, substantial genetic variation in susceptibility to P. ramorum occurs in its principal foliar host U. californica, but local environment mediates expression of susceptibility in nature.

  3. 2014 CERN Accelerator Schools: Beam Loss and Accelerator Protection

    CERN Multimedia

    2014-01-01

    The US-CERN-JAPAN-RUSSIA Joint International Accelerator School is organising a course on Beam Loss and Accelerator Protection to be held in Newport Beach, California, USA from 5-14 November, 2014.    This school is intended for physicists and engineers who are or may be engaged in the design, construction, and/or operation of accelerators with high power photon or particle beams and/or accelerator sub-systems with large stored energy. Application deadlines are 15 August and 4 September. Further information on this Joint School can be found at: http://cas.web.cern.ch/cas/JAS/Newport%20Beach%202014/NPBadvert.html http://indico.cern.ch/event/287647/ http://uspas.fnal.gov/programs/JAS/JAS14.shtml

  4. Racial differences in cigarette brand recognition and impact on youth smoking

    Directory of Open Access Journals (Sweden)

    Dauphinee Amanda L

    2013-02-01

    Full Text Available Abstract Background African Americans are disproportionately exposed to cigarette advertisements, particularly for menthol brands. Tobacco industry documents outline strategic efforts to promote menthol cigarettes to African Americans at the point of sale, and studies have observed more outdoor and retail menthol advertisements in neighborhoods with more African-American residents. Little research has been conducted to examine the effect of this target marketing on adolescents’ recognition of cigarette brand advertising and on smoking uptake. To our knowledge, this is the first study to examine racial differences in brand recognition and to assess the prospective relationship between brand recognition and smoking uptake. Methods School-based surveys assessing tobacco use and environmental and social influences to smoke were administered to 6th through 9th graders (ages 11 to 15 in an urban and racially diverse California school district. The primary outcome for the cross-sectional analysis (n = 2,589 was brand recognition, measured by students’ identification of masked tobacco advertisements from the point of sale. The primary outcome for the longitudinal analysis (n = 1,179 was progression from never to ever smoking within 12 months. Results At baseline, 52% of students recognized the Camel brand, 36% Marlboro, and 32% Newport. African-American students were three times more likely than others to recognize Newport (OR = 3.03, CI = 2.45, 3.74, p  Conclusions The study findings illustrate that African-American youth are better able to recognize Newport cigarette advertisements, even after adjustment for exposure to smoking by parents and peers. In addition, recognition of Newport cigarette advertising predicted smoking initiation, regardless of race. This longitudinal study contributes to a growing body of evidence that supports a ban on menthol flavored cigarettes in the US as well as stronger regulation of tobacco

  5. Bolster Ground Force Capabilities in the Asia-Pacific Region

    Science.gov (United States)

    2016-05-12

    Defense, China is “exploiting a power vacuum [in Asia ] with a Cold War mindset. It is tilting the balance of power in its favor against weak...NAVAL WAR COLLEGE Newport, R.I. BOLSTER GROUND FORCE CAPABILITIES IN THE ASIA -PACIFIC REGION by Bryan Dunker Major, United States Army...created them.” – Albert Einstein INTRODUCTION Following the collapse of the Soviet Union and the end of the Cold War in 1991, the United States

  6. Strategic Studies Quarterly. Volume 5, Number 2, Summer 2011

    Science.gov (United States)

    2011-01-01

    Santa Monica, CA: RAND, 1998), http://www.rand.org/pubs/monograph_reports/MR897.html; Ted R. Gurr, Peoples versus States: Minorities at Risk in the New...Beer Sheva, Israel: Ben-Gurion University Press, 2007). 37. Matthew Levitt , Hamas: Politics, Charity, and Terrorism in the Service of Jihad (New Haven...Newport, RI: Naval War College, 14 February 2005), 13, 15–16. 65. Lt Col Ted A. Uchida, USAF, Reforming the Interagency Process (Maxwell AFB, AL: Air

  7. Soil Type, Soil Moisture, and Field Slope Influence the Horizontal Movement of Salmonella enterica and Citrobacter freundii from Floodwater through Soil.

    Science.gov (United States)

    Callahan, Mary Theresa; Micallef, Shirley A; Buchanan, Robert L

    2017-01-01

    Pathogens in soil are readily mobilized by infiltrating water to travel downward through the soil. However, limited data are available on the horizontal movement of pathogens across a field. This study used a model system to evaluate the influence of soil type, initial soil moisture content, and field slope on the movement of Salmonella enterica serovar Newport across a horizontal plane of soil under flooding conditions. Three soil types of varying clay content were moistened to 40, 60, or 80% of their maximum water-holding capacities and flooded with water containing 6 log CFU/ml Salmonella Newport and Citrobacter freundii , the latter being evaluated as a potential surrogate for S. enterica in future field trials. A two-phase linear regression was used to analyze the microbial populations recovered from soil with increasing distance from the flood. This model reflected the presence of lag distances followed by a quantifiable linear decrease in the population of bacteria as a function of the distance from the site of flooding. The magnitude of the lag distance was significantly affected by the soil type, but this was not attributable to the soil clay content. The rate of the linear decline with distance from the flood zone was affected by soil type, initial soil moisture content, and soil incline. As the initial soil moisture content increased, the rate of decline in recovery decreased, indicating greater bacterial transport through soils. When flooding was simulated at the bottom of the soil incline, the rate of decline in recovery was much greater than when flooding was simulated at the top of the incline. There was no significant difference in recovery between Salmonella Newport and C. freundii , indicating that C. freundii may be a suitable surrogate for Salmonella Newport in future field studies.

  8. National Building: Installing Democracy in Iraq After Saddam

    Science.gov (United States)

    2003-02-03

    Symbol: C 7. Address: NAVAL WAR COLLEGE 686 CUSHING ROAD NEWPORT, RI 02841-1207 8. Title (Include...necessary for any exit strategy. New governments, like babies , first learn to crawl, then walk and then run. Once the DRI can walk, CENTCOM can...changing. Currently, 25,000 Arab students are studying in the U.S.57 Many embrace the west and choose to stay, causing a brain -drain in their native

  9. Information Dominance or Information Overload? Unintended Consequences of ’Every Soldier and Platform a Sensor’

    Science.gov (United States)

    2010-05-03

    Department Naval War College 686 Cushing Road Newport, RI 02841-1207 9. SPONSORING/MONITORING...it‟s logical to say operational commanders already have access to much more data than their brains can process and analyze in a reasonable amount of...Ivanoff, “Capacity limits of information processing in the brain ,” Trends in Cognitive Sciences 9, no. 6 (June 2005): 296-305. 20 Ibid. 21 Ibid

  10. The Fog of War: A Necessary Component of Modern Warfare

    Science.gov (United States)

    2010-05-03

    Cushing Road Newport, RI 02841-1207 9. SPONSORING/MONITORING AGENCY NAME(S) AND ADDRESS(ES) 10...uncertain situations the human brain defaults to what comes easiest and natural – intuitive or naturalistic decision-making. 5 Accordingly, despite the...War, p. 117. 11 information boils down to decision-making, specifically how the brain makes decisions. The first real test of the concepts behind

  11. Diversity and antimicrobial resistance of Salmonella enterica isolates from surface water in Southeastern United States.

    Science.gov (United States)

    Li, Baoguang; Vellidis, George; Liu, Huanli; Jay-Russell, Michele; Zhao, Shaohua; Hu, Zonglin; Wright, Anita; Elkins, Christopher A

    2014-10-01

    A study of prevalence, diversity, and antimicrobial resistance of Salmonella enterica in surface water in the southeastern United States was conducted. A new scheme was developed for recovery of Salmonella from irrigation pond water and compared with the FDA's Bacteriological Analytical Manual (8th ed., 2014) (BAM) method. Fifty-one isolates were recovered from 10 irrigation ponds in produce farms over a 2-year period; nine Salmonella serovars were identified by pulsed-field gel electrophoresis analysis, and the major serovar was Salmonella enterica serovar Newport (S. Newport, n = 29), followed by S. enterica serovar Enteritidis (n = 6), S. enterica serovar Muenchen (n = 4), S. enterica serovar Javiana (n = 3), S. enterica serovar Thompson (n = 2), and other serovars. It is noteworthy that the PulseNet patterns of some of the isolates were identical to those of the strains that were associated with the S. Thompson outbreaks in 2010, 2012, and 2013, S. Enteritidis outbreaks in 2011 and 2013, and an S. Javiana outbreak in 2012. Antimicrobial susceptibility testing confirmed 16 S. Newport isolates of the multidrug resistant-AmpC (MDR-AmpC) phenotype, which exhibited resistance to ampicillin, chloramphenicol, streptomycin, sulfamethoxazole, and tetracycline (ACSSuT), and to the 1st, 2nd, and 3rd generations of cephalosporins (cephalothin, amoxicillin-clavulanic acid, and ceftriaxone). Moreover, the S. Newport MDR-AmpC isolates had a PFGE pattern indistinguishable from the patterns of the isolates from clinical settings. These findings suggest that the irrigation water may be a potential source of contamination of Salmonella in fresh produce. The new Salmonella isolation scheme significantly increased recovery efficiency from 21.2 (36/170) to 29.4% (50/170) (P = 0.0002) and streamlined the turnaround time from 5 to 9 days with the BAM method to 4 days and thus may facilitate microbiological analysis of environmental water. Copyright © 2014, American Society for

  12. Case-Studies of Decision Support Models for Collaboration in Tactical Mobile Environments / 12th ICCRTS, Adapting C2 to the 21st Century

    OpenAIRE

    Bordetsky, Alex; Friman, Henrik

    2007-01-01

    12th International Command and Control Research and Technology Symposium (ICCRTS), June 19-21, 2007 at the Naval War College, Newport, RI. The paper addresses experimental studies of decision support models for collaboration in tactical network-centric operations. This project, supported by partners from Lawrence Livermore National Laboratory (LLNL), US Special Operations Command (SOCOM), Swedish Armed Forces, Austria, and Singapore. Naval Postgraduate Schools (NPS) Tactical Ne...

  13. Performance of Wireless Networks Subject to Constraints and Failures

    Science.gov (United States)

    2008-01-01

    international workshop on Multi-hop ad hoc networks: from theory to reality, pages 23–30. ACM Press, 2006. [19] Gregory Chockler, Murat Demirbas, Seth Gilbert...Gregory Chockler, Murat Demirbas, Seth Gilbert, Calvin Newport, and Tina Nolte. Consensus and collision detectors in wireless ad hoc networks. In PODC... Ulas C. Kozat and Leandros Tassiulas. Throughput capacity of random ad hoc net- works with infrastructure support. In MobiCom ’03: Proceedings of the

  14. The Effects of Behavioral Change in Response to Acoustic Disturbance on the Health of the Population of Blainville’s Beaked Whales (Mesoplodon densirostris) in the Tongue of the Ocean

    Science.gov (United States)

    2014-09-30

    Whales (Mesoplodon densirostris) in the Tongue of the Ocean David Moretti Navy Undersea Warfare Center (NUWC) Newport, RI Phone: (401) 832-5749...population health of Blainville’s beaked whale (Mesoplodon densirostris, Md) in the Tongue Of The Ocean (TOTO), Bahamas, using data from passive...in the Tongue Of The Ocean (TOTO), Bahamas [3], and a population of Zc has been documented on the Southern California Offshore Range (SCORE) off San

  15. Adjoint Sensitivities of Time-Periodic Nonlinear Structural Dynamics via Model Reduction

    Science.gov (United States)

    2009-10-01

    Balance Approaches or a Duffing Oscillator ,” Journal of Computational Physics, Vol. 215, No. 1, pp. 298-320, 2006. 12. Beran, P., Lucia, D., “A Reduced... oscillating transverse point load at the tip (equal to -2· δtip) which only operates within the last actuation cycle of motion. The member of the... Oscillations ,” AIAA Structures, Structural Dynamics, and Materials Conference, Newport, RI, May 1-4, 2006. 16. Lucia, D., Beran, P., Silva, W., “Reduced

  16. Santa Ana River Design Memorandum Number 1. Phase 2. GDM on the Santa Ana River Mainstem Including Santiago Creek. Volume 1. Seven Oaks Dam. Appendixes B Through G

    Science.gov (United States)

    1988-08-01

    approximately 177 square miles, excluding the 32 square miles tributary to Baldwin Lake , has its headwaters in the rugged San Bernardino Mountains. Elevations...include the Newport- Inglewood fault, which caused the 1933 Long Beach earthquake, the Whittier- Elsinore fault zone, and the San Jacinto fault zone...Upper Howell Dam, the Lower Howell Dam and the Lake Ranch Dam. For the latter two dams the fault is reported to have intersected the dam and for the

  17. Through the Lens of Cultural Awareness: A Primer for US Armed Forces Deploying to Arab and Middle Eastern Countries

    Science.gov (United States)

    2006-01-01

    Better Intel,” New York Daily News, 7 January 2004. 6. Calvin F. Swain, Jr., The Operational Planning Factors of Culture and Religion (Newport, RI... Bible , and has granted them privileged status from the early days of the Islamic empire into modern times. This is one reason other religions have...Management (DISAM), June 2000, 4–8. For a more definitive analysis of the role of Islam in Middle East and Arabic society, see Lewis (2003). 17. Calvin

  18. Salmonella-related urinary tract infection in an elderly patient.

    Science.gov (United States)

    Klosterman, Scott Anthony

    2014-09-05

    An elderly female patient with an uncomplicated urinary tract infection from Salmonella newport is presented. Radiological and laboratory studies were performed because of her systemic and exposure risk factors as well as prior urinary tract abnormalities. While this patient was successfully treated as an outpatient with oral antibiotics, complications and recurrence are common and deserve close follow-up with repeat urine cultures at a minimum. Further laboratory and radiological testing should be guided by patient gender, risk factors and recurrence.

