WorldWideScience

Sample records for psych 7a intro

  1. Instant IntroJs

    CERN Document Server

    Arasteh, Ehsan

    2013-01-01

    Get to grips with a new technology, understand what it is and what it can do for you, and then get to work with the most important features and tasks. A simple starter that will guide you through IntroJs from scratch to advanced topics using a simple step by step approach with useful examples along the way.This book is for web designers who want to create an interactive step-by-step introduction for showing specific or all parts of an application or website to users. Basic JavaScript programming and knowledge of HTML and CSS is required. No knowledge of any other JavaScript libraries is needed

  2. The Psyche as Behavior

    Directory of Open Access Journals (Sweden)

    ARTURO CLAVIJO A.

    2013-12-01

    Full Text Available Behaviorism has argued that behavior is the Psyche and the subject matter of psychology. Although, some scientists had done empirical work with objective methods before 1913, the year in which John B. Watson published his manifesto, he was the first one to attempt a systematization of behavior as the Psyche, that is, as psychology’s subject matter. In this text, I outline Watson’s notion of behavior to compare it with two other forms of behaviorism: Skinner’s radical behaviorism and molar behaviorism. The purpose of the paper is to illustrate how the concept of behavior has been and is changing.

  3. Inventing the Hispanic Psyche.

    Science.gov (United States)

    Stavans, Ilan

    1992-01-01

    Many Latin American authors have undertaken cultural criticism designed to explain the psyche of the Hispanic countries. Carlos Fuentes, in "The Buried Mirror: Reflections on Spain and the New World," presents another example of the obsessive need to interpret Latin America to the rest of the world. (SLD)

  4. A protocol for psych verbs

    Directory of Open Access Journals (Sweden)

    Giuliana Giusti

    2016-11-01

    Full Text Available So-called psychological verbs such as Italian temere ‘fear’, preoccupare ‘worry’, and piacere ‘like’ present an extremely varied argument structure across languages, that arranges these two roles in apparently opposite hierarchies and assigns them different grammatical functions (subject, direct, indirect and prepositional objects. This paper wants to provide a descriptively adequate classification of such verbs in Latin and Italian to serve future analyses irrespective of their theoretical persuasion. We individuate six classes in Italian and seven classes in Latin, which comply with Belletti and Rizzi’s (1988 original analysis of psych verbs and focus on the three less studied classes, namely unaccusatives, unergatives and impersonals. We show that diachronic variation and apparent intra-language idiosyncrasies are due to the fact that these classes are universally available to all psych roots. The presentation is set in a protocol fashion in the sense of Giusti and Zegrean (2015 and Di Caro and Giusti (2015.

  5. Dynamic malware analysis using IntroVirt: a modified hypervisor-based system

    Science.gov (United States)

    White, Joshua S.; Pape, Stephen R.; Meily, Adam T.; Gloo, Richard M.

    2013-05-01

    In this paper, we present a system for Dynamic Malware Analysis which incorporates the use of IntroVirt™. IntroVirt is an introspective hypervisor architecture and infrastructure that supports advanced analysis techniques for stealth-malwareanalysis. This system allows for complete guest monitoring and interaction, including the manipulation and blocking of system calls. IntroVirt is capable of bypassing virtual machine detection capabilities of even the most sophisticated malware, by spoofing returns to system call responses. Additional fuzzing capabilities can be employed to detect both malware vulnerabilities and polymorphism.

  6. 3-µm Spectroscopy of Asteroid 16 Psyche

    Science.gov (United States)

    Takir, Driss; Reddy, Vishnu; Sanchez, Juan; Shepard, Michael K.

    2016-10-01

    Asteroid 16 Psyche, an M-type asteroid, is thought to be one of the most massive exposed iron metal object in the asteroid belt. The high radar albedos of Psyche suggest that this differentiated asteroid is dominantly composed of metal. Psyche was previously found to be featureless in the 3-µm spectral region. However, in our study we found that this asteroid exhibits a 3-µm absorption feature, possibly indicating the presence of hydrated silicates.We have observed Psyche in the 3-µm spectral region, using the long-wavelength cross-dispersed (LXD:1.9-4.2 µm) mode of the SpeX spectrograph/imager at the NASA Infrared Telescope Facility (IRTF). For data reduction, we used the IDL (Interactive Data Language)-based spectral reduction tool Spextool (v4.1). Psyche was observed over the course of three nights with an apparent visual magnitude of ~9.50: 8 December 2015 (3 sets), 9 December 2015 (1 set), and 10 March 2016 (1 set). These observations have revealed that Psyche may exhibit a 3-µm absorption feature, similar to the sharp group in the 2.9-3.3-µm spectral range. Psyche also exhibits an absorption feature similar to the one in Ceres and Ceres-like group in the spectral 3.3-4.0-µm range. These 3-µm observational results revealed that Psyche may not be as featureless as once thought in the 3-µm spectral region.Evidence for the 3-µm band was found on the surfaces of many M-type asteroids and a number of plausible alternative interpretations for the presence of this 3-µm band were previously suggested. These interpretations include the presence of anhydrous silicates containing structural OH, the presence of fluid inclusions, the presence of xenolithic hydrous meteorite components on asteroid surfaces from impacts, solar wind-implanted H, or the presence of troilite. The detection of the Ceres-like feature in the 3.3-4.0-µm spectral range, however, would rule out some of these alternative interpretations, especially the solar wind-implanted H.

  7. Psyche: The Science of a Metal World

    Science.gov (United States)

    Elkins-Tanton, L. T.

    2016-12-01

    (16) Psyche is a large metallic asteroid orbiting in the outer main belt at 3 AU. Psyche's metal composition is indicated by high radar albedo, thermal inertia, and density. Models show that among the accretionary collisions early in the solar system, some destructive "hit and run" impacts could strip the silicate mantle from differentiated bodies. This is the leading hypothesis for Psyche's formation: it is a bare planetesimal core. It is the only one we can explore for substantial information about a metal core (other metallic asteroids are far smaller and not roughly spherical). If our observations indicate that it is not a core, Psyche may instead be highly reduced, primordial metal-rich materials that accreted closer to the Sun, and never melted. Psyche is also a Discovery-class mission, selected for a Step 2 concept study, to investigate this metal body. The Psyche investigation has three broad goals: Understand a previously unexplored building block of planet formation: iron cores. Look inside the terrestrial planets, including Earth, by directly examining the interior of a differentiated body, which otherwise could not be seen. Explore a new type of world. For the first time, examine a world made not of rock, ice, or gas, but of metal. We will meet our science objectives with three domestic high heritage instruments and radio science: Multispectral imagers with clear and seven color filters map surface morphology and reveal the distribution of residual mantle silicates. A gamma-ray and neutron spectrometer determines elemental composition, particularly the concentrations of iron, nickel, silicon, and potassium. Dual fluxgate magnetometers, in a gradiometer configuration, characterize the magnetic field. Radio science maps the gravity field sufficiently to differentiate among core-formation hypotheses. New models for magnetic dynamo generation and solidification of planetesimal cores make testable predictions for geophysical measurements, and lead as well to

  8. 'Psyching-up' and muscular force production.

    Science.gov (United States)

    Tod, David; Iredale, Fiona; Gill, Nicholas

    2003-01-01

    Psyching-up refers to self-directed cognitive strategies used immediately prior to or during skill execution that are designed to enhance performance. This review focuses on research that has investigated the effect of psyching-up on force production; specifically, strength, muscular endurance and power. Although firm conclusions are not possible, the research tentatively suggests that psyching-up may enhance performance during dynamic tasks requiring strength and/or muscular endurance. However, more research is required. Power has received scant empirical attention and there are not enough data to support any conclusions. Preparatory arousal appears to be the most effective strategy although other strategies like imagery, self-talk and attentional focus also have empirical support. The range of tasks that have been used to measure force production have been limited to movements such as handgrip, leg extension, bench press, sit-ups, press-ups, pull-ups, and the standing broad jump. Additionally, most studies have used undergraduate and/or untrained samples. Only a very small number of studies have examined well-trained individuals. Currently, no explanation for why psyching-up may influence force production has any substantive support. Although a small number of studies have examined moderating and mediating variables, few consistent patterns have emerged and knowledge in this area is somewhat restricted. Given the importance that many athletes place on their mental preparation just prior to performance this is an area that warrants further examination. Research needs to examine a range of complex sport-specific tasks and use well-trained samples. Additionally, research needs to further examine why psyching-up may enhance force production.

  9. Psych-education major students’ profile

    Directory of Open Access Journals (Sweden)

    Maria Regina Peres

    2014-01-01

    Full Text Available Among our post-graduate courses, Psych-Education demand has grown in the last few years. Little is known about the professionals who seek these courses. A research was done on a group of 251 new students in the Psych-Education Graduate course from 2005 to 2012, with the expectation of understanding the students profile and objectives. A questionnaire was provided to discover their major area of study in their Bachelor’s degree, work experience, and future aspirations. The results indicated that most students were Education majors who work now in the teaching profession with the objective of obtaining more professional training. It was concluded that these professionals are seeking alternative methods of teaching that will enhance the educational field.

  10. The iPSYCH2012 case-cohort sample

    DEFF Research Database (Denmark)

    Pedersen, C B; Bybjerg-Grauholm, J; Pedersen, M G

    2017-01-01

    The Integrative Psychiatric Research (iPSYCH) consortium has established a large Danish population-based Case-Cohort sample (iPSYCH2012) aimed at unravelling the genetic and environmental architecture of severe mental disorders. The iPSYCH2012 sample is nested within the entire Danish population ...

  11. The iPSYCH2012 case-cohort sample

    DEFF Research Database (Denmark)

    Pedersen, C B; Bybjerg-Grauholm, J; Pedersen, M G

    2018-01-01

    The Integrative Psychiatric Research (iPSYCH) consortium has established a large Danish population-based Case-Cohort sample (iPSYCH2012) aimed at unravelling the genetic and environmental architecture of severe mental disorders. The iPSYCH2012 sample is nested within the entire Danish population ...

  12. Graduating from the University of Psych

    National Research Council Canada - National Science Library

    Miller, Geordie

    2014-01-01

    ... Professorship just opened up-at The University of Psych!" The joke picks up again in the following season, when Lisa wins tickets to see an Albanian film called Kosovo Autumn. As they exit the theatre, Bart announces that he "was so bored [he] cut the ponytail off the guy sitting in front of [them]. 'Look at me. I'm a grad student,' " Bart pantomime...

  13. [Ethos, psyche, soma. Medicine and its mutations].

    Science.gov (United States)

    Lolas Stepke, F

    1995-09-01

    In this paper, understood as a contribution to a theoretical pathology, the necessity and urgency of a medical metatheory are explained on the basis of intensive and extensive developments of medical knowledge. These developments have extended beyond the limits of medicine modelled after the experimental and clinical paradigms, making it imperative to include the social and valoric dimensions within medicine and not as an addition to its traditional goals. The metamedicine so created, it is suggested, should develop a dialogic model in which, without having to postulate isomorphisms or correlations, the dilemmas posed by ethos, psyche and soma are confronted as discourses of a human science.

  14. Soul, butterfly, mythological nymph: psyche in philosophy and neuroscience.

    Science.gov (United States)

    Antonakou, Elena I; Triarhou, Lazaros C

    2017-03-01

    The term "psyche" and its derivatives - including "Psychology" and "Psychiatry" - are rooted in classical philosophy and in mythology. Over the centuries, psyche has been the subject of discourse and contemplation, and of fable; it has also come to signify, in entomology, the order of Lepidoptera. In the current surge of research on brain and mind, there is a gradual transition from the psyche (or the "soul") to the specified descriptors defined by the fields of Behavioral, Cognitive and Integrative Neuroscience.

  15. Psych-related iPhone apps.

    Science.gov (United States)

    Harrison, Anthony Mark; Goozee, Rhianna

    2014-02-01

    iPhone apps are a widely utilised technology that have recently been identified as a useful medium for health research, clinical interventions and education. While some researchers have discussed advances in app technology, others promote specific apps that are not free to access. To our knowledge, no study has conducted a review of current, free iPhone apps related to psychology, psychiatry and mental health. Therefore, we conducted a pilot, web-based review exploring free iPhone apps using a replicable search strategy within the iTunes Store search function. A selection of apps were selected and subjectively assessed in terms of their usability, utility, graphics, and associated costs for the consumer. We concluded that the apps reviewed, though novel, are limited in their scope and utility. We also note a significant gap in more scientific, evidence-based app technology, and pose some pertinent ethical questions when developing future psych-related apps.

  16. Reciprocal Pronouns Binding within Psych-Verb Constructions

    Science.gov (United States)

    Epoge, Napoleon

    2015-01-01

    This paper aims at giving an analysis of certain syntactic peculiarities of reciprocal pronouns within verbs of psychological state, commonly known as psych-verbs. The analysis reveal that psych-verbs constructions have a peculiar property in that the binding conditions of reciprocal pronouns are satisfied in Experiencer-Subject (ES) psychverbs…

  17. The interpretation of nature and the psyche

    CERN Document Server

    Jung, Carl Gustav

    2012-01-01

    Carl Gustav Jung (1875-1961) and Wolfgang Ernst Pauli (1900 – 1958) were two of the greatest thinkers of modern times. Jung is the founder of Analytical Psychology and is one of the best known researchers in the field of Dream Interpretation and Symbolization. Pauli was one of the pioneers of Quantum Physics. In 1945, Pauli received the Nobel Prize in Physics after being nominated by Albert Einstein for his “decisive contribution through his discovery of a new law of Nature, the exclusion principle” involving spin theory underpinning the structure of matter and the whole of chemistry. Together they collaborated on this book that was First published in 1952 in German as Naturerklärung und Psyche. C. G. Jung: Synchronizität als ein Prinzip akausaler Zusammenhänge. W. Pauli: Der Einfluss archetypischer Vorstellungen auf die Bildung naturwissenschaftlicher Theorien bei Kepler. However, our reviewer, himself an eminent professor of mathematics, concludes, “After thoroughly studying their writings for ma...

  18. Reciprocal Pronouns Binding within Psych-verb Constructions

    Directory of Open Access Journals (Sweden)

    Napoleon Epoge

    2015-04-01

    Full Text Available This paper aims at giving an analysis of certain syntactic peculiarities of reciprocal pronouns within verbs of psychological state, commonly known as psych-verbs. The analysis reveal that psych-verbs constructions have a peculiar property in that the binding conditions of reciprocal pronouns are satisfied in Experiencer-Subject (ES psych-verbs constructions but are not in the Experiencer-Object (EO at the surface level; though the latter constructions are grammatical. However, the paper argues that though binding conditions are not satisfied in EO psych-verb constructions at the surface level, they are satisfied in the deep structure (D-structure construction wherein the reciprocal pronoun, in the theme argument, is bound by a c-commanding Experiencer argument. By so doing, it satisfies binding condition A which holds that a reciprocal pronoun must be bound by an appropriate c-command antecedent. This analysis shows that reciprocal binding in Experiencer-Object psych-verb constructions, at the D-structure, does not reflect the linear order in the thematic hierarchy as proposed by Grimshaw (1990 and the psych-verb in EO D-structure construction is construed as one with two internal arguments. Keywords: antecedent, binding theory, D-structure, psych-verb, reciprocal pronoun, S-structure

  19. Foundations of educational psychology: Howard Gardner's neoclassical psyche.

    Science.gov (United States)

    Diessner, R

    2001-12-01

    This article is a theoretical examination of the implications of Howard Gardner's work in developmental and educational psychology (1983, 1993, 1999a, 1999b) for the structure of the psyche. The author accepts as axiomatic, in the context of this article, Gardner's educational manifesto (1999a) that all students should be taught disciplinary understandings of truth, beauty, and goodness. Rational inferences are then made indicating that the psyche that Gardner intends to educate and help develop is in the form of a neoclassical psyche and that it is structured by the capacities to know truth, to love beauty, and to will goodness.

  20. The iPSYCH2012 case-cohort sample

    DEFF Research Database (Denmark)

    Pedersen, C B; Bybjerg-Grauholm, J; Pedersen, M G

    2017-01-01

    The Integrative Psychiatric Research (iPSYCH) consortium has established a large Danish population-based Case-Cohort sample (iPSYCH2012) aimed at unravelling the genetic and environmental architecture of severe mental disorders. The iPSYCH2012 sample is nested within the entire Danish population...... born between 1981 and 2005, including 1 472 762 persons. This paper introduces the iPSYCH2012 sample and outlines key future research directions. Cases were identified as persons with schizophrenia (N=3540), autism (N=16 146), attention-deficit/hyperactivity disorder (N=18 726) and affective disorder...... (N=26 380), of which 1928 had bipolar affective disorder. Controls were randomly sampled individuals (N=30 000). Within the sample of 86 189 individuals, a total of 57 377 individuals had at least one major mental disorder. DNA was extracted from the neonatal dried blood spot samples obtained from...

  1. The iPSYCH2012 case-cohort sample

    DEFF Research Database (Denmark)

    Pedersen, C B; Bybjerg-Grauholm, J; Pedersen, M G

    2017-01-01

    The Integrative Psychiatric Research (iPSYCH) consortium has established a large Danish population-based Case-Cohort sample (iPSYCH2012) aimed at unravelling the genetic and environmental architecture of severe mental disorders. The iPSYCH2012 sample is nested within the entire Danish population...... (N=26 380), of which 1928 had bipolar affective disorder. Controls were randomly sampled individuals (N=30 000). Within the sample of 86 189 individuals, a total of 57 377 individuals had at least one major mental disorder. DNA was extracted from the neonatal dried blood spot samples obtained from...... the Danish Neonatal Screening Biobank and genotyped using the Illumina PsychChip. Genotyping was successful for 90% of the sample. The assessments of exome sequencing, methylation profiling, metabolome profiling, vitamin-D, inflammatory and neurotrophic factors are in progress. For each individual, the i...

  2. Soul and psyche: The Bible in psychological perspective

    Directory of Open Access Journals (Sweden)

    Willem J. Smith

    2004-10-01

    Full Text Available During the last third of the twentieth century a discipline that applies psychological and psychoanalytic insight to the study of the Bible, has resurfaced within biblical studies. In his book, Soul and Psyche, Wayne Rollins offers a psychological biblical approach as one of the new approaches to Scripture since the 1960’s. This approach tends to bring a renewed appreciation for the role of the human psyche or soul in the history of the Bible and its interpretation.

  3. Soul and psyche: The Bible in psychological perspective

    Directory of Open Access Journals (Sweden)

    Willem J. Smith

    2004-11-01

    Full Text Available During the last third of the twentieth century a discipline that applies psychological and psychoanalytic insight to the study of the Bible, has resurfaced within biblical studies. In his book, Soul and Psyche, Wayne Rollins offers a psychological biblical approach as one of the new approaches to Scripture since the 1960’s. This approach tends to bring a renewed appreciation for the role of the human psyche or soul in the history of the Bible and its interpretation.

  4. Media psychology: Modern man and nonlocality of psyche.

    Directory of Open Access Journals (Sweden)

    Pronina E.E.

    2014-12-01

    Full Text Available The development of modern information technologies is causing changes in the structure of the human psyche, bringing about a new psychotype. The transition to a new level of evolution is accompanied by the growing manifestation of the psyche’s ontological features — nonlocality and self-determination. From a sample of more than 300 people, it was demonstrated that active Internet users are significantly different in a number of parameters from those who mostly use traditional media. This article examines the resources of media psychology as a new paradigm in the study of mass communication phenomena and the laws of the development of psyche.

  5. Soul, butterfly, mythological nymph: psyche in philosophy and neuroscience

    Directory of Open Access Journals (Sweden)

    Elena I. Antonakou

    Full Text Available ABSTRACT The term “psyche” and its derivatives – including “Psychology” and “Psychiatry” – are rooted in classical philosophy and in mythology. Over the centuries, psyche has been the subject of discourse and contemplation, and of fable; it has also come to signify, in entomology, the order of Lepidoptera. In the current surge of research on brain and mind, there is a gradual transition from the psyche (or the “soul” to the specified descriptors defined by the fields of Behavioral, Cognitive and Integrative Neuroscience.

  6. Brainwaves and psyches : A genealogy of an extended self

    NARCIS (Netherlands)

    Brenninkmeijer, Jonna

    This article presents an ethnographical and historical analysis of the mode of being that is constituted when people use neurofeedback (brainwave training) for self-improvement. I analyse how human brainwaves have been associated with the psyche since their first demonstration by the psychiatrist

  7. Radar observations and shape model of asteroid 16 Psyche

    Science.gov (United States)

    Shepard, Michael K.; Richardson, James; Taylor, Patrick A.; Rodriguez-Ford, Linda A.; Conrad, Al; de Pater, Imke; Adamkovics, Mate; de Kleer, Katherine; Males, Jared R.; Morzinski, Katie M.; Close, Laird M.; Kaasalainen, Mikko; Viikinkoski, Matti; Timerson, Bradley; Reddy, Vishnu; Magri, Christopher; Nolan, Michael C.; Howell, Ellen S.; Benner, Lance A. M.; Giorgini, Jon D.; Warner, Brian D.; Harris, Alan W.

    2017-01-01

    Using the S-band radar at Arecibo Observatory, we observed 16 Psyche, the largest M-class asteroid in the main belt. We obtained 18 radar imaging and 6 continuous wave runs in November and December 2015, and combined these with 16 continuous wave runs from 2005 and 6 recent adaptive-optics (AO) images (Drummond et al., 2016) to generate a three-dimensional shape model of Psyche. Our model is consistent with a previously published AO image (Hanus et al., 2013) and three multi-chord occultations. Our shape model has dimensions 279 × 232 × 189 km (± 10%), Deff = 226 ± 23 km, and is 6% larger than, but within the uncertainties of, the most recently published size and shape model generated from the inversion of lightcurves (Hanus et al., 2013). Psyche is roughly ellipsoidal but displays a mass-deficit over a region spanning 90° of longitude. There is also evidence for two ∼50-70 km wide depressions near its south pole. Our size and published masses lead to an overall bulk density estimate of 4500 ± 1400 kgm-3. Psyche's mean radar albedo of 0.37 ± 0.09 is consistent with a near-surface regolith composed largely of iron-nickel and ∼40% porosity. Its radar reflectivity varies by a factor of 1.6 as the asteroid rotates, suggesting global variations in metal abundance or bulk density in the near surface. The variations in radar albedo appear to correlate with large and small-scale shape features. Our size and Psyche's published absolute magnitude lead to an optical albedo of pv = 0.15 ± 0.03, and there is evidence for albedo variegations that correlate with shape features.

  8. The grotesque female in Malaysian poems: shaping the migrant's psyche.

    Science.gov (United States)

    DMani, Sheba

    2011-12-01

    The works of Malaysian poet, Wong Phui Nam's Against the Wilderness (vii) China bride and Variations on a Birthday Theme (iv) Kali, illustrate a bride and a mother in terrifying images. Wong's stylistic form of representing the female body through startling images of inversion and degradation evoke feelings of unease. The suspension between the known and the unknown causes a bewildering reality verging on madness. Interpreted through the lens of the carnivalesque, specifically, the grotesque body, festive language and parody, I attempt to reconstruct the psyche of the Chinese migrant which underpins these poems. The migrant who arrived in Malaya during the colonial era in the early nineteenth century faced political and social struggles in adapting to a new land. In the poems, the migrant juxtaposes his position to a female and uses the female body as a site of contention to intensify the torment of the psyche and to reflect the despair of the Chinese in Malaysia.

  9. 'Psych ed' helps speed throughput time by 9%.

    Science.gov (United States)

    2006-02-01

    Adequate staffing, proper location, and design of psychiatric ED services area are critical to successful implementation. One ED cut average throughput time by 9%. Have mental health workers available to determine the level of care each patient needs. Have your psych area set apart from the main ED to avoid excessive noise and confusion. Have a minimal amount of equipment in the rooms so that patients cannot harm themselves.

  10. New psych unit eases patient burden in ED.

    Science.gov (United States)

    2008-06-01

    Creating a special unit for psychiatric patients frees up beds in your ED, ensures better care for that patient population, and improves the atmosphere in the main department for the rest of your patients. Consider these suggestions: The creation of a psych unit can be extremely costly. Be prepared to demonstrate projected savings when pitching the idea to administration. Make sure an ED physician has overall responsibility for each patient at all times. Keep a regular group of nurses in rotation. This setup will help ensure smooth handoffs.

  11. Beyond the Mind: Cultural Dynamics of the Psyche

    DEFF Research Database (Denmark)

    Marsico, Giuseppina; Valsiner, Jaan

    This book Beyond the Mind: Cultural Dynamics of the Psyche is unusual in the content and it the format. That’s why it requires an unusual look. It has to do with a man, an intellectual journey and with uncountable travels across the world over the last two decades. This man is Jaan Valsiner...... and here you will read of his restless effort of elaborating ideas while going in different places as invited keynote. This book is mainly about his intellectual trajectory, which touches several places and several and interconnected topics. He lives travelling in the mind and in the physical world...... of new ideas, theories, models and even schemas....

  12. Oncological translational research in the Spanish national health system: the INTRO study.

    Science.gov (United States)

    Caballero, C; Jantus-Lewintre, E; Carrato, A; García-Foncillas, J; Gascón, P; Blasco, A; Moreno-Nogueira, J A; Guillem, V; López, R; Codes, M; Antón, A; Díaz-Rubio, E; Camps, C

    2014-08-01

    Under the auspices of the Foundation for Excellence and Quality in Oncology (ECO), the Translational Research in Oncology Medical Services Study (INTRO) was conducted with the aim of describing the current state of, and future expectations for translational cancer research in Spanish medical centres. The first step in the investigation was intended to analyse the current condition of the national Medical Oncology Services network by examining different aspects of the oncology research field. A descriptive and observational multicentre study was performed at a statewide level; information was collected by surveying a cross-section of all those responsible for Medical Oncology Services in Spain. The survey was completed by key informants, who were selected independently by each service, between September 2010 and April 2011. We were able to gather comprehensive data from a total of 27 Spanish hospitals. These data enabled us to describe the allocation of human and material resources devoted to clinical and translational research across the Medical Oncology Services and to describe the organisational and functional components of these services and units. These data included information pertaining to the activities developed, their funding sources, and their functional dependence on other internal or external bodies. Finally, we explored the degree of dissemination and use of some specific techniques used for the genetic diagnosis of cancer, which have recently been introduced in Medical Oncology within the Spanish healthcare system. A wide range of variability exists between different oncology services in Spanish hospitals. Time should be spent reflecting on the need and opportunities for improvement in the development of translational research within the field of oncology.

  13. Psych verb production and comprehension in agrammatic Broca's aphasia.

    Science.gov (United States)

    Thompson, Cynthia K; Lee, Miseon

    2009-07-01

    This study examined the factors that affect agrammatic sentence production by testing eight agrammatic aphasic participants' comprehension and production of active and passive sentences using two types of English psych verbs, those with an Experiencer-marked subject (Subject-Experiencer (SubExp)) and those with an Experiencer-marked object (Object-Experiencer (ObjExp)). The Argument Structure Complexity Hypothesis (ASCH, [J. Neuroling. 16 (2003) 151]) posits that the verb (and sentence) production difficulties observed in agrammatic aphasia can be attributed, at least in part, to the argument structure properties of verbs, with verbs that are marked for more complex argument structure (in terms of the number and type of arguments) presenting greater difficulty than those with less complex argument structure entries. Based on previous linguistic analyses of psych verbs, ObjExp psych verbs are more complex than SubjExp verbs. Therefore, we predicted that the former would present greater production (but not comprehension) difficulty than the latter. Results showed above chance comprehension of all sentence types, with the exception of SubjExp passive constructions, in which the subject position is occupied by a non-Experiencer argument. In active sentence production, ObjExp verbs were more impaired than SubjExp verbs. However, the opposite pattern was noted for passive sentence production. While all participants had difficulty producing passive sentences of both types, they showed better performance on ObjExp verbs, as compared to SubjExp verbs, in which the Experiencer is in the subject position. Further, agrammatic aphasic speakers showed a preference for producing actives for SubjExp verbs and passives for ObjExp verbs, indicating that the thematic role requirements of selected verbs (e.g., Experiencer, Theme) influence production patterns, as they do in normal speakers. These data, as well as the error patterns seen in our patients, support the ASCH and suggest

  14. The I Ching and the psyche-body connection.

    Science.gov (United States)

    Ma, Shirley S Y

    2005-04-01

    Carl G. Jung's fateful meeting with Richard Wilhelm in 1929 has helped to build a bridge of depth psychological understanding between the East and the West. When Jung emerged from his 'confrontation with the unconscious', he felt validated by Wilhelm in his discovery of the healing power of medieval alchemical symbolism for the European psyche. Analytical psychology however offers a scientific, psychological understanding of Chinese wisdom as contained in the I Ching and Taoist alchemy. The Taoist alchemical tradition (also known as the Inner Elixir tradition of which 'The Secret of the Golden Flower' is a sample text) is based on the premise that psychological experience of the Tao can be achieved through mental and physiological means such as breathing and meditative techniques, gymnastics, dietary regimens such as fasting, consumption of medicinal herbs and minerals, and special sexual practices. This tradition incorporates the I Ching and traditional Chinese medicine in the alchemical opus. Taoist alchemy assumes the primacy of the physical body in the process of self-realization. The psychological and cosmic forces of the trigrams of the I Ching are stored in the internal organs of the body and are the basic material for the experience of Tao. The internal organs are the foundation of the material and subtle bodies and through cultivation, the body becomes spiritualized as the spirits are embodied. The body as a reflection of the entire cosmos becomes the residence of the gods. The realization of a new consciousness is symbolized by the hexagram Fu, meaning rebirth. The Chinese notion of Tao coincides with Jung's postulation of the unus mundus, the unity of existence which underlies the duality of psyche and matter, the psycho-physical background of existence. In this light, in the world of inner experience, East and West follow similar paths symbolically.

  15. Eugeniusz Misiło, comp. and ed., with an intro. Akcja “Wisła” 1947: Dokumenty i materiały.

    Directory of Open Access Journals (Sweden)

    Jerzy Borzęcki

    2016-02-01

    Full Text Available Eugeniusz Misiło, comp. and ed., with an intro. Akcja “Wisła” 1947: Dokumenty i materiały. Warsaw: Archiwum Ukraińskie and Management Academy Group, 2012. 1246 pp. Illustrations. Maps. Documents section. Appendices section. Biographies sections. Miscellaneous lists. English-language summary. Indexes. Cloth.

  16. Psych verbs, the linking problem, and the acquisition of language.

    Science.gov (United States)

    Hartshorne, Joshua K; O'Donnell, Timothy J; Sudo, Yasutada; Uruwashi, Miki; Lee, Miseon; Snedeker, Jesse

    2016-12-01

    In acquiring language, children must learn to appropriately place the different participants of an event (e.g., causal agent, affected entity) into the correct syntactic positions (e.g., subject, object) so that listeners will know who did what to whom. While many of these mappings can be characterized by broad generalizations, both within and across languages (e.g., semantic agents tend to be mapped onto syntactic subjects), not all verbs fit neatly into these generalizations. One particularly striking example is verbs of psychological state: The experiencer of the state can appear as either the subject (Agnes fears/hates/loves Bartholomew) or the direct object (Agnes frightens/angers/delights Bartholomew). The present studies explore whether this apparent variability in subject/object mapping may actually result from differences in these verbs' underlying meanings. Specifically, we suggest that verbs like fear describe a habitual attitude towards some entity whereas verbs like frighten describe an externally caused emotional episode. We find that this distinction systematically characterizes verbs in English, Mandarin, and Korean. This pattern is generalized to novel verbs by adults in English, Japanese, and Russian, and even by English-speaking children who are just beginning to acquire psych verbs. This results support a broad role for systematic mappings between semantics and syntax in language acquisition. Copyright © 2016 Elsevier B.V. All rights reserved.

  17. jsPsych: a JavaScript library for creating behavioral experiments in a Web browser.

    Science.gov (United States)

    de Leeuw, Joshua R

    2015-03-01

    Online experiments are growing in popularity, and the increasing sophistication of Web technology has made it possible to run complex behavioral experiments online using only a Web browser. Unlike with offline laboratory experiments, however, few tools exist to aid in the development of browser-based experiments. This makes the process of creating an experiment slow and challenging, particularly for researchers who lack a Web development background. This article introduces jsPsych, a JavaScript library for the development of Web-based experiments. jsPsych formalizes a way of describing experiments that is much simpler than writing the entire experiment from scratch. jsPsych then executes these descriptions automatically, handling the flow from one task to another. The jsPsych library is open-source and designed to be expanded by the research community. The project is available online at www.jspsych.org .

  18. The Etiology of the Illnesses of the Psyche in the Hippocratic Texts

    Directory of Open Access Journals (Sweden)

    Niki Papavramidou

    2014-01-01

    Full Text Available The Hippocratic Corpus played a key role to the disengagement of illness from the divine element that was believed to be to cause of all illnesses and injuries. Especially for the illnesses of the psyche (some call it “self” or “soul”, the Hippocratic physicians managed to recognize their biological origin and to create a “primitive” nosological structure. The aim of this paper is to identify the etiological factors of the illnesses of the psyche, according to the Hippocratic authors and to correlate them to modern medical observations. The Hippocratic physicians enumerated certain etiological factors for the occurrence of the illnesses of the psyche: imbalance of the humours, injuries of the head, extreme emotions, along with environmental features that were supposed to favor the appearance of such illnesses, such as the climate, the quality of the water, the winds, etc. Keywords: Hippocratic medicine; History of medicine; history of psychiatry; psyche

  19. The e-text corpus RusNeuroPsych: composition, structure and applicability

    Directory of Open Access Journals (Sweden)

    Litvinova Tatiana Aleksandrovna

    2016-10-01

    Full Text Available The article describes the text corpus RusNeuroPsych developed in the Russian language. It contains the meta-marking as information about the authors (gender, age, education, results of neuropsychological survey and psychological testing. We consider the details of data collection and procession in formation of the corpus, its composition and structure, and also analyse possibilities of application of the RusNeuroPsych corpus in general knowledge.

  20. PredPsych: A toolbox for predictive machine learning-based approach in experimental psychology research.

    Science.gov (United States)

    Koul, Atesh; Becchio, Cristina; Cavallo, Andrea

    2017-12-12

    Recent years have seen an increased interest in machine learning-based predictive methods for analyzing quantitative behavioral data in experimental psychology. While these methods can achieve relatively greater sensitivity compared to conventional univariate techniques, they still lack an established and accessible implementation. The aim of current work was to build an open-source R toolbox - "PredPsych" - that could make these methods readily available to all psychologists. PredPsych is a user-friendly, R toolbox based on machine-learning predictive algorithms. In this paper, we present the framework of PredPsych via the analysis of a recently published multiple-subject motion capture dataset. In addition, we discuss examples of possible research questions that can be addressed with the machine-learning algorithms implemented in PredPsych and cannot be easily addressed with univariate statistical analysis. We anticipate that PredPsych will be of use to researchers with limited programming experience not only in the field of psychology, but also in that of clinical neuroscience, enabling computational assessment of putative bio-behavioral markers for both prognosis and diagnosis.

  1. Detection of water and/or hydroxyl on asteroid (16) Psyche

    Science.gov (United States)

    Takir, Driss; Reddy, Vishnu; Sanchez, Juan A.; Shepard, Michael K.; Emery, Joshua P.

    2016-01-01

    In order to search for evidence of hydration on M-type asteroid (16) Psyche, we observed this object in the 3 μm spectral region using the long-wavelength cross-dispersed (LXD: 1.9–4.2 μm) mode of the SpeX spectrograph/imager at the NASA Infrared Telescope Facility. Our observations show that Psyche exhibits a 3 μm absorption feature, attributed to water or hydroxyl. The 3 μm absorption feature is consistent with the hydration features found on the surfaces of water-rich asteroids, attributed to OH- and/or H2O-bearing phases (phyllosilicates). The detection of a 3 μm hydration absorption band on Psyche suggests that this asteroid may not be a metallic core, or it could be a metallic core that has been impacted by carbonaceous material over the past 4.5 Gyr. Our results also indicate rotational spectral variations, which we suggest reflect heterogeneity in the metal/silicate ratio on the surface of Psyche.

  2. DETECTION OF WATER AND/OR HYDROXYL ON ASTEROID (16) Psyche

    Energy Technology Data Exchange (ETDEWEB)

    Takir, Driss [U.S. Geological Survey, Astrogeology Science Center, Flagstaff, AZ 86001 (United States); Reddy, Vishnu [Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ 85721 (United States); Sanchez, Juan A. [Planetary Science Institute, 1700 E Fort Lowell Road, Suite 106, Tucson, AZ 85719 (United States); Shepard, Michael K. [Department of Geography and Geosciences, Bloomsburg University of Pennsylvania, 400 E. Second Street, Bloomsburg, PA 17815 (United States); Emery, Joshua P., E-mail: dtakir@usgs.gov [Earth and Planetary Science Department, Planetary Geosciences Institute, University of Tennessee, Knoxville, TN 37996 (United States)

    2017-01-01

    In order to search for evidence of hydration on M-type asteroid (16) Psyche, we observed this object in the 3 μ m spectral region using the long-wavelength cross-dispersed (LXD: 1.9–4.2 μ m) mode of the SpeX spectrograph/imager at the NASA Infrared Telescope Facility. Our observations show that Psyche exhibits a 3 μ m absorption feature, attributed to water or hydroxyl. The 3 μ m absorption feature is consistent with the hydration features found on the surfaces of water-rich asteroids, attributed to OH- and/or H{sub 2}O-bearing phases (phyllosilicates). The detection of a 3 μ m hydration absorption band on Psyche suggests that this asteroid may not be a metallic core, or it could be a metallic core that has been impacted by carbonaceous material over the past 4.5 Gyr. Our results also indicate rotational spectral variations, which we suggest reflect heterogeneity in the metal/silicate ratio on the surface of Psyche.

  3. "Psych-Out": Using a Team-Based Game to Teach Diagnosis and Interventions

    Science.gov (United States)

    Pearson, Quinn M.; Townsend, Karen M.

    2012-01-01

    "Psych-Out" is a team-based game designed to motivate graduate counseling students to study diagnostic symptoms and related interventions associated with reading assignments. At least 83% of students agreed or strongly agreed that the game contributed to their enjoyment of the class, increased their motivation to study for class, and contributed…

  4. Acquiring Spanish at the Interfaces: An Integrative Approach to the L2 Acquisition of Psych-Verbs

    Science.gov (United States)

    Gomez Soler, Inmaculada

    2012-01-01

    This dissertation provides a comprehensive analysis of the L2 acquisition of Spanish psych-verbs (e.g. "gustar" "to like") across four different proficiency levels. In particular, psych-verbs constitute a testing ground for the predictions of the Interface Hypothesis (Sorace and Filiaci, 2006; Tsimpli, Sorace, Heycok &…

  5. Intro / Johannes Saar

    Index Scriptorium Estoniae

    Saar, Johannes, 1965-

    2006-01-01

    Kolmest projektist Tallinna Kunstihoones: 8.04.-28.05. 2006 avatud Elin Kardi, Marko Mäetamme, Marco Laimre ja Andres Tali Ühisnäitusest "Vägivald ja propaganda", selle raames 26.04.-09.05. avatud Emergency Biennale'ist, rahvusvahelisest rändnäitusest Tšetšeenia toetuseks (Tallinnas ühinesid biennaaliga Jüri Ojaver, Neeme Külm, Marco Laimre, Marko Mäetamm), 27.04. toimunud Kaasaegse Kunsti Eesti Keskuse 4. ettekannete päevast "Kunstnike moraalsed valikud kultuurikonfliktides" sarjast "Lisandusi eesti kunstiloole"

  6. Intro through Internet Psychology.

    Science.gov (United States)

    Webster, Sandra K.; Kelliher, Thomas P.

    Psychology and computer science were clustered into a course in "Internet Psychology" with the goal of enabling students to use electronic networks responsibly and creatively and to understand the principles of psychology as they operate in the electronic context. Fourteen students from a variety of majors registered for the class.…

  7. The distribution of referential adjectives in psych nominalizations in English and Romanian

    Directory of Open Access Journals (Sweden)

    Camelia Bejan

    2007-01-01

    Full Text Available Previous accounts of referential adjectives have examined their status in the structure of action nominalizations in correlation with the event vs. result interpretation of nominals. They have been argued to behave like noun phrases (Grimshaw 1990, to introduce new entities into the discourse (Giorgi and Longobardi 1991 or to simply modify deverbal nominals (Oersnes and Markantonatou 2002. This paper attempts a comparative study of referential adjectives in psychological nominalizations in English and Romanian. We argue that the restrictions on the occurrence of referential adjectives in psych nominalizations are imposed by the language specific functional structure of the DP. The paper is organized as follows. In section one we briefly overview the literature on referential adjectives in action nominalizations. In section two we look at the distribution of referential adjectives in psychological nominalizations and in section three we correlate modification by referential adjectives with the process vs. result interpretation of psych nominals.

  8. DETECTION OF ROTATIONAL SPECTRAL VARIATION ON THE M-TYPE ASTEROID (16) PSYCHE

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez, Juan A.; Thomas, Cristina [Planetary Science Institute, Tucson, AZ 85719 (United States); Reddy, Vishnu [Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ 85721 (United States); Shepard, Michael K. [Bloomsburg University, Bloomsburg, PA 17815 (United States); Cloutis, Edward A.; Kiddell, Cain; Applin, Daniel [Department of Geography, University of Winnipeg, Winnipeg, Manitoba (Canada); Takir, Driss [Astrogeology Science Center, U.S. Geological Survey, Flagstaff, AZ 86001 (United States); Conrad, Albert, E-mail: jsanchez@psi.edu [LBT Observatory, University of Arizona, Tucson, AZ 85721 (United States)

    2017-01-01

    The asteroid (16) Psyche is of scientific interest because it contains ∼1% of the total mass of the asteroid belt and is thought to be the remnant metallic core of a protoplanet. Radar observations have indicated the significant presence of metal on the surface with a small percentage of silicates. Prior ground-based observations showed rotational variations in the near-infrared (NIR) spectra and radar albedo of this asteroid. However, no comprehensive study that combines multi-wavelength data has been conducted so far. Here we present rotationally resolved NIR spectra (0.7–2.5 μ m) of (16) Psyche obtained with the NASA Infrared Telescope Facility. These data have been combined with shape models of the asteroid for each rotation phase. Spectral band parameters extracted from the NIR spectra show that the pyroxene band center varies from ∼0.92 to 0.94 μ m. Band center values were used to calculate the pyroxene chemistry of the asteroid, whose average value was found to be Fs{sub 30}En{sub 65}Wo{sub 5}. Variations in the band depth (BD) were also observed, with values ranging from 1.0% to 1.5%. Using a new laboratory spectral calibration method, we estimated an average orthopyroxene content of 6% ± 1%. The mass-deficit region of Psyche, which exhibits the highest radar albedo, also shows the highest value for the spectral slope and the minimum BD. The spectral characteristics of Psyche suggest that its parent body did not have the typical structure expected for a differentiated body or that the sequence of events that led to its current state was more complex than previously thought.

  9. Psyche=singularity: A comparison of Carl Jung's transpersonal psychology and Leonard Susskind's holographic string theory

    Science.gov (United States)

    Desmond, Timothy

    In this dissertation I discern what Carl Jung calls the mandala image of the ultimate archetype of unity underlying and structuring cosmos and psyche by pointing out parallels between his transpersonal psychology and Stanford physicist Leonard Susskind's string theory. Despite his atheistic, materialistically reductionist interpretation of it, I demonstrate how Susskind's string theory of holographic information conservation at the event horizons of black holes, and the cosmic horizon of the universe, corroborates the following four topics about which Jung wrote: (1) his near-death experience of the cosmic horizon after a heart attack in 1944; ( 2) his equation relating psychic energy to mass, "Psyche=highest intensity in the smallest space" (1997, 162), which I translate into the equation, Psyche=Singularity; (3) his theory that the mandala, a circle or sphere with a central point, is the symbolic image of the ultimate archetype of unity through the union of opposites, which structures both cosmos and psyche, and which rises spontaneously from the collective unconscious to compensate a conscious mind torn by irreconcilable demands (1989, 334-335, 396-397); and (4) his theory of synchronicity. I argue that Susskind's inside-out black hole model of our Big Bang universe forms a geometrically perfect mandala: a central Singularity encompassed by a two-dimensional sphere which serves as a universal memory bank. Moreover, in precise fulfillment of Jung's theory, Susskind used that mandala to reconcile the notoriously incommensurable paradigms of general relativity and quantum mechanics, providing in the process a mathematically plausible explanation for Jung's near-death experience of his past, present, and future life simultaneously at the cosmic horizon. Finally, Susskind's theory also provides a plausible cosmological model to explain Jung's theory of synchronicity--meaningful coincidences may be tied together by strings at the cosmic horizon, from which they

  10. Creativity as a Determinant of Intraspecific Aggressive Properties of the Psyche of Homo sapiens

    Directory of Open Access Journals (Sweden)

    Alexander G. Kruglov

    2017-06-01

    Full Text Available A sharp and non-linear qualitative change event, namely, the emergence of creativity in the structure of the psyche of Homo sapiens (HS about 50,000 years ago, created developmental bifurcations, as a result of which HS attained extraspecific and intraspecific domination. Creativity, a new quality of HS psyche, for the first time in the history of hominids enabled HS to separate the image of the goal (IG from the reactive behavior, transforming IG into an abstract, symbolic object. The emergence of this creative construct, the ambivalent structure existing in the interpretive environment, created a new need for hominids: a relationship with the virtual product of the psyche, a symbol, which has the signs of objective reality in PERCEPTION. Thus, a fundamentally unsolvable frustration was created: a frustration caused by the inability to achieve equilibrium relations with the CONTROLLING symbolic image. Behavior aimed at satisfying needs and eliminating frustration, accompanied by the ordering and structuring of society, acquires under certain conditions the elements of aggression, transforming into sheer aggression. We believe that in the periods preceding the aggression, there is a deliberate deformation of the psychological image of the enemy, the future victim, resulting in the aggressor perceiving the enemy as lacking in human qualities, those qualities that are the attributes of species identity. In this process, the aggressor’s psycho-filters and ethical restrictions are eliminated. We understand intraspecific aggression as the antagonistic contact between the frustration constructs, aimed at reducing the tension caused by frustration.

  11. Measuring sequences of keystrokes with jsPsych: Reliability of response times and interkeystroke intervals.

    Science.gov (United States)

    Pinet, S; Zielinski, C; Mathôt, S; Dufau, S; Alario, F-X; Longcamp, M

    2017-06-01

    Although the precision and reliability of response time (RT) measurements performed via Web-based interfaces have been evaluated, sequences of keystrokes have never been investigated in detail. Keystrokes often occur in much more rapid succession than RTs, and operating systems may interpret successive or concomitant keyboard events according to both automatic and user-based settings. Sequence keystroke timing could thus be more sensitive than single RTs to noise in online measurements. Here, we quantified the precision and reliability of timing measures performed during sequences of keystrokes. We used the JavaScript jsPsych library to create an experiment involving finger-movement sequences, and ran it online with 633 participants. We manipulated the structure of three keystroke motor sequences, targeting a replication of previous findings regarding both RTs and interkeystroke intervals (IKIs). Our online data accurately reproduced the original results and allowed for a novel assessment of demographic variables such as age and gender. In parallel, we also measured the objective timing accuracy of the jsPsych interface by using specialized hardware and software, showing a constant 60-ms delay for RTs and a 0-ms delay for IKIs across the sequences. The distribution of IKIs revealed quantizing for a majority of participants, most likely due to the sampling frequency of their USB keyboards. Overall, these findings indicate that JsPsych provides good reliability and accuracy in sequence keystroke timings for mental chronometry purposes, through online recordings.

  12. THE VALENCY OF STIMULUS IN RUSSIAN PSYCH-VERBS: SEMANTICS-SYNTAX INTERFACE

    Directory of Open Access Journals (Sweden)

    Valentina Ju. Apresjan

    2015-01-01

    Full Text Available The paper considers semantics—syntax interface in the domain of Russian psychverbs denoting emotional states. It attempts to demonstrate that syntactic properties of psych-verbs are semantically motivated. Psych-verbs are usually assigned two thematic roles — Experiencer and Stimulus. While Experiencer in Russian psych-verbs denoting state is usually coded as nominative or dative, Stimulus lacks a standard syntactic expression. The paper puts forward a hypothesis that variation in syntactic expression is semantically motivated. It is explained by the absence of a holistic role in place of Stimulus. The types of emotional stimuli vary greatly in different emotion clusters (anger, joy, sadness, pride, fear etc. and these ontological differences receive semantic and syntactic reflection. In different emotion clusters and depending on syntactic expression, the role of Stimulus can be semantically flavored by other thematic roles, such as Patient (for certain verbs of anger, Addressee (for certain verbs of joy, Place or Theme (for certain verbs of sadness, Instrument or Part (for verbs of pride and others. The choice of syntactic expression is often triggered by this additional thematic role. The types of additional roles are determined by the whole event structure, namely, the type of stimulus, wishes of the experience, the type of feeling, behavioral and speech manifestations of emotion. If a verb allows different kinds of syntactic expression of stimulus, each government pattern is associated with its own additional thematic role. 

  13. Psych Dome

    DEFF Research Database (Denmark)

    Computer EEG-controlled audio-visualisation software adapted for use by Sacred Resonance for 'Noosphere: A Vision Quest', a performance at Adelaide Planetarium, as part of the Adelaide Fringe Festival 2016....

  14. Quantum psyche

    CERN Document Server

    Baaquie, Belal E; Demongeot, J; Galli-Carminati, Giuliana; Martin, F; Teodorani, Massimo

    2015-01-01

    At the end of the 19th century Sigmund Freud discovered that our acts and choices are not only decisions of our consciousness, but that they are also deeply determined by our unconscious (the so-called "Freudian unconscious"). During a long correspondence between them (1932-1958) Wolfgang Pauli and Carl Gustav Jung speculated that the unconscious could be a quantum system. This book is addressed both to all those interested in the new developments of the age-old enquiry in the relations between mind and matter, and also to the experts in quantum physics that are interested in a formalisation of this new approach. The description of the "Bilbao experiment" adds a very interesting experimental inquiry into the synchronicity effect in a group situation, linking theory to a quantifiable verification of these subtle effects. Cover design: "Entangled Minds". Riccardo Carminati Galli, 2014.

  15. Real-time language comprehension research using the Apple-Psych system

    Science.gov (United States)

    BEEMAN, MARK; GERNSBACHER, MORTON A.

    2014-01-01

    We describe the use of the Apple-Psych system to conduct language comprehension experiments. Using this system, we have implemented several tasks commonly used to assess the cognitive processes involved in language comprehension. These include segment-by-segment reading tasks in which the stimuli are presented visually, and divided-attention and crossmodal tasks in which the stimuli are presented both visually and auditorily. Currently we are using the system to control collection of event-related potentials while subjects comprehend auditory discourse. PMID:25309032

  16. Social media, social avatars and the psyche: is Facebook good for us?

    Science.gov (United States)

    Brunskill, David

    2013-12-01

    This paper aims to explore how social media users represent themselves online, and to consider whether this process has inherent potential to impact upon the psyche of the individual. Advanced thinking around social media may exist on an organizational level, but on an individual level there exists a need to catch up, as the psychological dimensions of going online are significant and deserve consideration. Inherent to the experience of using social media is the self selection of favorable material to represent the individual. This process is cumulative, and effectively creates a socially-derived and socially-driven, composite online image ('social avatar'). Humans notably select their best aspects for presentation to others and the social avatar reflects this tendency, effectively facilitating the creation of a 'gap' between online image (representation) and offline identity (substance). The creation of a social avatar should therefore be an important and conscious consideration for all users of social media, not just those individuals already struggling with the task of integrating the multiple facets which make up modern personal identity. Social avatars appear to be an important factor in understanding the inherent potential for social media to affect the psyche/contribute to psychopathology within the individual.

  17. Psyche, Nightmare and Religion: Precursors of Colonial Conquest in Ahmed Yerima’s Attahiru

    Directory of Open Access Journals (Sweden)

    Taiwo A. Stanley Osanyemi

    2017-06-01

    Full Text Available This paper is premised on the connection between history and drama in order to profile the historical characters or heroes and explicate the socio-political predicament in their society. Existing studies on historical plays have focused on the celebration and chronicling of the heroic deeds of the historical characters, sometimes ignoring the artistic techniques the playwright employed. This study, therefore, examines psyche, nightmare and religion as the stylistic techniques for establishing the sources of disintegration in an imperial environment. This is with a view to investigating the link between the conflicts of the protagonist and the predicaments of his society. The study is based on psychoanalysis that allows for the investigation of characters’ unconscious motives and collective archetypes. The text, Attahiru is subjected to critical textual analysis in both content and form to analyse the paradigmatic use of history, dream and religion to account for the colonial conquest of an African society. Various patterns of unconscious archetypes such as psyche, nightmare, daydream and religion were discovered to serve as techniques of foreshadowing and flashback to the physical and psychological conflicts in the play. They serve as signifiers of the protagonist’s traumas. These unconscious archetypes, therefore, have become the catalysts for disintegration and veritable strategy in Ahmed Yerima’s account of imperial history.

  18. [Mental images: towards a media history of the psyche around 1900].

    Science.gov (United States)

    Rall, Veronika

    2014-12-01

    Presupposing that visual practices are inherent to the social constitution of knowledge, this article suggests juxtaposing photographs and films produced in a psychiatric environment to popular films run in theaters around 1900, thus identifying cinema's particular "Denkstil" (Fleck). Rejecting science's dominating paradigm of visual objectivity (Daston/Galison), the visual apparatus [dispositif] of early cinema facilitates subjective experience of unreason and irrationality and thus initiates a different epistemological approach to knowledge as self-knowledge of a modern, self-reflexive subject. This is particularly evident in early cinema's depiction of the psyche, which does not solely focus on the physical manifestation of the 'mad', 'insane' body, but also visualizes the subject's inner life: technical means like montage, multiple exposure or stop motion can be employed to illustrate subjective visions, fantasies or dreams. Thus, the invisible mind becomes visible as the "unthinkable within thinking" (Deleuze), while the subject is invited to participate in cinema's "gay science" (Nietzsche).

  19. [Gut microbiome and psyche: paradigm shift in the concept of brain-gut axis].

    Science.gov (United States)

    Konturek, Peter C; Zopf, Yurdagül

    2016-05-25

    The concept of the brain-gut axis describes the communication between the central and enteric nervous system. The exchange of information takes place in both directions. The great advances in molecular medicine in recent years led to the discovery of an enormous number of microorganisms in the intestine (gut microbiome), which greatly affect the function of the brain-gut axis. Overview Numerous studies indicate that the dysfunction of the brain-gut axis could lead to both inflammatory and functional diseases of the gastrointestinal tract. Moreover, it was shown that a faulty composition of the gut microbiota in childhood influences the maturation of the central nervous system and thus may favor the development of mental disorders such as autism, depression, or other. An exact causal relationship between psyche and microbiome must be clarified by further studies in order to find new therapeutic options.

  20. PSYCH: A Mnemonic to Help Psychiatric Residents Decrease Patient Handoff Communication Errors.

    Science.gov (United States)

    Mariano, Maria Theresa; Brooks, Victoria; DiGiacomo, Michael

    2016-07-01

    The substantial adverse impact of miscommunication during transitions in care has highlighted the importance of teaching proper patient handoff practices. Although handoff standardization has been suggested, a universal system has been difficult to adopt, given the unique characteristics of the different fields of medicine. A form of standardization that has emerged is a discipline-specific handoff mnemonic: a memory aid that can serve to assist a provider in communicating pertinent information to the succeeding treatment team. A pilot study was conducted in which psychiatry residents were taught a mnemonic to use during their post-call patient handoffs. The PSYCH mnemonic was introduced as a guide to help residents identify key information needed in a psychiatric emergency room handoff: Patient information/ background, S ituation leading to the hospital visit, Y our assessment, Critical information, and Hindrance to discharge. Resident post-call patient handoffs were voice recorded and transcribed for 12 weeks. The transcriptions were divided into three time periods: Time 1 (baseline resident handoff performance), Time 2 (natural progression in resident hand-off performance with experience), and Time 3 (resident handoff performance after training in use of the PSYCH mnemonic). There was a statistically significant decrease in the mean number of omissions after the intervention (p = 0.049). The decrease in time spent on handoffs after the intervention was not statistically significant. On the basis of a rating scale ranging from 1 (not clear) to 4 (very clear), the residents' rating of their clarity of expectations increased from a mean of 2.79 to 3.83, and their confidence rating increased from a mean of 2.57 to 3.42. The mnemonic helped decrease the residents' handoff omissions. It also helped improve their efficiency, clarity of expectation, and confidence during handoffs.

  1. Mood recognition in bipolar patients through the PSYCHE platform: preliminary evaluations and perspectives.

    Science.gov (United States)

    Valenza, Gaetano; Gentili, Claudio; Lanatà, Antonio; Scilingo, Enzo Pasquale

    2013-01-01

    Bipolar disorders are characterized by a series of both depressive and manic or hypomanic episodes. Although common and expensive to treat, the clinical assessment of bipolar disorder is still ill-defined. In the current literature several correlations between mood disorders and dysfunctions involving the autonomic nervous system (ANS) can be found. The objective of this work is to develop a novel mood recognition system based on a pervasive, wearable and personalized monitoring system using ANS-related biosignals. The monitoring platform used in this study is the core sensing system of the personalized monitoring systems for care in mental health (PSYCHE) European project. It is comprised of a comfortable sensorized t-shirt that can acquire the inter-beat interval time series, the heart rate, and the respiratory dynamics for long-term monitoring during the day and overnight. In this study, three bipolar patients were followed for a period of 90 days during which up to six monitoring sessions and psychophysical evaluations were performed for each patient. Specific signal processing techniques and artificial intelligence algorithms were applied to analyze more than 120 h of data. Experimental results are expressed in terms of confusion matrices and an exhaustive descriptive statistics of the most relevant features is reported as well. A classification accuracy of about 97% is achieved for the intra-subject analysis. Such an accuracy was found in distinguishing relatively good affective balance state (euthymia) from severe clinical states (severe depression and mixed state) and is lower in distinguishing euthymia from the milder states (accuracy up to 88%). The PSYCHE platform could provide a viable decision support system in order to improve mood assessment in patient care. Evidences about the correlation between mood disorders and ANS dysfunctions were found and the obtained results are promising for an effective biosignal-based mood recognition. Copyright © 2012

  2. Separate disciplines: The study of behavior and the study of the psyche.

    Science.gov (United States)

    Fraley, L E; Vargas, E A

    1986-01-01

    The study of behavior differs fundamentally from the study of the psyche and logically cannot share the same discipline. However, while disciplines might be defined through technical exercises, they function through exercises of political power. The evolution of a discipline, though based on field and laboratory data interpreted within a specific paradigm and justified publicity by its utility to solve personal and social problems, follows a course of development in the political arenas of the academies and the professions. We happen to have a discipline, roughly connoted by the label "behavior analysis," without an academic home (the present ones haphazardly tolerate our activities), without a professional organization (the present one lobbies only "for behavior analysis"), and without a true professional name (the present one implies an approach not a discipline). No scientific community lasts long without a supporting professional infrastructure. In explicitly asserting ourselves as a discipline, we confront a number of difficult issues such as continuing to work in departments antithetical to behaviorism and a number of problems such as what we call ourselves to identify our professional and scientific concerns. (For example, we need a term descriptive of our science in its broad sense. That term is not psychology. Too many people persist in maintaining its commitment to cognitivism. On whatever term we agree, "behavior" should constitute its stem, for our efforts focus there, not in the putative underlying psyche or its current cognitive update.) The focus of our concerns and the solutions of our problems rest on one issue: Will our discipline prosper most as a branch of psychology or as an independent discipline? Slowly, but surely, our actions demonstrate that the latter is the preferred option, but these actions, though fortuitous, occur almost by accident. By specifically programming to achieve an independent professional status we increase the probability

  3. Concurrent validity of the PSYCH-6, a very short scale for detecting anxiety and depression, among oncology outpatients.

    Science.gov (United States)

    Clover, Kerrie; Leigh Carter, Gregory; Adams, Catherine; Hickie, Ian; Davenport, Tracey

    2009-07-01

    To improve the acceptability of screening for depression and anxiety among patients with cancer there is a need for scales that are both very short and accurate. To date no very short questionnaire has been found to provide optimal performance for screening in oncology populations and other candidates must be examined. This study examined the concurrent validity of a relatively new, very short scale, the six item PSYCH-6 subscale of the Somatic and Psychological Health Report (SPHERE-12), in an oncology outpatient population. Cross-sectional survey of 340 oncology outpatients attending a regional hospital in Newcastle, Australia. The performance of the PSYCH-6 against the Hospital Anxiety and Depression Scale (HADS) was evaluated using correlation, Cohen's kappa, positive agreement and negative agreement. The PSYCH-6 subscale of the SPHERE-12, at a cut-off point of 3, had substantial agreement with the total score of the HADS (HADS-T; kappa = 0.73, p PSYCH-6 scale of the SPHERE-12 at a cut-off point of 3 is an equivalent instrument to the HADS-T for detecting cases and excluding non-cases of anxiety and depression and is suitable for deployment in oncology populations.

  4. Psych NP-NC: a benchmark graduate nurse practitioner program for meeting the mental health needs in North Carolina.

    Science.gov (United States)

    Soltis-Jarrett, Victoria

    2011-01-01

    UNC-Chapel Hill's Psych NP-NC program prepares clinically and culturally proficient nurse practitioners to provide psychiatric and mental health care in North Carolina areas that are medically underserved and have a greater number of health disparities. This article reviews the program and the role of its graduates and makes policy recommendations for improving mental health care in the state.