  19. Topology Optimisation for Energy Management in Underwater Sensor Networks

    Science.gov (United States)

    2015-01-01

    International Journal of Control, 2015 http://dx.doi.org/10.1080/00207179.2015.1017006 Topology optimisation for energy management in underwater...State University, University Park , PA 16802-1412, USA; bNaval Undersea Warfare Center, Newport, RI 02841-1708, USA and Department of Mechanical & Nuclear...Engineering, Pennsylvania State University, University Park , PA 16802-1412, USA; cUnited Technology Research Center, Cork, Ireland (Received 28

  20. Improving Operational Readiness through Total Quality Management

    Science.gov (United States)

    1991-06-21

    DTIC AD-A236 611 EL CT F NAVAL WAR COLL GE C Newport, R. I. IMPROVING OPERATIONAL READINESS THROUGH TOTAL QUALITY MANAGEMENT by Herb Westphal Defense...IMPROVING OPERATIONAL READINESS THROUGH TOTAL QUALITY MANAGEMENT (TQM) A Case Study: The Defense Mapping Agency Combat Support Center (DMACSC) initiated a...of the Defense Mapping Agency Combat Support Center’s (DMACSC) Total Quality Management (TQM) improvement methodology. This allows the reader to

  1. Santa Ana River Design Memorandum Number 1. Phase 2 GDM on the Santa Ana River Mainstem Including Santiago Creek. Volume 3. Lower Santa Ana River. Appendixes

    Science.gov (United States)

    1988-08-01

    NAWL REDDISH1 . MIST, SI 36 FINE 103’MM5 GWAtH SHE, IEFUSA. A 216.5FIF p TO1 17 41 99 31 SI).TI SAIT AMISH WICHN3. MIST, FEW 10 MIMIM WMED 5315D...Beach, Costa Mesa, and Newport Beach. Over 1,000,000 people reside or work within this area. Projected populations for the Lower Santa Ana River market

  2. Causes and consequences of obesity: epigenetics or hypokinesis?

    OpenAIRE

    Graham; Baker JS; Davies B

    2015-01-01

    Michael R Graham,1 Julien S Baker,2 Bruce Davies3 1Llantarnam Research Academy, Cwmbran, Torfaen, UK; 2Exercise Science Research Laboratory, Institute of Clinical Exercise and Health Science, School of Science, University of the West of Scotland, Hamilton, UK; 3Science Department, University of South Wales, Newport, UKEpigenetics can be defined as the study of heritable changes that affect gene function without modification of the deoxyribonucleic acid (DNA) sequence.1 The transfer of epigene...

  3. International Conference on the Physics of Electronic and Atomic Collisions (16th), Held in New York, NY on 26 July-1 August 1989. Third Conference Program

    Science.gov (United States)

    1989-08-01

    Logic Memory and Packaging Department) Le Croy Instruments The University of Massachusetts MKS Instruments, Inc. Newport Corp. Questek, Inc...Banquet: El]Vegotanian H- Kosher Fi1 Othter Mk -’thod of Payment. H-- Chock (Please make chock payable to XVI ICPF AC., U S. Funds Only) L IMa-ster Card...In The Measurement Of Coherence Parameters 168 Tue 45 In Electron - Heavy Noble Gas Collisions A. ShukLa , K.E. Martus and K. Becker Measurement Of The

  4. SEABEE Pretest Results of the Joint Logistics-over-the-Shore (LOTS) Test and Evaluation Program.

    Science.gov (United States)

    1977-12-07

    FIGURES 1. SS ALMERIA LYK(ES .. .. .. .. . . ... ..... . . . . . 3 2. Container Adapter.. .. .. .. ... .... . . . . . . . 7 3. TCDF Modified Container...include the deployment of the TCDF since the elevator restrictions were still in effect. Subject to the restrictions, the SS ALMERIA LYKES (See Figure 1...of the SS ALMERIA p LYKES in the Hampton Roads vicinity was centered around an upkeep period at Newport News, Virginia. When it became apparent that

  5. XML Tactical Chat (XTC): The Way Ahead for Navy Chat

    Science.gov (United States)

    2007-09-01

    Boger Chair, Information Sciences Department iv THIS PAGE INTENTIONALLY LEFT BLANK v ABSTRACT The...features categories below. 51 Client B as ic C ha t G ro up ch at H ea dl in e Su pp or t B ro w se r Su pp or t x: da ta S up po rt U ni co...School Monterey, California David Bellino NUWC Newport, Rhode Island Dan Boger NPS Monterey,

  6. A Virtual Commanding Officer, Intelligent Tutor for the Underway Replenishment Ship-handling Virtual Environment Simulator

    OpenAIRE

    Tenney, Karl R.

    1999-01-01

    While developing a Virtual Environment (VE) Ship-handling simulator for the Surface Warfare Officer School (SWOS) in Newport, RI, researchers at the Naval Air Warfare Center Training Systems Division (NAWCTSD) in Orlando, FL recognized the idea of integrating an Intelligent Tutoring System (ITS) to provide feedback to the student The system, known as a Virtual Commanding Officer (VCO), would provide instructional feedback to the student to ensure that beneficial training occurs. The VCO would...

  7. A task analysis of underway replenishment for virtual environment ship-handling simulator scenario development

    OpenAIRE

    Norris, Steven D.

    1998-01-01

    Approved for public release; distribution is unlimited While developing a Virtual Reality (VR) Ship handling simulator for the Surface Warfare Officer School (SWOS) in Newport, RI, researchers at the Naval Air Warfare Center Training Systems Division (NAWCTSD) in Orlando, FL discovered a need for a task analysis of a Conning Officer during an Underway Replenishment (UNREP). The purpose of this task analysis was to document the tasks the Conning Officer performs and cues used to accomplish ...

  8. Analysis of SWO fundamentals exam scores

    OpenAIRE

    Bradley, Jason Michael.

    2011-01-01

    Approved for public release; distribution is unlimited. Since August 2008, the newly commissioned Surface Warfare Officer (SWO) has been trained for SWO qualification through the INTRO/ASAT program. Through this program, USNA and NROTC officers check onto their first ship and subsequently attend a five-week introductory course given by the Afloat Training Group (ATG) located in one of the Fleet Concentration Areas, and OCS officers attend the course in Newport, RI. Following this traini...

  9. Characterization of antimicrobial resistance in Salmonella enterica food and animal isolates from Colombia: identification of a qnrB19-mediated quinolone resistance marker in two novel serovars

    DEFF Research Database (Denmark)

    Karczmarczyk, M.; Martins, M.; McCusker, M.

    2010-01-01

    Ninety-three Salmonella isolates recovered from commercial foods and exotic animals in Colombia were studied. The serotypes, resistance profiles and where applicable the quinolone resistance genes were determined. Salmonella Anatum (n=14), Uganda (19), Braenderup (10) and Newport (10) were the most...... hitherto unrecognized in various Salmonella serovars in Colombia. We also report unusual high-level quinolone resistance in the absence of any DNA gyrase mutations in serovars S. Carrau, Muenchen and Uganda....

  10. Roadmap to an Electric Naval Force

    Science.gov (United States)

    2002-07-01

    West Virginia University CDR Paul T. Norton, RN (Ret.) Alstom Power Conversion Ltd LtGen Keith A. Smith, USMCR (Ret...UK Royal Navy – Newport News Shipbuilding – Alstom – Sandia National Lab • 3 Field Trips – IPS – GTS Infinity – Brooks AFB • 33 Papers & Reports... Alstom Power Conversion Ltd LtGen Keith A. Smith, USMCR (Ret) **............... Private Consultant Dr. Jason Stamp

  11. An Adaptive H infinity Control Algorithm for Jitter Control and Target Tracking in a Directed Energy Weapon

    Science.gov (United States)

    2012-05-16

    system, (2) free electron laser for weapons of mass destruction detection, (3) high power microwave weapon, (4) electric fiber weapon system, and (5...1980’s and 1990’s1. Free-space laser communication provides many advantages to traditional microwave communication: broader bandwidth, lower power...eliminate torsional and bending modes below approximately 200 Hz. The mass of the bread board is 71.3 kg. Figure 10 Newport Breadboard7 2.1.6

  12. Magnetoelectric Energy Harvesting

    Science.gov (United States)

    2014-11-20

    08-2015 Publication Magnetoelectric Energy Harvesting Peter Finkel et al Naval Undersea Warfare Center Division, Newport 1176 Howell Street, Bldg...NUWC 102287 Distribution A An energy harvesting device for harvesting energy from a moving structure includes a housing allowing transmission of...MAGNETOELECTRIC ENERGY HARVESTING STATEMENT OF GOVERNMENT INTEREST [0001] The invention described herein may be manufactured and used by or for the

  13. SeaFrame: Innovation Leads to Superior Warfighting Capability. Volume 4, Issue 1, 2008

    Science.gov (United States)

    2008-01-01

    ratio times the model length gives full-scale vessel length), was tested for resistance and powering characteristics in both calm water and in waves ...certification program, based on applicable tests taken from the Northrop Grumman Newport News (NGNN) cable specifications. Military standard shock and vibration...the liquid emulsions used for dispersed-phase reactions in chemical engineering operations or the oil-in-water emulsions of common salad dressings. An

  14. The CINC’s Joint Interagency Coordination Group (JIACG) - Essential to Winning the War on Terrorism

    Science.gov (United States)

    2002-05-13

    next-generation operations cell for consequence management,” 84 Marine Corps Gazette, (February 2000): 40. 19 Ibid. 20 William P. Hamblet and Jerry G...College, Newport, RI: 1997), 7. 26 Hamblet and Kline, 97. 27 Dana, 40. 28 U.S. Joint Chiefs of Staff, III-13. 29 Mendel and Bradford, 50. 30 Ibid...Ignore.” Parameters (Winter 1998): 99-112. Hamblet , William P. and Jerry G. Kline, “Interagency Cooperation PDD 56 and Complex Contingency

  15. Leading in the Gray Zone: Command and Control of Special Operations in Phases 0-1

    Science.gov (United States)

    2016-05-13

    5a. CONTRACT NUMBER Leading in the Gray Zone: Command and Control of Special Operations in Phases 0-1 5b. GRANT NUMBER 5c. PROGRAM...NAVAL WAR COLLEGE Newport, R.I. Leading in the Gray Zone: Command and Control of Special Operations in Phases 0-1 by Joshua O...18 iii Paper Abstract Leading in the Gray Zone: Command and Control of Special

  16. Annual Technical Symposium (27th) on Challenges of the Nineties - Accomplishing More with Less

    Science.gov (United States)

    1990-05-23

    tested on cialI % 1 1 p ro d u c t d ’ o p - c L ships of the USS SPRUANCE (DD-963) and USS NEWPORT (LST-1 179) classes. I pplication to the Tables 2...to send a registered letter, pay rent on a box, and apply for a passport, whereas CUSTOMER2 just wants to buy a role of stamps.rl o Software

  17. IT’S THEIR MESSAGE, STUPID! Targeting the True Center of Gravity in the U.S. War on Terrorism

    Science.gov (United States)

    2004-02-09

    Strategy for Combating Terrorism, Washington DC, p 23. 6 Milan Vego, Operational Warfare, Newport RI, Naval War College Press, 2000, p 309. 7 Ibid. 5...or capital weapons, or a state to call its own? The answer to this question beckons back to Dr. Milan Vego’s generic definition of COG: a “source of...Harakat-ul- Mujahidin.12 In establishing a World Islamic Jihad against the Jews and Crusaders through publication of such edicts as 1998 “Fatwah

  18. Vibration Damping Workshop Proceedings Held at Long Beach, California on 27-29 February 1984.

    Science.gov (United States)

    1984-11-11

    1976). 21. Rimkunas, D. A. and H. M. Frye : Investigation of Fan Blade Shroud Mechanical Damping. Wright-Patterson Air Force Base, Aero Propulsion Lab...AFB, OH 45433 Newport Beach, CA 92660 Roy Ikegami Allen Kandelman Boeing Aerospace Company Northrop Corporation Structural Development Flight Controls...Mail Stop 8C-43, P.O. Box 3999 One Northrop Avenue, Dept. 3320/AL Seattle, WA 98124 Hawthorne, CA 90250 Norman L. Ingold Abner Kaplan U.S. Air Force

  19. Surface temperature measurements of diamond

    CSIR Research Space (South Africa)

    Masina, BN

    2006-07-01

    Full Text Available ) and the waist position (z0) 3. TEMPERATURE MEASUREMENTS There are many methods to measure the temperature of a body. Here we used a thermocou- ple and a pyrometer, while future plans involve emission spectroscopy. A thermocouple is a temperature... sensor that consists of two wires con- nected together made from different metals, which produces an electrical voltage that is dependant on tem- perature. A Newport electronic thermocou- ple was used to meas- ured temperature. It can measure...

  20. Effects of Crimped Fiber Paths on Mixed Mode Delamination Behaviors in Woven Fabric Composites

    Science.gov (United States)

    2016-09-01

    figure 3. The force was applied to the loading bar at a constant rate with respect to time. This type of loading is referred to as “ force -control... rate Gc_eff. Once this occurred, strain energy was released and crack growth developed . Failure was based on LEFM through the use of VCCT. The VCCT...Composites Paul V. Cavallaro Andrew W. Hulton NUWC Division Newport Melvin W. Jee U.S. Army Natick Soldier Research, Development & Engineering Center

  1. Racial differences in cigarette brand recognition and impact on youth smoking.

    Science.gov (United States)

    Dauphinee, Amanda L; Doxey, Juliana R; Schleicher, Nina C; Fortmann, Stephen P; Henriksen, Lisa

    2013-02-25

    African Americans are disproportionately exposed to cigarette advertisements, particularly for menthol brands. Tobacco industry documents outline strategic efforts to promote menthol cigarettes to African Americans at the point of sale, and studies have observed more outdoor and retail menthol advertisements in neighborhoods with more African-American residents. Little research has been conducted to examine the effect of this target marketing on adolescents' recognition of cigarette brand advertising and on smoking uptake. To our knowledge, this is the first study to examine racial differences in brand recognition and to assess the prospective relationship between brand recognition and smoking uptake. School-based surveys assessing tobacco use and environmental and social influences to smoke were administered to 6th through 9th graders (ages 11 to 15) in an urban and racially diverse California school district. The primary outcome for the cross-sectional analysis (n = 2,589) was brand recognition, measured by students' identification of masked tobacco advertisements from the point of sale. The primary outcome for the longitudinal analysis (n = 1,179) was progression from never to ever smoking within 12 months. At baseline, 52% of students recognized the Camel brand, 36% Marlboro, and 32% Newport. African-American students were three times more likely than others to recognize Newport (OR = 3.03, CI = 2.45, 3.74, p brand recognition of Camel and Marlboro did not predict smoking initiation. Regardless of race, students who recognized the Newport brand at baseline were more likely to initiate smoking at follow-up (OR = 1.49, CI = 1.04, 2.15, p recognition of Newport cigarette advertising predicted smoking initiation, regardless of race. This longitudinal study contributes to a growing body of evidence that supports a ban on menthol flavored cigarettes in the US as well as stronger regulation of tobacco advertising at the point of sale.