  5. Review: Gerd Jüttemann (Hrsg. (2013. Die Entwicklung der Psyche in der Geschichte der Menschheit

    Directory of Open Access Journals (Sweden)

    Uwe Krebs

    2015-03-01

    Full Text Available Der Vorbereitungsband für die Reihe "Die Psychogenese der Menschheit" – ein Sammelband aus 32 Beiträgen, betitelt "Die Entwicklung der Psyche in der Geschichte der Menschheit" und 2013 herausgegeben von Gerd JÜTTEMANN – wird in dieser Besprechung in mehreren Schritten vorgestellt und bewertet. Zunächst wird kontextuell argumentiert, dass die bewährte, empirisch-experimentelle Methodologie der Psychologie zur Vernachlässigung weiterer Erkenntnisverfahren führte, die bei Themen wie dem hier zu besprechenden Werk allein verbleiben und die kurz angesprochen werden. Sodann wird das Werk im Überblick knapp dargestellt und die außergewöhnliche Heterogenität in Inhalten und Methoden betont. Die Besprechung einzelner Beiträge, die nach dem Gesichtspunkt großer Unterschiedlichkeit ausgewählt wurden, schließt sich an. Die abschließende Gesamtbewertung betont den lückenhaften Forschungsstand, die Notwendigkeit der allein verbleibenden qualitativen Methodik mit ihren verschiedenen Möglichkeiten und nennt Desiderata künftigen Vorgehens für diesen thematisch und methodisch interessanten Auftakt-Band, der insbesondere durch Dichte und Verschiedenheit der Beiträge beeindruckt. URN: http://nbn-resolving.de/urn:nbn:de:0114-fqs1502219

  6. Monuments of memory: defensive mechanisms of the collective psyche and their manifestation in the memorialization process.

    Science.gov (United States)

    Kalinowska, Malgorzata

    2012-09-01

    The paper searches for insight in the area of collective memory as a part of collective consciousness, a phenomenon understood as a stabilizing factor for a society's self-image and identity. Collective memories are seen as originating from shared communications transmitting and creating the meaning of the past in the form of narrative, symbols and signs. As such, they contain the individual, embodied and lived side of our relations to the past. As well as the identity-building and meaning-making functions of collective memories, their defensive function is discussed with a focus on commemorative practices taking place in a transitional space between psychic and social life. Fears of a lack of collective identity and coherence have contributed to the way Polish commemorative practices have been shaped. This is considered in relation to the Smolensk catastrophe in 2010, viewed in the context of the Jungian concept of the collective psyche and the psychoanalytical understanding of defensive group mechanisms against trauma, especially those relating to loss and mourning. It leads to a consideration of how historical experiences and the experience of history can be accessed, as well as their meaning for individual and group development. © 2012, The Society of Analytical Psychology.

  7. Discontinuities in the male psyche: waiting, deadness and disembodiment. Archetypal and clinical approaches.

    Science.gov (United States)

    Goss, Phil

    2006-11-01

    The discontinuities of development in the male psyche that are manifested in some analyses in unconscious experiences of inner disintegration are described. Narcissism and a de-somatized relationship to their own presence are the dominant clinical presentation in these patients. The analyst sometimes experiences these analyses as 'dead', as a result of the projection of a 'dead mother' object. The question of how psychic deadness and impotence can be worked with is examined. Clinical experience with these men shows how notions associated with the puer-senex archetype can illuminate the stark realities of a patient's early experiences, particularly in how mother's presence is felt. A theoretical and clinical bridge is proposed between puer and narcissus to frame how a man may unconsciously strive against psychic fragmentation by clinging to an identification with both--in order to remain intact in the face of being caught in a pre-pubescent state which reflects the insecure attachment to mother. The author describes how patients may find a more grounded embrace of reality via the use of the analyst's empathy and a greater potency through work in the transference/countertransference. These strengthening achievements help men to begin to leave the 'dead mother' behind.

  8. Emergency medical services and "psych calls": Examining the work of urban EMS providers.

    Science.gov (United States)

    Prener, Christopher; Lincoln, Alisa K

    2015-11-01

    Emergency medical technicians and paramedics form the backbone of the United States' Emergency Medical Service (EMS) system. Despite the frequent involvement of EMS with people with mental health and substance abuse problems, the nature and content of this work, as well as how EMS providers think about this work, have not been fully explored. Using data obtained through observations and interviews with providers at an urban American EMS agency, this paper provides an analysis of the ways in which EMS providers interact with people with mental illness and substance abuse problems, as well as providers' experiences with the mental health care system. Results demonstrate that EMS providers share common beliefs and frustrations about "psych calls" and the types of calls that involve people with behavioral health problems. In addition, providers described their understandings of the ways in which people with mental health and substance use problems "abuse the system" and the consequences of this abuse. Finally, EMS providers discuss the system-level factors that impact their work and specific barriers and challenges to care. These results suggest that additional work is needed to expand our understanding of the role of EMS providers in the care of people with behavioral health problems and that mental health practitioners and policy makers should include consideration of the important role of EMS and prehospital care in providing community-based supports for people with behavioral health needs. (PsycINFO Database Record (c) 2015 APA, all rights reserved).

  9. Tattoos as a window to the psyche: How talking about skin art can inform psychiatric practice.

    Science.gov (United States)

    Roggenkamp, Hannah; Nicholls, Andrew; Pierre, Joseph M

    2017-09-22

    Tattooing the skin as a means of personal expression is a ritualized practice that has been around for centuries across many different cultures. Accordingly, the symbolic meaning of tattoos has evolved over time and is highly individualized, from both the internal perspective of the wearer and the external perspective of an observer. Within modern Western societies through the 1970s, tattoos represented a cultural taboo, typically associated with those outside of the mainstream such as soldiers, incarcerated criminals, gang members, and others belonging to marginalized and counter-cultural groups. This paper aims to review the more recent epidemiology of tattoos in Western culture in order to establish that tattooing has become a mainstream phenomenon. We then review psychological and psychiatric aspects of tattoos, with a goal of revising outmoded stigmas about tattooing and helping clinicians working with tattooed patients to facilitate an exploration of the personal meaning of skin art and self-identity. We suggest that as a kind of augmentation of the physical exam, looking at and talking to patients about their tattoos can provide a valuable window into the psyche, informing clinical practice.

  10. Satisfaction with and benefits of a psych-social club: development of a mixed method evaluation instrument.

    Science.gov (United States)

    Labun, Evelyn; Yurkovich, Eleanor; Ide, Bette A

    2012-12-01

    There are no instruments for validation or evaluation of a member's satisfaction of and benefits with psych-social clubs. This article reports on the development and testing of the mixed-method instrument entitled Benefits and Satisfaction Tool for Members of a Psych-social Club (B&ST-MPC), which evolved from findings of a qualitative research study. The alpha reliability coefficient was .92. The Kaiser-Meyer-Olkin Test yielded a value of .812. The items loaded on 3 factors. Utilization of B&ST-MPC supports development of services for rural communities through feedback from consumers. Further testing of the B&ST-MPC in settings with diverse populations is recommended. Copyright © 2012 Elsevier Inc. All rights reserved.

  11. Human behavior in contextual multi-armed bandit problem - MathPsych, CogSci, SPUDM presentation

    OpenAIRE

    Stojic, Hrvoje; Pantelis P. Analytis; Speekenbrink, Maarten

    2015-01-01

    Presentation slides from talks given at the Annual Meeting of the Society for Mathematical Psychology (MathPsych 2015), the Annual meeting of the Cognitive Science Society (CogSci 2015) and at the Subjective Probability, Utility, and Decision Making Conference (SPUDM 2015). This work is closely related to the following article: Stojic, H., Analytis, P. P., & Speekenbrink, M. (2015). Human behavior in contextual multi-armed bandit problems. Proceedings of the 37th Annual Conference of the C...

  12. Med Psych Units: Proceedings and abstracts of the Triptych Workshop 9 december 1999 Maastricht.

    Science.gov (United States)

    Honig, A; Troost, J; Kuijpers, P M; van Vliet, I M

    1999-12-01

    Med Psych Units (MPU) are neither clear-cut medical nor psychiatric units. This makes it difficult to acquire funding for these often expensive units. Despite this, there are many reasons why MPU's should be a necessary part of any larger scale inpatient service of a general and teaching hospital. It is therefore even more remarkable that such units hardly exist in Europe and that only about twenty exist in the USA. Five main reasons why such units should be opened are: The increasing average age of the population of the Western World, with high co-morbidity and polypharmacy in the elderly and elderly elderly. An increase in the number of chronic physical diseases resulting in co-morbid psychiatric disorders. This increase in chronicity is the consequence of increasingly successful treatment of acute and potentially lethal diseases; for example, acute myocardial infarction and the subsequent development of chronic heart disease. The decreasing duration of hospital admission. On average the duration of stay in a general hospital in The Netherlands is now nine days. The number of day-treatments has doubled in the last decade. This situation means that it is not possible to observe the behavior of patients on a general medical ward or to carry out a psychiatric consultation. Inadequate medical evaluation of psychiatric patients. According to a recent survey by the Dutch Ministry of Health, the care given for physical disease to psychiatric patients in mental hospitals in The Netherlands needs much to be desired for. The psychiatric co-morbidity of somatic diseases is accompanied by a high consumption of medical facilities and high economic losses, unless adequately recognized and treated.

  13. Intro to the Zotero API

    Directory of Open Access Journals (Sweden)

    Amanda Morton

    2013-04-01

    Full Text Available In this lesson, you’ll learn how to use python with the Zotero API to interact with your Zotero library. The Zotero API is a powerful interface that would allow you to build a complete Zotero client from scratch if you so desired. But like most APIs, it works in small, discrete steps, so we have to build our way up to the complicated requests we might want to use to access our Zotero libraries. But this incremental building gives us plenty of time to learn as we go along.

  14. Telemonitoring with respect to Mood Disorders and Information and Communication Technologies: Overview and Presentation of the PSYCHE Project

    Directory of Open Access Journals (Sweden)

    Hervé Javelot

    2014-01-01

    Full Text Available This paper reviews what we know about prediction in relation to mood disorders from the perspective of clinical, biological, and physiological markers. It then also presents how information and communication technologies have developed in the field of mood disorders, from the first steps, for example, the transition from paper and pencil to more sophisticated methods, to the development of ecological momentary assessment methods and, more recently, wearable systems. These recent developments have paved the way for the use of integrative approaches capable of assessing multiple variables. The PSYCHE project stands for Personalised monitoring SYstems for Care in mental HEalth.

  15. Working out the interstitial and syncopic nature of the human psyche: on the analysis of verbal data.

    Science.gov (United States)

    Roth, Wolff-Michael

    2014-09-01

    Psychology studies the human mind and its development. Although it is often recognized that the human mind needs to be understood as a temporal (developmental) phenomenon between past and future and at the interstices between the idealities of pure Self and Other, the analytic methods interpretive researchers use tend to reify ahistorical and solipsist conceptions of the human being. In this article, I provide examples of an approach to the analysis of verbal data that immediately gets us to the interstitial and syncopic nature of the human psyche.

  16. [The ability for psych self-regulation as a factor in resistance to the stresses in extreme conditions of space flight].

    Science.gov (United States)

    Vinokhodova, A G; Bystritskaia, A F; Smirnova, T M

    2005-01-01

    Significance of the ability for psych self-regulation in the context of resistance to the stresses of space flight was studied in an experiment with 9 test-subjects simulating such factors of space flights as 8 to 9-day isolation and confinement, some physiological effects of microgravity in a head-down position at -8 degrees for 7 d, artificial climate, and implementation of dock and piloting operations. Stress resistance, self-regulation, mental performance and behavior were assessed with the use of computerized tests "Mirror coordinograph", "Relaxometer", and "SOPR-monitoring". The ability to voluntary control psych was shown to be favorable to stress-resistance and rapid recovery of mental efficiency after the natural decline in consequence of the experimental simulation. The ability for psych self-regulation is one of the major criteria of professional selection for exposure to extreme conditions.

  17. An Affect-Centered Model of the Psyche and its Consequences for a New Understanding of Nonlinear Psychodynamics

    Science.gov (United States)

    Ciompi, Luc

    At variance with a purely cognitivistic approach, an affect-centered model of mental functioning called `fractal affect-logic' is presented on the basis of current emotional-psychological and neurobiological research. Functionally integrated feeling-thinking-behaving programs generated by action appear in this model as the basic `building blocks' of the psyche. Affects are understood as the essential source of energy that mobilises and organises both linear and nonlinear affective-cognitive dynamics, under the influence of appropriate control parameters and order parameters. Global patterns of affective-cognitive functioning form dissipative structures in the sense of Prigogine, with affect-specific attractors and repulsors, bifurcations, high sensitivity for initial conditions and a fractal overall structure that may be represented in a complex potential landscape of variable configuration. This concept opens new possibilities of understanding normal and pathological psychodynamics and sociodynamics, with numerous practical and theoretical implications.

  18. La psyché démodée. Psychanalyse et objectivité sociale chez Adorno

    Directory of Open Access Journals (Sweden)

    Giovanni Zanotti

    2014-06-01

    Full Text Available The paper discusses the problem of the possible relation between psychoanalytic concepts and social critique in the perspective of Adorno's social thought. The title refers to Adorno's idea that psyche as individual spontaneity has now lost the weight it used to have in the liberal era. As a brief introductory remark, I clarify the status of theory for Adorno, i.e., the circularity between interpretation and description as grounded by the nature of the social object itself. Then I analyse his core idea of “social objectivity” as an impersonal mechanism which is at the same time produced by men and reified, heteronomous for them, and I argue that, for Adorno, the discontinuity existing between individual and society prevents an immediate shift of psychoanalytic concepts to the social world: the example of fascism clearly proves that the determining social forces today, while instrumentally exploiting deep psychical materials, are not themselves psychological. In the final part, I show how, for Adorno, psychology and sociology nevertheless need to be mediated with each other, while avoiding the superficial synthesis the so-called “revised psychoanalysis” aims to, and I point out some similarities between psychoanalytic practice and social critique as conceived by him.

  19. [Standard treatment of schizophrenia and legality of personnel equipment in psychiatric hospitals (German Psych-PV): possibilities and limitations].

    Science.gov (United States)

    Wölfle, M; Onnen, V; Vollmer, E; Steinert, T

    1999-09-01

    Comprehensive insight regarding better treatment and social reintegration of patients with schizophrenia has been gained over the past decade. Implementation of this knowledge into everyday's practice should be a major aim prior to the research on new variants of rehabilitative measures. To which extent this takes place has been poorly discussed until now. Our comprehensive treatment program includes psychoeducation for patients and relatives, cognitive training, social skills training, additional psychoeducation for patients with dual diagnosis and a variety of a traditional group therapies like work therapy. An intensive cooperation is practised with complementary psycho-social services. In n = 89 consecutive admissions lasting at least 2 weeks we examined which patients were reached by these treatment offers. 84% of the patients participated in group therapies, where they passed 6.9 hours weekly on average. Most patients were reached by occupation therapy (62%), followed by physical therapy (54%), unspecific conversation group (54%), psychoeducation (35%), cognitive training (30%), work therapy (26%) and social skills training (7%). The PANSS Positive Scale at admission was negatively correlated with participation in group therapies. The implementation of a variety of psychotherapeutic offers for psychotic patients adequate to the state of the art can be achieved under conditions of standard hospital care in Germany (Psych-PV-law). Required organizational measures therefore are programs offered for patients of several wards in union and participation of employees in education. However, even by such efforts a considerable part of patients is not reached. Strategies to improve treatment results should consider these problems.

  20. Psychoneuroimmunology - psyche and autoimmunity.

    Science.gov (United States)

    Ziemssen, Tjalf

    2012-01-01

    Psychoneuroimmunology is a relatively young field of research that investigates interactions between central nervous and immune system. The brain modulates the immune system by the endocrine and autonomic nervous system. Vice versa, the immune system modulates brain activity including sleep and body temperature. Based on a close functional and anatomical link, the immune and nervous systems act in a highly reciprocal manner. From fever to stress, the influence of one system on the other has evolved in an intricate manner to help sense danger and to mount an appropriate adaptive response. Over recent decades, reasonable evidence has emerged that these brain-to-immune interactions are highly modulated by psychological factors which influence immunity and autoimmune disease. For several diseases, the relevance of psychoneuroimmunological findings has already been demonstrated.

  1. The Psyche as Behavior

    OpenAIRE

    ARTURO CLAVIJO A.

    2013-01-01

    Según el conductismo, el comportamiento constituye la Psique y el tema de estudio de la psicología. Aunque algunos científicos habían realizado trabajos empíricos con métodos objetivos antes de 1913, año en el que John B. Watson publicó su manifiesto, este último fue el primero en intentar la sistematización de la conducta como equivalente a la Psique, esto es, como el objeto de estudio de la psicología. El artículo discute la noción de comportamiento de Watson y la compara con otras dos form...

  2. The Psyche as Behavior

    Directory of Open Access Journals (Sweden)

    ARTURO CLAVIJO A.

    2013-01-01

    Full Text Available Según el conductismo, el comportamiento constituye la Psique y el tema de estudio de la psicología. Aunque algunos científicos habían realizado trabajos empíricos con métodos objetivos antes de 1913, año en el que John B. Watson publicó su manifiesto, este último fue el primero en intentar la sistematización de la conducta como equivalente a la Psique, esto es, como el objeto de estudio de la psicología. El artículo discute la noción de comportamiento de Watson y la compara con otras dos formas de conductismo: el conductismo radical de Skinner y el conductismo molar, con el fin de ilustrar la forma en que el concepto de comportamiento ha cambiado y sigue cambiando.

  3. Complex Variables-Intro-duction and Applications

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 4; Issue 11. Complex Variables – Introduction and Applications. S Kesavan. Book Review Volume 4 Issue 11 November 1999 pp 86-87. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/004/11/0086-0087 ...

  4. Intro to Google Maps and Google Earth

    Directory of Open Access Journals (Sweden)

    Jim Clifford

    2013-12-01

    Full Text Available Google My Maps and Google Earth provide an easy way to start creating digital maps. With a Google Account you can create and edit personal maps by clicking on My Places. In My Maps you can choose between several different base maps (including the standard satellite, terrain, or standard maps and add points, lines and polygons. It is also possible to import data from a spreadsheet, if you have columns with geographical information (i.e. longitudes and latitudes or place names. This automates a formerly complex task known as geocoding. Not only is this one of the easiest ways to begin plotting your historical data on a map, but it also has the power of Google’s search engine. As you read about unfamiliar places in historical documents, journal articles or books, you can search for them using Google Maps. It is then possible to mark numerous locations and explore how they relate to each other geographically. Your personal maps are saved by Google (in their cloud, meaning you can access them from any computer with an internet connection. You can keep them private or embed them in your website or blog. Finally, you can export your points, lines, and polygons as KML files and open them in Google Earth or Quantum GIS.

  5. Retail Marketing: Part 1. Communication methods. Intro

    OpenAIRE

    Juan Vigaray, María Dolores de

    2010-01-01

    Se complementa con artículos, casos y lecturas. Introducción al retail marketing centrando la asignatura en merchandising, revisando los conceptos de "store image" y "posicionamiento", así como el "space productivity". Presenta las áreas de estudio en las que se basan los temas siguientes: exterior, general interior, store layout, promotion, customer service.

  6. La Psique Latinoamericana: Breve Ensayo Hermenéutico Desde Freud y Jung Latin-American Psyche: Brief Hermeneutic Essay Based on Freud and Jung

    Directory of Open Access Journals (Sweden)

    Jorge Gissi

    2004-05-01

    Full Text Available El artículo integra algunas tesis de Freud y de Jung y las aplica a la psique latinoamericana. Según el autor, la conquista española en América, fue y aún es psicoculturalmente, distinta para conquistadores y conquistados. Desde la perspectiva de Freud, el análisis se basa en la segunda tópica, en la teoría de los mecanismos de defensa y en el complejo de Edipo. Se relacionan conflictos represivos, castratorios, proyectivos, etc. en los grupos culturales en pugna, y las derivaciones familiares y psicopolíticas congruentes. Desde Jung, el análisis se realiza a través de mitos y símbolos, lo que refleja una no integración sana de los arquetipos y un fuerte componente patriarcal de dominación. Esto implica la baja individuación, el "yo débil" y las disociaciones descubiertas por Freud.This article joins together some of Freud's and Jung's thesis and applies them into the Latin-American psyche. The author states that Spaniard's conquer period in America was, and still is, very different for conquerors and conquered (from a psychological and cultural point of view. From a Freudian approach, the analysis is based on the "Topica II", on the defense mechanisms theory and the Oedipus complex. In both groups, the author relates repressive conflicts, castration, projection, etc., with its familiar and psycho-political consequences. From Jung, the analysis is made with myths and symbols, which reflects a strong patriarchal component of domination and a unwholesome integration of the archetypes. This implies the low individuation, the "weak self" and the dissociations discovered by Freud.

  7. A crisis in adolescent psych.

    Science.gov (United States)

    Haugh, Richard

    2003-01-01

    The number of children and adolescents needing mental health services has surged; yet state mental hospitals are closing and private for-profit psychiatric facilities are getting out of the business. Hospitals that still offer inpatient psychiatric beds are often full, with long waiting lists. So who fills the breach? The hospital emergency department.

  8. The Gut and the Psyche

    African Journals Online (AJOL)

    retrogradely by inhibition of somatic (pelvic floor) innervation. I believe that this study gives a clue to both the mechanism and the cure of severe idiopathic constipation. Treatment involves modifying diet (if only to provide the rectum with something to expel) and encouraging moderate exercise (40-60 minutes a day at no ...

  9. CPV 101: Intro to CPV Technology, Opportunities and Challenges (Presentation)

    Energy Technology Data Exchange (ETDEWEB)

    Kurtz, S.

    2009-10-26

    The presentation describes Concentrating Photovoltaic power (CPV), why it is important, the associated the opportunities and challenges, and more than 5-dozen companies that are pursuing the approach.

  10. report intro | Overview | Publications | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    The inputs from the Fellowship have been valuable to the Panel in drafting its report. I would like to take this opportunity to thank Professor Mukunda and his distinguished colleagues on the Panel for the extraordinary effort they have put into the preparation of a report that I am now happy to place before the Academy's ...

  11. Intro Courses that Entice Majors and Future Teachers

    Science.gov (United States)

    Stewart, Gay

    2004-05-01

    University of Arkansas is part of the Physics Teacher Education Coalition (PhysTEC), an APS/AAPT/AIP program. PhysTEC provides dramatic improvement of science preparation of teachers, developing programs to work at a range of institutions. Features of our undergraduate program already in place that benefit all students, including future teachers, and in-progress curricular revisions will be discussed. As an example, we began with introductory calculus-based electromagnetism and optics, UPII. Our goal was to improve the level of student learning, confidence, and enjoyment of science, while maintaining the resource level common to large institutions. The program is successful. Confidence is up, particularly women end the course as confident as men, with strong correlation between confidence and performance. Students who successfully complete UPII go on to earn a SMET degree. This is the majority, as we make it hard not to learn the material. Students given a 50-minute closed-book test from a 1990 class (ave=53.8%) finished in 35 minutes with an average of 69.2%. They outperformed previous classes where the concepts had been specifically addressed by 18% on multiple-choice questions. Students have a higher retention to degree than university average. Graduation rates tripled concurrent with our first UPII students graduating and continues to increase. Our method involves leading the student from concrete hands-on examples to conceptual understanding through group discussion. Experimental results provide verification. Concepts are related to familiar phenomena. Students are taught to reason in a structured manner about both conceptual and quantitative problems. Cooperative learning, found to improve retention of female and minority students, is emphasized. The increased number of majors impacts almost every aspect of the department.

  12. [Nonnative guidelines for allocating human resources in child and adolescent psychiatry using average values under convergence conditions instead of price determination - analysis of the data of university hospitals in Germany concerning the costs of calculating day and minute values according to Psych-PV and PEPP-System].

    Science.gov (United States)

    Barufka, Steffi; Heller, Michael; Prayon, Valeria; Fegert, Jörg M

    2015-11-01

    Despite substantial opposition in the practical field, based on an amendment to the Hospital Financing Act (KHG). the so-called PEPP-System was introduced in child and adolescent psychiatry as a new calculation model. The 2-year moratorium, combined with the rescheduling of the repeal of the psychiatry personnel regulation (Psych-PV) and a convergence phase, provided the German Federal Ministry of Health with additional time to enter a structured dialogue with professional associations. Especially the perspective concerning the regulatory framework is presently unclear. In light of this debate, this article provides calculations to illustrate the transformation of the previous personnel regulation into the PEPP-System by means of the data of §21 KHEntgG stemming from the 22 university hospitals of child and adolescent psychiatry and psychotherapy in Germany. In 2013 there was a total of 7,712 cases and 263,694 calculation days. In order to identify a necessary basic reimbursement value th1\\t would guarantee a constant quality of patient care, the authors utilize outcomes, cost structures, calculation days, and minute values for individual professional groups according to both systems (Psych-PV and PEPP) based on data from 2013 and the InEK' s analysis of the calculation datasets. The authors propose a normative agreement on the basic reimbursement value between 270 and 285 EUR. This takes into account the concentration phenomenon and the expansion of services that has occurred since the introduction of the Psych-PV system. Such a normative agreement on structural quality could provide a verifiable framework for the allocation of human resources corresponding to the previous regulations of Psych-PV.

  13. Quantum information, oscillations and the psyche

    Science.gov (United States)

    Martin, F.; Carminati, F.; Galli Carminati, G.

    2010-05-01

    In this paper, taking the theory of quantum information as a model, we consider the human unconscious, pre-consciousness and consciousness as sets of quantum bits (qubits). We view how there can be communication between these various qubit sets. In doing this we are inspired by the theory of nuclear magnetic resonance. In this way we build a model of handling a mental qubit with the help of pulses of a mental field. Starting with an elementary interaction between two qubits we build two-qubit quantum logic gates that allow information to be transferred from one qubit to the other. In this manner we build a quantum process that permits consciousness to "read" the unconscious and vice versa. The elementary interaction, e.g. between a pre-consciousness qubit and a consciousness one, allows us to predict the time evolution of the pre-consciousness + consciousness system in which pre-consciousness and consciousness are quantum entangled. This time evolution exhibits Rabi oscillations that we name mental Rabi oscillations. This time evolution shows how for example the unconscious can influence consciousness. In a process like mourning the influence of the unconscious on consciousness, as the influence of consciousness on the unconscious, are in agreement with what is observed in psychiatry.

  14. Synchronicity, Quantum Information and the Psyche

    CERN Document Server

    Martin, Francois; Galli Carminati, Giuliana

    2009-01-01

    In this paper we describe synchronicity phenomena. As an explanation of these phenomena we propose quantum entanglement between the psychic realm known as the "unconscious" and also the classical illusion of the collapse of the wave-function. Then, taking the theory of quantum information as a model we consider the human unconscious, pre-consciousness and consciousness as sets of quantum bits (qu-bits). We analyze how there can be communication between these various qu-bit sets. In doing this we are inspired by the theory of nuclear magnetic resonance. In this manner we build quantum processes that permit consciousness to "read" the unconscious and vice-versa. The most elementary interaction, e.g. between a pre-consciousness qu-bit and a consciousness one, allows us to predict the time evolution of the pre-consciousness + consciousness system in which pre-consciousness and consciousness are quantum entangled. This time evolution exhibits Rabi oscillations that we name mental Rabi oscillations. This time evolu...

  15. Quantum information, oscillations and the psyche

    CERN Document Server

    Martin, F; Carminati, G Galli

    2010-01-01

    In this paper, taking the theory of quantum information as a model, we consider the human unconscious, pre-consciousness and consciousness as sets of quantum bits (qubits). We view how there can be communication between these various qubit sets. In doing this we are inspired by the theory of nuclear magnetic resonance. In this way we build a model of handling a mental qubit with the help of pulses of a mental field. Starting with an elementary interaction between two qubits we build two-qubit quantum logic gates that allow information to be transferred from one qubit to the other. In this manner we build a quantum process that permits consciousness to ``read{''} the unconscious and vice versa. The elementary interaction, e.g. between a pre-consciousness qubit and a consciousness one, allows us to predict the time evolution of the pre-consciousness + consciousness system in which pre-consciousness and consciousness are quantum entangled. This time evolution exhibits Rabi oscillations that we name mental Rabi o...

  16. Imago and Psyche: creative and therapeutic process

    Directory of Open Access Journals (Sweden)

    Roberto Boccalon

    2012-01-01

    Full Text Available Words are speakers for human adventure, but often they difficultly come over in memory’s labyrinth. Esthetical knowledge allows to be in contact with the most inner mind plot. Psychoanalytical view and experimental data underlined multiplicity of expressive codes, show an interpersonal process of mirroring which start with Self state regulation and seem  to confirm transposition in esthetic object of personal identity. Esthetical productions are a natural, available alphabet. The “images” realized in different  contexts  of expressive therapy intevention exemplify and confirm the theoretical arguments. The language of arts can welcome, transform and make intelligible the original and unaware emotional chaos. The evocative quality in the relation between masterpiece and interpreter, between interpreter and  fruitor/user can  be similar to the model of intimacy mother-child. Creative potential and disruptive potential are both present in human condition. It’s necessary to join courage of creation with patience and measure of therapy to promote a creative and vital process  that can be speaker of primary experience.

  17. Steve Jobs and the User Psyche

    OpenAIRE

    Denning, Peter J.

    2011-01-01

    The article of record as published may be found at http://dx.doi.org/10.1145/2043155.2043157 Peter J. Denning reflects on a meeting he had with Steve Jobs in 1988. Published in ACM Ubiquity.Ubiquity Commentary

  18. Psych "Lite:" Great Price, Less Filling

    Science.gov (United States)

    Jackson, Sherri L.; Griggs, Richard A.

    2013-01-01

    Introductory psychology textbooks have been criticized for being too long and too expensive. A national survey of introductory teachers found that 89% of introductory courses are only one term in length and that teachers could only cover 68% of a text's topics. This situation has been made more problematic by the soaring prices of…

  19. Patient care. Give psych a home.

    Science.gov (United States)

    Bilchik, Gloria Shur

    2005-02-01

    Cuts to mental health services put most hospitals in a bind when treating patients who need such care. But an Alaska hospital has found a creative--and cost-effective--way to provide psychiatric service in the emergency department.

  20. Will staff restructuring improve psych diagnoses?

    Science.gov (United States)

    2005-05-01

    Shift philosophy and supplement your staff's expertise with specialists to improve psychiatric diagnosis rates. Broaden your trauma-based model to incorporate non-urgent mental health conditions. Increase access to substance abuse specialists, psychologists/psychiatrists, and social workers. Seek to have other departments bear financial burden of making these specialists available to the ED.

  1. King Sinukwan Mythology and the Kapampangan Psyche

    Directory of Open Access Journals (Sweden)

    Julieta C. Mallari

    2009-07-01

    Full Text Available This paper focuses on the metaphorical categories of the Sinukwan legends that could account for the ethnocentric qualities of the Kapampangans (people of Pampanga, a province in the northern part of the Philippines and their behavioral patterns as a distinct race. According to oral accounts, Sinukwan, supposedly the first inhabitant in Pampanga, was a noble, gigantic being whose countenance reflected beautiful traits such as royalty, wisdom, faithfulness, ability and love. Sinukwan is a product of the Kapampangans’ primordial culture but, in many respects, he serves as a central image in the maintenance of their internal racial affinity as well as in the interaction of their past and present. On one hand, he may be perceived as an instrument of sentimental evocation. But on the other, Sinukwan is an indispensable force in asserting and reasserting the Kapampangan identity. The Kapampangans still believe that their historical beginnings were woven into and their society constructed within the realm of a powerful cultural symbol. In the development of Kapampangan civilization, Sinukwan has become an established archetype in Kapampangan arts and literature, a rallying point in the socio-political transformation of the Kapampangan community, and the paradigmatic model that is constantly invoked in the unfolding events of Kapampangan history. To be mentioned in particular is an aspect of a Sinukwan legend that provides a colorful explanation of one of the worst calamities that struck Pampanga: the eruption of Mt. Pinatubo. The story is, in a sense, an imaginative articulation of a historical phenomenon that pierced through the very heart of Kapampangan civilization and altered the course of its development.

  2. Synchronicity and the meaning-making psyche.

    Science.gov (United States)

    Colman, Warren

    2011-09-01

    This paper contrasts Jung's account of synchronicity as evidence of an objective principle of meaning in Nature with a view that emphasizes human meaning-making. All synchronicities generate indicative signs but only where this becomes a 'living symbol' of a transcendent intentionality at work in a living universe does synchronicity generate the kind of symbolic meaning that led Jung to posit the existence of a Universal Mind. This is regarded as a form of personal, experiential knowledge belonging to the 'imaginal world of meaning' characteristic of the 'primordial mind', as opposed to the 'rational world of knowledge' in which Jung attempted to present his experiences as if they were empirically and publicly verifiable. Whereas rational knowledge depends on a form of meaning in which causal chains and logical links are paramount, imaginal meaning is generated by forms of congruent correspondence-a feature that synchronicity shares with metaphor and symbol-and the creation of narratives by means of retroactive organization of its constituent elements. © 2011, The Society of Analytical Psychology.

  3. 7 CFR 201.7a - Treated seed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Treated seed. 201.7a Section 201.7a Agriculture..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) FEDERAL SEED ACT FEDERAL SEED ACT REGULATIONS Records for Agricultural and Vegetable Seeds § 201.7a Treated seed. The complete record for any...

  4. 17 CFR 260.7a-21 - Clarity.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Clarity. 260.7a-21 Section 260.7a-21 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) GENERAL RULES AND REGULATIONS, TRUST INDENTURE ACT OF 1939 General Requirements As to Contents § 260.7a-21 Clarity...

  5. Analysis list: ZBTB7A [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ZBTB7A Blood,Liver,Uterus + hg19 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/ta...rget/ZBTB7A.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/ZBTB7A.5.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/target/ZBTB7A.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/ZBTB7A.B...lood.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/ZBTB7A.Liver.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/colo/ZBTB7A.Uterus.tsv http://dbarchive.biosciencedbc.jp/kyush

  6. Reestruturação produtiva no setor bancário brasileiro e sofrimento dos caixas executivos: um estudo de caso Restructuring in the work of Brazilian banks and the consequences on the psyche of their workers

    Directory of Open Access Journals (Sweden)

    Álvaro Roberto Crespo Merlo

    2002-06-01

    , replaced workforce for computerizing systems which allow the treatment of data using less workers. These changes have not occured without consequences for the workers. These people have had to adapt themselves to the new situation, to the increase of pressure of work, of the exposure to risks and, to the end of job stability. Based on a research carried out with cashiers from a bank, an analysis of the repercussion of those changes for the workers' psyche was done with particular attention to the ways of the mobilization of intelligence and of their personality in the work and in the use of collective strategies of defence to fight the suffering. In order to carry out the research and to analyse the data, we have used the theoretical and methodological approaches of the Psychodynamics of Work, a subject which studies in which situations the conditions of the organisations determine the direction and the subjective mobilization in the work as well as the consequences of those conditions on the workers' health.

  7. Strengthening introductory psychology: A new model for teaching the introductory course.

    Science.gov (United States)

    Gurung, Regan A R; Hackathorn, Jana; Enns, Carolyn; Frantz, Susan; Cacioppo, John T; Loop, Trudy; Freeman, James E

    2016-01-01

    Introductory psychology (Intro Psych) is one of the most popular and frequently taught courses on college campuses, yet educators in psychology have limited knowledge about what is covered in classes around the nation or the extent to which class content reflects the current scope of the discipline. There is no explicit model to guide course content selection for the intro course, which poses substantial challenges for instructors. This article proposes a new model for teaching the intro course that integrates (a) scientific foundations, (b) 5 major domains or pillars of knowledge (biological, cognitive, developmental, social and personality, and mental and physical health), and (c) cross-cutting themes relevant to all domains (cultural and social diversity, ethics, variations in human functioning, and applications; American Psychological Association, 2014). We advocate for national assessment of the course, a similar introductory course for majors and nonmajors, the inclusion of experiential or laboratory components, and additional training resources for instructors of the intro course. Given the exponential growth of psychological knowledge and applications during the past decades, we caution against attempting to provide exhaustive coverage of all topic areas of psychology in a one-semester course. We conclude by discussing the challenges that lie ahead for the discipline of psychology as it launches this new model for Intro Psych. (c) 2016 APA, all rights reserved).

  8. Exon duplications in the ATP7A gene

    DEFF Research Database (Denmark)

    Mogensen, Mie; Skjørringe, Tina; Kodama, Hiroko

    2011-01-01

    BACKGROUND: Menkes disease (MD) is an X-linked, fatal neurodegenerative disorder of copper metabolism, caused by mutations in the ATP7A gene. Thirty-three Menkes patients in whom no mutation had been detected with standard diagnostic tools were screened for exon duplications in the ATP7A gene. ME...

  9. 17 CFR 260.7a-19 - Margin for binding.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Margin for binding. 260.7a-19...) GENERAL RULES AND REGULATIONS, TRUST INDENTURE ACT OF 1939 Formal Requirements § 260.7a-19 Margin for... and documents filed as a part thereof, shall have a back or stitching margin of at least 11/2 inches...

  10. ZBTB7A Suppresses Melanoma Metastasis by Transcriptionally Repressing MCAM.

    Science.gov (United States)

    Liu, Xue-Song; Genet, Matthew D; Haines, Jenna E; Mehanna, Elie K; Wu, Shaowei; Chen, Hung-I Harry; Chen, Yidong; Qureshi, Abrar A; Han, Jiali; Chen, Xiang; Fisher, David E; Pandolfi, Pier Paolo; Yuan, Zhi-Min

    2015-08-01

    The excessive metastatic propensity of melanoma makes it the most deadly form of skin cancer, yet the underlying mechanism of metastasis remains elusive. Here, mining of cancer genome datasets discovered a frequent loss of chromosome 19p13.3 and associated downregulation of the zinc finger transcription factor ZBTB7A in metastatic melanoma. Functional assessment of ZBTB7A-regulated genes identified MCAM, which encodes an adhesion protein key to melanoma metastasis. Using an integrated approach, it is demonstrated that ZBTB7A directly binds to the promoter and transcriptionally represses the expression of MCAM, establishing ZBTB7A as a bona fide transcriptional repressor of MCAM. Consistently, downregulation of ZBTB7A results in marked upregulation of MCAM and enhanced melanoma cell invasion and metastasis. An inverse correlation of ZBTB7A and MCAM expression in association with melanoma metastasis is further validated with data from analysis of human melanoma specimens. Together, these results uncover a previously unrecognized role of ZBTB7A in negative regulation of melanoma metastasis and have important clinical implications. ©2015 American Association for Cancer Research.

  11. Semaphorin 7A Aggravates Pulmonary Inflammation during Lung Injury

    Science.gov (United States)

    Schneider, Mariella; Granja, Tiago Folgosa; Rosenberger, Peter

    2016-01-01

    The extent of pulmonary inflammation during lung injury ultimately determines patient outcome. Pulmonary inflammation is initiated by the migration of neutrophils into the alveolar space. Recent work has demonstrated that the guidance protein semaphorin 7A (SEMA7A) influences the migration of neutrophils into hypoxic tissue sites, yet, its role during lung injury is not well understood. Here, we report that the expression of SEMA7A is induced in vitro through pro-inflammatory cytokines. SEMA7A itself induces the production of pro-inflammatory cytokines in endothelial and epithelial cells, enhancing pulmonary inflammation. The induction of SEMA7A facilitates the transendothelial migration of neutrophils. In vivo, animals with deletion of SEMA7A expression showed reduced signs of pulmonary inflammatory changes following lipopolysaccharide challenge. We define here the role of SEMA7A in the development of lung injury and identify a potential pathway to interfere with these detrimental changes. Future anti-inflammatory strategies for the treatment of lung injury might be based on this finding. PMID:26752048

  12. Corpo e psique: da dissociação à unificação - algumas implicações na prática pedagógica Body and psyche: from dissociation to unification - implications for pedagogical practice

    Directory of Open Access Journals (Sweden)

    Lucia Helena Pena Pereira

    2008-04-01

    Full Text Available Este trabalho tem por objetivo analisar a unicidade corpo/psique e os bloqueios de expressão pessoal, provenientes da dissociação dessas dimensões, que dificultam as atividades profissionais e a própria vida. A formação do professor exige mais que a aquisição de conteúdos e técnicas de ensino. Transformações mais profundas na prática pedagógica implicam uma mudança de atitude dos educadores, uma nova postura diante da vida e da educação, não apenas uma mudança cognitiva com a aquisição de conhecimentos, mas também mudanças emocional, corporal e espiritual, uma aprendizagem da integração das várias dimensões do ser humano. É necessário saber como superar ou minimizar bloqueios que a vida exigiu como proteção como nos mostram os estudos de Wilhelm Reich e alguns de seus continuadores - Alexander Lowen, Stanley Keleman e David Boadella -, que dão fundamentação teórica a esta pesquisa. É preciso saber como criar possibilidades de transformar padrões que são adquiridos pela formação acadêmica e que acabam por se cristalizar como evidenciam estudos pedagógicos aqui considerados. Uma das formas viáveis para tal são as atividades expressivas, dentre elas as atividades lúdicas e de arte-educação. As relações se constituem no ambiente social, o processo de crescimento se dá no contato com o outro, na percepção das diferenças, na aceitação da multiplicidade de pensamentos, na avaliação de seu próprio fazer. As teorias aqui consideradas são significativas para os estudos na área da Educação na medida em que apontam possibilidades de um novo olhar para a prática de sala de aula e as relações que nela se estabelecem.The objective of this work is to analyze the body/psyche unity and the hindrance to personal expression that arises from the dissociation of these two dimensions, complicating professional activities and life itself. The education of a teacher requires more than just the acquisition

  13. DOT-7A Type A packaging test and evaluation procedure

    Energy Technology Data Exchange (ETDEWEB)

    Kelly, D.L., Westinghouse Hanford

    1996-06-13

    The purpose of this document is to provide guidance for qualifying a DOT-7A Type A packaging for use. WHC qualifies DOT-7A packaging for two purposes. The first is to provide packages for use by WHC (manufacturer-qualified). The second is to provide a contracted service in support of DOE/EM-76 (DOE-qualified). This document includes descriptions of the performance tests, the personnel involved and their qualifications, appropriate safety and quality assurance considerations, and the procedures to be followed when WHC performs the tests (either as the manufacturer, or on behalf of the DOE`s certification program).

  14. An ancient spliceosomal intron in the ribosomal protein L7a gene (Rpl7a of Giardia lamblia

    Directory of Open Access Journals (Sweden)

    Gray Michael W

    2005-08-01

    Full Text Available Abstract Background Only one spliceosomal-type intron has previously been identified in the unicellular eukaryotic parasite, Giardia lamblia (a diplomonad. This intron is only 35 nucleotides in length and is unusual in possessing a non-canonical 5' intron boundary sequence, CT, instead of GT. Results We have identified a second spliceosomal-type intron in G. lamblia, in the ribosomal protein L7a gene (Rpl7a, that possesses a canonical GT 5' intron boundary sequence. A comparison of the two known Giardia intron sequences revealed extensive nucleotide identity at both the 5' and 3' intron boundaries, similar to the conserved sequence motifs recently identified at the boundaries of spliceosomal-type introns in Trichomonas vaginalis (a parabasalid. Based on these observations, we searched the partial G. lamblia genome sequence for these conserved features and identified a third spliceosomal intron, in an unassigned open reading frame. Our comprehensive analysis of the Rpl7a intron in other eukaryotic taxa demonstrates that it is evolutionarily conserved and is an ancient eukaryotic intron. Conclusion An analysis of the phylogenetic distribution and properties of the Rpl7a intron suggests its utility as a phylogenetic marker to evaluate particular eukaryotic groupings. Additionally, analysis of the G. lamblia introns has provided further insight into some of the conserved and unique features possessed by the recently identified spliceosomal introns in related organisms such as T. vaginalis and Carpediemonas membranifera.

  15. Test report dot7A type A liquid packaging

    Energy Technology Data Exchange (ETDEWEB)

    Ketusky, E. T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Brandjes, C. [Ameriphysics LLC, Knoxville, TN (United States); Benoit, T. J. [Argonne National Lab. (ANL), Argonne, IL (United States)

    2017-09-19

    This section presents a general description of the DOT Specification 7A Type A liquid content packaging (HVYTAL), the liquid content evaluated as its payload, acceptable payload shipping configurations and features special to its use. This test report documents compliance with the regulatory safety requirements of 49 CFR Parts 173.24, 173.24a, 173.27, 173.410, 173.412, 173.461 – 173.466 and 178.350.

  16. MPC Related Computational Capabilities of ARMv7A Processors

    DEFF Research Database (Denmark)

    Frison, Gianluca; Jørgensen, John Bagterp

    2015-01-01

    are powerful enough to solve the complex optimization problems arising in MPC in real-time, while keeping the traditional low-cost and low-power consumption. This makes these processors ideal candidates for use in embedded MPC. In this paper, we investigate the floating-point capabilities of Cortex A7, A9...... and A15 and show how to exploit the unique features of each processor to obtain the best performance, in the context of a novel implementation method for the linear-algebra routines used in MPC solvers. This method adapts high-performance computing techniques to the needs of embedded MPC. In particular...

  17. Splice Site Mutations in the ATP7A Gene

    DEFF Research Database (Denmark)

    Skjørringe, Tina; Tümer, Zeynep; Møller, Lisbeth Birk

    2011-01-01

    Menkes disease (MD) is caused by mutations in the ATP7A gene. We describe 33 novel splice site mutations detected in patients with MD or the milder phenotypic form, Occipital Horn Syndrome. We review these 33 mutations together with 28 previously published splice site mutations. We investigate 12...... mutations for their effect on the mRNA transcript in vivo. Transcriptional data from another 16 mutations were collected from the literature. The theoretical consequences of splice site mutations, predicted with the bioinformatics tool Human Splice Finder, were investigated and evaluated in relation...

  18. Test report dot 7A type a liquid packaging

    Energy Technology Data Exchange (ETDEWEB)

    Ketusky, E. T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Brandjes, C. [Ameriphysics, LLC, Knoxville, TN (United States); Benoit, T. J. [Argonne National Lab. (ANL), Argonne, IL (United States)

    2017-05-01

    This test report documents the performance of Savannah River National Laboratory’s (SRNL’s) U.S. Department of Transportation (DOT) Specification 7A; General Packaging, Type A shielded liquid shipping packaging and compliance with the regulatory requirements of Title 49 of the Code of Federal Regulations (CFR). The primary use of this packaging design is for the transport of radioactive liquids of up to 1.3 liters in an unshielded configuration and up to 113 mL of radioactive liquids in a shielded configuration, with no more than an A2 quantity in either configuration, over public highways and/or commercial aircraft. The contents are liquid radioactive materials sufficiently shielded and within the activity limits specified in173.435 or 173.433 for A2 (normal form) materials, as well as within the analyzed thermal heat limits. Any contents must be compatibly packaged and must be compatible with the packaging. The basic packaging design is based on the U.S. Department of Energy’s (DOE’s) Model 9979 Type A fissile shipping packaging designed and tested by SRNL. The shielded liquid configuration consists of the outer and inner drums of the 9979 package with additional low density polyethylene (LDPE) dunnage nesting a tungsten shielded cask assembly (WSCA) within the 30-gallon inner drum. The packaging model for the DOT Specification 7A, Type A liquids packaging is HVYTAL.

  19. REPORTABLE RADIONUCLIDES IN DWPF SLUDGE BATCH 7A (MACROBATCH 8)

    Energy Technology Data Exchange (ETDEWEB)

    Reboul, S.; Diprete, D.; Click, D.; Bannochie, C.

    2011-12-20

    The Waste Acceptance Product Specifications (WAPS) 1.2 require that the waste producer 'shall report the curie inventory of radionuclides that have half-lives longer than 10 years and that are, or will be, present in concentrations greater than 0.05 percent of the total inventory for each waste type indexed to the years 2015 and 3115.' As part of the strategy to meet WAPS 1.2, the Defense Waste Processing Facility (DWPF) will report for each waste type all radionuclides that have half-lives longer than 10 years and contribute greater than 0.01 percent of the total curie inventory from the time of production through the 1100 year period from 2015 through 3115. The initial list of radionuclides to be reported is based on the design-basis glass identified in the Waste Form Compliance Plan (WCP) and Waste Form Qualification Report. However, it is required that the list be expanded if other radionuclides with half-lives greater than 10 years are identified that meet the 'greater than 0.01% of the curie inventory' criterion. Specification 1.6 of the WAPS, International Atomic Energy Agency Safeguards Reporting for High Level Waste (HLW), requires that the ratio by weights of the following uranium and plutonium isotopes be reported: U-233, U-234, U-235, U-236, and U-238; and Pu-238, Pu-239, Pu-240, Pu-241, and Pu-242. Therefore, the complete list of reportable radionuclides must also include these sets of U and Pu isotopes - and the U and Pu isotopic mass distributions must be identified. The DWPF receives HLW sludge slurry from Savannah River Site (SRS) Tank 40. For Sludge Batch 7a (SB7a), the waste in Tank 40 contained a blend of the heel from Sludge Batch 6 (SB6) and the Sludge Batch 7 (SB7) material transferred to Tank 40 from Tank 51. This sludge blend is also referred to as Macrobatch 8. Laboratory analyses of a Tank 40 sludge sample were performed to quantify the concentrations of pertinent radionuclides in the SB7a waste. Subsequently

  20. Splice site mutations in the ATP7A gene.

    Directory of Open Access Journals (Sweden)

    Tina Skjørringe

    Full Text Available Menkes disease (MD is caused by mutations in the ATP7A gene. We describe 33 novel splice site mutations detected in patients with MD or the milder phenotypic form, Occipital Horn Syndrome. We review these 33 mutations together with 28 previously published splice site mutations. We investigate 12 mutations for their effect on the mRNA transcript in vivo. Transcriptional data from another 16 mutations were collected from the literature. The theoretical consequences of splice site mutations, predicted with the bioinformatics tool Human Splice Finder, were investigated and evaluated in relation to in vivo results. Ninety-six percent of the mutations identified in 45 patients with classical MD were predicted to have a significant effect on splicing, which concurs with the absence of any detectable wild-type transcript in all 19 patients investigated in vivo. Sixty-seven percent of the mutations identified in 12 patients with milder phenotypes were predicted to have no significant effect on splicing, which concurs with the presence of wild-type transcript in 7 out of 9 patients investigated in vivo. Both the in silico predictions and the in vivo results support the hypothesis previously suggested by us and others, that the presence of some wild-type transcript is correlated to a milder phenotype.

  1. The Tidewater Z-Degree and the INTRO Model for Sustaining OER Adoption

    Science.gov (United States)

    Wiley, David; Williams, Linda; DeMarte, Daniel; Hilton, John

    2016-01-01

    A growing body of research confirms the financial and academic benefits that accrue to students whose faculty adopt open educational resources, or OER. While there are no content licensing costs associated with using OER, there are several real costs that must be incurred by an institution that chooses to support its faculty in adopting OER. The…

  2. Predicting Who Will Fail Your Intro Course by Week 2 Based on Student Behaviors

    Science.gov (United States)

    Samson, P. J.

    2016-12-01

    Early warning systems attempt to identify students at risk based on student background and current performance. It is possible however that systems based on current performance are too late. Analytics performed over multiple semesters in multiple introductory geosciences courses at the University of Michigan has revealed that differences in in-class behaviors are related to student outcomes. In-class student behavior data were combined with background data, student surveys and LMS data and analyzed against student exam scores. The data included attendance, participation in activities, correctness in activities, volume of note taking and questions asked. This analysis has shown that a combination of student behavior data can be used to predict who will get less than 70% on the first exam with an accuracy approaching 80%. This understanding is leading to an examination of what interventions will be most effective at changing student behaviors. This presenttion discusses the data used, the modeled results and the results of our initial attempts to intervene with students projected to fail.

  3. Intro and Recent Advances: Remote Data Access via OPeNDAP Web Services

    Science.gov (United States)

    Fulker, David

    2016-01-01

    During the upcoming Summer 2016 meeting of the ESIP Federation (July 19-22), OpenDAP will hold a Developers and Users Workshop. While a broad set of topics will be covered, a key focus is capitalizing on recent EOSDIS-sponsored advances in Hyrax, OPeNDAPs own software for server-side realization of the DAP2 and DAP4 protocols. These Hyrax advances are as important to data users as to data providers, and the workshop will include hands-on experiences of value to both. Specifically, a balanced set of presentations and hands-on tutorials will address advances in1.server installation,2.server configuration,3.Hyrax aggregation capabilities,4.support for data-access from clients that are HTTP-based, JSON-based or OGC-compliant (especially WCS and WMS),5.support for DAP4,6.use and extension of server-side computational capabilities, and7.several performance-affecting matters. Topics 2 through 7 will be relevant to data consumers, data providers and notably, due to the open-source nature of all OPeNDAP software to developers wishing to extend Hyrax, to build compatible clients and servers, and/or to employ Hyrax as middleware that enables interoperability across a variety of end-user and source-data contexts. A session for contributed talks will elaborate the topics listed above and embrace additional ones.

  4. Intro til Learning Analytics & datainformeret undervisning og læring

    DEFF Research Database (Denmark)

    Ringtved, Ulla Lunde

    2016-01-01

    Introduktion til Learning Analytics – Modeller og eksempler fra forskningsfeltet Learning Analytics. Data fra ny opgavetyper, ny kompetencer, nyt læringsudbytte. Nye Målemetoder – Hvad er det vi vil måle – Hvordan viser vi det?...

  5. ResDAC - Intro to the Use of Medicare Data for Research

    Data.gov (United States)

    U.S. Department of Health & Human Services — This brief presentation outlines the educational objectives for the Introduction to Medicare workshop. Objectives of the workshop which are found in the various...

  6. Adaptation at Scale in Semi-Arid Regions ASSAR Intro Presentation

    International Development Research Centre (IDRC) Digital Library (Canada)

    Mark New

    Biophysical drivers. – Social, political, economic and governance drivers. • Research vehicle: Transformative Scenario Planning. – Social learning process. – Co-sensing/exploration of vulnerabilities, opportunities, barriers and enablers. – Co-development of scenarios of key drivers/barriers. – Co-development of adaptation ...

  7. New Media Learning: Student Podcasting and Blogging in an Intro to Meteorology Course

    Science.gov (United States)

    Small, J. D.

    2013-12-01

    Current weather events and climate change are hot media topics discussed on television, the internet, and through social media. In this world of 'Tweets', 'Texts' and constant multi-media bombardment it is becoming increasingly difficult to engage students in the learning process by simply standing at a podium and lecturing in a darkened classroom. Educational research has found that lectures place students in a passive role, preventing them from actively engaging in the learning process. Through the innovative use of multi-media platforms this study assesses the potential to create active learning opportunities (podcasting and blogging) that connect theoretical 'textbook' atmospheric science with the 'real world.' This work focuses on students enrolled in the Introduction to Meteorology course (MET 101) at the University of Hawaii at Manoa. This study summarizes the impact of the 'course-casting' technique which utilizes podcasts of lectures and supplemental material. Lecture Podcasts are used mainly as a revision tool for students by providing on-demand portable (MP3) course content that supports independent student learning. Students also produced their own podcasts (research projects) to share with classmates throughout the course relating atmospheric science content to personal 'real world' experiences. Along with podcasting, students blogged about designated topics related to weather and climate, making their knowledge and understanding accessible to other students in the course and the general internet community. Student surveys, journals, and final exit interviews are used to assess the impact of the blogging and podcasting exercises on the student learning experience. The number of times each lecture podcast was downloaded is recorded to determine the interest level in using audio lectures as a review tool. Student blogs and podcasts are evaluated based on science content accuracy and student survey evaluations of the learning experience.

  8. An intro to the Internet, Part III, the Internet and other online services.

    Science.gov (United States)

    Nicoll, L H

    1994-01-01

    Although the use of computer for word processing and spreadsheet analysis is widespread, other less well-known uses can also increase efficiency and productivity. In this bimonthly column, Dr. Nicoll discusses a variety of computer applications to help the nurse executive catch up, keep up, and get ahead.

  9. Re-thinking intro physics labs: Teaching and assessing critical thinking

    Science.gov (United States)

    Holmes, Natasha

    2017-04-01

    Taking a scientific approach to understanding and improving how we teach physics starts with figuring out what it is we are trying to measure and, therefore, what we are trying to teach. The goals of instructional lab courses have been highly debated for decades with not much research to back up either side. In this talk, I will describe new research into the efficacy of lab courses with different aims: from teaching conceptual physics to fostering critical thinking. I will demonstrate how new pedagogies are taking advantage of the unique affordances of labs to teach experimentation skills and critical thinking about data and models, without sacrificing learning traditional physics content.

  10. Creative Intelligence: Intro to Design Thinking Workshop / e-week short course flyer

    OpenAIRE

    Gibbon, Anne

    2014-01-01

    • Learn how design thinking can develop your capacity for creative intelligence. • Use the design thinking process to challenge your biases and ask better questions. • Explore the potential for rapid prototyping to support decision making.

  11. Stage-specific functions of Semaphorin7A during adult hippocampal neurogenesis rely on distinct receptors

    NARCIS (Netherlands)

    Jongbloets, Bart C.; Lemstra, Suzanne|info:eu-repo/dai/nl/413920542; Schellino, Roberta; Broekhoven, Mark H.|info:eu-repo/dai/nl/310934826; Parkash, Jyoti; Hellemons, Anita J C G M; Mao, Tianyi; Giacobini, Paolo; Van Praag, Henriette; De Marchis, Silvia; Ramakers, Geert M J|info:eu-repo/dai/nl/127710140; Pasterkamp, R. Jeroen|info:eu-repo/dai/nl/197768814

    2017-01-01

    The guidance protein Semaphorin7A (Sema7A) is required for the proper development of the immune and nervous systems. Despite strong expression in the mature brain, the role of Sema7A in the adult remains poorly defined. Here we show that Sema7A utilizes different cell surface receptors to control

  12. The English Language and the Human-Psyche Trafficking: A ...

    African Journals Online (AJOL)

    Religion Dept

    Portuguese adventurers had contact with Nigeria in the fifteenth century. This contact initiated diplomatic relationship with the Oba of Benin and Portugal. In keeping with the spirit of this relationship, the Oba sent a son of his to be educated in Portuguese ways. Thus, Portuguese is the first foreign language learned and.

  13. Engaging space: extraterrestrial architecture and the human psyche.

    Science.gov (United States)

    Sequin, Angel Marie

    2005-01-01

    The human fascination with exploring and inhabiting the space that lies beyond Earth's atmosphere continues to grow. Nevertheless, 40 years of experience to date have clearly established that humans in outer space routinely suffer significant psychological impairment arising from their stressful extraterrestrial living conditions. This paper explores those extraterrestrial conditions through the interactions between the extraordinarily harsh environment of outer space, the sensations that humans encounter in space, and the qualities of a habitat that physically interposes itself between the two. The objective of this paper is to develop a habitat that expresses the extraterrestrial condition while supporting the mental health of its inhabitants, so as to augment the success of prolonged extraterrestrial residence and interplanetary travel. c2005 Elsevier Ltd. All rights reserved.

  14. The English Language and the Human-Psyche Trafficking: A ...

    African Journals Online (AJOL)

    The English language, invading Africa, is changing Africa's world-views, wrecking cultural perspectives and gradually overpowering many languages. This bare-faced blow on indigenous languages, pivotal channels for cultural transmission and retention, has made many start thinking in English, acting out English culture, ...

  15. [Between psyche and brain : State of the art in psychiatry].

    Science.gov (United States)

    Fuchs, T

    2017-05-01

    Since its development around 1800 psychiatry has been oscillating between the poles of the sciences and the humanities, being directed towards subjective experience on the one hand and towards the neural substrate on the other hand. Today, this dualism seems to have been overcome by a naturalism, which identifies subjective experience with neural processes, according to Griesinger's frequently quoted statement "mental diseases are brain diseases". The progress achieved by the neurobiological paradigm on the level of a fundamental science is in contrast to the tendency to isolate mental illnesses from the patients' social relationships and to neglect subjectivity and intersubjectivity in their explanation. What should be searched for is therefore an overarching paradigm that is able to establish psychiatry as a relational medicine in an encompassing sense: as a science and practice of biological, psychological and social relationships and their disorders. Within such a paradigm, the brain may be understood and investigated as the central "relational organ" without reductionist constrictions.

  16. Jung's "Psychology with the Psyche" and the Behavioral Sciences.

    Science.gov (United States)

    Jones, Raya A

    2013-09-01

    The behavioral sciences and Jung's analytical psychology are set apart by virtue of their respective histories, epistemologies, and definitions of subject matter. This brief paper identifies Jung's scientific stance, notes perceptions of Jung and obstacles for bringing his system of thought into the fold of the behavioral sciences. The impact of the "science versus art" debate on Jung's stance is considered with attention to its unfolding in the fin de siècle era.

  17. Dietary and psych predictors of weight loss after gastric bypass.

    Science.gov (United States)

    Fox, Benjamin; Chen, Ellie; Suzo, Andrew; Jolles, Sally; Greenberg, Jacob A; Campos, Guilherme M; Voils, Corrine I; Funk, Luke M

    2015-08-01

    Identifying severely obese patients who will succeed after bariatric surgery remains challenging. Although numerous studies have attempted to identify preoperative patient characteristics associated with weight loss, the roles of many dietary and psychological characteristics are unclear. The purpose of this study was to examine preoperative dietary and psychological predictors of successful weight loss after bariatric surgery. This retrospective cohort study included all patients who underwent laparoscopic Roux-en-Y gastric bypass from September 2011-June 2013 at a single institution (n = 124). Patient demographics, comorbidities, dietary and psychological factors, and weight loss outcomes were extracted from the electronic medical record. Bivariate associations between these factors and successful weight loss (≥50% excess body weight) were examined. Factors significant at P ≤ 0.1 were included in a multivariate logistic regression model. On bivariate analysis, absence of either type 2 diabetes or hypertension, preoperative weight 50 lbs, no previous purging or family history of obesity, and no soda consumption preoperatively were associated with successful weight loss (P 50 lbs (OR, 0.12 [95% CI, 0.04-0.43]), and decreasing soda consumption by >50% (OR, 0.27 [95% CI, 0.08-0.99]). Patients with type 2 diabetes mellitus, significant previous weight loss, and poor soda consumption habits are more likely to experience suboptimal weight loss after bariatric surgery. Additional preoperative counseling and close postoperative follow-up is warranted for these patients. Copyright © 2015 Elsevier Inc. All rights reserved.

  18. Reparative therapy: the adolescent, the psych nurse, and the issues.

    Science.gov (United States)

    Hein, Laura C; Matthews, Alicia K

    2010-02-01

    Reparative therapy aims to modify the sexual orientation of lesbian, gay, and bisexual (LGB) people into that of heterosexuals. Although denounced as harmful by most professional organizations, these treatments continue-youth may be particularly vulnerable to the negative consequences. The purpose of this article is to discuss reparative therapies, the potential harm LGB youth may experience, clinical and practice issues for psychiatric nurses, and the ethical issues surrounding nurse involvement in reparative therapy. Reparative therapy for adolescents raises important clinical and ethical issues for psychiatric nursing. Further discussion of nurse involvement in these treatments is needed.