  2. Progress in Applying Tunable Diode Laser Absorption Spectroscopy to Scramjet Isolators and Combustors

    Science.gov (United States)

    2010-05-01

    the point that several c ompanies including Z olo T echnologies I nc., Southwest Sciences, I nc., L os Gatos R esearch, Inc., a nd P hysical S...with the 10% beam going to a 50/50 splitter (Newport F-CPL- B12355) whose output is routed to either a SiO2 (Los Gatos Research) etalon with a 2.000

  3. Slotted Antenna with Anisotropic Covering

    Science.gov (United States)

    2015-08-06

    08-2015 Publication Slotted Antenna with Anisotropic Covering David A. Tonn et al Naval Under Warfare Center Division, Newport 1176 Howell St...NUWC 300055 Distribution A An antenna includes a tubular, conductive radiator having a longitudinal slot formed therein from a first end of the...conductive radiator to a second end of the conductive radiator. An antenna feed can be joined to the conductive radiator adjacent to and across the slot

  4. Variable Length Inflatable Ramp Launch and Recovery System

    Science.gov (United States)

    2016-09-22

    DEPARTMENT OF THE NAVY OFFICE OF COUNSEL NAVAL UNDERSEA WARFARE CENTER DIVISION 1176 HOWELL STREET NEWPORT Rl 02841-1708...recovery system for towed bodies. (2) Description of the Prior Art [0004] Various at-sea training exercises require the launch, tracking and recovery...continuously circular braided material, reinforced with tensile webbing straps for shaping. As is known to those of skill in the art , tubes fabricated in

  5. Causes and consequences of obesity: epigenetics or hypokinesis?

    OpenAIRE

    Graham,, Sj; Baker JS; Davies B

    2015-01-01

    Michael R Graham,1 Julien S Baker,2 Bruce Davies3 1Llantarnam Research Academy, Cwmbran, Torfaen, UK; 2Exercise Science Research Laboratory, Institute of Clinical Exercise and Health Science, School of Science, University of the West of Scotland, Hamilton, UK; 3Science Department, University of South Wales, Newport, UKEpigenetics can be defined as the study of heritable changes that affect gene function without modification of the deoxyribonucleic acid (DNA) sequence.1 The transfer of epigene...

  6. Experimental and Numerical Investigations on Damage and Delamination in Thick Plain Weave S-2 Glass Composites Under Quasi-Static Punch Shear Loading

    Science.gov (United States)

    2004-02-01

    the interface element layers are defined by providing different orientation angles at specified interface layers (interface locations are kept the...1 USDOT FEDERAL RAILRD M FATEH RDV 31 WASHINGTON DC 20590 3 CYTEC FIBERITE R DUNNE D KOHLI R MAYHEW 1300 REVOLUTION ST...195 BEAR HILL RD WALTHAM MA 02354-1196 1 ROM DEVELOPMENT CORP R O MEARA 136 SWINEBURNE ROW BRICK MARKET PLACE NEWPORT RI 02840

  7. Predicting the Nonlinear Response and Failure of Composite Laminates: Correlation With Experimental Results

    Science.gov (United States)

    2004-06-01

    orientation due to large deformation. 2.13. Loading case 13: stress–strain curves of (y:x=1:0) for [0/+45/45/90]s AS4 graphite/3501- 6 epoxy. A comparison of...GEORGETOWN PIKE MCLEAN VA 22101 1 USDOT FEDERAL RAILROAD M FATEH RDV 31 WASHINGTON DC 20590 3 CYTEC FIBERITE R DUNNE D KOHLI ...ORGANIZATION COPIES ORGANIZATION 1 ROM DEVELOPMENT CORP R O MEARA 136 SWINEBURNE ROW BRICK MARKET PLACE NEWPORT RI 02840 2 TEXTRON

  8. Characterizing Optical Loss in Orientation Patterned III-V Materials using Laser Calorimetry

    Science.gov (United States)

    2014-03-27

    Spectrophotometer transmission measurement for GaAs and GaP samples...size of 518 microns on the sample. A THOR Labs beam profiler was used to find this beam size. Also a calibrated Newport Power Meter and detector...A. Figure 39 presents the transmission measurements for GaAs and GaP samples using a CARY spectrophotometer . 59 Table 4: Absorptance

  9. Redefining U.S. Arctic Strategy

    Science.gov (United States)

    2015-05-15

    52 Xie, Kevin. Some BRICS in the Arctic: Developing Powers Look North, Harvard International Review, Vol 36, No. 3, Spring 2015. Accessed 11...May 2015 at <https://www.questia.com/library/journal/1G1- 411013832/some- brics -in-the-arctic-developing-powers-look-north> 18 Strategy for the...2013. Vego, Milan. Joint Operational Warfare, Theory and Practice. Newport, RI: U.S. Naval War College, 2009. Xie, Kevin. Some BRICS in the

  10. Prospects for Reenlistment of Prior-Service Personnel.

    Science.gov (United States)

    1984-02-01

    abilities and characteris- tics in common ( Kotler 1980, Chapter 10). The several segments, in turn, should be distinguishable from one another...Klecka, W. R. Discriminant Analysis. Beverly Hills, CA: Sage Publica- tions, 1980. Kotler , P. Principles of Marketing. Englewood Cliffs, NJ: Prentice...Library Naval War College Newport, RI 02940 Mr. Philip Bernard B-K Dynamics, Inc. 15825 Shady Grove Road Rockville, MD 20850 Dr. Bruce M. Meglino College of

  11. Characterization of the Boundary Layers on Full-Scale Bluefin Tuna

    Science.gov (United States)

    2014-09-30

    The model was instrumented with 32 wall pressure sensors; experiments were performed in a tow tank. Results from flow visualization, drag, and...ACRONYMS DOF Degree of Freedom DPIV Digital Particle Image Velocimetry FY Fiscal Year HPV Human-Powered Vehicle NACA National Advisory...and instrumented for tests performed in a tow tank at the Naval Undersea Warfare Center (NUWC) Division Newport, RI. As the project progresses

  12. Science, Technical Innovation and Applications in Bioacoustics: Summary of a Workshop

    Science.gov (United States)

    2004-07-01

    acoustical experiments on beluga whales, which sonar system surpasses that one of bottlenose dolphins, and we still do not know why. The set of tests, which...tests on beluga whales will help us discover the reasons of that superiority. Appendix 3n Paul Doust Transducer Equalisation Techniques. P.E. Doust...Clinic EPSRC IMPROVES Project Three-year £600K Programme. Commenced 2001, and involves: University of Southampton University of Wales College Newport

  13. Automatic Submerged ARC Welding With Metal Power Additions to Increase Productivity and Maintain Quality

    Science.gov (United States)

    1986-06-01

    Manager of Welding Engineering PROPOSAL WELDING OF CARBON STEEL AND HY80 UTILIZING THE BULK WELDING PROCESS May 9, 1983 PREPARED BY: NEWPORT NEwS...12 joints with carbon steel and 12 with HY80 , utilizing three The joints will requirements of Benefits 1. Deposition times that different size double...of Joint Variations and Deposition Rates Filler Metal/Base Material Chemical Analyses; Carbon Steel /HIS Filler Metal/Base Material Chemical Analyses

  14. Isolation and identification of Salmonella spp. in drinking water, streams, and swine wastewater by molecular techniques in Taiwan

    Science.gov (United States)

    Kuo, C.; Hsu, B.; Shen, T.; Tseng, S.; Tsai, J.; Huang, K.; Kao, P.; Chen, J.

    2013-12-01

    Salmonella spp. is a common water-borne pathogens and its genus comprises more than 2,500 serotypes. Major pathogenic genotypes which cause typhoid fever, enteritis and other intestinal-type diseases are S. Typhimurium, S. Enteritidis, S. Stanley, S. Agona, S.Albany, S. Schwarzengrund, S. Newport, S. Choleraesuis, and S. Derby. Hence, the identification of the serotypes of Salmonella spp. is important. In the present study, the analytical procedures include direct concentration method, non-selective pre-enrichment method and selective enrichment method of Salmonella spp.. Both selective enrichment method and cultured bacteria were detected with specific primers of Salmonella spp. by polymerase chain reaction (PCR). At last, the serotypes of Salmonella were confirmed by using MLST (multilocus sequence typing) with aroC, dnaN, hemD, hisD, purE, sucA, thrA housekeeping genes to identify the strains of positive samples. This study contains 121 samples from three different types of water sources including the drinking water (51), streams (45), and swine wastewater (25). Thirteen samples with positive invA gene are separated from culture method. The strains of these positive samples which identified from MLST method are S. Albany, S. Typhimurium, S. Newport, S. Bareilly, and S. Derby. Some of the serotypes, S. Albany, S. Typhimurium and S. Newport, are highly pathogenic which correlated to human diarrhea. In our results, MLST is a useful method to identify the strains of Salmonella spp.. Keywords: Salmonella, PCR, MLST.

  15. Seasonal and annual dynamics of harmful algae and algal toxins revealed through weekly monitoring at two coastal ocean sites off southern California, USA

    KAUST Repository

    Seubert, Erica L.

    2013-01-04

    Reports of toxic harmful algal blooms (HABs) attributed to the diatom Pseudo-nitzschia spp. have been increasing in California during the last several decades. Whether this increase can be attributed to enhanced awareness and monitoring or to a dramatic upswing in the development of HAB events remains unresolved. Given these uncertainties, the ability to accurately and rapidly identify an emerging HAB event is of high importance. Monitoring of HAB species and other pertinent chemical/physical parameters at two piers in southern California, Newport and Redondo Beach, was used to investigate the development of a site-specific bloom definition for identifying emerging domoic acid (DA) events. Emphasis was given to abundances of the Pseudo-nitzschia seriata size category of Pseudo-nitzschia due to the prevalence of this size class in the region. P. seriata bloom thresholds were established for each location based on deviations from their respective long-term mean abundances, allowing the identification of major and minor blooms. Sixty-five percent of blooms identified at Newport Beach coincided with measurable DA concentrations, while 36 % of blooms at Redondo Beach coincided with measurable DA. Bloom definitions allowed for increased specificity in multiple regression analysis of environmental forcing factors significant to the presence of DA and P. seriata. The strongest relationship identified was between P. seriata abundances 2 weeks following upwelling events at Newport Beach. © 2012 Springer-Verlag Berlin Heidelberg.

  16. Can't take the heat: Temperature-enhanced toxicity in the mayfly Isonychia bicolor exposed to the neonicotinoid insecticide imidacloprid.

    Science.gov (United States)

    Camp, A A; Buchwalter, D B

    2016-09-01

    Neonicotinoid insecticide usage has increased globally in recent decades. Neonicotinoids, such as imidacloprid, are potent insect neurotoxicants that may pose a threat to non-target aquatic organisms, such as aquatic insects. In nature, insects typically live in thermally fluctuating conditions, which may significantly alter both contaminant exposures and affects. Here we investigate the relationship between temperature and time-to-effect for imidacloprid toxicity with the aquatic insect Isonychia bicolor, a lotic mayfly. Additionally, we examined the mechanisms driving temperature-enhanced toxicity including metabolic rate, imidacloprid uptake rate, and tissue bioconcentration. Experiments included acute toxicity tests utilizing sublethal endpoints and mortality, as well as respirometry and radiotracer assays with [(14)C] imidacloprid. Further, we conducted additional uptake experiments with a suite of aquatic invertebrates (including I. bicolor, Neocloeon triangulifer, Macaffertium modestum, Pteronarcys proteus, Acroneuria carolinensis, and Pleuroceridae sp) to confirm and contextualize our findings from initial experiments. The 96h EC50 (immobility) for I. bicolor at 15°C was 5.81μg/L which was approximately 3.2 fold lower than concentrations associated with 50% mortality. Assays examining the impact of temperature were conducted at 15, 18, 21, and 24°C and demonstrated that time-to-effect for sublethal impairment and immobility was significantly decreased with increasing temperature. Uptake experiments with [(14)C] imidacloprid revealed that initial uptake rates were significantly increased with increasing temperature for I. bicolor, as were oxygen consumption rates. Further, in the separate experiment with multiple species across temperatures 15, 20, and 25°C, we found that all the aquatic insects tested had significantly increased imidacloprid uptake with increasing temperatures, with N. triangulifer accumulating the most imidacloprid on a mass

  17. Active-site peptides of acetylcholinesterase of Electrophorus electricus: labelling of His-440 by 1-bromo-[2-14C]pinacolone and Ser-200 by tritiated diisopropyl fluorophosphate.