  19. Engaging space: extraterrestrial architecture and the human psyche

    Science.gov (United States)

    Marie Seguin, Angel

    2005-05-01

    The human fascination with exploring and inhabiting the space that lies beyond Earth's atmosphere continues to grow. Nevertheless, 40 years of experience to date have clearly established that humans in outer space routinely suffer significant psychological impairment arising from their stressful extraterrestrial living conditions. This paper explores those extraterrestrial conditions through the interactions between the extraordinarily harsh environment of outer space, the sensations that humans encounter in space, and the qualities of a habitat that physically interposes itself between the two. The objective of this paper is to develop a habitat that expresses the extraterrestrial condition while supporting the mental health of its inhabitants, so as to augment the success of prolonged extraterrestrial residence and interplanetary travel.

  20. Meditation, Mindfulness, Psyche and Soma: Eastern, Western Perspectives

    DEFF Research Database (Denmark)

    Singla, Rashmi; Jordanov, Daniel; Autrup, Mads

    This presentation focuses on the genesis of meditation and mindfulness in the East for comprehension of these phenomena, which are increasingly applied and adapted in the current Western context. Their very origin from the East, particularly Buddhism and Yoga practices, directs our attention...... to the three major assumptions about human nature; the monoism between mind and body, the centrality of consciousness and meditation as a part of daily conduct. The mainstream Western understandings promoting the body-mind dualism are challenged by invoking the bodily experiences and consciousness emphasising...... is perceived as a way of resisting dualisms and binaries regarding psychological, physical, social and spiritual realities. We conclude that without a holistic, integrated understanding of the basic principles and assumptions in which meditation and mindfulness are embedded, there is a risk for these phenomena...

  1. Psyche/Logos: Mapping the Terrains of Mind and Rhetoric.

    Science.gov (United States)

    Baumlin, James S.; Baumlin, Tita French

    1989-01-01

    Discusses rhetoric as mirroring psychology. Examines Aristotle's three "pisteis"--the pathetic, logical, and ethical proofs, paralleling them to Freud's id, ego, and super-ego. Explores an adequate feminine psychology and a corresponding rhetoric. Outlines two models of persuasive discourse, the rational world paradigm and the narrative…

  2. Test plan for the M-100 container, (model M-101/7A/12/90) docket 96-43-7A, type A container. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Kelly, D.L.

    1997-07-22

    This report concerns the packaging configurations being tested by the U.S. DOE and its contractors, and according to U.S. DOT specification 7A Type A (DOT-7A) requirements. The objective of this Test Plan is to describe the testing for the qualification of the M-100 Container, Model M-101/7A/12/90 as a DOT-7A Type A packaging. This packaging system is designed to ship Type A solid radioactive materials, normal form, Form Number 1, Form Number 2, and Form Number 3.

  3. Data of evolutionary structure change: 1BNFA-3DA7A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BNFA-3DA7A 1BNF 3DA7 A A ---------------------------------------...EEEEEE EEEEE HHHHHHHHHHHH HHHHHH HHHH EE ---------------------------------EEE ----------- ...EVID> 0 1BNF... A 1BNFA VINTF-DGVAD

  4. Data of evolutionary structure change: 1BSEA-3DA7A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BSEA-3DA7A 1BSE 3DA7 A A --------------------------------------------VINTF-DGVADY...LQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRIVYSSDWLIYKTTDHYQTFTKIR...SSDWLIYKTTDHYQTFTKIRCAQVINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGK-------------...1BSE A 1BSEA VINTF-DGVAD

  5. Pri-let-7a-1 rs10739971 polymorphism is associated with gastric cancer prognosis and might affect mature let-7a expression

    Directory of Open Access Journals (Sweden)

    Li Y

    2016-07-01

    Full Text Available Ying Li, Qian Xu, Jingwei Liu, Caiyun He, Quan Yuan, Chengzhong Xing, Yuan Yuan Tumor Etiology and Screening Department of Cancer Institute and General Surgery, the First Affiliated Hospital of China Medical University, and Key Laboratory of Cancer Etiology and Prevention (China Medical University, Liaoning Provincial Education Department, Shenyang, People’s Republic of China Abstract: The relationship between the pri-let-7a-1 rs10739971 polymorphism and gastric cancer (GC risk has been reported. However, the role of this polymorphism in the prognosis of GC remains largely elusive. Sequenom MassARRAY platform method and the polymerase chain reaction (PCR-restriction fragment length polymorphism were used to investigate pri-let-7a-1 rs10739971 G→A in 334 GC patients. Real-time PCR detected expression of mature let-7a in serum and tissue. Patients with AA or GA+AA genotypes of the pri-let-7a-1 rs10739971 polymorphism demonstrated significantly longer survival time than those with the wild GG genotype. Stratified analysis indicated that survival time was significantly longer in women with AA or GA+AA genotypes and in Borrmann type I/II patients with GA heterozygote or GA+AA genotypes. AA genotype was more frequent in the lymphatic-metastasis-negative subgroup. Serum mature let-7a expression in healthy people with the GA heterozygote and the GA+AA genotype was higher than in those with the GG genotype, and the difference remained significant in the female healthy subgroup. Pri-let-7a-1 rs10739971 polymorphism might be a biomarker for GC prognosis, especially for female and Borrmann type I/II patients. The pri-let-7a-1 rs10739971 polymorphism might affect serum mature let-7a expression, and partly explain the mechanism of the relationship between the pri-let-7a-1 rs10739971 polymorphism and GC survival. Keywords: miRNA, let-7a, polymorphism, gastric cancer, prognosis, expression

  6. ZBTB7A Enhances Osteosarcoma Chemoresistance by Transcriptionally Repressing lncRNALINC00473-IL24 Activity

    Directory of Open Access Journals (Sweden)

    Lu Zhang

    2017-11-01

    Full Text Available Chemoresistance remains a major drawback to osteosarcoma treatment. ZBTB7A, a member of the POK transcription repressor family, was shown to play an important role in tumorigenesis. However, the effect of ZBTB7A on osteosarcoma chemoresistance is completely unknown. In this study, we found that ZBTB7A is increased in cisplatin-resistant osteosarcoma cells and that elevated ZBTB7A inhibits cisplatin-induced apoptosis by repressing LINC00473 expression. Further mechanistic studies revealed that ZBTB7A directly binds to the promoter and suppresses the transcription of LINC00473. Additionally, our data indicate that LINC00473 interacts with the transcript factor C/EBPβ, facilitating its binding to the promoter of IL24, leading to decrease chemoresistance. Thus, these findings indicate that the ZBTB7A-mediated LINC00473-C/EBPβ-IL24 pathway is a promising novel target for overcoming cisplatin resistance in osteosarcoma.

  7. Let7a involves in neural stem cell differentiation relating with TLX level

    Energy Technology Data Exchange (ETDEWEB)

    Song, Juhyun [Department of Anatomy, Yonsei University College of Medicine, Seoul (Korea, Republic of); Cho, Kyoung Joo; Oh, Yumi [Department of Anatomy, Yonsei University College of Medicine, Seoul (Korea, Republic of); BK21 Plus Project for Medical Sciences, and Brain Research Institute, Yonsei University College of Medicine, Seoul (Korea, Republic of); Lee, Jong Eun, E-mail: jelee@yuhs.ac [Department of Anatomy, Yonsei University College of Medicine, Seoul (Korea, Republic of); BK21 Plus Project for Medical Sciences, and Brain Research Institute, Yonsei University College of Medicine, Seoul (Korea, Republic of)

    2015-07-10

    Neural stem cells (NSCs) have the potential for differentiation into neurons known as a groundbreaking therapeutic solution for central nervous system (CNS) diseases. To resolve the therapeutic efficiency of NSCs, recent researchers have focused on the study on microRNA's role in CNS. Some micro RNAs have been reported significant functions in NSC self-renewal and differentiation through the post-transcriptional regulation of neurogenesis genes. MicroRNA-Let7a (Let7a) has known as the regulator of diverse cellular mechanisms including cell differentiation and proliferation. In present study, we investigated whether Let7a regulates NSC differentiation by targeting the nuclear receptor TLX, which is an essential regulator of NSC self-renewal, proliferation and differentiation. We performed the following experiments: western blot analysis, TaqMan assay, RT-PCR, and immunocytochemistry to confirm the alteration of NSCs. Our data showed that let7a play important roles in controlling NSC fate determination. Thus, manipulating Let-7A and TLX could be a novel strategy to enhance the efficiency of NSC's neuronal differentiation for CNS disorders. - Highlights: • Let7a influences on NSC differentiation and proliferation. • Let7a involves in mainly NSC differentiation rather than proliferation. • Let7a positively regulates the TLX expression.

  8. Data of evolutionary structure change: 1AHPA-1XC7A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AHPA-1XC7A 1AHP 1XC7 A A ---SQPIFN---DKQFQEALSRQWQ-RYGLNSAAEMTPRQWWLAVSEALAEMLRAQ...1AHP A 1AHPA SRQWQ-RYGLN ...1AHP A 1AHPA GGAVT---KDGRW...1AHP A 1AHPA LAVVH---DKQVH...1AHP A 1AHPA RYGLNSAAEMT

  9. Data of evolutionary structure change: 1ACLA-1GZ7A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ACLA-1GZ7A 1ACL 1GZ7 A A SELLVNTKS-GKVMGTRVPVLSSHISAFLGIPFAEPPVG...PVDGTYGTEIYNQVVASAGCGSASD--KLACLRGLSQDTLYQATSDTPGVLAYPSLRLSYLPRPDGTFITDDMYALVRDGK...el> 0 1ACL A 1ACL...14> 1ACL A 1ACLA...in> 1ACL A 1ACLA

  10. Small amounts of functional ATP7A protein permit mild phenotype

    DEFF Research Database (Denmark)

    Møller, Lisbeth Birk

    2015-01-01

    in the ATP7A gene. We have conducted several studies in the hope of uncovering the relationship between genotype and phenotype. We have examined the X-inactivation pattern in affected females, the effect of exon-deletions and-duplications, and splice-site mutations on the composition and amount of ATP7A...... individuals exhibited preferential inactivation of the X-chromosome with the mutated ATP7A gene. The observed mild phenotype in some patients with mutations that effect the composition of the ATP7A transcript, seems to be explained by the presence of a small amount of normal ATP7A transcript. The location...... of missense mutations on structural models of the ATP7A protein suggests that affected conserved residues generally lead to a severe phenotype. The ATP7A protein traffics within the cells. At low copper levels, ATP7A locates to the Trans-Golgi Network (TGN) to load cuproenzymes with copper, whereas at higher...

  11. Data of evolutionary structure change: 1AQ7A-2FOCA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AQ7A SLNSG-----YHFCG >EEE ----- EE... A 2FOCA SLQYRSGSSWAHTCG ...>EEEEEE EEE EE> ATOM 123 CA SER A 32 54.310 29.996 36.5...Q7A PVVCS----GKLQG >EEEE ---- EEEEcture...cture>EEEEEE EEEEEE>

  12. Data of evolutionary structure change: 1ALCA-1GF7A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1ALCA-1GF7A 1ALC 1GF7 A A KQFTKCELSQNLYDI--DGYGRIALPELICTMFHTSGYDTQAIVEND--ESTEYGL...1ALC A 1ALCA NLYDI--DGYGR...1ALC A 1ALCA IVEND--ESTEY...1ALC A 1ALCA KILDI-KGIDY ...1ALC A 1ALCA ALCTE-KLEQW

  13. Data of evolutionary structure change: 1BAYB-1OE7A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available pdbChain>B 1BAYB KFEDG-----DLTLY ...>EEEE ----- EEE > ATOM 1839 CA LYS B 54 22.283 44.646 -22...hain>1OE7A AVKITDNHGHVKWMV ture>EEEEEE EEEEE ...ure> - Hre> A...tryIDChain>1OE7A KEFLTGKYPEI ucture> HHH

  14. Xylan oligosaccharides and cellobiohydrolase I (TrCeI7A) interaction and effect on activity

    DEFF Research Database (Denmark)

    Baumann, Martin Johannes; Borch, Kim; Westh, Peter

    2011-01-01

    and an enzyme variant without the cellulose-binding domain (CBM). Results We studied the binding of XOSs to TrCel7A by isothermal titration calorimetry. We found that XOSs bind to TrCel7A and that the affinity increases commensurate with XOS length. The CBM, on the other hand, did not affect the affinity...

  15. ZBTB7A acts as a tumor suppressor through the transcriptional repression of glycolysis

    Science.gov (United States)

    Liu, Xue-Song; Haines, Jenna E.; Mehanna, Elie K.; Genet, Matthew D.; Ben-Sahra, Issam; Asara, John M.; Manning, Brendan D.

    2014-01-01

    Elevated glycolysis is a common metabolic trait of cancer, but what drives such metabolic reprogramming remains incompletely clear. We report here a novel transcriptional repressor-mediated negative regulation of glycolysis. ZBTB7A, a member of the POK (POZ/BTB and Krüppel) transcription repressor family, directly binds to the promoter and represses the transcription of critical glycolytic genes, including GLUT3, PFKP, and PKM. Analysis of The Cancer Genome Atlas (TCGA) data sets reveals that the ZBTB7A locus is frequently deleted in many human tumors. Significantly, reduced ZBTB7A expression correlates with up-regulation of the glycolytic genes and poor survival in colon cancer patients. Remarkably, while ZBTB7A-deficient tumors progress exceedingly fast, they exhibit an unusually heightened sensitivity to glycolysis inhibition. Our study uncovers a novel tumor suppressor role of ZBTB7A in directly suppressing glycolysis. PMID:25184678

  16. DFT, Hirshfeld surfaces, spectral and in vivo cytotoxic studies of 7a-Aza-B-homostigmast-5-eno [7a,7-d] tetrazole

    Science.gov (United States)

    Alam, Mahboob; Alam, Mohammad Jane; Nami, Shahab A. A.; Khan, Mohd Shoeb; Ahmad, Shabbir; Lee, Dong-Ung

    2015-11-01

    The DFT (B3LYP) calculations on a synthetic steroidal molecule 7a-Aza-B-homostigmast-5-eno [7a,7-d] tetrazole, C29H48N4, have been performed. The molecular structure, IR and NMR (13C and 1H) spectra of the present compound were interpreted using experiments (XRD, FTIR, NMR) as well as theoretical, B3LYP/6-311 + G(2d,p), calculations. The vibrational bands appearing in FTIR are assigned with great accuracy using animated modes. Molecular properties like HOMO-LUMO analysis, chemical reactivity descriptors, MEP mapping, dipole moment and Mullikan's atomic charges have been presented at the same level of theory. The theoretical results are found in good correlation with experimental data. Moreover, the Hirshfeld analysis was carried out to ascertain the secondary interactions and associated 2D fingerprint plots. The in vivo cytotoxicity of 7a-Aza-B-homostigmast-5-eno [7a,7-d] has also been carried out against brine shrimp nauplii by lethality bioassay.

  17. Semaphorin 7A as a Potential Therapeutic Target for Multiple Sclerosis.

    Science.gov (United States)

    Gutiérrez-Franco, Ana; Eixarch, Herena; Costa, Carme; Gil, Vanessa; Castillo, Mireia; Calvo-Barreiro, Laura; Montalban, Xavier; Del Río, José A; Espejo, Carmen

    2017-08-01

    Semaphorin 7A (sema7A) is classified as an immune semaphorin with dual functions in the immune system and in the central nervous system (CNS). These molecules are of interest due to their potential role in multiple sclerosis (MS), which is a chronic demyelinating and neurodegenerative disease of autoimmune origin. In this study, we elucidated the role of sema7A in neuroinflammation using both in vitro and in vivo experimental models. In an in vitro model of neuroinflammation, using cerebellar organotypic slice cultures, we observed that challenge with lipopolysaccharide (LPS) endotoxin did not affect demyelination or cell death in sema7A-deficient cultures compared to wild-type cultures. Moreover, the in vivo outcome of experimental autoimmune encephalomyelitis (EAE) in sema7A-deficient mice was altered in an antigen- and adjuvant-dose-dependent manner, while no differences were observed in the wild-type counterparts. Altogether, these results indicate that sema7A is involved in peripheral immunity and CNS inflammation in MS pathogenesis. Indeed, these data suggest that sema7A might be a potential therapeutic target to treat MS and autoimmune conditions.

  18. The Activity of Menkes Disease Protein ATP7A Is Essential for Redox Balance in Mitochondria

    Energy Technology Data Exchange (ETDEWEB)

    Bhattacharjee, Ashima; Yang, Haojun; Duffy, Megan; Robinson, Emily; Conrad-Antoville, Arianrhod; Lu, Ya-Wen; Capps, Tony; Braiterman, Lelita; Wolfgang, Michael; Murphy, Michael P.; Yi, Ling; Kaler, Stephen G.; Lutsenko, Svetlana; Ralle, Martina

    2016-05-16

    Copper-transporting ATPase ATP7A is essential for mammalian copper homeostasis. Loss of ATP7A activity is associated with fatal Menkes disease and various other pathologies. In cells, ATP7A inactivation disrupts copper transport from the cytosol into the secretory pathway. Using fibroblasts from Menkes disease patients and mouse 3T3-L1 cells with a CRISPR/Cas9-inactivated ATP7A, we demonstrate that ATP7A dysfunction is also damaging to mitochondrial redox balance. In these cells, copper accumulates in nuclei, cytosol, and mitochondria, causing distinct changes in their redox environment. Quantitative imaging of live cells using GRX1-roGFP2 and HyPer sensors reveals highest glutathione oxidation and elevation of H2O2 in mitochondria, whereas the redox environment of nuclei and the cytosol is much less affected. Decreasing the H2O2 levels in mitochondria with MitoQ does not prevent glutathione oxidation; i.e. elevated copper and not H2O2 is a primary cause of glutathione oxidation. Redox misbalance does not significantly affect mitochondrion morphology or the activity of respiratory complex IV but markedly increases cell sensitivity to even mild glutathione depletion, resulting in loss of cell viability. Thus, ATP7A activity protects mitochondria from excessive copper entry, which is deleterious to redox buffers. Mitochondrial redox misbalance could significantly contribute to pathologies associated with ATP7A inactivation in tissues with paradoxical accumulation of copper (i.e. renal epithelia).

  19. Metal-dependent regulation of ATP7A and ATP7B in fibroblast cultures

    Directory of Open Access Journals (Sweden)

    Lenartowicz Malgorzata

    2016-08-01

    Full Text Available Deficiency of one of the copper transporters ATP7A and ATP7B leads to the rare X-linked disorder Menkes Disease (MD or the rare autosomal disorder Wilson disease (WD, respectively. In order to investigate whether the ATP7A and the ATP7B genes may be transcriptionally regulated, we measured the expression level of the two genes at various concentrations of iron, copper and insulin. Treating fibroblasts from controls or from individuals with MD or WD for 3 and10 days with iron chelators revealed that iron deficiency led to increased transcript levels of both ATP7A and ATP7B. Copper deficiency obtained by treatment with the copper chelator led to a downregulation of ATP7A in the control fibroblasts, but surprisingly not in the WD fibroblasts. In contrast, the addition of copper led to an increased expression of ATP7A, but a decreased expression of ATP7B. Thus, whereas similar regulation patterns for the two genes were observed in response to iron deficiency, different responses were observed after changes in the access to copper. Mosaic fibroblast cultures from female carriers of MD treated with copper or copper chelator for 6-8 weeks led to clonal selection. Cells that express the normal ATP7A allele had a selective growth advantage at high copper concentrations, whereas more surprisingly, cells that express the mutant ATP7A allele had a selective growth advantage at low copper concentrations. Thus, although the transcription of ATP7A is regulated by copper, clonal growth selection in mosaic cell cultures is affected by the level of copper. Female carriers of MD are rarely affected probably due to a skewed inactivation of the X-chromosome bearing the ATP7A mutation.

  20. Efficient cell culture system for hepatitis C virus genotype 7a

    DEFF Research Database (Denmark)

    2013-01-01

    Genotype 7a has been identified recently, thus not much is known about the biology of this new, major HCV genotype. The present inventors developed hepatitis C virus 7a/2a intergenotypic recombinants in which the JFH1 structural genes (Core, E1 and E2), p7 and the complete NS2 were replaced...... by the corresponding genes of the genotype 7a strain QC69 and characterized them in Huh7.5 cells. Sequence analysis of 7a/JFH1 recombinants recovered after viral passage in Huh7.5 cells following 4 independent transfection experiments revealed adaptive mutations in Core, E2, NS2, NS5A and NS5B. In reverse genetic...... in HCV genotype 7, including vaccine studies and functional analyses...

  1. Metal-dependent regulation of ATP7A and ATP7B in fibroblast cultures

    DEFF Research Database (Denmark)

    Lenartowicz, Malgorzata; Moos, Torben; Ogórek, Mateusz

    2016-01-01

    Deficiency of one of the copper transporters ATP7A and ATP7B leads to the rare X-linked disorder Menkes Disease (MD) or the rare autosomal disorder Wilson disease (WD), respectively. In order to investigate whether the ATP7A and the ATP7B genes may be transcriptionally regulated, we measured...... the expression level of the two genes at various concentrations of iron, copper, and insulin. Treating fibroblasts from controls or from individuals with MD or WD for 3 and 10 days with iron chelators revealed that iron deficiency led to increased transcript levels of both ATP7A and ATP7B. Copper deficiency...... for the two genes were observed in response to iron deficiency, different responses were observed after changes in the access to copper. Mosaic fibroblast cultures from female carriers of MD treated with copper or copper chelator for 6-8 weeks led to clonal selection. Cells that express the normal ATP7A...

  2. Certification of packagings: compliance with DOT specification 7A packaging requirements

    Energy Technology Data Exchange (ETDEWEB)

    Edling, D.A.

    1976-10-08

    A study was conducted to determine which of the packagings currently listed in CFR 49 Section 173.395 a.1-5, meet the Specification 7A requirements (CFR 49 Section 173.350). According to DOT HM-111 the present listing of various authorized DOT specifications in Section 173.394 and Section 173.395 (Type A containers) of ICC Tariff No. 27 would be deleted with complete reliance being placed on the use of DOT 7A, Type A general packaging specification. Each user of a Specification 7A package would be required to document and maintain on file for one year a written record of his determination of compliance with the DOT Specification 7A performance requirements. All the specification packagings listed in CFR 49 Section 173.395a.1-5 were tested and shown to meet the Specification 7A criteria; however, in many cases qualifications were placed on their use. Forty-nine specification packagings were tested and shown to meet the DOT Specification 7A performance requirements and since there were several styles of some specific packagings, this amounts to greater than 80 packagings. The extensive testing generally indicated a high degree of containment integrity in the packagings tested and the documentation discussed is a valuable tool for shippers of Type A quantities of radioactive materials. (DLC)

  3. Naringenin Ameliorated Kidney Injury through Let-7a/TGFBR1 Signaling in Diabetic Nephropathy

    Directory of Open Access Journals (Sweden)

    Ning Yan

    2016-01-01

    Full Text Available Diabetic nephropathy (DN is one of the most common complications of diabetes mellitus (DM. However, the exact mechanism is not clearly understood. In this study, our results showed that 24 h urinary protein, kidney index, and glomerular area were decreased, while creatinine clearance ratio was increased in DN rats when the rats were treated with NAR 50 mg/d for 6 weeks. Mesangial cell (MMCs proliferation was inhibited in the NAR group by 3,(4,5-dimethyl-2-thiazolyl-2,5-diphenyl-2H-tetrazolium bromide (MTT, and the cell cycle analysis showed that cells stayed in G2 phase in NAR group. And NAR treatment attenuated the deposition of ECM in DN rats and MMCs. Moreover, our data showed that let-7a was downexpressed in both DN rats and MMCs under high glucose condition. Surprisingly, NAR affected the expressions of Col4 and FN through upregulating let-7a in MMCs. In addition, we found that let-7a negatively regulated the expression of transforming growth factor-β1 receptor 1 (TGFBR1, and TGFBR1 was required for the let-7a-mediated downregulation of TGF-β1/smad signaling. Interestingly, NAR inhibited TGF-β1/smads signaling activation by upregulating let-7a. Therefore, our findings indicated that NAR ameliorated kidney injury by regulating let-7a/TGFBR1 signaling.

  4. The Activity of Menkes Disease Protein ATP7A Is Essential for Redox Balance in Mitochondria.

    Science.gov (United States)

    Bhattacharjee, Ashima; Yang, Haojun; Duffy, Megan; Robinson, Emily; Conrad-Antoville, Arianrhod; Lu, Ya-Wen; Capps, Tony; Braiterman, Lelita; Wolfgang, Michael; Murphy, Michael P; Yi, Ling; Kaler, Stephen G; Lutsenko, Svetlana; Ralle, Martina

    2016-08-05

    Copper-transporting ATPase ATP7A is essential for mammalian copper homeostasis. Loss of ATP7A activity is associated with fatal Menkes disease and various other pathologies. In cells, ATP7A inactivation disrupts copper transport from the cytosol into the secretory pathway. Using fibroblasts from Menkes disease patients and mouse 3T3-L1 cells with a CRISPR/Cas9-inactivated ATP7A, we demonstrate that ATP7A dysfunction is also damaging to mitochondrial redox balance. In these cells, copper accumulates in nuclei, cytosol, and mitochondria, causing distinct changes in their redox environment. Quantitative imaging of live cells using GRX1-roGFP2 and HyPer sensors reveals highest glutathione oxidation and elevation of H2O2 in mitochondria, whereas the redox environment of nuclei and the cytosol is much less affected. Decreasing the H2O2 levels in mitochondria with MitoQ does not prevent glutathione oxidation; i.e. elevated copper and not H2O2 is a primary cause of glutathione oxidation. Redox misbalance does not significantly affect mitochondrion morphology or the activity of respiratory complex IV but markedly increases cell sensitivity to even mild glutathione depletion, resulting in loss of cell viability. Thus, ATP7A activity protects mitochondria from excessive copper entry, which is deleterious to redox buffers. Mitochondrial redox misbalance could significantly contribute to pathologies associated with ATP7A inactivation in tissues with paradoxical accumulation of copper (i.e. renal epithelia). © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

  5. Novel and recurrent MYO7A mutations in Usher syndrome type 1 and type 2.

    Directory of Open Access Journals (Sweden)

    Weining Rong

    Full Text Available Usher syndrome (USH is a group of disorders manifested as retinitis pigmentosa and bilateral sensorineural hearing loss, with or without vestibular dysfunction. Here, we recruited three Chinese families affected with autosomal recessive USH for detailed clinical evaluations and for mutation screening in the genes associated with inherited retinal diseases. Using targeted next-generation sequencing (NGS approach, three new alleles and one known mutation in MYO7A gene were identified in the three families. In two families with USH type 1, novel homozygous frameshift variant p.Pro194Hisfs*13 and recurrent missense variant p.Thr165Met were demonstrated as the causative mutations respectively. Crystal structural analysis denoted that p.Thr165Met would very likely change the tertiary structure of the protein encoded by MYO7A. In another family affected with USH type 2, novel biallelic mutations in MYO7A, c.[1343+1G>A];[2837T>G] or p.[?];[Met946Arg], were identified with clinical significance. Because MYO7A, to our knowledge, has rarely been correlated with USH type 2, our findings therefore reveal distinguished clinical phenotypes associated with MYO7A. We also conclude that targeted NGS is an effective approach for genetic diagnosis for USH, which can further provide better understanding of genotype-phenotype relationship of the disease.

  6. 7a, 25-dihydroxycholesterol-mediated activation of EBI2 in immune regulation and diseases

    Directory of Open Access Journals (Sweden)

    Siquan eSun

    2015-03-01

    Full Text Available EBI2, aka GPR183, is a G-couple receptor originally identified in 1993 as one of main genes induced in Burkitt’s lymphoma cell line BL41 by Epstein-Barr virus (EBV infection. After it was reported in 2009 that the receptor played a key role in regulating B cell migration and responses, we initiated an effort in looking for its endogenous ligand. In 2011 we and another group reported the identification of 7a, 25-dihydroxyxcholesterol (7a, 25-OHC, an oxysterol, as the likely physiological ligand of EBI2. A few subsequently published studies further elucidated how 7a, 25-OHC bound to EBI2, and how a gradient of 7a, 25-OHC could be generated in vivo and regulated migration, activation, and functions of B cells, T cells, dendritic cells (DC, monocytes/macrophages and astrocytes. The identification of 7a, 25-OHC as a GPCR ligand revealed a previously unknown signaling system of oxysterols, a class of molecules which exert profound biological functions. Dysregulation of the synthesis or functions of these molecules is believed to contribute to inflammation and autoimmune diseases, cardiovascular diseases, neurodegenerative diseases, cancer as well as metabolic diseases such as diabetes, obesity, and dyslipidemia. Therefore EBI2 may represent a promising target for therapeutic interventions for human diseases.

  7. Let7a involves in neural stem cell differentiation relating with TLX level.

    Science.gov (United States)

    Song, Juhyun; Cho, Kyoung Joo; Oh, Yumi; Lee, Jong Eun

    2015-07-10

    Neural stem cells (NSCs) have the potential for differentiation into neurons known as a groundbreaking therapeutic solution for central nervous system (CNS) diseases. To resolve the therapeutic efficiency of NSCs, recent researchers have focused on the study on microRNA's role in CNS. Some micro RNAs have been reported significant functions in NSC self-renewal and differentiation through the post-transcriptional regulation of neurogenesis genes. MicroRNA-Let7a (Let7a) has known as the regulator of diverse cellular mechanisms including cell differentiation and proliferation. In present study, we investigated whether Let7a regulates NSC differentiation by targeting the nuclear receptor TLX, which is an essential regulator of NSC self-renewal, proliferation and differentiation. We performed the following experiments: western blot analysis, TaqMan assay, RT-PCR, and immunocytochemistry to confirm the alteration of NSCs. Our data showed that let7a play important roles in controlling NSC fate determination. Thus, manipulating Let-7A and TLX could be a novel strategy to enhance the efficiency of NSC's neuronal differentiation for CNS disorders. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

  8. Pre-steady-state Kinetics for Hydrolysis of Insoluble Cellulose by Cellobiohydrolase Cel7A

    DEFF Research Database (Denmark)

    Cruys-Bagger, Nicolaj; Olsen, Jens Elmerdahl; Præstgaard, Eigil

    2012-01-01

    complex, processive hydrolysis, and dissociation, respectively. These kinetic parameters elucidate limiting factors in the cellulolytic process. We concluded, for example, that Cel7A cleaves about four glycosidic bonds/s during processive hydrolysis. However, the results suggest that stalling...... for the exo-acting cellulase Cel7A using amperometric biosensors and an explicit model for processive hydrolysis of cellulose. This analysis allows the identification of a pseudo-steady-state period and quantification of a processivity number as well as rate constants for the formation of a threaded enzyme...

  9. Test and evaluation document for DOT Specification 7A Type A Packaging. Revision 3

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-01-30

    The US Department of Energy (DOE) has been conducting, through several of its operating contractors, an evaluation and testing program to qualify Type A radioactive material packagings per US Department of Transportation (DOT) Specification 7A (DOT-7A) of the Code of Federal Regulations (CFR), Title 49, Part 178 (49 CFR 178). The program is currently administered by the DOE, Office of Facility Safety Analysis, DOE/EH-32, at DOE-Headquarters (DOE-HQ) in Germantown, Maryland. This document summarizes the evaluation and testing performed for all of the packagings successfully qualified in this program.