    Science.gov (United States)

    Salih, E; Chishti, S B; Vicedomine, P; Cohen, S G; Chiara, D C; Cohen, J B

    1994-10-19

    To characterize the structure of the active site of acetylcholinesterase (AChE) from the electric organ of E. electricus, we identified sites of incorporation of two active-site affinity labels, [3H]diisopropyl fluorophosphate ([3H]DFP), and 1-bromo-2-[14C]pinacolone ([14C]BrPin). AChE was isolated, purified, inactivated and digested with trypsin, and peptides containing 3H or 14C were purified by reverse-phase HPLC and characterized by N-terminal sequence analysis. [3H]DFP, labelling Ser-200, was found in a single peptide, QVTIFGESAGAASVGMHLLSPDSR, 83% identical with the sequence from Thr-193 to Arg-216 deduced for AChE of T. californica, with Gln, Ala, Leu, and Asp in place of Thr-193, Gly-203, Ile-210 and Gly-214, respectively, and 87% identical with that from bovine and human brain AChEs. Inactivation by [14C]BrPin led to two radioactive peptides. One, ASNLVWPEWMGVIHGYEIEFVFGLPLEK, was 96% identical with that extending from Ala-427 to Lys-454 of T. californica. Release of 14C in cycle 14 established reaction of [14C]BrPin with active-site His-440, protected by 5-trimethylammonio-2-pentanone (TAP). The other peptide, LLXVTENIDDAER, 77% homologous with that of T. californica extending from Leu-531 to Arg-543, had label associated with the third cycle, not protected by TAP, corresponding to Asn-533. The slow inactivation of eel AChE by reaction of [14C]BrPin at His-440 contrasts with that of AChE from T. nobiliana, where it reacts rapidly with a free cysteine, Cys-231, not present in eel AChE. For both AChEs, inactivation by BrPin prevents subsequent reaction with [3H]DFP, and prior inactivation by DFP does not prevent reactions with [14C]BrPin.

  18. Comparative morphology of stingray lateral line canal and electrosensory systems.

    Science.gov (United States)

    Jordan, Laura K

    2008-11-01

    Elasmobranchs (sharks, skates, and rays) possess a variety of sensory systems including the mechanosensory lateral line and electrosensory systems, which are particularly complex with high levels of interspecific variation in batoids (skates and rays). Rays have dorsoventrally compressed, laterally expanded bodies that prevent them from seeing their mouths and more often than not, their prey. This study uses quantitative image analysis techniques to identify, quantify, and compare structural differences that may have functional consequences in the detection capabilities of three Eastern Pacific stingray species. The benthic round stingray, Urobatis halleri, pelagic stingray, Pteroplatytrygon (Dasyatis) violacea, and benthopelagic bat ray, Myliobatis californica, show significant differences in sensory morphology. Ventral lateral line canals correlate with feeding ecology and differ primarily in the proportion of pored and nonpored canals and the degree of branching complexity. Urobatis halleri shows a high proportion of nonpored canals, while P. violacea has an intermediate proportion of pored and nonpored canals with almost no secondary branching of pored canals. In contrast, M. californica has extensive and highly branched pored ventral lateral line canals that extended laterally toward the wing tips on the anterior edge of the pectoral fins. Electrosensory morphology correlates with feeding habitat and prey mobility; benthic feeders U. halleri and M. californica, have greater electrosensory pore numbers and densities than P. violacea. The percentage of the wing surface covered by these sensory systems appears to be inversely related to swimming style. These methods can be applied to a broader range of species to enable further discussion of the relationship of phylogeny, ecology, and morphology, while the results provide testable predictions of detection capabilities.

  19. Two new desert Eschscholzia (Papaveraceae from southwestern North America

    Directory of Open Access Journals (Sweden)

    Shannon Still

    2014-03-01

    Full Text Available Two new species of Eschscholzia are described. Both are found in the deserts of California and one extends outside the state boundary into Arizona. Eschscholzia androuxii Still, sp.nov. is found mainly in and around Joshua Tree National Park in Riverside and San Bernardino counties. Eschscholzia papastillii Still, sp. nov. is found from the northern Mojave south through Joshua Tree National Park to central Imperial County. Both are annuals found in coarse, sandy soil and have yellow flowers typical of desert Eschscholzia. Eschscholzia papastillii has an expanded receptacular rim similar to that of E. californica. Eschscholzia androuxii has anthocyanin bands around the stamen filaments.

  20. Purification of acetylcholine receptors from the muscle of Electrophorus electricus.

    Science.gov (United States)

    Lindstrom, J M; Cooper, J F; Swanson, L W

    1983-08-02

    Muscle from the electric eel Electrophorus electricus contains acetylcholine receptors at 50 times the concentration of normal mammalian muscle and fully one-tenth the concentration of receptors in its electric organ tissue. Receptor is organized much more diffusely over the surface of Electrophorus muscle cells than is the case in normally innervated mammalian skeletal muscle. Receptor was purified from Electrophorus muscle by affinity chromatography on cobra toxin-agarose and found to contain subunits which correspond immunochemically to the alpha, beta, gamma, and delta subunits of receptor from electric organ tissue of Torpedo californica. Receptor purified from Electrophorus muscle appears virtually identical with receptor purified from Electrophorus electric organ tissue.

  1. Morphological and chemical characteristics of fruits of selected Rosa sp.

    Directory of Open Access Journals (Sweden)

    Agnieszka Najda

    2013-04-01

    Full Text Available The aim of this study was to evaluate the morphological and chemical parameters, antioxidant activity (DPPH of five rose species (Rosa rugosa, R. villosa, R. californica, R. spinosissima, and R. × damascene and grouping them according to the harvest date. On the basis of the study, rose species grown in eastern Poland were grouped according to their harvest time, and three dates of cumulative ripeness of pseudofruits were distinguished. Rosehips of studied species varied referring to their harvest date and morphological properties and were characterized by diverse contents of primary metabolites analyzed. In addition, obtained extracts showed high antioxidant activity, which has a significant impact on their value for processing.

  2. Analysis of neuropeptides using capillary zone electrophoresis with multichannel fluorescence detection

    Science.gov (United States)

    Sweedler, Jonathan V.; Shear, Jason B.; Fishman, Harvey A.; Zare, Richard N.; Scheller, Richard H.

    1991-12-01

    Capillary zone electrophoresis is fast becoming one of the most sensitive separation schemes for sampling complex microenvironments. A unique detection scheme is developed in which a charge-coupled device (CCD) detects laser induced fluorescence from an axially illuminated electrophoresis capillary. The fluorescence from an analyte band is measured over a several centimeter section of the capillary, greatly increasing the observation time of the fluorescently tagged band. The sensitivity of the system is in the 1-8 X 10-20 mol range for derivatized amino acids and peptides. Subattomole quantities of bag cell neuropeptides collected from the giant marine mollusk Aplysia californica can be measured.

  3. Central loop of non-conventional toxin WTX from Naja kaouthia is important for interaction with nicotinic acetylcholine receptors.

    Science.gov (United States)

    Lyukmanova, Ekaterina N; Shulepko, Mikhail A; Shenkarev, Zakhar O; Kasheverov, Igor E; Chugunov, Anton O; Kulbatskii, Dmitrii S; Myshkin, Mikhail Yu; Utkin, Yuri N; Efremov, Roman G; Tsetlin, Victor I; Arseniev, Alexander S; Kirpichnikov, Mikhail P; Dolgikh, Dmitry A

    2016-09-01

    'Three-finger' toxin WTX from Naja kaouthia interacts with nicotinic and muscarinic acetylcholine receptors (nAChRs and mAChRs). Mutagenesis and competition experiments with (125)I-α-bungarotoxin revealed that Arg31 and Arg32 residues from the WTX loop II are important for binding to Torpedo californica and human α7 nAChRs. Computer modeling suggested that loop II occupies the orthosteric binding site at α7 nAChR. The similar toxin interface was previously described as a major determinant of allosteric interactions with mAChRs.

  4. [Bacterial expression of water-soluble domain of Lynx1, endogenic neuromodulator of human nicotinic acetylcholine receptors].

    Science.gov (United States)

    Shulepko, M A; Liukmanova, E N; Kasheverov, I E; Dolgikh, D A; Tsetlin, V I; Kirpichnikov, M P

    2011-01-01

    Lynx1 expresses in the central nervous system and plays important role in a regulation of nicotinic acetylcholine receptors. Successful milligram-quantitive expression of ws-Lynx1 was achieved only in the case of its production in the form of cytoplasm inclusion bodies. Different conditions of ws-Lynx1 refolding for yield optimization were performed. The obtained recombinant protein was characterized by means of mass spectrometry and CD spectroscopy. The binding experiments on the nAChRs from Torpedo californica membranes revealed that ws-Lynxl is biologically active and blocks muscle nAChR with IC50-20-30 microM.

  5. Viruses that ride on the coat-tails of actin nucleation.

    Science.gov (United States)

    Newsome, Timothy P; Marzook, N Bishara

    2015-10-01

    Actin nucleation drives a diversity of critical cellular processes and the motility of a select group of viral pathogens. Vaccinia virus and baculovirus, Autographa californica multiple nucleopolyhedrovirus, recruit and activate the cellular actin nucleator, the Arp2/3 complex, at the surface of virus particles thereby instigating highly localized actin nucleation. The extension of these filaments provides a mechanical force that bestows the ability to navigate the intracellular environment and promote their infectious cycles. This review outlines the viral and cellular proteins that initiate and regulate the signalling networks leading to viral modification of the actin cytoskeleton and summarizes recent insights into the role of actin-based virus transport.

  6. New and rare species of Volvocaceae (Chlorophyta in the Polish phycoflora

    Directory of Open Access Journals (Sweden)

    Ewa A. Dembowska

    2013-12-01

    Full Text Available Seven species of Volvocaceae were recorded in the lower Vistula River and its oxbow lakes, including Pleodorina californica for the first time in Poland. Three species – Eudorina cylindrica, E. illinoisensis and E. unicocca – were found in the Polish Vistula River in the 1960s and 1970s, as well as at present. They are rare species in the Polish aquatic ecosystems. Three species are common both in the oxbow lakes and in the Vistula River: Eudorina elegans, Pandorina morum and Volvox aureus. New and rare Volvocaceae species were described in terms of morphology and ecology; also photographic documentation (light microscope microphotographs was completed.

  7. Functional Authentication of a Novel Gastropod Gonadotropin-Releasing Hormone Receptor Reveals Unusual Features and Evolutionary Insight

    OpenAIRE

    Kavanaugh, Scott I.; Tsai, Pei-San

    2016-01-01

    A gonadotropin-releasing hormone (GnRH)-like molecule was previously identified in a gastropod, Aplysia californica, and named ap-GnRH. In this study, we cloned the full-length cDNA of a putative ap-GnRH receptor (ap-GnRHR) and functionally authenticated this receptor as a bona fide ap-GnRHR. This receptor contains two potential translation start sites, each accompanied by a Kozak sequence, suggesting the translation of a long and a short form of the receptor is possible. The putative ap-GnRH...

  8. Infrared neural stimulation (INS) inhibits electrically evoked neural responses in the deaf white cat

    Science.gov (United States)

    Richter, Claus-Peter; Rajguru, Suhrud M.; Robinson, Alan; Young, Hunter K.

    2014-03-01

    Infrared neural stimulation (INS) has been used in the past to evoke neural activity from hearing and partially deaf animals. All the responses were excitatory. In Aplysia californica, Duke and coworkers demonstrated that INS also inhibits neural responses [1], which similar observations were made in the vestibular system [2, 3]. In deaf white cats that have cochleae with largely reduced spiral ganglion neuron counts and a significant degeneration of the organ of Corti, no cochlear compound action potentials could be observed during INS alone. However, the combined electrical and optical stimulation demonstrated inhibitory responses during irradiation with infrared light.

  9. Wetlands Research Program. Corps of Engineers Wetlands Delineation Manual. Appendix C. Section 1. Region O - California.

    Science.gov (United States)

    1987-01-01

    Palmerella’ . Fnicwn c~zpi !are L. W~itch grass A .P. dich otor’,i"’Iorum Michx. Fall panicum FAC.; I ccn.a Scribn Pacific panicum FACW riq-c’*?_U"L...ladyslipper FAG CypseZea hwnifusa Turpin Cypselea FACW Vanthonia californica Boland. California danthonia FACW D. intermedia Vasey Timber danthonia Darlingtonia...Trin.) Munro Annual hairgrass FACW DRA i. eZongata (Hook.) Munro Slender hairgrass Dichantheliwn czcuminatum (Swartz) Pacific panicum Gould & C. A

  10. Distribution and sources of surfzone bacteria at Huntington Beach before and after disinfection on an ocean outfall - A frequency-domain analysis

    Science.gov (United States)

    Noble, M.A.; Xu, J. P.; Robertson, G.L.; Rosenfeld, L.K.

    2006-01-01

    Fecal indicator bacteria (FIB) were measured approximately 5 days a week in ankle-depth water at 19 surfzone stations along Huntington Beach and Newport Beach, California, from 1998 to the end of 2003. These sampling periods span the time before and after treated sewage effluent, discharged into the coastal ocean from the local outfall, was disinfected. Bacterial samples were also taken in the vicinity of the outfall during the pre- and post-disinfection periods. Our analysis of the results from both data sets suggest that land-based sources, rather than the local outfall, were the source of the FIB responsible for the frequent closures and postings of local beaches in the summers of 2001 and 2002. Because the annual cycle is the dominant frequency in the fecal and total coliform data sets at most sampling stations, we infer that sources associated with local runoff were responsible for the majority of coliform contamination along wide stretches of the beach. The dominant fortnightly cycle in enterococci at many surfzone sampling stations suggests that the source for these relatively frequent bacteria contamination events in summer is related to the wetting and draining of the land due to the large tidal excursions found during spring tides. Along the most frequently closed section of the beach at stations 3N-15N, the fortnightly cycle is dominant in all FIBs. The strikingly different spatial and spectral patterns found in coliform and in enterococci suggest the presence of different sources, at least for large sections of beach. The presence of a relatively large enterococci fortnightly cycle along the beaches near Newport Harbor indicates that contamination sources similar to those found off Huntington Beach are present, though not at high enough levels to close the Newport beaches. ?? 2006 Elsevier Ltd. All rights reserved.

  11. Prevalence and Characteristics of Salmonella Serotypes Isolated from Fresh Produce Marketed in the United States.

    Science.gov (United States)

    Reddy, Shanker P; Wang, Hua; Adams, Jennifer K; Feng, Peter C H

    2016-01-01

    Salmonella continues to rank as one of the most costly foodborne pathogens, and more illnesses are now associated with the consumption of fresh produce. The U.S. Department of Agriculture Microbiological Data Program (MDP) sampled select commodities of fresh fruit and vegetables and tested them for Salmonella, pathogenic Escherichia coli, and Listeria. The Salmonella strains isolated were further characterized by serotype, antimicrobial resistance, and pulsed-field gel electrophoresis profile. This article summarizes the Salmonella data collected by the MDP between 2002 and 2012. The results show that the rates of Salmonella prevalence ranged from absent to 0.34% in cilantro. A total of 152 isolates consisting of over 50 different serotypes were isolated from the various produce types, and the top five were Salmonella enterica serotype Cubana, S. enterica subspecies arizonae (subsp. IIIa) and diarizonae (subsp. IIIb), and S. enterica serotypes Newport, Javiana, and Infantis. Among these, Salmonella serotypes Newport and Javiana are also listed among the top five Salmonella serotypes that caused most foodborne outbreaks. Other serotypes that are frequent causes of infection, such as S. enterica serotypes Typhimurium and Enteritidis, were also found in fresh produce but were not prevalent. About 25% of the MDP samples were imported produce, including 65% of green onions, 44% of tomatoes, 42% of hot peppers, and 41% of cantaloupes. However, imported produce did not show higher numbers of Salmonella-positive samples, and in some products, like cilantro, all of the Salmonella isolates were from domestic samples. About 6.5% of the Salmonella isolates were resistant to the antimicrobial compounds tested, but no single commodity or serotype was found to be the most common carrier of resistant strains or of resistance. The pulsed-field gel electrophoresis profiles of the produce isolates showed similarities with Salmonella isolates from meat samples and from outbreaks, but

  12. Regularization of languages by adults and children: A mathematical framework.

    Science.gov (United States)

    Rische, Jacquelyn L; Komarova, Natalia L

    2016-02-01

    The fascinating ability of humans to modify the linguistic input and "create" a language has been widely discussed. In the work of Newport and colleagues, it has been demonstrated that both children and adults have some ability to process inconsistent linguistic input and "improve" it by making it more consistent. In Hudson Kam and Newport (2009), artificial miniature language acquisition from an inconsistent source was studied. It was shown that (i) children are better at language regularization than adults and that (ii) adults can also regularize, depending on the structure of the input. In this paper we create a learning algorithm of the reinforcement-learning type, which exhibits patterns reported in Hudson Kam and Newport (2009) and suggests a way to explain them. It turns out that in order to capture the differences between children's and adults' learning patterns, we need to introduce a certain asymmetry in the learning algorithm. Namely, we have to assume that the reaction of the learners differs depending on whether or not the source's input coincides with the learner's internal hypothesis. We interpret this result in the context of a different reaction of children and adults to implicit, expectation-based evidence, positive or negative. We propose that a possible mechanism that contributes to the children's ability to regularize an inconsistent input is related to their heightened sensitivity to positive evidence rather than the (implicit) negative evidence. In our model, regularization comes naturally as a consequence of a stronger reaction of the children to evidence supporting their preferred hypothesis. In adults, their ability to adequately process implicit negative evidence prevents them from regularizing the inconsistent input, resulting in a weaker degree of regularization. Copyright © 2015 Elsevier Inc. All rights reserved.

  13. Antimicrobial activity of apple, hibiscus, olive, and hydrogen peroxide formulations against Salmonella enterica on organic leafy greens.

    Science.gov (United States)

    Moore, Katherine L; Patel, Jitendra; Jaroni, Divya; Friedman, Mendel; Ravishankar, Sadhana

    2011-10-01

    Salmonella enterica is one of the most common bacterial pathogens implicated in foodborne outbreaks involving fresh produce in the last decade. In an effort to discover natural antimicrobials for use on fresh produce, the objective of the present study was to evaluate the effectiveness of different antimicrobial plant extract-concentrate formulations on four types of organic leafy greens inoculated with S. enterica serovar Newport. The leafy greens tested included organic romaine and iceberg lettuce, and organic adult and baby spinach. Each leaf sample was washed, dip inoculated with Salmonella Newport (10(6) CFU/ml), and dried. Apple and olive extract formulations were prepared at 1, 3, and 5% concentrations, and hibiscus concentrates were prepared at 10, 20, and 30%. Inoculated leaves were immersed in the treatment solution for 2 min and individually incubated at 4°C. After incubation, samples were taken on days 0, 1, and 3 for enumeration of survivors. Our results showed that the antimicrobial activity was both concentration and time dependent. Olive extract exhibited the greatest antimicrobial activity, resulting in 2- to 3-log CFU/g reductions for each concentration and type of leafy green by day 3. Apple extract showed 1- to 2-log CFU/g reductions by day 3 on various leafy greens. Hibiscus concentrate showed an overall reduction of 1 log CFU/g for all leafy greens. The maximum reduction by hydrogen peroxide (3%) was about 1 log CFU/g. The antimicrobial activity was also tested on the background microflora of organic leafy greens, and reductions ranged from 0 to 2.8 log. This study demonstrates the potential of natural plant extract formulations to inactivate Salmonella Newport on organic leafy greens.

  14. Targeted advertising, promotion, and price for menthol cigarettes in California high school neighborhoods.

    Science.gov (United States)

    Henriksen, Lisa; Schleicher, Nina C; Dauphinee, Amanda L; Fortmann, Stephen P

    2012-01-01

    To describe advertising, promotions, and pack prices for the leading brands of menthol and nonmenthol cigarettes near California high schools and to examine their associations with school and neighborhood demographics. In stores (n = 407) within walking distance (0.8 km [1/2 mile]) of California high schools (n = 91), trained observers counted ads for menthol and nonmenthol cigarettes and collected data about promotions and prices for Newport and Marlboro, the leading brand in each category. Multilevel modeling examined the proportion of all cigarette advertising for any menthol brand, the proportion of stores with sales promotions, and the lowest advertised pack price in relation to store types and school/neighborhood demographics. For each 10 percentage point increase in the proportion of Black students, the proportion of menthol advertising increased by 5.9 percentage points (e.g., from an average of 25.7%-31.6%), the odds of a Newport promotion were 50% higher (95% CI = 1.01, 2.22), and the cost of Newport was 12 cents lower (95% CI = -0.18, -0.06). By comparison, the odds of a promotion and the price for Marlboro, the leading brand of nonmenthol cigarettes, were unrelated to any school or neighborhood demographics. In high school neighborhoods, targeted advertising exposes Blacks to more promotions and lower prices for the leading brand of menthol cigarettes. This evidence contradicts the manufacturer's claims that the availability of its promotions is not based on race/ethnicity. It also highlights the need for tobacco control policies that would limit disparities in exposure to retail marketing for cigarettes.

  15. Procedures, Requirements and Challenges Associated with Analysis of Environmental Samples for Chemical Warfare Material (CWM)

    Science.gov (United States)

    2012-03-29

    TN • Edwards AFB , CA • Ogden, UT • Ft. McClellan , AL • Camp Sibert, AL • Brooksville AAF, FL • Cleveland Plant, OH • Holloman AFB , NM • Lowry BGR...0.064) 19 (0.018) 100 (0.053) Approved for Public Release CONUS Projects • England AFB , LA • Redstone Arsenal, AL • Spring Valley DC • Memphis Depot...Deseret Chemical Depot, UT • Rocky Mt Arsenal, CO • Dover AFB , DE • Bluegrass, KY• Newport, IN • Dugway, UT Approved for Public Release OCONUS Projects

  16. Operational Art and Risk: Why Doctrine Does Not Help

    Science.gov (United States)

    2013-05-23

    London; New York: Frank Cass, 2005), 6. 16 Ibid., 26. 17 Basil Henry Liddell Hart, Strategy (New York, N.Y., U.S.A.: Meridian, 1991), 338. 18 U.S...concur 98 Frank Newport, David W. Moore , and Jeffrey M. Jones, “Special Release: American Opinion on the War,” Gallup, March 21, 2003, http...Media and Public Affairs, August 2003. http://www.cmpa.com/files/media_monitor/03novdec.pdf (accessed January 16, 2013). Liddell Hart, Basil Henry

  17. 500 Contractors Receiving the Largest Dollar Volume of Prime Contract Awards for RDT&E (Research, Development, Test and Evaluation) Fiscal Year 1983.

    Science.gov (United States)

    1983-01-01

    MCLEAN VIRGINIA 42 GREAT NECK NEW YORK 134,621 HAWTHORNE NEW YORK 75 16 NORTHROP CORP 245,512 2 SOUTHAMPTON PA 2,033 HUNTSVILLE ALABAMA 385 SALT LAKE ...33 FORD AEROSPACE & COMMUNICATIONS 98,343 * BUFFALO NEW YORK 17,620 ELSINORE CALIFORNIA I11 ROME NEW YORK 127 NEWPORT BEACH CALIFORNIA 5,638 DAYTON...GARLAND TEXAS 925 MISHAWAKA INDIANA 103 GREENVILLE TEXAS 25,057 SOUTH BEND INDIANA 375 SALT LAKE CITY UTAH 275 DAVENPORT IOWA 299 FALLS CHURCH VIRGINIA 864

  18. Transformation in Russian and Soviet Military History,

    Science.gov (United States)

    1986-10-01

    NJ: Princeton University Pi-ess, 1985. (on order) Golovin , Nikolai N. The Russian army in the World War. New Haven, CT: Yale University Press, 1931...S45 1973) Shaskol’skii, Igor P. Bor’ba russkogo naroda za nevskie berega. Moskva: Gos. voen. izd-vo, 1940 . (DK 51.7 S53) Smith, Clarence J. The...perspective. Newport, bI: Naval War 2ol~e re, 1973. (AD-A044 938/9) 9 II. The Development of Soviet Military Doctrine (1918- 1940 ) Based upon her rich

  19. Thermodynamics and Quantum Corrections from Molecular Dynamics for Liquid Water.

    Science.gov (United States)

    1982-10-01

    10"m2𔃻 for liqud warer at 300 L The pcislon of our reported value is questionable became we selected out my twelfth velocity rather than all...Bulding 1M6 D epartsent of Chemistry Newport, Rhode Island 02640 University of Arizona Tuscon, Arizona 63721 Professor Isish M. Warer Texas A&H University...REPORT DATE Office of Naval Research October, 1982 Arlington, VA 22217 1S. NU11SER911 OF PAGES 14. MONITORING AGENCY NM A AODRCSS(1f 1f11#60 beet COMsISMA

  20. Manufacturing Methods and Technology Measure for Fabrication of Silicon Transcalent Rectifier.

    Science.gov (United States)

    1980-09-01

    auxx-ma Reverse Current "Post" Baro . Reverse Current "Post" BVLT 5 5 4 4, 3 2 3 0.5 0.6 0.7 0.5 0.6 0.7I r (mA) I r (mA) Fig. 21 Fig. 22 Reverse...not shown) for the high tem- perature and reduced baro - metric pressure tests. Reverse blocking currents are measured with this equipmnent. -88- J 4I...Avenue ATTN: Mr. Kenneth Lipman Newport Beach, CA 92663 Box 109 South Windsor, CT 06074 Silicon Transistor Corp. ATTN: Mr. P. Fitzgerald Martin Marietta

  1. Notes from the field: multistate outbreak of human salmonella infections linked to live poultry from a mail-order hatchery in Ohio--February-October 2014.

    Science.gov (United States)

    Basler, Colin; Forshey, Tony M; Machesky, Kimberly; Erdman, C Matthew; Gomez, Thomas M; Brinson, Denise L; Nguyen, Thai-An; Behravesh, Casey Barton; Bosch, Stacey

    2015-03-13

    In early 2014, five clusters of human Salmonella infections were identified through PulseNet, the national molecular subtyping network for foodborne disease surveillance. Many ill persons in each of these clusters reported contact with live poultry, primarily chicks and ducklings, from a single mail-order hatchery; therefore, the clusters were merged into a single investigation. During February 3-October 14, 2014, a total of 363 persons infected with outbreak strains of Salmonella serotypes Infantis, Newport, and Hadar were reported from 43 states and Puerto Rico, making it the largest live poultry-associated salmonellosis outbreak reported in the United States.

  2. Outbreak-associated Salmonella enterica serotypes and food Commodities, United States, 1998-2008.

    Science.gov (United States)

    Jackson, Brendan R; Griffin, Patricia M; Cole, Dana; Walsh, Kelly A; Chai, Shua J

    2013-08-01

    Salmonella enterica infections are transmitted not only by animal-derived foods but also by vegetables, fruits, and other plant products. To clarify links between Salmonella serotypes and specific foods, we examined the diversity and predominance of food commodities implicated in outbreaks of salmonellosis during 1998-2008. More than 80% of outbreaks caused by serotypes Enteritidis, Heidelberg, and Hadar were attributed to eggs or poultry, whereas >50% of outbreaks caused by serotypes Javiana, Litchfield, Mbandaka, Muenchen, Poona, and Senftenberg were attributed to plant commodities. Serotypes Typhimurium and Newport were associated with a wide variety of food commodities. Knowledge about these associations can help guide outbreak investigations and control measures.

  3. Cooperation of Adhesin Alleles in Salmonella-Host Tropism

    Science.gov (United States)

    De Masi, Leon; Yue, Min; Hu, Changmin; Rakov, Alexey V.; Rankin, Shelley C.