  10. Data of evolutionary structure change: 1JK7A-2IE4C [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1JK7A-2IE4C 1JK7 2IE4 A C -KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSR...AKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA- FTKELDQWIEQLNE--------CKQ... LYS CA 260 LEU CA 355 TRP CA 408 2IE...4 C 2IE4C CLRKYGNANVW 1 2IE4 C 2IE

  11. Targeting ATP7A to increase the sensitivity of neuroblastoma cells to retinoid therapy.

    Science.gov (United States)

    Cheung, B B; Marshall, G M

    2011-09-01

    Following the discovery that defective retinoid signaling directly contributes to tumorigenesis, and, that retinoids have an anti-cancer effect in vitro and in vivo, retinoids have become part of the routine care in children with neuroblastoma at the stage of minimal residual disease. However, many patients still relapse following retinoid therapy, demonstrating the need for more effective retinoids and better assays to predict retinoid sensitivity in cancer cells. Recent evidence suggests that the copper metabolism gene, ATP7A, is retinoid-regulated and an important component of the retinoic acid receptor β (RARβ) anticancer effect in neuroblastoma cells. To highlight and further develop the concept of using ATP7A as a target in retinoid therapy, and combination therapy with copper chelators in neuroblastoma, the current literature and abstracts related to the clinical application of retinoids, the function of ATP7A and the clinical application of copper chelators are summarized. We propose that strategies targeting the copper export protein, ATP7A, in combination therapy with retinoids and copper depletion therapy, may have great therapeutic potential in the clinical treatment of neuroblastoma and other malignancies.

  12. Data of evolutionary structure change: 1RU7A-1HGJC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1RU7A-1HGJC 1RU7 1HGJ A C ----------DTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCRLKG...1HGJ C 1HGJC VASSGTLEFITE...1HGJ C 1HGJC GKICN-NPHRI ...1HGJ C 1HGJC RSKAF-SNCYP ...1HGJ C 1HGJC ITEGF-----TWTGV

  13. Data of evolutionary structure change: 1CJ7A-2G4NF [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CJ7A-2G4NF 1CJ7 2G4N A F KVFERCELARVLKRLGMDGYRGISLANWMCLAKWESGYN...G HHHH - GGGG -- EVID>EVID> 0 2G4N... F 2G4NF ELKD...274536 2.0796310901641846 4.057032108306885 ...EVID> 1 2G4N F 2G4NF

  14. Data of evolutionary structure change: 1GB7A-2G4NF [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1GB7A-2G4NF 1GB7 2G4N A F KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYN...HHH - GGGG -- EVID>EVID> 0 2G4N F 2G4NF IVQNN--...n> 0.7096549868583679 1.3399250507354736 EVID> 1 2G4N F 2G4NF

  15. SLC7A5 act as a potential leukemic transformation target gene in myelodysplastic syndrome

    Science.gov (United States)

    Ma, Yan; Song, Jing; Chen, Bobin; Xu, Xiaoping; Lin, Guowei

    2016-01-01

    Objective Myelodysplastic syndromes (MDS) are a heterogenous group of clonal hematopoietic stem cell disorders characterized by increased risk of leukemic transformation. This study identifies microRNAs(miRNA) and miRNA targets that might represent leukemic transformation markers for MDS. Methods Based on our previously established nested case-control study cohort of MDS patients, we chose paired patients to undergo Angilent 8 × 15K human miRNA microarrays. Target prediction analysis was administrated using targetscan 5.1 software. We further investigated the function of target gene in MDS cell line using siRNA method, including cell proliferation, cell apoptosis, cell cycle and electron microscope. Results Finally we screened a subset of 7 miRNAs to be significantly differentially expressed between the case (at the end of follow up with leukemic transformation) and control group (at the end of follow up without leukemic transformation). Target prediction analysis revealed SLC7A5 was the common target gene of these 7 miRNAs. Further study on the function of SLC7A5 gene in SKM-1 cell line showed that downregulation of SLC7A5 inhibited SKM-1 cells proliferation, increased apoptosis and caused cell cycle arrest in the G0/G1 stage. Conclusion Our data indicate that SLC7A5 gene may act as a potential leukemic transformation target gene in MDS. PMID:26657287

  16. Data of evolutionary structure change: 1BN7A-2PSEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BN7A-2PSEA 1BN7 2PSE A A ------------IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYL...2PSE A 2PSEA ELLNLPKKIIF ...2PSE A 2PSEA PFKEKGEVRRP ...2PSE A 2PSEA PLVKGGKPDVV ...2PSE A 2PSEA LRASDDLPKLF

  17. Data of evolutionary structure change: 1AE7A-2QOGD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AE7A-2QOGD 1AE7 2QOG A D NLVQFSYLIQCANHGKRPT-WHYMDYGCYCGAGGSGTPV...D 2QOGD CLRRSLSTYKNE HHHGG...D 2QOGD YGKLA--KCNTK...n> 2QOG D 2QOGD YITCG-KGTWC D 2QOGD YMFYP-DSRCR

  18. Data of evolutionary structure change: 1BY7A-9APIA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BY7A-9APIA 1BY7 9API A A ----EDLCVANTLFALNLFKHLAKASPTQNLFLSPWSIS...> ASP CA 226 LYS CA 244 ILE CA 368 9API... A 9APIA FNLTEIPEAQI PRO CA 256 PHE CA 330 9API... A 9APIA RPFEVKDTEEED

  19. Genome Sequence of Streptomyces viridosporus Strain T7A ATCC 39115, a Lignin-Degrading Actinomycete

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Jennifer R. [Brown University; Goodwin, Lynne A. [Los Alamos National Laboratory (LANL); Teshima, Hazuki [Los Alamos National Laboratory (LANL); Detter, J. Chris [U.S. Department of Energy, Joint Genome Institute; Tapia, Roxanne [Los Alamos National Laboratory (LANL); Han, Cliff [Los Alamos National Laboratory (LANL); Huntemann, Marcel [U.S. Department of Energy, Joint Genome Institute; Wei, Chia-Lin [Los Alamos National Laboratory (LANL); Han, James [U.S. Department of Energy, Joint Genome Institute; Chen, Amy [U.S. Department of Energy, Joint Genome Institute; Kyrpides, Nikos C [U.S. Department of Energy, Joint Genome Institute; Mavromatis, K [U.S. Department of Energy, Joint Genome Institute; Szeto, Ernest [U.S. Department of Energy, Joint Genome Institute; Markowitz, Victor [U.S. Department of Energy, Joint Genome Institute; Ivanova, N [U.S. Department of Energy, Joint Genome Institute; Mikhailova, Natalia [U.S. Department of Energy, Joint Genome Institute; Ovchinnikova, Galina [U.S. Department of Energy, Joint Genome Institute; Pagani, Ioanna [U.S. Department of Energy, Joint Genome Institute; Pati, Amrita [U.S. Department of Energy, Joint Genome Institute; Woyke, Tanja [U.S. Department of Energy, Joint Genome Institute; Pitluck, Sam [U.S. Department of Energy, Joint Genome Institute; Peters, Lin [U.S. Department of Energy, Joint Genome Institute; Nolan, Matt [U.S. Department of Energy, Joint Genome Institute; Land, Miriam L [ORNL; Sello, Jason K. [Brown University

    2013-01-01

    We announce the availability of the genome sequence of Streptomyces viridosporus strain T7A ATCC 39115, a plant biomass- degrading actinomycete. This bacterium is of special interest because of its capacity to degrade lignin, an underutilized compo- nent of plants in the context of bioenergy. It has a full complement of genes for plant biomass catabolism.

  20. Data of evolutionary structure change: 1CZ7A-2REPA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CZ7A-2REPA 1CZ7 2REP A A ELETCKEQLFQSNMERKELHNTVMDLRGNIRVFCRIRPPLESEENRMCCTWTYH--...2REP A 2REPA LLLFPSDPPTRL...2REP A 2REPA EGGPGGDPQLEGLI...2REP A 2REPA EIRRA---SEELT...2REP A 2REPA QNRAV-----ARRSS

  1. Grand Canyon as a universally accessible virtual field trip for intro Geoscience classes using geo-referenced mobile game technology

    Science.gov (United States)

    Bursztyn, N.; Pederson, J. L.; Shelton, B.

    2012-12-01

    There is a well-documented and nationally reported trend of declining interest, poor preparedness, and lack of diversity within U.S. students pursuing geoscience and other STEM disciplines. We suggest that a primary contributing factor to this problem is that introductory geoscience courses simply fail to inspire (i.e. they are boring). Our experience leads us to believe that the hands-on, contextualized learning of field excursions are often the most impactful component of lower division geoscience classes. However, field trips are becoming increasingly more difficult to run due to logistics and liability, high-enrollments, decreasing financial and administrative support, and exclusivity of the physically disabled. Recent research suggests that virtual field trips can be used to simulate this contextualized physical learning through the use of mobile devices - technology that exists in most students' hands already. Our overarching goal is to enhance interest in introductory geoscience courses by providing the kinetic and physical learning experience of field trips through geo-referenced educational mobile games and test the hypothesis that these experiences can be effectively simulated through virtual field trips. We are doing this by developing "serious" games for mobile devices that deliver introductory geology material in a fun and interactive manner. Our new teaching strategy will enhance undergraduate student learning in the geosciences, be accessible to students of diverse backgrounds and physical abilities, and be easily incorporated into higher education programs and curricula at institutions globally. Our prototype involves students virtually navigating downstream along a scaled down Colorado River through Grand Canyon - physically moving around their campus quad, football field or other real location, using their smart phone or a tablet. As students reach the next designated location, a photo or video in Grand Canyon appears along with a geological question. The students must answer each question correctly in order to proceed to the next location and accrue points in the game and multiple attempts reduce the number of points earned when the correct answer is found. The questions are either multiple choice or involve touch-screen interaction to identify a specific geologic feature. Initial testing of the prototype game in Historical and Physical geology courses at Utah State University indicate that students enjoy the mobile "exploration" nature of the game as well as experiencing photographs of geologic features rather than traditional cartoons. Qualitative evaluation using anonymous surveys was conducted to help determine the usability of the game and the potential effectiveness of this technology-based approach. Students were asked about the degree of fun and difficulty of the game, content learned, and their overall response to features they liked/disliked about it. The results of these early assessments are positive, both in regard to the improvement of students' understanding of key geology concepts and their enjoyment of learning with the technology in a mobile orienteering manner. This is a positive first step in an innovative teaching tool with the power to overcome the pervasive problem of the boring first year STEM course and make world-class field trips accessible to all.

  2. MathPatch - Raising Retention and Performance in an Intro-geoscience Class by Raising Students' Quantitative Skills

    Science.gov (United States)

    Baer, E. M.; Whittington, C.; Burn, H.

    2008-12-01

    The geological sciences are fundamentally quantitative. However, the diversity of students' mathematical preparation and skills makes the successful use of quantitative concepts difficult in introductory level classes. At Highline Community College, we have implemented a one-credit co-requisite course to give students supplemental instruction for quantitative skills used in the course. The course, formally titled "Quantitative Geology," nicknamed "MathPatch," runs parallel to our introductory Physical Geology course. MathPatch teaches the quantitative skills required for the geology class right before they are needed. Thus, students learn only the skills they need and are given opportunities to apply them immediately. Topics include complex-graph reading, unit conversions, large numbers, scientific notation, scale and measurement, estimation, powers of 10, and other fundamental mathematical concepts used in basic geological concepts. Use of this course over the past 8 years has successfully accomplished the goals of increasing students' quantitative skills, success and retention. Students master the quantitative skills to a greater extent than before the course was implemented, and less time is spent covering basic quantitative skills in the classroom. Because the course supports the use of quantitative skills, the large number of faculty that teach Geology 101 are more comfortable in using quantitative analysis, and indeed see it as an expectation of the course at Highline. Also significant, retention in the geology course has increased substantially, from 75% to 85%. Although successful, challenges persist with requiring MathPatch as a supplementary course. One, we have seen enrollments decrease in Geology 101, which may be the result of adding this co-requisite. Students resist mandatory enrollment in the course, although they are not good at evaluating their own need for the course. The logistics utilizing MathPatch in an evening class with fewer and longer class meetings has been challenging. Finally, in order to better serve our students' needs, we began to offer on-line sections of MathPatch; this mode of instruction is not as clearly effective, although it is very popular. Through the new The Math You Need project, we hope to improve the effectiveness of the on-line instruction so it can provide comparable results to the face-to-face sections of this class.

  3. KONSUMSI MIKRONUTRIEN DAN EKSPRESI GEN eNOS3 ALEL INTRO 4a4b PADA PENDERITA HIPERTENSI ETNIK MINANGKABAU

    Directory of Open Access Journals (Sweden)

    Delmi Sulastri

    2011-05-01

    Full Text Available AbstrakGen eNOS3 varian intron 4a4b merupakan salah satu gen yang berhubungan dengan kejadian hipertensi esensial. Kemampuan Gen eNOS3 varian ini untuk mensintesis enzim nitric oxide synthase (NOS berkurang sehingga sintesis Nitric oxide (NO menurun. Senyawa NO adalah suatu senyawa vasoaktif yang menyebabkan vasodilatasi pembuluh darah.Penelitian pada subjek hipertensi dan normotensi berusia 30-65 tahun bertujuan untuk melihat pengaruh mikronutrien terhadap ekspresi gen eNOS3 alel intron 4a4b. 130 subjek, diwawancara pola makannya lalu dilakukan analisis asupan mikronutrien, gen eNOS3, serta kadar NO plasma. Data yang diperoleh dianalisis menggunakan uji T dan chi-square.Kadar NO plasma penderita hipertensi adalah 26.91 + 15.40 μM/L dan normotensi 25.79 + 15.04 μM/L. 55.5% subjek hipertensi memiliki gen eNOS3 varian intron 4b dan 69% subjek normotensi mempunyai varian intron 4a4b. Kadar NO plasma rendah, (66.7% ditemukan pada subjek hipertensi dengan varian intron 4b. Tidak terdapat hubungan bermakna asupan mikronutrien dengan kadar NO plasma pada subjek hipertensi.Hasil ini tidak mendukung pengaruh konsumsi mikronutrien terhadap kadar NO plasma pada penderita hipertensi dengan gen eNOS3 varian intron 4a4b.Kata Kunci : hipertensi esensial, gen eNOS3, kadar NO plasmaAbstracteNOS 3 gene intron 4a4b allel is one of the important genes which is related to hypertesion essensial. This gene expresses the nitric oxide synthase (NOS enzyme which regulates the synthesis of Nitric oxide (NO in human body. NO causes vasodilatation, which decreases peripheral resistant and blood pressure.A research has been done based on cross sectional study on hypertension patients and those with normal blood pressure in the range of 30-65 years old. The main of this research is to evaluate the influence of micronutrient consumption on eNOS3 gene intron 4a4b allel expression in hypertension subjects in Minangkabau ethnicity. 130 subjects interviewed about micronutrient consumption and theARTIKEL PENELITIAN14assessment of eNOS3 gene and NO plasma level were done. The Data was analysed with t-test and chi-square. The results of this study showed that the hypertensive’s plasma NO concentration was 26.91 ± 15.40 μM/L and normotensive’s was 25.79 ± 15.04 μM/L. 55.5% of the hypertensive group has eNOS3 gene intron 4b alleles and 69% of the normotensive group has eNOS3 gene intron 4a4b alleles . Low NO plasma level can be found at 66.7% subject hypertension with eNOS3 gene allel intron 4b. There was no significant relationship between consumption of micronutrient with NO plasma level in hypertension patients.This result did not support that consumption micronutrient can influenced NO plasma level in hypertension subject with eNOS3 gene allel 4a4b.Key word : essensial hypertension, eNOS3 gene, NO plasma level.

  4. From Syllabus To Diagnostic Exam: Learnings from the New Faculty Workshop Applied In the Intro Physics Classroom

    Science.gov (United States)

    Tanoff, Michael

    2009-03-01

    Kalamazoo College offers a ``one-size-fits-all'' concept-based introductory physics sequence. The widely varying demographic composition of the class --- including majors in biology, chemistry, pre-med, physics, and math, along with occasional humanities majors --- adds obvious challenges to the successful learning experience. As such, educational techniques that apply across the demographic are required. Several ideas presented at the Fall 2005 New Faculty Workshop apply to the needs of this broad range of students at Kalamazoo College, including an ``organic'' course syllabus that has been allowed to grow to whatever extent necessary to address recurring student concerns and misunderstandings about course expectations, policies, and guidelines, and to provide advice on recurring themes; peer instruction for maximizing classroom value; and hiring teaching assistants with first hand experience in the course and the labs. Details on implementing these techniques, including developing a syllabus with unusual section headings such as ``Attendance and Homework Dramas'' and ``Introductory Physics Survival Requirements,'' will be presented. Success of the techniques, as evidenced by performance on diagnostic exams, class attendance, and comments from course evaluations, will be discussed.

  5. Variation in WNT7A is unlikely to be a cause of familial Congenital Talipes Equinovarus

    Science.gov (United States)

    Liu, Guoqing; Inglis, Julie; Cardy, Amanda; Shaw, Duncan; Sahota, Sukhy; Hennekam, Raoul; Sharp, Linda; Miedzybrodzka, Zosia

    2008-01-01

    Background Genetic factors make an important contribution to the aetiology of congenital talipes equinovarus (CTEV), the most common developmental disorder of the lower limb. WNT7A was suggested as a candidate gene for CTEV on the basis of a genome-wide scan for linkage in a large multi-case family. WNT7A is a plausible candidate gene for CTEV as it provides a signal for pattern formation during limb development, and mutation in WNT7A has been reported in a number of limb malformation syndromes. Methods We investigated the role of WNT7A using a family-based linkage approach in our large series of European multi-case CTEV families. Three microsatellite markers were used, of which one (D3S2385) is intragenic, and the other two (D3S2403, D3S1252) are 700 kb 5' to the start and 20 kb from the 3' end of the gene, respectively. Ninety-one CTEV families, comprising 476 individuals of whom 211 were affected, were genotyped. LOD scores using recessive and incomplete-dominant inheritance models, and non-parametric linkage scores, excluded linkage. Results No significant evidence for linkage was observed using either parametric or non-parametric models. LOD scores for the parametric models remained strongly negative in the regions between the markers, and in the 0.5 cM intervals outside the marker map. No significant lod scores were obtained when the data were analysed allowing for heterogeneity. Conclusion Our evidence suggests that the WNT7A gene is unlikely to be a major contributor to the aetiology of familial CTEV. PMID:18538017

  6. Variation in WNT7A is unlikely to be a cause of familial Congenital Talipes Equinovarus

    Directory of Open Access Journals (Sweden)

    Hennekam Raoul

    2008-06-01

    Full Text Available Abstract Background Genetic factors make an important contribution to the aetiology of congenital talipes equinovarus (CTEV, the most common developmental disorder of the lower limb. WNT7A was suggested as a candidate gene for CTEV on the basis of a genome-wide scan for linkage in a large multi-case family. WNT7A is a plausible candidate gene for CTEV as it provides a signal for pattern formation during limb development, and mutation in WNT7A has been reported in a number of limb malformation syndromes. Methods We investigated the role of WNT7A using a family-based linkage approach in our large series of European multi-case CTEV families. Three microsatellite markers were used, of which one (D3S2385 is intragenic, and the other two (D3S2403, D3S1252 are 700 kb 5' to the start and 20 kb from the 3' end of the gene, respectively. Ninety-one CTEV families, comprising 476 individuals of whom 211 were affected, were genotyped. LOD scores using recessive and incomplete-dominant inheritance models, and non-parametric linkage scores, excluded linkage. Results No significant evidence for linkage was observed using either parametric or non-parametric models. LOD scores for the parametric models remained strongly negative in the regions between the markers, and in the 0.5 cM intervals outside the marker map. No significant lod scores were obtained when the data were analysed allowing for heterogeneity. Conclusion Our evidence suggests that the WNT7A gene is unlikely to be a major contributor to the aetiology of familial CTEV.

  7. MYO7A and USH2A gene sequence variants in Italian patients with Usher syndrome.

    Science.gov (United States)

    Sodi, Andrea; Mariottini, Alessandro; Passerini, Ilaria; Murro, Vittoria; Tachyla, Iryna; Bianchi, Benedetta; Menchini, Ugo; Torricelli, Francesca

    2014-01-01

    To analyze the spectrum of sequence variants in the MYO7A and USH2A genes in a group of Italian patients affected by Usher syndrome (USH). Thirty-six Italian patients with a diagnosis of USH were recruited. They received a standard ophthalmologic examination, visual field testing, optical coherence tomography (OCT) scan, and electrophysiological tests. Fluorescein angiography and fundus autofluorescence imaging were performed in selected cases. All the patients underwent an audiologic examination for the 0.25-8,000 Hz frequencies. Vestibular function was evaluated with specific tests. DNA samples were analyzed for sequence variants of the MYO7A gene (for USH1) and the USH2A gene (for USH2) with direct sequencing techniques. A few patients were analyzed for both genes. In the MYO7A gene, ten missense variants were found; three patients were compound heterozygous, and two were homozygous. Thirty-four USH2A gene variants were detected, including eight missense variants, nine nonsense variants, six splicing variants, and 11 duplications/deletions; 19 patients were compound heterozygous, and three were homozygous. Four MYO7A and 17 USH2A variants have already been described in the literature. Among the novel mutations there are four USH2A large deletions, detected with multiplex ligation dependent probe amplification (MLPA) technology. Two potentially pathogenic variants were found in 27 patients (75%). Affected patients showed variable clinical pictures without a clear genotype-phenotype correlation. Ten variants in the MYO7A gene and 34 variants in the USH2A gene were detected in Italian patients with USH at a high detection rate. A selective analysis of these genes may be valuable for molecular analysis, combining diagnostic efficiency with little time wastage and less resource consumption.

  8. Cystinuria Associated with Different SLC7A9 Gene Variants in the Cat.

    Directory of Open Access Journals (Sweden)

    Keijiro Mizukami

    Full Text Available Cystinuria is a classical inborn error of metabolism characterized by a selective proximal renal tubular defect affecting cystine, ornithine, lysine, and arginine (COLA reabsorption, which can lead to uroliths and urinary obstruction. In humans, dogs and mice, cystinuria is caused by variants in one of two genes, SLC3A1 and SLC7A9, which encode the rBAT and bo,+AT subunits of the bo,+ basic amino acid transporter system, respectively. In this study, exons and flanking regions of the SLC3A1 and SLC7A9 genes were sequenced from genomic DNA of cats (Felis catus with COLAuria and cystine calculi. Relative to the Felis catus-6.2 reference genome sequence, DNA sequences from these affected cats revealed 3 unique homozygous SLC7A9 missense variants: one in exon 5 (p.Asp236Asn from a non-purpose-bred medium-haired cat, one in exon 7 (p.Val294Glu in a Maine Coon and a Sphinx cat, and one in exon 10 (p.Thr392Met from a non-purpose-bred long-haired cat. A genotyping assay subsequently identified another cystinuric domestic medium-haired cat that was homozygous for the variant originally identified in the purebred cats. These missense variants result in deleterious amino acid substitutions of highly conserved residues in the bo,+AT protein. A limited population survey supported that the variants found were likely causative. The remaining 2 sequenced domestic short-haired cats had a heterozygous variant at a splice donor site in intron 10 and a homozygous single nucleotide variant at a branchpoint in intron 11 of SLC7A9, respectively. This study identifies the first SLC7A9 variants causing feline cystinuria and reveals that, as in humans and dogs, this disease is genetically heterogeneous in cats.

  9. Multi-Mode Binding of Cellobiohydrolase Cel7A from Trichoderma reesei to Cellulose

    Science.gov (United States)

    Jalak, Jürgen; Väljamäe, Priit

    2014-01-01

    Enzymatic hydrolysis of recalcitrant polysaccharides like cellulose takes place on the solid-liquid interface. Therefore the adsorption of enzymes to the solid surface is a pre-requisite for catalysis. Here we used enzymatic activity measurements with fluorescent model-substrate 4-methyl-umbelliferyl-β-D-lactoside for sensitive monitoring of the binding of cellobiohydrolase TrCel7A from Trichoderma reesei to bacterial cellulose (BC). The binding at low nanomolar free TrCel7A concentrations was exclusively active site mediated and was consistent with Langmuir's one binding site model with Kd and Amax values of 2.9 nM and 126 nmol/g BC, respectively. This is the strongest binding observed with non-complexed cellulases and apparently represents the productive binding of TrCel7A to cellulose chain ends on the hydrophobic face of BC microfibril. With increasing free TrCel7A concentrations the isotherm gradually deviated from the Langmuir's one binding site model. This was caused by the increasing contribution of lower affinity binding modes that included both active site mediated binding and non-productive binding with active site free from cellulose chain. The binding of TrCel7A to BC was found to be only partially reversible. Furthermore, the isotherm was dependent on the concentration of BC with more efficient binding observed at lower BC concentrations. The phenomenon can be ascribed to the BC concentration dependent aggregation of BC microfibrils with concomitant reduction of specific surface area. PMID:25265511

  10. Reduced climbing and increased slipping adaptation in cochlear hair cells of mice with Myo7a mutations

    NARCIS (Netherlands)

    Kros, CJ; Marcotti, W; van Netten, SM; Self, TJ; Libby, RT; Brown, SDM; Richardson, GP; Steel, KP

    Mutations in Myo7a cause hereditary deafness in mice and humans. We describe the effects of two mutations, Myo7a(6J) and Myo7a(4626SB). on mechano-electrical transduction in cochlear hair cells. Both mutations result in two major functional abnormalities that would interfere with sound transduction.

  11. Direct kinetic comparison of the two cellobiohydrolases Cel6A and Cel7A from Hypocrea jecorina

    DEFF Research Database (Denmark)

    Badino, Silke Flindt; Kari, Jeppe; Christensen, Stefan Jarl

    2017-01-01

    compared to Cel6A. We conclude that Cel6A is a fast but selective enzyme and that Cel7A is slower, but promiscuous. One consequence of this is that Cel6A is more effective when substrate is plentiful, while Cel7A excels when substrate is limiting. These diverse kinetic properties of Cel6A and Cel7A might...

  12. 17 CFR 260.7a-16 - Inclusion of items, differentiation between items and answers, omission of instructions.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Inclusion of items, differentiation between items and answers, omission of instructions. 260.7a-16 Section 260.7a-16 Commodity and... INDENTURE ACT OF 1939 Formal Requirements § 260.7a-16 Inclusion of items, differentiation between items and...

  13. Loop variants of the thermophile Rasamsonia emersonii Cel7A with improved activity against cellulose

    DEFF Research Database (Denmark)

    Sørensen, Trine Holst; Skovbo Windahl, Michael; McBrayer, Brett

    2017-01-01

    Cel7A cellobiohydrolases perform processive hydrolysis on one strand of cellulose, which is threaded through the enzyme's substrate binding tunnel. The tunnel structure results from a groove in the catalytic domain, which is covered by a number of loops. These loops have been identified as potent......Cel7A cellobiohydrolases perform processive hydrolysis on one strand of cellulose, which is threaded through the enzyme's substrate binding tunnel. The tunnel structure results from a groove in the catalytic domain, which is covered by a number of loops. These loops have been identified...... from Rasamsonia emersonii had profound effects on both substrate interactions and catalytic efficacy. At room temperature the double mutant N194A/N197A showed strongly reduced substrate affinity with a water-cellulose partitioning coefficient threefold lower than the wild type. Yet, this variant...

  14. Mechanism of product inhibition for cellobiohydrolase Cel7A during hydrolysis of insoluble cellulose

    DEFF Research Database (Denmark)

    Olsen, Johan P.; Alasepp, Kadri; Kari, Jeppe

    2016-01-01

    implemented an electrochemical biosensor assay for product inhibition studies of cellulases acting on their natural substrate, cellulose. Using this method we measured the hydrolytic rate of Cel7A as a function of both product (inhibitor) concentration and substrate load. This data enabled analyses along...... ± 40 μM. Noncompetitive inhibition implies that the inhibitor binds with comparable strength to either free enzyme or an enzymesubstrate complex, that is, that association between enzyme and substrate has no effect on the binding of the inhibitor. This mechanism is rarely observed, but we argue......The cellobiohydrolase cellulase Cel7A is extensively utilized in industrial treatment of lignocellulosic biomass under conditions of high product concentrations, and better understanding of inhibition mechanisms appears central in attempts to improve the efficiency of this process. We have...

  15. In utero copper treatment for Menkes disease associated with a severe ATP7A mutation

    Science.gov (United States)

    Haddad, Marie Reine; Macri, Charles J.; Holmes, Courtney S.; Goldstein, David S.; Jacobson, Beryl E.; Centeno, Jose A.; Popek, Edwina J.; Gahl, Willam A.; Kaler, Stephen G.

    2012-01-01

    Menkes disease is a lethal X-linked recessive neurodegenerative disorder of copper transport caused by mutations in ATP7A, which encodes a copper-transporting ATPase. Early postnatal treatment with copper injections often improves clinical outcomes in affected infants. While Menkes disease newborns appear normal neurologically, analyses of fetal tissues including placenta indicate abnormal copper distribution and suggest a prenatal onset of the metal transport defect. In an affected fetus whose parents found termination unacceptable and who understood the associated risks, we began in utero copper histidine treatment at 31.5 weeks gestational age. Copper histidine (900 μg per dose) was administered directly to the fetus by intramuscular injection (fetal quadriceps or gluteus) under ultrasound guidance. Percutaneous umbilical blood sampling enabled serial measurement of fetal copper and ceruloplasmin levels that were used to guide therapy over a four-week period. Fetal copper levels rose from 17 μg/dL prior to treatment to 45 μg/dL, and ceruloplasmin levels from 39 mg/L to 122 mg/L. After pulmonary maturity was confirmed biochemically, the baby was delivered at 35.5 weeks and daily copper histidine therapy (250 μg sc b.i.d.) was begun. Despite this very early intervention with copper, the infant showed hypotonia, developmental delay, and electroencephalographic abnormalities and died of respiratory failure at 5.5 months of age. The patient’s ATP7A mutation, which severely disrupted mRNA splicing, resulted in complete absence of ATP7A protein on Western blots. These investigations suggest that prenatally initiated copper replacement is inadequate to correct Menkes disease caused by severe loss-of-function mutations, and that postnatal ATP7A gene addition represents a rational approach in such circumstances. PMID:22695177

  16. Retinal Disease Course in Usher Syndrome 1B Due to MYO7A Mutations

    Science.gov (United States)

    Jacobson, Samuel G.; Cideciyan, Artur V.; Gibbs, Dan; Sumaroka, Alexander; Roman, Alejandro J.; Aleman, Tomas S.; Schwartz, Sharon B.; Olivares, Melani B.; Russell, Robert C.; Steinberg, Janet D.; Kenna, Margaret A.; Kimberling, William J.; Rehm, Heidi L.; Williams, David S.