    2017-01-01

    ABSTRACT Allelic combinations and host specificities for three fimbrial adhesins, FimH, BcfD, and StfH, were compared for 262 strains of Salmonella enterica serovar Newport, a frequent human and livestock pathogen. Like FimH, BcfD had two major alleles (designated A and B), whereas StfH had two allelic groups, each with two alleles (subgroup A1 and A2 and subgroup B1 and B2). The most prevalent combinations of FimH/BcfD/StfH alleles in S. Newport were A/A/A1 and B/B/B1. The former set was most frequently found in bovine and porcine strains, whereas the latter combination was most frequently found in environmental and human isolates. Bacteria genetically engineered to express Fim, Bcf, or Stf fimbriae on their surface were tested with the different alleles for binding to human, porcine, and bovine intestinal epithelial cells. The major allelic combinations with bovine and porcine strains (A/A/A1) or with human isolates (B/B/B1) provided at least two alleles capable of binding significantly better than the other alleles to an intestinal epithelial cell line from the respective host(s). However, each combination of alleles kept at least one allele mediating binding to an intestinal epithelial cell from another host. These findings indicated that allelic variation in multiple adhesins of S. Newport contributes to bacterial adaptation to certain preferential hosts without losing the capacity to maintain a broad host range. IMPORTANCE Salmonella enterica remains a leading foodborne bacterial pathogen in the United States; infected livestock serve often as the source of contaminated food products. A study estimated that over a billion Salmonella gastroenteritis cases and up to 33 million typhoid cases occur annually worldwide, with 3.5 million deaths. Although many Salmonella strains with a broad host range present preferential associations with certain host species, it is not clear what determines the various levels of host adaptation. Here, causal properties of host

  4. Real-time volumetric visualization of high-resolution array and toroidal volume search sonar data

    Science.gov (United States)

    Cross, Robert A.

    1998-09-01

    The Advanced Volume Visualization Display (AVVD) research program is a joint research program between the Fraunhofer Center for Research in Computer Graphics, Inc. and Innovative Research and Development Corp. It is dedicated the application of the human visual system to real-time visualization of high- resolution volumetric sensor data sets. The AVVD program has successfully demonstrated its application to undersea imaging using data from the Naval Undersea Warfare Center -- Division Newport's High Resolution Array (HRA), and from the Naval Surface Warfare Center -- Coastal System Stations's Toroidal Volume Search Sonar (TVSS).

  5. Highly Efficient Flexible Hybrid Photovoltaic Cells Based on Low-Band-Gap Conjugated Polymers Sensitized by Nanoparticle-Grafted Carbon

    Science.gov (United States)

    2010-09-01

    J-V characteristics were measured via a Keithley 2400 source-measure unit. A solar simulator with Xenon lamp (Newport, ~100 mW/cm2, AM 1.5) was...The DSC curve shows a pronounced melting peak at 205oC. XRD study shows that a decent crystalline structure is formed without any annealing of...Low Bandgap Polymers- C12PTV-0.5 % (CdS-CNT) Un-thermal annealed 0.0 0.5 1.0 1.5 2.0 0 2 4 6 8 10 C ur re nt D en si ty (m A /c m 2 ) Voltage

  6. Development and Characterization of New Donor-Acceptor Conjugated Polymers and Fullerene Nanoparticles for High Performance Bulk Heterojunction Solar Cells

    Science.gov (United States)

    2011-01-14

    xenon lamp (450 W) with an AM 1.5 G filter was used as the solar simulator. The light intensity was calibrated to 100 mW cm-2 using a calibrated silicon...monochromator (Newport, Cornerstone 130) joined to the same xenon lamp and a lock-in amplifier (Stanford Research Systems, SR 830) coupled to a...polymer (5 mg mL-1) and PC71BM (20 mg mL-1) in 1,2-dichlorobenzene and filtered with a 0.2 μm PTFE filter. The substrates were annealed at 150 ºC for 10

  7. Using Community-Based Participatory Research to Identify Environmental Justice Issues in an Inner-City Community and Inform Urban Planning.

    Science.gov (United States)

    Mansyur, Carol Leler; Jeng, Hueiwang Anna; Holloman, Erica; DeBrew, Linwood

    2016-01-01

    The Southeast CARE Coalition has been using community-based participatory research to examine environmental degradation in the Southeast Community, Newport News, Virginia. A survey was developed to collect assessment data. Up to 66% of respondents were concerned about environmental problems in their community. Those with health conditions were significantly more likely to identify specific environmental problems. The top 5 environmental concerns included coal dust, air quality, crime, water quality, and trash. The community-based participatory research process is building community capacity and participation, providing community input into strategic planning, and empowering community members to take control of environmental justice issues in their community.

  8. The Antiaircraft Journal. Volume 93, Number 5, September-October 1950

    Science.gov (United States)

    1950-10-01

    Hampton, Va. Tobin, Ralph c., Pen Craig, Newport. R. 1. Townsend, J. R. (Ret), 1821 Dalton Rd., Greens. boro, N. C. . Underwood, Edgar H. (Ret...Northampton St., Richmond, Va. Gard, H. P., Qtrs. 02, Ft. Meade, Md. Gettys, C. W., Bremerhaven POE , APO 69, c/o PM, New York, N. Y. Gibbs, G. G., State...B, New Castle, DeL Warfield, Benj. M., 810 Allan St., Jefferson Vil- lage Apts., Falls Church, Va. Watson, John T., 50 Sena Plaza, Santa Fe, N. M

  9. Strategic Consequences of China’s Expanding Maritime Power

    Science.gov (United States)

    2008-03-18

    any other provision of law , no person shall be subject to a penalty for failing to comply with a collection of information if it does not display a...area, especially given the United Nations Law of the Sea Treaty that allows nations to claim a 200 nautical mile Exclusive Economic Zone.26 China’s...Calls for Stronger Navy Fleet,” Newport News Daily Press, 17 January, 2008. 95 Vago Muradian, “Visions of U.S. Navy Called Unrealistic,” Defense News

  10. Naval War College Summary Record of Research and Publication, July 1985-June 1986

    Science.gov (United States)

    1986-01-01

    Operations, Newport, RI: 1986. 27pp. (AD C040 262L) N 420 F95 1986 no. 105. SECRET 164. REAMS, James P., MAJ, USA. "The Science and Art of Soviet...Assessment of Mexican Affairs, November 1913." Mexican Studies/Estudios Mexicanos , v.1, 1985, pp. 303-327. 226. JORDAN, Robert S. "The Oxford Connection...Middle East 2,106, 232 233, 235,238 Military Art and Science- Automation 116,165 Military Assistance, American 8 Military Bases, American 98 Military

  11. Naval War College Review. Volume 66, Number 4, Autumn 2013

    Science.gov (United States)

    2013-01-01

    to the most shameless modes of burial ,” such as throwing bodies on top of funeral pyres meant for others and then run- ning away. Perseverance “in...Kamikaze Threat (Newport, r.I.: Naval War College Press, 1985), pp. 130– 34; robert stern, Fire from the Sky : Surviving the Kamikaze Threat (annapolis...rat, angel on the Yardarm, pp. 126–27. 35. for Iff spoofing by Japanese kamikazes, see stern, Fire from the Sky , p. 155. for a thor- ough technical

  12. Three strategies to reduce overcrowding and gridlock.

    Science.gov (United States)

    2004-07-01

    ED overcrowding leads to lost revenue and service opportunities. Hoag Memorial Hospital Presbyterian in Newport Beach, CA, dropped diversion hours to zero with Code Emergency Saturation Triage (EST). Mobilize all staff to take extraordinary measures to move patients, i.e., immediate assessment of patients who should be moved upstairs and prioritizing bed cleaning. Pre-emptive bed requests can identify patient needs much sooner. Creative staffing, such as creating the position of emergency care admit nurse, can ease the paperwork burden of floor nurses.

  13. Salmonella in California wildlife species: prevalence in rehabilitation centers and characterization of isolates.

    Science.gov (United States)

    Smith, Woutrina A; Mazet, Jonna A K; Hirsh, Dwight C

    2002-09-01

    Fecal samples from 212 selected marine mammals, marine birds, and raptors were cultured for Salmonella spp. on arrival at rehabilitation centers in California from May 1999 through July 2000. Salmonella spp. were cultured from nine (4%) animals, and seven serotypes were isolated: Johannesberg, Montevideo, Newport, Ohio, Saint Paul, Enteritidis Group D, and 4,5,12:1 Monophasic. One western gull (Larus occidentalis) had two serotypes. Antibiotic susceptibilities and chromosomal fingerprints were evaluated for Salmonella isolates. Some isolates were resistant to gentamicin, amoxicillin-clavulanic acid, and ampicillin. Chromosomal fingerprints with XbaI and XhoI restriction enzymes differed between serotypes but not between individuals carrying the same serotype of Salmonella.

  14. Top cross section measurements at ATLAS

    CERN Document Server

    Okumura, Y; The ATLAS collaboration

    2011-01-01

    We present a measurement of the top-quark pair-production in proton-proton collisions at sqrt(s) = 7 TeV with the ATLAS detector at the Large Hadron Collider using the full 2010 data sample. The cross sections are measured in the lepton+jets and dilepton channels. This is a 15 minute talk (+ 6min discussion) to be given at "DIS2011" Workshop , Newport News, VA USA. The conference starts on April 11, 2011. The talk is scheduled for April 13, 2011.

  15. Coast of California Storm and Tidal Waves Study. Southern California Coastal Processes Data Summary,

    Science.gov (United States)

    1986-02-01

    level and extreme high and low readings. These are available for the stations listed above and for Newport Bay, Santa Monica, Port San Luis , Rincon Island...cells within the group. Ragged Point (3 mi. south of the Monterey-San Luis Obispo County line) which is the northern boundary of this -10- #A, -J -J...Pt. San Luis ) Santa Barbara Cell: Pt. Conception - Pt. Mugu 96 6 Santa Monica Cell: Pt. Dume - Palos Verdes Pt. 40 7 (extended cell includes ume Sub

  16. A Supplementary RDX/HMX Products Site Selection Study -- Economic Cost Analysis

    Science.gov (United States)

    1975-08-01

    Chemical REQUIREMENTS (1000 LBS) Composition-Ba RDXa HMXb Caustic Soda 1,320 1,320 330 Anhydrous Ammonia 2,225 2,225 556 Oxygen 1,315 1,315 329 Acetic...Ammonia $173/ton 0.086 0425 .0255 Caustic Soda $9/cwt 0.090 0264 .0158 Cyclohesanone 32/2c/lb 0.325 .0033 .0020 Hexamine 27c/lb 0.270 1031 .0618...Newport Army Ammunition Plant and the McAlester and Hawthorne Naval Ammunition Depots were the candidate sites. A ranking based on Present Value DO

  17. Social Organization in Parasitic Flatworms--Four Additional Echinostomoid Trematodes Have a Soldier Caste and One Does Not.

    Science.gov (United States)

    Garcia-Vedrenne, Ana E; Quintana, Anastasia C E; DeRogatis, Andrea M; Martyn, Kayla; Kuris, Armand M; Hechinger, Ryan F

    2016-02-01

    Complex societies where individuals exhibit division of labor with physical polymorphism, behavioral specialization, and caste formation have evolved several times throughout the animal kingdom. Recently, such complex sociality has been recognized in digenean trematodes; evidence is limited to 6 marine species. Hence, the extent to which a soldier caste is present throughout the Trematoda is sparsely documented, and there are no studies detailing the structure of a species lacking such a social structure. Here we examine colony structure for an additional 5 echinostomoid species, 4 of which infect the marine snail Cerithidea californica and 1 (Echinostoma liei) that infects the freshwater snail Biomphalaria glabrata . For all species, we present redia morphology (pharynx and body size) and the distribution of individuals of different castes throughout the snail body. When morphological evidence indicated the presence of a soldier caste, we assessed behavior by measuring attack rates of the different morphs toward heterospecific trematodes. Our findings indicate that each of the 4 species from C. californica have a permanent soldier caste while E. liei does not. The observed intra- and inter-specific variation of caste structure for those species with soldiers, and the documentation of colony structure for a species explicitly lacking permanent soldiers, emphasizes the diverse nature of trematode sociality and the promise of the group to permit comparative investigations of the evolution and ecology of sociality.

  18. Alkaloid metabolism in thrips-Papaveraceae interaction: recognition and mutual response.

    Science.gov (United States)

    Schütz, Ingeborg; Moritz, Gerald B; Roos, Werner

    2014-01-15

    Frankliniella occidentalis (Pergande), the Western Flower Thrips (WFT), is a polyphagous and highly adaptable insect of the order Thysanoptera. It has a broad host range but is rarely found on Papaveraceae, which might be due to deterrent effects of alkaloids present in most species of this family. In order to test the adaptive potential of WFT, we investigated its interaction with two Papaveraceae offered as sole feeding source. We found that WFT are able to live and feed on leaves of Eschscholzia californica and Chelidonium majus. Both plants respond to thrips feeding by the enhanced production of benzophenanthridine alkaloids. Furthermore, cell cultures of E. californica react to water insoluble compounds prepared from adult thrips with enhanced alkaloid production. During feeding, WFT take up benzophenanthridine alkaloids from either plant and from an artificial feeding medium and convert them to their less toxic dihydroderivatives. This was shown in detail with sanguinarine, the most cytotoxic benzophenanthridine. A similar conversion is used in plants to prevent self-intoxication by their own toxins. We conclude that WFT causes a phytoalexin-like response in Papaveraceae, but is able to adapt to such host plants by detoxification of toxic alkaloids. Copyright © 2013 Elsevier GmbH. All rights reserved.

  19. The artisanal elasmobranch fishery of the Pacific coast of Baja California Sur, Mexico, management implications

    Directory of Open Access Journals (Sweden)

    Sergio R. Ramirez-Amaro

    2013-09-01

    Full Text Available Artisanal fisheries in Mexico account for approximately 40% of the total national catch. In 2009, Baja California Sur (BCS had the second largest catch of elasmobranchs on the Mexican Pacific coast. This paper characterizes and describes the artisanal elasmobranch fishery of Pacific coast of BCS from 2000 to 2010. Sixty artisanal camps were documented, of which 45 targeted elasmobranchs, using primarily gillnets and longlines. We identified 52 elasmobranch species. Gillnetting accounted for 73.5% of the fishing effort and most frequently captured Rhinobatos productus, Mustelus henlei and Myliobatis californica. Longline fishing accounted for 26.5% of effort, most frequently capturing Prionace glauca and Isurus oxyrinchus. The prevalence of juveniles of several species (e.g., Cephaloscyllium ventriosum, Galeorhinus galeus, Isurus oxyrinchus, and Myliobatis californica within landings suggests that fishing effort may be opportunistically directed at breeding or nursery areas. Despite the dominance of species with wide distributions, we observed a significant biogeographic pattern in the abundance of some species relative to Bahia Magdalena. Results of the present study will be useful to detect changes in the structure of commercially exploited elasmobranch populations, and to provide useful indications for management purposes.

  20. Maternal adjustment of offspring provisioning and the consequences for dispersal.

    Science.gov (United States)

    Larios, Eugenio; Venable, D Lawrence

    2015-10-01

    Phenotypic plasticity in seed provisioning is a widespread phenomenon in plant populations that is often manifested as environmentally induced maternal effects. Environmental maternal effects can be beneficial if they influence population dynamic functions of seeds in a way that increases fitness, such as escaping from crowding. Using the winter annual plant, Dithyrea californica, we studied the response of seed provisioning to the maternal competitive environment and the associated seed dispersal consequences. We measured the average size of seeds produced by plants experiencing different competitive environments in order to test the hypothesis that mother plants respond to crowding by providing fewer resources to each offspring. We also hypothesized that smaller seeds produced by crowded mothers would benefit from greater dispersal away from their high-density natal habitat. We marked seeds with fluorescent paint while still attached to the mother plant, recorded seed diameter, and followed them for nine months after dispersal, recording the distance they moved from the mother plant. Plants that experienced more competition produced smaller seeds that dispersed farther from their mother plant. Larger seed diameter was previously shown to be'associated with greater competitive ability in D. californica. Thus the production of smaller seeds in more competitive environments implies a possible trade-off between competitive ability and dispersal arising from an environmentally driven aspect of phenotype. Fitness consequences of this trade-off in the context of the year-to-year variation in rainfall and density are uncertain.

  1. Review of Canadian species of the genera Gnathusa Fenyes, Mniusa Mulsant & Rey and Ocyusa Kraatz (Coleoptera, Staphylinidae, Aleocharinae).

    Science.gov (United States)

    Klimaszewski, Jan; Webster, Reginald P; Langor, David W; Bourdon, Caroline; Hammond, H E James; Pohl, Greg R; Godin, Benoit

    2014-01-01

    Four species of Gnathusa Fenyes (G. alfacaribou Klimaszewski & Langor, G. caribou Lohse, G. eva Fenyes, and G. tenuicornis Fenyes) occur in the Nearctic and in Canada. Three species of Ocyusa Kraatz (O. asperula Casey, O. californica Bernhauer, O. canadensis Lohse), and three species of Mniusa Mulsant and Ray (M. minutissima (Klimaszewski & Langor), M. yukonensis (Klimaszewski & Godin), and M. odelli Klimaszewski & Webster, sp. n.), are known from the Nearctic and all but O. californica occur in Canada. The recently described Gnathusa minutissima Klimaszewski and Langor and Ocyusa yukonensis Klimaszewski and Godin, are transferred here to the genus Mniusa Mulsant & Rey. New provincial and state records are reported for: G. eva (Alberta), G. tenuicornis (Alberta, Oregon, and New Brunswick), O. canadensis (New Brunswick and Newfoundland), M. minutissima (New Brunswick), and M. yukonensis (Nova Scotia, New Brunswick, Quebec, and British Columbia). The female of M. yukonensis was discovered and is illustrated for the first time. The genus Mniusa is reported for the first time from Canada and represents the first confirmed generic record for North America. Keys for identification of all Canadian species, images of body and genital structures, maps showing distribution mainly in Canada, and new bionomics data are provided.

  2. Functional consequences of structural differences in stingray sensory systems. Part I: mechanosensory lateral line canals.

    Science.gov (United States)

    Jordan, Laura K; Kajiura, Stephen M; Gordon, Malcolm S

    2009-10-01

    Short range hydrodynamic and electrosensory signals are important during final stages of prey capture in elasmobranchs (sharks, skates and rays), and may be particularly useful for dorso-ventrally flattened batoids with mouths hidden from their eyes. In stingrays, both the lateral line canal and electrosensory systems are highly modified and complex with significant differences on ventral surfaces that relate to feeding ecology. This study tests functional hypotheses based on quantified differences in sensory system morphology of three stingray species, Urobatis halleri, Myliobatis californica and Pteroplatytrygon violacea. Part I investigates the mechanosensory lateral line canal system whereas part II focuses on the electrosensory system. Stingray lateral line canals include both pored and non-pored sections and differ in branching complexity and distribution. A greater proportion of pored canals and high pore numbers were predicted to correspond to increased response to water flow. Behavioral experiments were performed to compare responses of stingrays to weak water jets mimicking signals produced by potential prey at velocities of 10-20 cm s(-1). Bat rays, M. californica, have the most complex and broadly distributed pored canal network and demonstrated both the highest response rate and greater response intensity to water jet signals. Results suggest that U. halleri and P. violacea may rely on additional sensory input, including tactile and visual cues, respectively, to initiate stronger feeding responses. These results suggest that stingray lateral line canal morphology can indicate detection capabilities through responsiveness to weak water jets.

  3. Chemical composition of inks of diverse marine molluscs suggests convergent chemical defenses.

    Science.gov (United States)

    Derby, Charles D; Kicklighter, Cynthia E; Johnson, P M; Zhang, Xu

    2007-05-01

    Some marine molluscs, notably sea hares, cuttlefish, squid, and octopus, release ink when attacked by predators. The sea hare Aplysia californica releases secretions from the ink gland and opaline gland that protect individuals from injury or death from predatory spiny lobsters through a combination of mechanisms that include chemical deterrence, sensory disruption, and phagomimicry. The latter two mechanisms are facilitated by millimolar concentrations of free amino acids (FAA) in sea hare ink and opaline, which stimulate the chemosensory systems of predators, ultimately leading to escape by sea hares. We hypothesize that other inking molluscs use sensory disruption and/or phagomimicry as a chemical defense. To investigate this, we examined concentrations of 21 FAA and ammonium in the defensive secretions of nine species of inking molluscs: three sea hares (Aplysia californica, Aplysia dactylomela, Aplysia juliana) and six cephalopods (cuttlefish: Sepia officinalis; squid: Loligo pealei, Lolliguncula brevis, Dosidicus gigas; octopus: Octopus vulgaris, Octopus bimaculoides). We found millimolar levels of total FAA and ammonium in these secretions, and the FAA in highest concentration were taurine, aspartic acid, glutamic acid, alanine, and lysine. Crustaceans and fish, which are major predators of these molluscs, have specific receptor systems for these FAA. Our chemical analysis supports the hypothesis that inking molluscs have the potential to use sensory disruption and/or phagomimicry as a chemical defense.

  4. Prices for Tobacco and Nontobacco Products in Pharmacies Versus Other Stores: Results From Retail Marketing Surveillance in California and in the United States.

    Science.gov (United States)

    Henriksen, Lisa; Schleicher, Nina C; Barker, Dianne C; Liu, Yawen; Chaloupka, Frank J

    2016-10-01

    To examine disparities in the price of tobacco and nontobacco products in pharmacies compared with other types of stores. We recorded the prices of Marlboro, Newport, the cheapest cigarettes, and bottled water in a random sample of licensed tobacco retailers (n = 579) in California in 2014. We collected comparable data from retailers (n = 2603) in school enrollment zones for representative samples of US 8th, 10th, and 12th graders in 2012. Ordinary least squares regressions modeled pretax prices as a function of store type and neighborhood demographics. In both studies, the cheapest cigarettes cost significantly less in pharmacies than other stores; the average estimated difference was $0.47 to $1.19 less in California. We observed similar patterns for premium-brand cigarettes. Conversely, bottled water cost significantly more in pharmacies than elsewhere. Newport cost less in areas with higher proportions of African Americans; other cigarette prices were related to neighborhood income and age. Neighborhood demographics were not related to water prices. Compared with other stores, pharmacies charged customers less for cigarettes and more for bottled water. State and local policies to promote tobacco-free pharmacies would eliminate an important source of discounted cigarettes.

  5. Rapid climatic signal propagation from source to sink in a southern California sediment-routing system

    Science.gov (United States)

    Covault, J.A.; Romans, B.W.; Fildani, A.; McGann, M.; Graham, S.A.

    2010-01-01

    Terrestrial source areas are linked to deep-sea basins by sediment-routing systems, which only recently have been studied with a holistic approach focused on terrestrial and submarine components and their interactions. Here we compare an extensive piston-core and radiocarbon-age data set from offshore southern California to contemporaneous Holocene climate proxies in order to test the hypothesis that climatic signals are rapidly propagated from source to sink in a spatially restricted sediment-routing system that includes the Santa Ana River drainage basin and the Newport deep-sea depositional system. Sediment cores demonstrate that variability in rates of Holocene deep-sea turbidite deposition is related to complex ocean-atmosphere interactions, including enhanced magnitude and frequency of the North American monsoon and El Ni??o-Southern Oscillation cycles, which increased precipitation and fluvial discharge in southern California. This relationship is evident because, unlike many sediment-routing systems, the Newport submarine canyon-and-channel system was consistently linked tothe Santa Ana River,which maintained sediment delivery even during Holocene marine transgression and highstand. Results of this study demonstrate the efficiency of sediment transport and delivery through a spatially restricted, consistently linked routing system and the potential utility of deep-sea turbidite depositional trends as paleoclimate proxies in such settings. ?? 2010 by The University of Chicago.

  6. Sorotipos de Salmonella isolados de processos entéricos humanos em Recife-Pernambuco, durante o triênio 1978-1980 Salmonella serotypes isolated from enteric human cases in Recife, Pernambuco State, Brazil, during 1978-1980

    Directory of Open Access Journals (Sweden)

    Nilma Cintra Leal

    1987-03-01

    Full Text Available De 13.196 coproculturas realizadas durante o triênio 1978-1980 em Recife, Pernambuco, foram isoladas 1.720 salmonelas, das quais 1.387 foram caracterizadas sorologicamente. O estudo global possibilitou o reconhecimento de 63 sorotipos concentrados em primeiro plano no grupo sorológico B (73,18% e identificando-se como tipos mais incidentes: S. typhimurium, S. saint-paul, S. poona, S. derby, S. agona, S. newport, S. oranienburg, S. infantis, S. tshiongwe e S. ndolo, que representaram 1.231 amostras ou 88,75% do total de isolamentos. Algumas considerações de ordem epidemiológica e bacteriológica são discutidas em relação aos quatros sorotipos mais freqüentes.From 13,196 faecal cultures made in Recife-Pernambuco during the period form 1978 to 1980, 1,720 strains of Salmonella were isolated. Serological typing on 1,387 of the isolates recognized 63 serotypes, 73,18% of which belonged to group B. The prevalent serotypes adding up to 1,231 strains (88,75% of the total of the isolats were: S. typhimurium, S. saint-paul, S. poona, S. derby, S. agona, S. newport, S. oraniengurg, S. infantis, S. tshiongwe and S. ndolo. Some epidemiological and bacteriological aspects are discussed regarding the four commonest serotypes.

  7. Identifying counterfeit cigarette packs using ultraviolet irradiation and light microscopy.

    Science.gov (United States)

    Kurti, Marin; He, Yi; von Lampe, Klaus; Li, Yanlei

    2017-01-01

    Develop a method that yields high rates of sensitivity and specificity for determination of counterfeit cigarette packs for three popular brands: Newport, Marlboro ('Red') and Marlboro Gold. Using systematic keyword searches, we identified industry documents from the University of California, San Francisco's Legacy Tobacco Documents Library that describe the use of ultraviolet (UV) irradiation and close examination of printing quality to distinguish between counterfeit and genuine cigarette packs. Guided by these documents, we identified six markers for counterfeit cigarettes across three popular brands using counterfeit cigarette packs (N=68) seized by law enforcement agencies in the USA. We assessed the diagnostic test accuracy of these markers and tested it against genuine packs (N=22) using receiver operating characteristic curves analysis. We find that counterfeit cigarette packs fluoresce to long-wave UV irradiation and display poor printing quality. The optimal cut-off value varies among the three brands. For example, counterfeit Newport and Marlboro packaging can be reliably classified with two of six characteristics, while Marlboro Gold requires four. Researchers who conduct littered pack and pack swap studies are urged to include this method to assess the share of counterfeit cigarettes, and compare the result against tobacco industry figures. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  8. Small drains, big problems: the impact of dry weather runoff on shoreline water quality at enclosed beaches.

    Science.gov (United States)

    Rippy, Megan A; Stein, Robert; Sanders, Brett F; Davis, Kristen; McLaughlin, Karen; Skinner, John F; Kappeler, John; Grant, Stanley B

    2014-12-16

    Enclosed beaches along urban coastlines are frequent hot spots of fecal indicator bacteria (FIB) pollution. In this paper we present field measurements and modeling studies aimed at evaluating the impact of small storm drains on FIB pollution at enclosed beaches in Newport Bay, the second largest tidal embayment in Southern California. Our results suggest that small drains have a disproportionate impact on enclosed beach water quality for five reasons: (1) dry weather surface flows (primarily from overirrigation of lawns and ornamental plants) harbor FIB at concentrations exceeding recreational water quality criteria; (2) small drains can trap dry weather runoff during high tide, and then release it in a bolus during the falling tide when drainpipe outlets are exposed; (3) nearshore turbulence is low (turbulent diffusivities approximately 10(-3) m(2) s(-1)), limiting dilution of FIB and other runoff-associated pollutants once they enter the bay; (4) once in the bay, runoff can form buoyant plumes that further limit vertical mixing and dilution; and (5) local winds can force buoyant runoff plumes back against the shoreline, where water depth is minimal and human contact likely. Outdoor water conservation and urban retrofits that minimize the volume of dry and wet weather runoff entering the local storm drain system may be the best option for improving beach water quality in Newport Bay and other urban-impacted enclosed beaches.