    2011-01-01

    Purpose. To determine the disease course in Usher syndrome type IB (USH1B) caused by myosin 7A (MYO7A) gene mutations. Methods. USH1B patients (n = 33, ages 2–61) representing 25 different families were studied by ocular examination, kinetic and chromatic static perimetry, dark adaptometry, and optical coherence tomography (OCT). Consequences of the mutant alleles were predicted. Results. All MYO7A patients had severely abnormal ERGs, but kinetic fields revealed regional patterns of visual loss that suggested a disease sequence. Rod-mediated vision could be lost to different degrees in the first decades of life. Cone vision followed a more predictable and slower decline. Central vision ranged from normal to reduced in the first four decades of life and thereafter was severely abnormal. Dark adaptation kinetics was normal. Photoreceptor layer thickness in a wide region of central retina could differ dramatically between patients of comparable ages; and there were examples of severe losses in childhood as well as relative preservation in patients in the third decade of life. Comparisons were made between the mutant alleles in mild versus more severe phenotypes. Conclusions. A disease sequence in USH1B leads from generally full but impaired visual fields to residual small central islands. At most disease stages, there was preserved temporal peripheral field, a potential target for early phase clinical trials of gene therapy. From data comparing patients' rod disease in this cohort, the authors speculate that null MYO7A alleles could be associated with milder dysfunction and fewer photoreceptor structural losses at ages when other genotypes show more severe phenotypes. PMID:21873662

  17. A COL7A1 mutation causes dystrophic epidermolysis bullosa in Rotes Hohenvieh cattle.

    Directory of Open Access Journals (Sweden)

    Annie Menoud

    Full Text Available We identified a congenital mechanobullous skin disorder in six calves on a single farm of an endangered German cattle breed in 2010. The condition presented as a large loss of skin distal to the fetlocks and at the mucosa of the muzzle. All affected calves were euthanized on humane grounds due to the severity, extent and progression of the skin and oral lesions. Examination of skin samples under light microscopy revealed detachment of the epidermis from the dermis at the level of the dermo epidermal junction, leading to the diagnosis of a subepidermal bullous dermatosis such as epidermolysis bullosa. The pedigree was consistent with monogenic autosomal recessive inheritance. We localized the causative mutation to an 18 Mb interval on chromosome 22 by homozygosity mapping. The COL7A1 gene encoding collagen type VII alpha 1 is located within this interval and COL7A1 mutations have been shown to cause inherited dystrophic epidermolysis bullosa (DEB in humans. A SNP in the bovine COL7A1 exon 49 (c.4756C>T was perfectly associated with the observed disease. The homozygous mutant T/T genotype was exclusively present in affected calves and their parents were heterozygous C/T confirming the assumed recessive mode of inheritance. All known cases and genotyped carriers were related to a single cow, which is supposed to be the founder animal. The mutant T allele was absent in 63 animals from 24 cattle breeds. The identified mutation causes a premature stop codon which leads to a truncated protein representing a complete loss of COL7A1 function (p.R1586*. We thus have identified a candidate causative mutation for this genetic disease using only three cases to unravel its molecular basis. Selection against this mutation can now be used to eliminate the mutant allele from the Rotes Höhenvieh breed.

  18. Structural Insights into the Affinity of Cel7A Carbohydrate-binding Module for Lignin*

    Science.gov (United States)

    Strobel, Kathryn L.; Pfeiffer, Katherine A.; Blanch, Harvey W.; Clark, Douglas S.

    2015-01-01

    The high cost of hydrolytic enzymes impedes the commercial production of lignocellulosic biofuels. High enzyme loadings are required in part due to their non-productive adsorption to lignin, a major component of biomass. Despite numerous studies documenting cellulase adsorption to lignin, few attempts have been made to engineer enzymes to reduce lignin binding. In this work, we used alanine-scanning mutagenesis to elucidate the structural basis for the lignin affinity of Trichoderma reesei Cel7A carbohydrate binding module (CBM). T. reesei Cel7A CBM mutants were produced with a Talaromyces emersonii Cel7A catalytic domain and screened for their binding to cellulose and lignin. Mutation of aromatic and polar residues on the planar face of the CBM greatly decreased binding to both cellulose and lignin, supporting the hypothesis that the cellulose-binding face is also responsible for lignin affinity. Cellulose and lignin affinity of the 31 mutants were highly correlated, although several mutants displayed selective reductions in lignin or cellulose affinity. Four mutants with increased cellulose selectivity (Q2A, H4A, V18A, and P30A) did not exhibit improved hydrolysis of cellulose in the presence of lignin. Further reduction in lignin affinity while maintaining a high level of cellulose affinity is thus necessary to generate an enzyme with improved hydrolysis capability. This work provides insights into the structural underpinnings of lignin affinity, identifies residues amenable to mutation without compromising cellulose affinity, and informs engineering strategies for family one CBMs. PMID:26209638

  19. Omeprazole, a gastric proton pump inhibitor, inhibits melanogenesis by blocking ATP7A trafficking.

    Science.gov (United States)

    Matsui, Mary S; Petris, Michael J; Niki, Yoko; Karaman-Jurukovska, Nevena; Muizzuddin, Neelam; Ichihashi, Masamitsu; Yarosh, Daniel B

    2015-03-01

    Omeprazole is a proton pump inhibitor used in the treatment of peptic ulcer disease and gastrosophageal reflux disease and acts by irreversibly blocking ATP4A, a P-type H+/K+ ATPase in gastric parietal cells. We found that omeprazole and its closely related congeners inhibited melanogenesis at micromolar concentrations in B16 mouse melanoma cells, normal human epidermal melanocytes, and in a reconstructed human skin model. Omeprazole topically applied to the skin of UV-irradiated human subjects significantly reduced pigment levels after 3 weeks compared with untreated controls. Omeprazole had no significant inhibitory effect on the activities of purified human tyrosinase or on the mRNA levels of tyrosinase, dopachrome tautomerase, Pmel17, or MITF mRNA levels. Although melanocytes do not express ATP4A, they do express ATP7A, a copper transporting P-type ATPase in the trans-Golgi network that is required for copper acquisition by tyrosinase. ATP7A relocalization from the trans-Golgi network to the plasma membrane in response to elevated copper concentrations in melanocytes was inhibited by omeprazole. Omeprazole treatment increased the proportion of EndoH sensitive tyrosinase, indicating that tyrosinase maturation was impaired. In addition, omeprazole reduced tyrosinase protein abundance in the presence of cycloheximide, suggestive of increased degradation. Our findings are consistent with the hypothesis that omeprazole reduces melanogenesis by inhibiting ATP7A and by enhancing degradation of tyrosinase.

  20. Identification of a novel MYO7A mutation in Usher syndrome type 1.

    Science.gov (United States)

    Cheng, Ling; Yu, Hongsong; Jiang, Yan; He, Juan; Pu, Sisi; Li, Xin; Zhang, Li

    2018-01-05

    Usher syndrome (USH) is an autosomal recessive disease characterized by deafness and retinitis pigmentosa. In view of the high phenotypic and genetic heterogeneity in USH, performing genetic screening with traditional methods is impractical. In the present study, we carried out targeted next-generation sequencing (NGS) to uncover the underlying gene in an USH family (2 USH patients and 15 unaffected relatives). One hundred and thirty-five genes associated with inherited retinal degeneration were selected for deep exome sequencing. Subsequently, variant analysis, Sanger validation and segregation tests were utilized to identify the disease-causing mutations in this family. All affected individuals had a classic USH type I (USH1) phenotype which included deafness, vestibular dysfunction and retinitis pigmentosa. Targeted NGS and Sanger sequencing validation suggested that USH1 patients carried an unreported splice site mutation, c.5168+1G>A, as a compound heterozygous mutation with c.6070C>T (p.R2024X) in the MYO7A gene. A functional study revealed decreased expression of the MYO7A gene in the individuals carrying heterozygous mutations. In conclusion, targeted next-generation sequencing provided a comprehensive and efficient diagnosis for USH1. This study revealed the genetic defects in the MYO7A gene and expanded the spectrum of clinical phenotypes associated with USH1 mutations.

  1. Myosin7a deficiency results in reduced retinal activity which is improved by gene therapy.

    Directory of Open Access Journals (Sweden)

    Pasqualina Colella

    Full Text Available Mutations in MYO7A cause autosomal recessive Usher syndrome type IB (USH1B, one of the most frequent conditions that combine severe congenital hearing impairment and retinitis pigmentosa. A promising therapeutic strategy for retinitis pigmentosa is gene therapy, however its pre-clinical development is limited by the mild retinal phenotype of the shaker1 (sh1(-/- murine model of USH1B which lacks both retinal functional abnormalities and degeneration. Here we report a significant, early-onset delay of sh1(-/- photoreceptor ability to recover from light desensitization as well as a progressive reduction of both b-wave electroretinogram amplitude and light sensitivity, in the absence of significant loss of photoreceptors up to 12 months of age. We additionally show that subretinal delivery to the sh1(-/- retina of AAV vectors encoding the large MYO7A protein results in significant improvement of sh1(-/- photoreceptor and retinal pigment epithelium ultrastructural anomalies which is associated with improvement of recovery from light desensitization. These findings provide new tools to evaluate the efficacy of experimental therapies for USH1B. In addition, although AAV vectors expressing large genes might have limited clinical applications due to their genome heterogeneity, our data show that AAV-mediated MYO7A gene transfer to the sh1(-/- retina is effective.

  2. Neural effects in copper defiient Menkes disease: ATP7A-a distinctive marker

    Directory of Open Access Journals (Sweden)

    S K Kanthlal

    2016-08-01

    Full Text Available Menkes disease, also termed as “Menkes’s syndrome”, is a disastrous infantile neurodegenerative disorder originated by diverse mutations in cupric cation-transport gene called ATP7A. This gene encodes a protein termed as copper transporting P-type ATPase, essential for copper ion transport from intestine to the other parts of our body along with other transporters like copper transporter receptor 1 and divalent metal transporter 1. The copper transportation is vital in the neuronal development and synthesis of various enzymes. It is found to be an appreciated trace element for normal biological functioning but toxic in excess. It is essential for the metallation of cuproenzymes which is responsible for the biosynthesis of neurotransmitters and other vital physiological mechanisms. Copper is also actively involved in the transmission pathway of N-methyl-D-aspartate receptors and its subsequent molecular changes in neural cells. The expression of ATP7A gene in regions of brain depicts the importance of copper in neural development and stabilization. Studies revealed that the mutation of ATP7A gene leads the pathophysiology of various neurodegenerative disorders. This review focused on the normal physiological function of the gene with respect to their harmful outcome of the mutated gene and its associated deficiency which detriments the neural mechanism in Menkes patients.

  3. Novel Mutations of the Tetratricopeptide Repeat Domain 7A Gene and Phenotype/Genotype Comparison

    Directory of Open Access Journals (Sweden)

    Reyin Lien

    2017-09-01

    Full Text Available The gastrointestinal tract contains the largest lymphoid organ to react with pathogenic microorganisms and suppress excess inflammation. Patients with primary immunodeficiency diseases (PIDs can suffer from refractory diarrhea. In this study, we present two siblings who began to suffer from refractory diarrhea with a poor response to aggressive antibiotic and immunosuppressive treatment after surgical release of neonatal intestinal obstruction. Their lymphocyte proliferation was low, but superoxide production and IL-10 signaling were normal. Candidate genetic approach targeted to genes involved in PIDs with inflammatory bowel disease (IBD-like manifestation was unrevealing. Whole-genome sequencing revealed novel heterozygous mutations Glu75Lys and nucleotide 520–521 CT deletion in the tetratricopeptide repeat domain 7A (TTC7A gene. A Medline search identified 49 patients with TTC7A mutations, of whom 20 survived. Their phenotypes included both multiple intestinal atresia (MIA and combined T and/or B immunodeficiency (CID in 16, both IBD and CID in 14, isolated MIA in 8, MIA, IBD, and CID complex in 8, and isolated IBD in 3. Of these 98 mutant alleles over-through the coding region clustering on exon 2 (40 alleles, exon 7 (12 alleles, and exon 20 (10 alleles, 2 common hotspot mutations were c.211 G>A (p.E71K in exon 2 in 26 alleles and AAGT deletion in exon 7 (+3 in 10 alleles. Kaplan–Meier analysis showed that those with biallelic missense mutations (p = 0.0168, unaffected tetratricopeptide repeat domains (p = 0.0311, and developing autoimmune disorders (p = 0.001 had a relatively better prognosis. Hematopoietic stem cell transplantation (HSCT restored immunity and seemed to decrease the frequency of infections; however, refractory diarrhea persisted. Clinical improvement was reported upon intestinal and liver transplantation in a child with CID and MIA of unknown genetic etiology. In conclusion, patients with TTC7A mutations

  4. Soluble THSD7A Is an N-Glycoprotein That Promotes Endothelial Cell Migration and Tube Formation in Angiogenesis

    Science.gov (United States)

    Kuo, Meng-Wei; Wang, Chian-Huei; Wu, Hsiao-Chun; Chang, Shing-Jyh; Chuang, Yung-Jen

    2011-01-01

    Background Thrombospondin type I domain containing 7A (THSD7A) is a novel neural protein that is known to affect endothelial migration and vascular patterning during development. To further understand the role of THSD7A in angiogenesis, we investigated the post-translational modification scheme of THS7DA and to reveal the underlying mechanisms by which this protein regulates blood vessel growth. Methodology/Principal Findings Full-length THSD7A was overexpressed in human embryonic kidney 293T (HEK293T) cells and was found to be membrane associated and N-glycosylated. The soluble form of THSD7A, which is released into the cultured medium, was harvested for further angiogenic assays. We found that soluble THSD7A promotes human umbilical vein endothelial cell (HUVEC) migration and tube formation. HUVEC sprouts and zebrafish subintestinal vessel (SIV) angiogenic assays further revealed that soluble THSD7A increases the number of branching points of new vessels. Interestingly, we found that soluble THSD7A increased the formation of filopodia in HUVEC. The distribution patterns of vinculin and phosphorylated focal adhesion kinase (FAK) were also affected, which implies a role for THSD7A in focal adhesion assembly. Moreover, soluble THSD7A increased FAK phosphorylation in HUVEC, suggesting that THSD7A is involved in regulating cytoskeleton reorganization. Conclusions/Significance Taken together, our results indicate that THSD7A is a membrane-associated N-glycoprotein with a soluble form. Soluble THSD7A promotes endothelial cell migration during angiogenesis via a FAK-dependent mechanism and thus may be a novel neuroangiogenic factor. PMID:22194972

  5. Gene Therapy for the Retinal Degeneration of Usher Syndrome Caused by Mutations in MYO7A.

    Science.gov (United States)

    Lopes, Vanda S; Williams, David S

    2015-01-20

    Usher syndrome is a deaf-blindness disorder. One of the subtypes, Usher 1B, is caused by loss of function of the gene encoding the unconventional myosin, MYO7A. A variety of different viral-based delivery approaches have been tested for retinal gene therapy to prevent the blindness of Usher 1B, and a clinical trial based on one of these approaches has begun. This review evaluates the different approaches. Copyright © 2015 Cold Spring Harbor Laboratory Press; all rights reserved.

  6. Cloning, expression, purification and crystallization of Schizosaccharomyces pombe Set7, a putative histone methyltransferase.

    Science.gov (United States)

    Mevius, Damiaan E H F; Shen, Yunpeng; Morishita, Masayo; di Luccio, Eric

    2016-04-01

    Dysfunction of histone-modifying enzymes affects chromatin regulation and is involved in carcinogenesis, tumour progression and other diseases. Histone methyltransferases are a family of key histone-modifying enzymes, but their structures, functions and mechanisms are incompletely understood, thus constraining drug-design efforts. Here, preliminary steps towards structure-function studies of Schizosaccharomyces pombe Set7, a putative histone methyltransferase and the first yeast full-length SET-domain-containing protein to be studied using X-ray crystallography, are reported. The methods from cloning to X-ray diffraction and phasing are discussed and the results will aid in prospective studies of histone-modifying enzymes.

  7. SURVEILLANCE TEST (ENVIRONMENTAL) OF GRENADE, HAND RIOT, CS, ABC-M7A2; DPGR 387.

    Science.gov (United States)

    Tests were conducted to determine the effects of environment upon the storage and functioning of the grenade , hand, riot, CS, ABC-M7A2, in climates...represented by the arctic, desert, temperate, and tropic test sites. The grenade is a 28-gauge steel cylinder 2.5 inches in diameter and 4.5 inches...long. It is ignited by a standard M201A1 fuze threaded into the grenade top. It is filled with approximately 275 grams of CS agent - pyrotechnic mix in

  8. Ammonium tetrathiomolybdate treatment targets the copper transporter ATP7A and enhances sensitivity of breast cancer to cisplatin

    OpenAIRE

    Chisholm, Cristine L.; Wang, Haitao; Wong, Ada Hang-Heng; Vazquez-Ortiz, Guelaguetza; Chen, Weiping; Xu, Xiaoling; Deng, Chu-Xia

    2016-01-01

    Cisplatin is an effective breast cancer drug but resistance often develops over prolonged chemotherapy. Therefore, we performed a candidate approach RNAi screen in combination with cisplatin treatment to identify molecular pathways conferring survival advantages. The screen identified ATP7A as a therapeutic target. ATP7A is a copper ATPase transporter responsible for intercellular movement and sequestering of cisplatin. Pharmaceutical replacement for ATP7A by ammonium tetrathiomolybdate (TM) ...

  9. TEST & EVALUATION REPORT FOR THE HEDGEHOG-II PACKAGING SYSTEMS DOT-7A TYPE A CONTAINER

    Energy Technology Data Exchange (ETDEWEB)

    KELLY, D.L.

    2003-12-29

    This report documents the US. Department of Transportation Specification 7A (DOT-7A) Type A compliance test and evaluation results for the Hedgehog-II packaging systems. The approved Hedgehog-II packaging configurations provide primary and secondary containment. The approved packaging configurations described within this report are designed to ship Type A quantities of radioactive materials, normal form. Contents may be in solid or liquid form. Liquids transported in the approved 1 L glass bottle assembly shall have a specific gravity of less than or equal to 1.6. Liquids transported in all other approved configurations shall have a specific gravity of less than or equal to 2.0. The solid contents, including packaging, are limited in weight to the gross weight of the as-tested liquids and bottles. The approved Hedgehog-II packaging configurations described in this report may be transported by air, and have been evaluated as meeting the applicable International Air Transport Association/International Civil Aviation Organization (IATA/ICAO) Dangerous Goods Regulations in addition to the DOT requirements.

  10. Compound heterozygous MYO7A mutations segregating Usher syndrome type 2 in a Han family.

    Science.gov (United States)

    Zong, Ling; Chen, Kaitian; Wu, Xuan; Liu, Min; Jiang, Hongyan

    2016-11-01

    Identification of rare deafness genes for inherited congenital sensorineural hearing impairment remains difficult, because a large variety of genes are implicated. In this study we applied targeted capture and next-generation sequencing to uncover the underlying gene in a three-generation Han family segregating recessive inherited hearing loss and retinitis pigmentosa. After excluding mutations in common deafness genes GJB2, SLC26A4 and the mitochondrial gene, genomic DNA of the proband of a Han family was subjected to targeted next-generation sequencing. The candidate mutations were confirmed by Sanger sequencing and subsequently analyzed with in silico tools. An unreported splice site mutation c.3924+1G > C compound with c.6028G > A in the MYO7A gene were detected to cosegregate with the phenotype in this pedigree. Both mutations, located in the evolutionarily conserved FERM domain in myosin VIIA, were predicted to be pathogenic. In this family, profound sensorineural hearing impairment and retinitis pigmentosa without vestibular disorder, constituted the typical Usher syndrome type 2. Identification of novel mutation in compound heterozygosity in MYO7A gene revealed the genetic origin of Usher syndrome type 2 in this Han family. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  11. Semisolid slurry of 7A04 aluminum alloy prepared by electromagnetic stirring and Sc, Zr additions

    Directory of Open Access Journals (Sweden)

    Jun-wen Zhao

    2017-05-01

    Full Text Available Slurry preparation is one of the most critical steps for semisolid casting, and its primary goal is to prepare slurry with uniformly distributed fine globules. In this work, electromagnetic stirring (EMS and the addition of Sc and Zr elements were used to prepare semisolid slurry of 7A04 aluminum alloy in a large diameter slurry maker. The effects of different treatments on the microstructure, composition and their radial homogeneity were investigated. The results show that, compared to the slurry without any treatment, large volume slurry with finer and more uniform microstructure can be obtained when treated by EMS, Sc, or Zr additions individually. EMS is more competent in the microstructural and chemical homogenization of the slurry while Sc and Zr additions are more excellent in its microstructural refinement. The combined treatment of EMS, Sc and Zr produces premium 7A04 aluminum alloy slurry with uniformly distributed fine α-Al globules and composition. The interaction mechanism between EMS and Sc and Zr additions was also discussed.

  12. Loop variants of the thermophile Rasamsonia emersonii Cel7A with improved activity against cellulose.

    Science.gov (United States)

    Sørensen, Trine Holst; Windahl, Michael Skovbo; McBrayer, Brett; Kari, Jeppe; Olsen, Johan Pelck; Borch, Kim; Westh, Peter

    2017-01-01

    Cel7A cellobiohydrolases perform processive hydrolysis on one strand of cellulose, which is threaded through the enzyme's substrate binding tunnel. The tunnel structure results from a groove in the catalytic domain, which is covered by a number of loops. These loops have been identified as potential targets for engineering of this industrially important enzyme family, but only few systematic studies on this have been made. Here we show that two asparagine residues (N194 and N197) positioned in the loop covering the glucopyranose subsite -4 (recently denoted B2 loop) of the thermostable Cel7A from Rasamsonia emersonii had profound effects on both substrate interactions and catalytic efficacy. At room temperature the double mutant N194A/N197A showed strongly reduced substrate affinity with a water-cellulose partitioning coefficient threefold lower than the wild type. Yet, this variant was catalytically efficient with a maximal turnover about twice as high as the wild type. Analogous but smaller changes were found for the single mutants. Analysis of these changes in affinity and kinetics as a function of temperature, led to the conclusion that replacement of N194 and particularly N197 with alanine leads to faster enzyme-substrate dissociation. Conversely, these residues appeared to have little or no effect on the rate of association. We suggest that the controlled adjustment of the enzyme-substrate dissociation prompts faster cellulolytic enzymes. Biotechnol. Bioeng. 2017;114: 53-62. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  13. Expression of WNT genes in cervical cancer-derived cells: Implication of WNT7A in cell proliferation and migration

    Energy Technology Data Exchange (ETDEWEB)

    Ramos-Solano, Moisés, E-mail: mrsolano84@gmail.com [División de Inmunología, Centro de Investigación Biomédica de Occidente (CIBO)-Instituto Mexicano del Seguro Social (IMSS), Guadalajara, Jalisco (Mexico); Programa de Doctorado en Ciencias Biomédica, Centro Universitario de Ciencias de la Salud (CUCS), Universidad de Guadalajara, Guadalajara, Jalisco (Mexico); Meza-Canales, Ivan D., E-mail: imezacanales@ice.mpg.de [Department of Molecular Ecology, Max Planck Institute for Chemical Ecology, 07745 Jena (Germany); Torres-Reyes, Luis A., E-mail: torres_reyes_88@hotmail.com [División de Inmunología, Centro de Investigación Biomédica de Occidente (CIBO)-Instituto Mexicano del Seguro Social (IMSS), Guadalajara, Jalisco (Mexico); Programa de Doctorado en Ciencias Biomédica, Centro Universitario de Ciencias de la Salud (CUCS), Universidad de Guadalajara, Guadalajara, Jalisco (Mexico); Alvarez-Zavala, Monserrat, E-mail: monse_belan@hotmail.com [División de Inmunología, Centro de Investigación Biomédica de Occidente (CIBO)-Instituto Mexicano del Seguro Social (IMSS), Guadalajara, Jalisco (Mexico); Programa de Doctorado en Ciencias Biomédica, Centro Universitario de Ciencias de la Salud (CUCS), Universidad de Guadalajara, Guadalajara, Jalisco (Mexico); and others

    2015-07-01

    According to the multifactorial model of cervical cancer (CC) causation, it is now recognized that other modifications, in addition to Human papillomavirus (HPV) infection, are necessary for the development of this neoplasia. Among these, it has been proposed that a dysregulation of the WNT pathway might favor malignant progression of HPV-immortalized keratinocytes. The aim of this study was to identify components of the WNT pathway differentially expressed in CC vs. non-tumorigenic, but immortalized human keratinocytes. Interestingly, WNT7A expression was found strongly downregulated in cell lines and biopsies derived from CC. Restoration of WNT7A in CC-derived cell lines using a lentiviral gene delivery system or after adding a recombinant human protein decreases cell proliferation. Likewise, WNT7A silencing in non-tumorigenic cells markedly accelerates proliferation. Decreased WNT7A expression was due to hypermethylation at particular CpG sites. To our knowledge, this is the first study reporting reduced WNT7A levels in CC-derived cells and that ectopic WNT7A restoration negatively affects cell proliferation and migration. - Highlights: • WNT7A is expressed in normal keratinocytes or cervical cells without lesion. • WNT7A is significantly reduced in cervical cancer-derived cells. • Restoration of WNT7A expression in HeLa decreases proliferation and cell migration. • Silencing of WNT7A in HaCaT induces an increased proliferation and migration rate. • Decreased WNT7A expression in this model is due to hypermethylation.

  14. Identification and analysis of 21 novel disease-causing amino acid substitutions in the conserved part of ATP7A

    DEFF Research Database (Denmark)

    Moller, L.B.; Bukrinsky, J.T.; Mølgaard, Anne

    2005-01-01

    ATP7A encodes a copper. translocating ATPase that belongs to the large family of P-type ATPases. Eight conserved regions define the core of the P-type ATPase superfamily. We report here the identification of 21 novel missense mutations in the conserved part of ATP7A that encodes the residues p.V8...

  15. Engineering Cel7A carbohydrate binding module and linker for reduced lignin inhibition.

    Science.gov (United States)

    Strobel, Kathryn L; Pfeiffer, Katherine A; Blanch, Harvey W; Clark, Douglas S

    2016-06-01

    Non-productive binding of cellulases to lignin inhibits enzymatic hydrolysis of biomass, increasing enzyme requirements and the cost of biofuels. This study used site-directed mutagenesis of the Trichoderma Cel7A carbohydrate binding module (CBM) and linker to investigate the mechanisms of adsorption to lignin and engineer a cellulase with increased binding specificity for cellulose. CBM mutations that added hydrophobic or positively charged residues decreased the specificity for cellulose, while mutations that added negatively charged residues increased the specificity. Linker mutations that altered predicted glycosylation patterns selectively impacted lignin affinity. Beneficial mutations were combined to generate a mutant with 2.5-fold less lignin affinity while fully retaining cellulose affinity. This mutant was uninhibited by added lignin during hydrolysis of Avicel and generated 40% more glucose than the wild-type enzyme from dilute acid-pretreated Miscanthus. Biotechnol. Bioeng. 2016;113: 1369-1374. © 2015 Wiley Periodicals, Inc. © 2015 Wiley Periodicals, Inc.

  16. Exo-exo synergy between Cel6A and Cel7A from Hypocrea jecorina

    DEFF Research Database (Denmark)

    Badino, Silke Flindt; Christensen, Stefan Jarl; Kari, Jeppe

    2017-01-01

    Synergy between cellulolytic enzymes is essential in both natural and industrial breakdown of biomass. In addition to synergy between endo- and exo-lytic enzymes, a lesser known but equally conspicuous synergy occurs among exo-acting, processive cellobiohydrolases (CBHs) such as Cel7A and Cel6A...... from Hypocrea jecorina. We studied this system using microcrystalline cellulose as substrate and found a degree of synergy between 1.3 and 2.2 depending on the experimental conditions. Synergy between enzyme variants without the carbohydrate binding module (CBM) and its linker was strongly reduced...... compared to the wild types. One plausible interpretation of this is that exo-exo synergy depends on the targeting role of the CBM. Many earlier works have proposed that exo-exo synergy was caused by an auxiliary endo-lytic activity of Cel6A. However, biochemical data from different assays suggested...

  17. Genotypic and phenotypic spectrum of pyridoxine-dependent epilepsy (ALDH7A1 deficiency)

    DEFF Research Database (Denmark)

    Mills, Philippa B; Footitt, Emma J; Mills, Kevin A

    2010-01-01

    Pyridoxine-dependent epilepsy was recently shown to be due to mutations in the ALDH7A1 gene, which encodes antiquitin, an enzyme that catalyses the nicotinamide adenine dinucleotide-dependent dehydrogenation of l-alpha-aminoadipic semialdehyde/L-Delta1-piperideine 6-carboxylate. However, whilst...... with suspected or clinically proven pyridoxine-dependent epilepsy and to characterize further the phenotypic spectrum of antiquitin deficiency. Urinary L-alpha-aminoadipic semialdehyde concentration was determined by liquid chromatography tandem mass spectrometry. When this was above the normal range, DNA......, through abnormal foetal movements and a multisystem neonatal disorder, to the onset of seizures and autistic features after the first year of life. Our relatively large series suggested that clinical diagnosis of pyridoxine dependent epilepsy can be challenging because: (i) there may be some response...

  18. An overview and update of ATP7A mutations leading to menkes disease and occipital horn syndrome

    DEFF Research Database (Denmark)

    Tümer, Zeynep

    2013-01-01

    of patients are males. MD occurs because of mutations in the ATP7A gene and the vast majority of ATP7A mutations are intragenic mutations or partial gene deletions. ATP7A is an energy-dependent transmembrane protein, which is involved in the delivery of copper to the secreted copper enzymes and in the export...... of surplus copper from cells. Severely affected MD patients die usually before the third year of life. A cure for the disease does not exist, but very early copper-histidine treatment may correct some of the neurological symptoms. This study reviews 274 published and 18 novel disease causing mutations...... identified in 370 unrelated MD patients, nonpathogenic variants of ATP7A, functional studies of the ATP7A mutations, and animal models of MD....

  19. Arsenic trioxide inhibits cell growth and motility via up-regulation of let-7a in breast cancer cells.

    Science.gov (United States)

    Shi, Ying; Cao, Tong; Huang, Hua; Lian, Chaoqun; Yang, Ying; Wang, Zhiwei; Ma, Jia; Xia, Jun

    2017-10-05

    Arsenic trioxide (ATO) has been reported to exert its anti-cancer activities in human cancers. However, the molecular mechanism of ATO-triggered anti-tumor activity has not been fully elucidated. Recently, multiple studies demonstrated that ATO could regulate miRNAs in human cancers. Therefore, in this study, we investigated whether ATO regulated let-7a in breast cancer cells. We found that ATO upregulated let-7a level in breast cancer cells. We also found that up-regulation of let-7a inhibited cell growth and induced apoptosis and retarded cell migration and invasion. We also observed that up-regulation of let-7a enhanced cell growth inhibition and invasion suppression induced by ATO treatment. Our findings suggest that ATO suppressed cell growth, stimulated apoptosis, and retarded cell invasion partly via upregulation of let-7a in breast cancer cells. Our study provides a new anti-tumor mechanism of ATO treatment in breast cancer.