  9. A comparative study on the use of real time polymerase chain reaction (RT-PCR and standard isolation techniques for the detection of Salmonellae in broiler c

    Directory of Open Access Journals (Sweden)

    Waleed A. Ibrahim

    2014-06-01

    Full Text Available This study was carried out to compare between conventional cultural isolation methods and real time polymerase chain reaction (RT-PCR technique for the detection of Salmonella in broiler chicks. About 120 livers and intestinal contents samples were collected from 1800 day-old imported and local broiler chicks. The incidence of Salmonellae among imported chicks was 11.67% compared to 21.67% among local chicks using conventional cultural isolation methods. Salmonella newport (S. newport showed the highest incidence rate in imported chicks, while Salmonella enteritidis and Salmonella typhimurium were frequently detected in local chicks. The RT-PCR results for detection of invA gene of Salmonella spp. were 58.33% and 66.67% positive samples in imported and local chicks, respectively. Results have confirmed that RT-PCR technique is rapid, robust, effective and reliable method for detection of Salmonella spp. in broiler chicken when compared to conventional cultural methods. However, RT-PCR should be performed parallel with conventional methods for more accurate detection results of different Salmonellae serovars.

  10. Ecological prevalence, genetic diversity and epidemiological aspects of Salmonella isolated from tomato agricultural regions of the Virginia Eastern Shore

    Directory of Open Access Journals (Sweden)

    Rebecca L. Bell

    2015-05-01

    Full Text Available Virginia is the third largest producer of fresh-market tomatoes in the United States. Tomatoes grown along the eastern shore of Virginia are implicated almost yearly in Salmonella illnesses. Traceback implicates contamination occurring in the pre-harvest environment. To get a better understanding of the ecological niches of Salmonella in the tomato agricultural environment, a two-year study was undertaken at a regional agricultural research farm in Virginia. Environmental samples, including tomato (fruit, blossoms and leaves, irrigation water, surface water and sediment, were collected over the growing season. These samples were analyzed for the presence of Salmonella using modified FDA-BAM methods. Molecular assays were used to screen the samples. Over 1500 samples were tested. Seventy-five samples tested positive for Salmonella yielding over 230 isolates. The most commonly isolated serovars were S. Newport and S. Javiana with pulsed-field gel electrophoresis yielding 39 different patterns. Genetic diversity was further underscored among many other serotypes, which showed multiple PFGE subtypes. Whole genome sequencing of several S. Newport isolates collected in 2010 compared to clinical isolates associated with tomato consumption showed very few single nucleotide differences between environmental isolates and clinical isolates suggesting a source link to Salmonella contaminated tomatoes. Nearly all isolates collected during two growing seasons of surveillance were obtained from surface water and sediment sources pointing to these sites as long-term reservoirs for persistent and endemic contamination of this environment.

  11. Lipase production by yeasts from extra virgin olive oil.

    Science.gov (United States)

    Ciafardini, G; Zullo, B A; Iride, A

    2006-02-01

    Newly produced olive oil has an opalescent appearance due to the presence of solid particles and micro-drops of vegetation water from the fruits. Some of our recent microbiological research has shown that a rich micro-flora is present in the suspended fraction of the freshly produced olive oil capable of improving the quality of the oil through the hydrolysis of the oleuropein. Present research however has, for the first time, demonstrated the presence of lipase-positive yeasts in some samples of extra virgin olive oil which can lower the quality of the oil through the hydrolysis of the triglycerides. The tests performed with yeasts of our collection, previously isolated from olive oil, demonstrated that two lipase-producing yeast strains named Saccharomyces cerevisiae 1525 and Williopsis californica 1639 were able to hydrolyse different specific synthetic substrates represented by p-nitrophenyl stearate, 4-nitrophenyl palmitate, tripalmitin and triolein as well as olive oil triglycerides. The lipase activity in S. cerevisiae 1525 was confined to the whole cells, whereas in W. californica 1639 it was also detected in the extracellular fraction. The enzyme activity in both yeasts was influenced by the ratio of the aqueous to the organic phase reaching its maximum value in S. cerevisiae 1525 when the water added to the olive oil was present in a ratio of 0.25% (v/v), whereas in W. californica 1639 the optimal ratio was 1% (v/v). Furthermore, the free fatty acids of olive oil proved to be good inducers of lipase activity in both yeasts. The microbiological analysis carried out on commercial extra virgin olive oil, produced in four different geographic areas, demonstrated that the presence of lipase-producing yeast varied from zero to 56% of the total yeasts detected, according to the source of oil samples. The discovery of lipase-positive yeasts in some extra virgin olive oils leads us to believe that yeasts are able to contribute in a positive or negative way towards

  12. Cloning and Characterization of an Abalone (Haliotis discus hannai) Actin Gene

    Institute of Scientific and Technical Information of China (English)

    MA Hongming; XU Wei; MAI Kangsen; LIUFU Zhiguo; CHEN Hong

    2004-01-01

    An actin encoding gene was cloned by using RT-PCR, 3' RACE and 5' RACE from abalone Haliotis discus hannai. The full length of the gene is 1532 base pairs, which contains a long 3' untranslated region of 307 base pairs and 79 base pairs of 5' untranslated sequence. The open reading frame encodes 376 amino acid residues. Sequence comparison with those of human and other mollusks showed high conservation among species at amino acid level. The identities was 96%, 97% and 96% respectively compared with Aplysia californica, Biomphalaria glabrata and Homo sapience β-actin. It is also indicated that this actin is more similar to the human cytoplasmic actin(β-actin)than to human muscle actin.

  13. Phosphatase activity of Bombyx mori nucleopolyhedrovirus PTP is dispensable for enhanced locomotory activity in B. mori larvae.

    Science.gov (United States)

    Katsuma, Susumu

    2015-11-01

    Baculovirus-induced enhanced locomotory activity (ELA) is not induced in caterpillars infected with a mutant Bombyx mori nucleopolyhedrovirus (BmNPV) or Autographa californica multiple nucleopolyhedrovirus (AcMNPV) lacking a functional protein tyrosine phosphatase gene (ptp). Previous studies suggest that the PTP proteins from BmNPV and AcMNPV act in different ways to induce ELA, i.e., BmNPV PTP is utilized as a virion structural component, whereas AcMNPV PTP requires its phosphatase activity. Here, I generated and characterized two new BmNPV mutants expressing enzymatically inactive PTP proteins and confirmed that the phosphatase activity of PTP is not required for ELA induction in BmNPV-infected B. mori larvae.

  14. The influence of Aster x salignus Willd. Invasion on the diversity of soil yeast communities

    Science.gov (United States)

    Glushakova, A. M.; Kachalkin, A. V.; Chernov, I. Yu.

    2016-07-01

    The annual dynamics of yeast communities were studied in the soddy-podzolic soil under the thickets of Aster x salignus Willd., one of the widespread invasive plant species in central Russia. Yeast groups in the soils under continuous aster thickets were found to differ greatly from the yeast communities in the soils under the adjacent indigenous meadow vegetation. In both biotopes the same species ( Candida vartiovaarae, Candida sake, and Cryptococcus terreus) are dominants. However, in the soils under indigenous grasses, eurybiontic yeasts Rhodotorula mucilaginosa, which almost never occur in the soil under aster, are widespread. In the soil under aster, the shares of other typical epiphytic and pedobiontic yeast fungi (ascomycetic species Wickerhamomyces aniomalus, Barnettozyma californica and basidiomycetic species Cystofilobasidium macerans, Guehomyces pullulans) significantly increase. Thus, the invasion of Aster x salignus has a clear effect on soil yeast complexes reducing their taxonomic and ecological diversity.

  15. Small estuarine fishes feed on large trematode cercariae: Lab and field investigations

    Science.gov (United States)

    Kaplan, A.T.; Rebhal, S.; Lafferty, K.D.; Kuris, A.M.

    2009-01-01

    In aquatic ecosystems, dense populations of snails can shed millions of digenean trematode cercariae every day. These short-lived, free-living larvae are rich in energy and present a potential resource for consumers. We investigated whether estuarine fishes eat cercariae shed by trematodes of the estuarine snail Cerithidea californica. In aquaria we presented cercariae from 10 native trematode species to 6 species of native estuarine fishes. Many of these fishes readily engorged on cercariae. To determine if fishes ate cercariae in the field, we collected the most common fish species, Fundulus parvipinnis (California killifish), from shallow water on rising tides when snails shed cercariae. Of 61 killifish, 3 had recognizable cercariae in their gut. Because cercariae are common in this estuary, they could be frequent sources of energy for small fishes. In turn, predation on cercariae by fishes (and other predators) could also reduce the transmission success of trematodes. ?? 2009 American Society of Parasitologists.

  16. Development of a novel baculovirus titration method using the Enzyme-linked immunosorbent spot (ELISPOT) assay.

    Science.gov (United States)

    Wang, Wei; Cheng, Tong; Ma, Ke; Xia, Dezhen; Wang, Yongmei; Liu, Jian; Du, Hailian; Shih, James Wai Kuo; Zhang, Jun; Zhao, Qinjian; Xia, Ningshao

    2013-03-01

    The baculovirus expression vector system (BEVS) is one of the most powerful methods for production of recombinant proteins for research or commercial purposes. Titration of viable virus in insect cell culture is often required when BEVS is used for basic research or bioprocessing. An enzyme-linked immunosorbent spot (ELISPOT) assay using monoclonal antibodies against the major capsid protein VP39 of both Autographa californica nuclear polyhedrosis virus (AcMNPV) and Bombyx mori nuclear polyhedrosis virus (BmNPV) was developed for baculovirus quantitation at 48h post-infection. The titer was determined by visualizing infected insect cells as blue spots and automated spot counting was achieved with ELISPOT hardware and software. Log-scale comparison of the results between the ELISPOT assay and a conventional end point dilution assay using a fluorescent marker showed a good correlation for both AcMNPV (R(2)=0.9980, pspot counting.

  17. The serrate leaf margined Juniperus (Section Sabina) of the western hemisphere: systematics and evolution based on leaf essential oils and Random Amplified Polymorphic DNAs (RAPDs).

    Science.gov (United States)

    Adams

    2000-12-01

    The volatile leaf essential compositions of all 17 serrate leaf margin species of Juniperus (sect. Sabina) of the western hemisphere are reported and compared: J. angosturana, J. ashei, J. californica, J. coahuilensis, J. comitana, J. deppeana, J. durangensis, J. flaccida, J. gamboana, J. jaliscana, J. monosperma, J. monticola, J. osteosperma, J. occidentalis, J. pinchotii, J. saltillensis, and J. standleyi. A number of previously unidentified compounds of the leaf essential oils have now been identified. In addition, DNA data (RAPDs) of all these species were analyzed. Both the leaf essential oils and DNA show these species to be quite distinct with few apparent subgroups, such that the species groupings were not strong in either data set. These data support the hypothesis that this group of junipers originated in Mexico as part of the Madro-Tertiary flora by rapid radiation into new arid land habitats, leaving few extant intermediate taxa.

  18. AcEST: DK955788 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Oryza sati... 67 6e-11 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus G... 66 1e-10 sp|Q9ZT4...848_DICDI Probable serine/threonine-protein kinase D... 65 3e-10 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmi...p|P41823|SY65_APLCA Synaptotagmin-1 OS=Aplysia californica GN=S... 60 7e-09 sp|Q5M7N9|ESYT3_XENTR Extended s...ynaptotagmin-3 OS=Xenopus tropic... 60 7e-09 sp|Q7ZWU7|EST2B_XENLA Extended synaptotagmin-2-B OS=Xenopus lae...v... 60 9e-09 sp|Q5FWL4|EST2A_XENLA Extended synaptotagmin-2-A OS=Xenopus laev... 60 9e-09 sp|P48231|TCB2_YE

  19. AcEST: DK956209 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 5_APLCA Synaptotagmin-1 OS=Aplysia californica GN=S... 73 1e-12 sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin...-2 OS=Mus musculus G... 73 1e-12 sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 O...Y62_DISOM Synaptotagmin-B OS=Discopyge ommata GN=P65-... 63 1e-09 sp|A0FGR9|ESYT3_HUMAN Extended synaptotagm...-LDIHVFDQEKHGSDEAMG 299 +P + L I V D ++ G+ E +G Sbjct: 361 VPFEQIQKVTLIITVVDYDRIGTSEPIG 388 >sp|Q3TZZ7|ESYT2_MOUSE Extended...+ E+ I+LFD+D Sbjct: 355 KENLSPKWNEVYEALVYEHPGQELEIELFDED 386 >sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2

  20. AcEST: DK954129 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=Oryza sati... 86 1e-16 sp|P41823|SY65_APLCA Synaptotagmin-1 OS=Aplysia californica GN=S... 72 2e-12 sp|Q3TZZ7|ESYT2_MOUSE Extende...d synaptotagmin-2 OS=Mus musculus G... 67 5e-11 sp|A0FGR8|ESYT2_HUMAN Extended syna...s mus... 62 2e-09 sp|Q9ZT47|PP16A_CUCMA 16 kDa phloem protein 1 OS=Cucurbita maxim... 62 2e-09 sp|Q5RAG2|ESYT1_PONAB Extended... synaptotagmin-1 OS=Pongo abelii G... 62 3e-09 sp|Q9Z1X1|ESYT1_RAT Extended synaptotagmin-1... OS=Rattus norvegicu... 61 4e-09 sp|Q9BSJ8|ESYT1_HUMAN Extended synaptotagmin-1 O