  20. Caspase-6 Induces 7A6 Antigen Localization to Mitochondria During FAS-induced Apoptosis of Jurkat Cells.

    Science.gov (United States)

    Suita, Hiroaki; Shinomiya, Takahisa; Nagahara, Yukitoshi

    2017-04-01

    Mitochondria are central to apoptosis. However, apoptosis progression involving mitochondria is not fully understood. A factor involved in mitochondria-mediated apoptosis is 7A6 antigen. 7A6 localizes to mitochondria from the cytosol during apoptosis, which seems to involve 'effector' caspases. In this study, we investigated the precise role of effector caspases in 7A6 localization to mitochondria during apoptosis. Human T-cell lymphoma Jurkat cells were treated with an antibody against FAS. 7A6 localization was analyzed by confocal laser scanning microscopy and flow cytometry. Caspases activation was determined by western blot analysis. 7A6 localization to mitochondria during anti-FAS-induced apoptosis was significantly reduced by the caspase-6 inhibitor, N-acetyl-Val-Glu-Ile-Asp-aldehyde, but not by the caspase-3 inhibitor, N-acetyl-Asp-Asn-Leu-Asp-aldehyde, nor caspase-7/3 inhibitor, N-acetyl-Asp-Gln-Thr-Asp-aldehyde. Moreover, caspase-6 down-regulation suppressed 7A6 localization to mitochondria. Caspase-6 regulates 7A6 localization to mitochondria during anti-FAS-induced apoptosis of Jurkat cells. Copyright© 2017, International Institute of Anticancer Research (Dr. George J. Delinasios), All rights reserved.

  1. Final evaluation & test report for the standard waste box (docket 01-53-7A) type A packaging

    Energy Technology Data Exchange (ETDEWEB)

    KELLY, D L

    2001-10-15

    This report documents the U.S. Department of Transportation Specification 7A Type A compliance test and evaluation results of the Standard Waste Box. Testing and evaluation activities documented herein are on behalf of the U.S. Department of Energy-Headquarters, Office of Safety, Health and Security (EM-5), Germantown, Maryland. Duratek Federal Services, Inc., Northwest Operations performed an evaluation of the changes as documented herein under Docket 01-53-7A.

  2. Premature termination codons in the Type VII collagen gene (COL7A1) underlie severe, mutilating recessive dystrophic epidermolysis bullosa

    Energy Technology Data Exchange (ETDEWEB)

    Christiano, A.M.; Uitto, J. (Thomas Jefferson Univ., Philadelphia, PA (United States)); Anhalt, G. (Johns Hopkins School of Medicine, Baltimore, MD (United States)); Gibbons, S.; Bauer, E.A. (Stanford Univ. School of Medicine, CA (United States))

    1994-05-01

    Epidermolysis bullosa (EB) is a group of heritable mechano-bullous skin diseases classified into three major categories on the basis of the level of tissue separation within the dermal-epidermal basement membrane zone. The most severe, dystrophic (scarring) forms of EB demonstrate blister formation below the cutaneous basement membrane at the level of the anchoring fibrils. Ultrastructural observations of altered anchoring fibrils and genetic linkage to the gene encoding type VII collagen (COL7A1), the major component of anchoring fibrils, have implicated COL7A1 as the candidate gene in the dystrophic forms of EB. The authors have recently cloned the entire cDNA and gene for human COL7A1, which has been mapped to 3p21. In this study, they describe mutations in four COL7A1 alleles in three patients with severe, mutilating recessive dystrophic EB (Hallopeau-Siemens type, HS-RDEB). Each of these mutations resulted in a premature termination codon (PTC) in the amino-terminal portion of COL7A1. One of the patients was a compound heterozygote for two different mutations. The heterozygous carriers showed an [approximately] 50% reduction in anchoring fibrils, yet were clinically unaffected. Premature termination codons in both alleles of COL7A1 may thus be a major underlying cause of the severe, recessive dystrophic forms of EB. 40 refs., 8 figs.

  3. LIN7A depletion disrupts cerebral cortex development, contributing to intellectual disability in 12q21-deletion syndrome.

    Directory of Open Access Journals (Sweden)

    Ayumi Matsumoto

    Full Text Available Interstitial deletion of 12q21 has been reported in four cases, which share several common clinical features, including intellectual disability (ID, low-set ears, and minor cardiac abnormalities. Comparative genomic hybridization (CGH analysis using the Agilent Human Genome CGH 180K array was performed with the genomic DNA from a two-year-old Japanese boy with these symptoms, as well as hypoplasia of the corpus callosum. Consequently, a 14 Mb deletion at 12q21.2-q21.33 (nt. 77 203 574-91 264 613 bp, which includes 72 genes, was detected. Of these, we focused on LIN7A, which encodes a scaffold protein that is important for synaptic function, as a possible responsible gene for ID, and we analyzed its role in cerebral cortex development. Western blotting analyses revealed that Lin-7A is expressed on embryonic day (E 13.5, and gradually increases in the mouse brain during the embryonic stage. Biochemical fractionation resulted in the enrichment of Lin-7A in the presynaptic fraction. Suppression of Lin-7A expression by RNAi, using in utero electroporation on E14.5, delayed neuronal migration on postnatal day (P 2, and Lin-7A-deficient neurons remained in the lower zone of the cortical plate and the intermediate zone. In addition, when Lin-7A was silenced in cortical neurons in one hemisphere, axonal growth in the contralateral hemisphere was delayed; development of these neurons was disrupted such that one half did not extend into the contralateral hemisphere after leaving the corpus callosum. Taken together, LIN7A is a candidate gene responsible for 12q21-deletion syndrome, and abnormal neuronal migration and interhemispheric axon development may contribute to ID and corpus callosum hypoplasia, respectively.

  4. LIN7A depletion disrupts cerebral cortex development, contributing to intellectual disability in 12q21-deletion syndrome.

    Science.gov (United States)

    Matsumoto, Ayumi; Mizuno, Makoto; Hamada, Nanako; Nozaki, Yasuyuki; Jimbo, Eriko F; Momoi, Mariko Y; Nagata, Koh-ichi; Yamagata, Takanori

    2014-01-01

    Interstitial deletion of 12q21 has been reported in four cases, which share several common clinical features, including intellectual disability (ID), low-set ears, and minor cardiac abnormalities. Comparative genomic hybridization (CGH) analysis using the Agilent Human Genome CGH 180K array was performed with the genomic DNA from a two-year-old Japanese boy with these symptoms, as well as hypoplasia of the corpus callosum. Consequently, a 14 Mb deletion at 12q21.2-q21.33 (nt. 77 203 574-91 264 613 bp), which includes 72 genes, was detected. Of these, we focused on LIN7A, which encodes a scaffold protein that is important for synaptic function, as a possible responsible gene for ID, and we analyzed its role in cerebral cortex development. Western blotting analyses revealed that Lin-7A is expressed on embryonic day (E) 13.5, and gradually increases in the mouse brain during the embryonic stage. Biochemical fractionation resulted in the enrichment of Lin-7A in the presynaptic fraction. Suppression of Lin-7A expression by RNAi, using in utero electroporation on E14.5, delayed neuronal migration on postnatal day (P) 2, and Lin-7A-deficient neurons remained in the lower zone of the cortical plate and the intermediate zone. In addition, when Lin-7A was silenced in cortical neurons in one hemisphere, axonal growth in the contralateral hemisphere was delayed; development of these neurons was disrupted such that one half did not extend into the contralateral hemisphere after leaving the corpus callosum. Taken together, LIN7A is a candidate gene responsible for 12q21-deletion syndrome, and abnormal neuronal migration and interhemispheric axon development may contribute to ID and corpus callosum hypoplasia, respectively.

  5. Differential expression of ATP7A, ATP7B and CTR1 in adult rat dorsal root ganglion tissue

    Directory of Open Access Journals (Sweden)

    Ip Virginia

    2010-09-01

    Full Text Available Abstract Background ATP7A, ATP7B and CTR1 are metal transporting proteins that control the cellular disposition of copper and platinum drugs, but their expression in dorsal root ganglion (DRG tissue and their role in platinum-induced neurotoxicity are unknown. To investigate the DRG expression of ATP7A, ATP7B and CTR1, lumbar DRG and reference tissues were collected for real time quantitative PCR, RT-PCR, immunohistochemistry and Western blot analysis from healthy control adult rats or from animals treated with intraperitoneal oxaliplatin (1.85 mg/kg or drug vehicle twice weekly for 8 weeks. Results In DRG tissue from healthy control animals, ATP7A mRNA was clearly detectable at levels similar to those found in the brain and spinal cord, and intense ATP7A immunoreactivity was localised to the cytoplasm of cell bodies of smaller DRG neurons without staining of satellite cells, nerve fibres or co-localisation with phosphorylated heavy neurofilament subunit (pNF-H. High levels of CTR1 mRNA were detected in all tissues from healthy control animals, and strong CTR1 immunoreactivity was associated with plasma membranes and vesicular cytoplasmic structures of the cell bodies of larger-sized DRG neurons without co-localization with ATP7A. DRG neurons with strong expression of ATP7A or CTR1 had distinct cell body size profiles with minimal overlap between them. Oxaliplatin treatment did not alter the size profile of strongly ATP7A-immunoreactive neurons but significantly reduced the size profile of strongly CTR1-immunoreactive neurons. ATP7B mRNA was barely detectable, and no specific immunoreactivity for ATP7B was found, in DRG tissue from healthy control animals. Conclusions In conclusion, adult rat DRG tissue exhibits a specific pattern of expression of copper transporters with distinct subsets of peripheral sensory neurons intensely expressing either ATP7A or CTR1, but not both or ATP7B. The neuron subtype-specific and largely non

  6. Screening for SLC7A14 gene mutations in patients with autosomal recessive or sporadic retinitis pigmentosa.

    Science.gov (United States)

    Sugahara, Masako; Oishi, Maho; Oishi, Akio; Ogino, Ken; Morooka, Satoshi; Gotoh, Norimoto; Kang, Inyeop; Yoshimura, Nagahisa

    2017-01-01

    In this study, we aimed to detect mutations in the SLC7A14 cationic transporter gene, which has recently been reported as a causative gene for retinitis pigmentosa (RP), in Japanese patients with autosomal recessive (AR) or sporadic RP. We included 146 unrelated Japanese patients with AR or sporadic RP who lacked mutations in genes known to be associated with RP despite next-generation sequencing-based screening. We sequenced the seven SLC7A14 coding exons along with their flanking intronic DNA using the Sanger method. The detected polymorphisms were assessed for their pathogenicity with in silico prediction tools. For those who had heterozygous, nonsynonymous variants, we performed multiplex ligation-dependent probe amplification (MLPA) to search for additional deletion/duplication. We detected four distinct SLC7A14 polymorphisms excluding synonymous polymorphisms. Two of these polymorphisms were assessed as detrimental by in silico prediction tools. However, all of the mutations were heterozygous. Neither homozygous polymorphisms nor compound heterozygous polymorphisms, which are considered detrimental variants, were detected. Neither deletion nor duplication was found with MLPA in patients with heterozygous variants. The four SLC7A14 mutations detected herein were unlikely to be pathogenic in this Japanese cohort. The frequency and pathogenicity of SLC7A14 mutations may vary depending on ethnicity, and these mutations may be rare in Japanese patients.

  7. A Gene Gun-mediated Nonviral RNA trans-splicing Strategy for Col7a1 Repair

    Directory of Open Access Journals (Sweden)

    Patricia Peking

    2016-01-01

    Full Text Available RNA trans-splicing represents an auspicious option for the correction of genetic mutations at RNA level. Mutations within COL7A1 causing strong reduction or absence of type VII collagen are associated with the severe skin blistering disease dystrophic epidermolysis bullosa. The human COL7A1 mRNA constitutes a suitable target for this RNA therapy approach, as only a portion of the almost 9 kb transcript has to be delivered into the target cells. Here, we have proven the feasibility of 5′ trans-splicing into the Col7a1 mRNA in vitro and in vivo. We designed a 5′ RNA trans-splicing molecule, capable of replacing Col7a1 exons 1–15 and verified it in a fluorescence-based trans-splicing model system. Specific and efficient Col7a1 trans-splicing was confirmed in murine keratinocytes. To analyze trans-splicing in vivo, we used gene gun delivery of a minicircle expressing a FLAG-tagged 5′ RNA trans-splicing molecule into the skin of wild-type mice. Histological and immunofluorescence analysis of bombarded skin sections revealed vector delivery and expression within dermis and epidermis. Furthermore, we have detected trans-spliced type VII collagen protein using FLAG-tag antibodies. In conclusion, we describe a novel in vivo nonviral RNA therapy approach to restore type VII collagen expression for causative treatment of dystrophic epidermolysis bullosa.

  8. Novel compound heterozygous MYO7A mutations in Moroccan families with autosomal recessive non-syndromic hearing loss.

    Directory of Open Access Journals (Sweden)

    Amina Bakhchane

    Full Text Available The MYO7A gene encodes a protein belonging to the unconventional myosin super family. Mutations within MYO7A can lead to either non syndromic hearing loss or to the Usher syndrome type 1B (USH1B. Here, we report the results of genetic analyses performed on Moroccan families with autosomal recessive non syndromic hearing loss that identified two families with compound heterozygous MYO7A mutations. Five mutations (c.6025delG, c.6229T>A, c.3500T>A, c.5617C>T and c.4487C>A were identified in these families, the latter presenting two differently affected branches. Multiple bioinformatics programs and molecular modelling predicted the pathogenic effect of these mutations. In conclusion, the absence of vestibular and retinal symptom in the affected patients suggests that these families have the isolated non-syndromic hearing loss DFNB2 (nonsyndromic autosomal recessive hearing loss presentation, instead of USH1B.

  9. Mutation spectrum of MYO7A and evaluation of a novel nonsyndromic deafness DFNB2 allele with residual function.

    Science.gov (United States)

    Riazuddin, Saima; Nazli, Sabiha; Ahmed, Zubair M; Yang, Yi; Zulfiqar, Fareeha; Shaikh, Rehan S; Zafar, Ahmed U; Khan, Shaheen N; Sabar, Farooq; Javid, Fouzia T; Wilcox, Edward R; Tsilou, Ekaterini; Boger, Erich T; Sellers, James R; Belyantseva, Inna A; Riazuddin, Sheikh; Friedman, Thomas B

    2008-04-01

    Recessive mutations of MYO7A, encoding unconventional myosin VIIA, can cause either a deaf-blindness syndrome (type 1 Usher syndrome; USH1B) or nonsyndromic deafness (DFNB2). In our study, deafness segregating as a recessive trait in 24 consanguineous families showed linkage to markers for the DFNB2/USH1B locus on chromosome 11q13.5. A total of 23 of these families segregate USH1 due to 17 homozygous mutant MYO7A alleles, of which 14 are novel. One family segregated nonsyndromic hearing loss DFNB2 due to a novel three-nucleotide deletion in an exon of MYO7A (p.E1716del) encoding a region of the tail domain. We hypothesized that DFNB2 alleles of MYO7A have residual myosin VIIA. To address this question we investigated the effects of several mutant alleles by making green fluorescent protein (GFP) tagged cDNA expression constructs containing engineered mutations of mouse Myo7a at codons equivalent to pathogenic USH1B and DFNB2 alleles of human MYO7A. We show that in transfected mouse hair cells an USH1B mutant GFP-myosin VIIa does not localize properly to inner ear hair cell stereocilia. However, a GFP-myosin VIIa protein engineered to have an equivalent DFNB2 mutation to p.E1716del localizes correctly in transfected mouse hair cells. This finding is consistent with the hypothesis that p.E1716del causes a less severe phenotype (DFNB2) than the USH1B-associated alleles because the resulting protein retains some degree of normal function. Published 2008 Wiley-Liss, Inc.

  10. Surgery for the psyche: a longitudinal study of women undergoing reduction mammoplasty.

    Science.gov (United States)

    Hollyman, J A; Lacey, J H; Whitfield, P J; Wilson, J S

    1986-04-01

    This study suggests that surgery is effective in relieving the psychological distress of women requesting reduction mammoplasty for minimal deformity. Eleven young women who applied for operation on the NHS completed measures of psychoneurosis, mood, self-esteem and body perception. Prior to operation they had a distorted body image, low self-esteem and abnormal psychoneurotic profiles. Following surgery body image returned to a normal range; their self-confidence, and view of their femininity and sexual attractiveness were also enhanced. Improvement was maintained during 6 months of follow-up. These results have implications for the NHS provision of cosmetic surgery for such patients.

  11. Opera, Byron, and a South African Psyche in JM Coetzee's Disgrace

    African Journals Online (AJOL)

    At the close of Coetzee's novel Disgrace, Professor David Lurie retreats into a state of alienation. He chooses both a physical and psychic reality removed from a functioning democratic South Africa. In this state he attempts to compose an opera on Lord Byron and Teresa Guiccioli, which becomes representative on many ...

  12. The Self-Organizing Psyche: Nonlinear and Neurobiological Contributions to Psychoanalysis

    Science.gov (United States)

    Stein, A. H.

    Sigmund Freud attempted to align nineteenth century biology (and the dynamically conservative, continuous, Newtonian mechanics that underlie it) with discontinuous conscious experience. His tactics both set the future course for psychoanalytic development and introduced seemingly intractable complications into its metapsychology. In large part, these arose from what we now recognize were biological errors and dynamical oversimplifications amid his physical assumptions. Their correction, brought about by integrating nonlinear dynamics and neuro-biological research findings with W. Bion's reading of metapsychology, fundamentally supports a psychoanalysis based upon D. W. Winnicott's ideas surrounding play within transitional space.

  13. Psyche, soma, and science studies: new directions in the sociology of mental health and illness.

    Science.gov (United States)

    Pickersgill, Martyn D

    2010-08-01

    With the expanding scope of scientific and technological discourse within psychiatry, social scientists need new theoretical tools to grapple with the complex links between psychiatry, science and society. Benefit may be afforded through engagement with the discipline of science and technology studies (STS), which is concerned explicitly with the relationships between science and society. To highlight existing engagements between STS and the sociology of (mental) health, and to encourage researchers to consider ways in which insights from these traditions may be developed further through interdisciplinary debate and analysis. Some of the key works in STS and the sociology of mental illness that use the empirical or theoretical writings of the other were reviewed and appraised. Whilst it is clear that some research synthesizing insights from STS and the sociology of mental health exists, this is currently limited. Sociologists and others concerned with longstanding and emergent issues in mental health might usefully familiarize themselves with some work in STS. A new sociology of psychiatric knowledge production and application represents an important way forward.

  14. Virtual reality and the psyche. Some psychoanalytic approaches to media addiction.

    Science.gov (United States)

    Weisel, Anja

    2015-04-01

    This paper explores the ramifications of excessive use of media on personality development, the development of symbolic and thinking functions and on psychic reality. In doing so, the questions of whether there are specific media objects possessing an intrinsic symbolic quality, and which attachments in the inner world of a child/adolescent can be mobilized or destroyed are discussed. By selecting specific material, computer gamers use their game to activate the field of a personal psychic reality. Hereby, they attempt some kind of self-healing. However, after leaving the game, conflicts and traumata re-enacted but unresolved in the game disappear from their temporary representation without generating any resonance in the gamer's psychic experience. Consequently, although states of mind and affects are activated in the computer game, their processing and integration fail; the game results in a compulsive repetition. The construction and consolidation of retrievable maturation and structural development, the representation of the unrepresentable, succeed in the context of the triangulating analytic relationship, initially through a jointly performed symbolic and narrative re-experience or the recreation of the game. Theoretical considerations are illustrated by means of clinical vignettes. © 2015, The Society of Analytical Psychology.

  15. Soul in the world: symbolic culture as the medium for psyche.

    Science.gov (United States)

    Colman, Warren

    2017-02-01

    Whilst the loss of a sense of living connection with the material world is mainly associated with the scientific revolution in seventeenth century Europe, it can be traced back to Plato's introduction of a hierarchy between soul and body. Jung's attempted solution to this - esse in anima - is ingenious but maintains the Cartesian split by which the aliveness of the world is reduced to a projection of psychic forces (the archetypes). An alternative approach is proposed, rooted in the Aristotelean emphasis on practical activity that sees the soul as a function of our way of being in the world. Human cognition is extended and distributed by our social and material engagement with the world, especially via collective representations whose symbolic character is constitutive of the reality of the world in which we live. Despite the dominance of 'scientific Cartesian' representations in the modern Western world, there remain numerous instances of participation mystique that cannot be captured by the Cartesian notion of projection. These indicate an opening to ways of being in the world that may lead us out of the impasse of the Cartesian matrix. © 2017, The Society of Analytical Psychology.

  16. Synchronicity - The Link Between Physics and Psyche, from Pauli and Jung to Chopra

    Science.gov (United States)

    Teodorani, M.

    2006-07-01

    This book, which is entirely dedicated to the mystery of "synchronicity", is divided into three parts: a) the joint research between analytic psychologist Carl Gustav Jung and quantum physicist Wolfgang Pauli; b) synchronicity mechanisms occurring in the microscopic (canonical quantum entanglement), mesoscopic and macroscopic scales; c) research and philosophy concerning synchronicity by MD Deepak Chopra.

  17. Peri physeos psyches: sobre a natureza da alma no Fedro de Platão

    Directory of Open Access Journals (Sweden)

    Maria Aparecida de Paiva Montenegro

    2010-12-01

    Full Text Available No passo 245c do Fedro de Platão, no contexto do segundo discurso de Sócrates (no qual ele compõe sua palinodia dirigida a Eros, o filósofo chama atenção para a importância de "se tornar explícita a natureza da alma, dos seus estados e atos, assim como indagar se esta natureza é humana ou divina". Pretendo mostrar que Platão, nesse diálogo, tenta fundamentar a natureza mista da alma: em parte racional em parte passional. Essa ambiguidade constitutiva mostra-se diretamente correlacionada àquelas referentes às formas de Amor, Loucura e Retórica abordadas ao longo do diálogo, à medida que estas podem ser tanto perniciosas quanto prodigiosas, a depender do modo como se as conduz. Nessa perspectiva, meu propósito é defender a presença, na filosofia pensada por Platão, de elementos passionais imprescindíveis ao sucesso de sua atividade, cabendo ao filósofo alcançar, por meio de uma formação apropriada, a maestria para reverter aquilo que pode mergulhá-lo na ignorância e, consequentemente, na escravidão e na infelicidade, naquilo que justamente irá conduzi-lo na direção oposta: a do amor à Sabedoria.In Plato's Phaedrus 245-c, when Socrates delivers his second speech (in which he composes his palinodia addressed to Eros, the philosopher calls attention to the importance of "first understanding the truth about the nature of the soul, divine or human, by examining what it does and what is done to it". I intend to point out that in this dialogue, Plato tries to found the mixed composition of the soul: partly rational, partly passionate. This constitutive ambiguity seems to be directly related to those different kinds of Love, Madness and Rhetoric examined in the dialogue, inasmuch as they could be either beneficial or harmful, depending on the way they are managed. Therefore, my purpose is to point that regarding philosophy as conceived by Plato, the appealing of passionate elements are quite indispensable for its successful activity, so that the philosopher must receive an adequate up-bringing in order to reach the mastery of turning elements that could draw him into deep ignorance, consequently into slavery and unhappiness, in their very opposite, which is the love of Wisdom.

  18. [Alienation to burn-out. Psyche and the Universe of Technology].

    Science.gov (United States)

    Tomei, Gianfranco; Casale, Teodorico; Tomei, Francesco; Nieto, Hector Alberto; Prenna, Alessandro; Schifano, Maria Pia; Sinibaldi, Federica; Rosati, Maria Valeria; Fiaschetti, Maria; Nardone, Nadia; Pimpinella, Benedetta; Caciari, Tiziana

    2012-01-01

    The new D. Lgs. N 81, 2008 Article 28 paragraph 1 sanctions that the risk assessment must involve all the possible risks to safety and health of workers, including the work-related stress factors. Stressors at work may vary as to: quantity of work assigned, whether excessive or inadequate; lack of recognition or reward for good job performance; degree of responsibility; precariousness of work; emotional pressures exerted on workers; violence and harassment of psychological nature, poor balance between work and private life. The need man has to understand the causes of his psycho-physical and social disease are old. Only the words we use when dealing with the topic has changed over the time: once it was Alienation now it is Burn-out. The concept of alienation, which has been very important over the time, has many different aspects and has had countless interpretations (which have followed one another), the psycho-analytical, the sociological analysis and the Marxist one, Burnout is actually a syndrome characterized by three interrelated dimensions: exhaustion, cynicism and inefficacy. Therefore it is important to prevent, eliminate or reduce problems related to occupational stress. Among preventive measures, the Europe Agreement identified in the management and in the communication the information necessary to define the goals of the company and the role each employee has. Moreover information and formation are considered the necessary elements to increase awareness and understanding of the problem, its potential causes and possible ways of approading it. Our research group, has developed targeted questionnaires, biological indicators and medical instrumental examinations the occupational doctors can make use of to assess these issues.

  19. PO Box 30125, Nairobi and P. Kigamwa, MBChB, MMed (Psych)

    African Journals Online (AJOL)

    2003-03-01

    Mar 1, 2003 ... to the needy. Conclusion: The media is a controversial, sometimes overused and at times underused resource in Disaster Management. Judicious use of the media was shown to be helpful in this study. Literature supports ... catastrophe would be defined as those who were physically touched by its effects.

  20. [Fifty years of psychiatry at the interface between psyche and soma: a SWOT analysis].

    Science.gov (United States)

    van Houdenhove, B; Luyten, P

    2008-01-01

    During the past 50 years the border area between psychiatry and somatic medicine has undergone remarkable changes. Theories have become better-founded, both psychologically and neurobiologically, research has become more sophisticated, and liaison-psychiatrists and health psychiatrist/behavioural medicine psychologists have played an increasingly active role in this domain. At the beginning of the 21st century modern psychosomatic medicine is facing new challenges; these include how to create a workable diagnostic classification system, how to instruct and educate both health professionals and lay-persons to an adequate level, how to utilize innovative research paradigms without having recourse to reductionism and how to implement in medical practice treatments that are geared to the needs of the individual patient.

  1. Enriched and empowered: nature’s influence on the psyche in two Afrikaans youth novels

    Directory of Open Access Journals (Sweden)

    S. Meyer

    2009-07-01

    Full Text Available In this article two Afrikaans youth novels are analysed in order to determine to what extent nature and elements of the natural environment can influence a child’s experience and view of life. In “Gamkab” (Betsie van Niekerk and “Om ’n kierie te keer” (Pieter Pieterse their natural surroundings expose the characters to challenges and adventures which form a context in which their ways of thinking are challenged and stimulated. This develops their ability to make decisions and solve problems, thereby broadening their life experience and developing their life skills. Theories on reader identification are used to argue that stories like these have the potential to expand and develop reader consciousness. These novels are of importance to the South African child of today, because they introduce various contemporary issues, such as entrepreneurship, social responsibility and multicultural interaction. In identifying with the characters, the reader is confronted with pertinent topics such as peer pressure, teenage insecurities and fears, and problematic family relationships. From the analysis of the novels, which focuses on the enriching and reinforcing contribution of nature, it is apparent that through nature’s challenges the characters are empowered to overcome their problems and improve their personal circumstances. This foreshadows the potential empowerment of the reader.

  2. Depression is common among AIDS patients. Psych consult often is necessary.

    Science.gov (United States)

    2002-12-01

    A national survey indicates that it's fairly common for HIV physicians to identify depression and similar symptoms in HIV-infected patients. A telephone survey of AIDS physicians found that 84.3% reported that their HIV-positive patients suffered from depressive symptoms.

  3. North Carolina clinic employs holistic approach. Care includes nutritionist, psych assessment.

    Science.gov (United States)

    2001-11-01

    HIV physicians have stayed busy in the last decade just keeping up with the latest treatment and pharmaceutical advances that will keep their patients alive. But when clinicians focus entirely on HIV patients' medical treatment, they might be missing the big picture, according to one long-time HIV physician.

  4. Med-psych drug-drug interactions update. Antiretrovirals, part III: antiretrovirals and drugs of abuse.

    Science.gov (United States)

    Wynn, Gary H; Cozza, Kelly L; Zapor, Michael J; Wortmann, Glenn W; Armstrong, Scott C

    2005-01-01

    The third in a series reviewing the HIV/AIDS antiretroviral drugs, this report summarizes the interactions between antiretrovirals and common drugs of abuse. In an overview format for primary care physicians and psychiatrists, the metabolism and drug interactions in the context of antiretroviral therapy are presented for the following drugs of abuse: alcohol, benzodiazepines, cocaine, GHB (liquid X), ketamine (special K), LSD (acid), MDMA (Ecstasy), opiates, PCP (angel dust), and THC (marijuana).

  5. Terror/Enjoyment: Performativity, Resistance and the Teacher's Psyche

    Science.gov (United States)

    Clarke, Matthew

    2013-01-01

    This paper focuses on Stephen Ball's article, "The teacher's soul and the terrors of performativity", since it is here that he analyses the issue of how neoliberal education policies shape teacher identities that I also wish to explore. I begin by providing a summary of the 2003 piece, noting how it locates teachers and their…

  6. The Models of Relationship between Training and Psyche development in Cultural-historical and Activity Approaches

    Directory of Open Access Journals (Sweden)

    Pogozhina I.N.,

    2016-12-01

    Full Text Available The possibility of referring of the psychological theories studying interrelation of training and mental development processes to this or that stage of scientific knowledge formation on the basis of studied objects types and corresponded determination systems as a basic criterion distinguishing the ideals of scientific rationality is justified. General characteristics of classical, non-classical and post-non-classical models, determination of the mechanisms of dissipative systems, requirements for learning and development model building in the context of post-non-classic science paradigm on the criterion of the system features of the object of cognition are described. Domestic psychological school models are compared with associanism, behaviorism, gestalt psychology and Piaget determination models on the number of options allocated to these determinants, types of causal chains and types of links between causal chains. It is shown that cultural-historical approach is situated intermediately between post-non-classical and non-classical models, while activity approach corresponds to post-non-classical understanding of the object of study as complicated self-developing "man-size" system. Determination relationships models developed by L.V.Vygotskii, S.L. Rubinstein, A.N. Leont’ev continue to play the heuristic role at the present stage of scientific development.

  7. The democratic psyche: gender, mental health, and militancy under the Augusto Pinochet dictatorship

    Directory of Open Access Journals (Sweden)

    Brandi Townsend

    2013-05-01

    Full Text Available This essay investigates the work of mental health professionals associated with Chilean non-governmental organizations that were created at the end of the 1970s in opposition to Augusto Pinochet’s dictatorship: The Vicariate of Solidarity and the Foundation of Social Aid of the Christian Churches (FASIC. Those professionals helped political prisoners and their families reconstruct their subjectivities, which meant overcoming everyday survival and private life and participating in society in a dynamic way, typically through a political project. Mental health professionals put ideas about politics, human rights, and subjectivity in dialogue with the dictatorship’s practices and victims’ personal experiences. They argued that individual recovery was a collective process and that collective resistance depended on the reconstruction of the individual. This invoked the populist notion of the individual’s participation in the collective. I contend that ideas about gender based in populist patriarchy influenced mental health professionals’ concepts about reconstructing subjectivity. Above all, they focused on the male-headed nuclear family, or at least a person’s identity as a member of one, as the concept had consolidated under populism. As a result, mental health studies tended to subjugate women militants’ experiences to those of male militants and their wives.

  8. Characterization of ATP7A missense mutants suggests a correlation between intracellular trafficking and severity of Menkes disease

    DEFF Research Database (Denmark)

    Skjørringe, Tina; Pedersen, Per Amstrup; Thorborg, Sidsel Salling

    2017-01-01

    Menkes disease (MD) is caused by mutations in ATP7A, encoding a copper-transporting P-type ATPase which exhibits copper-dependent trafficking. ATP7A is found in the Trans-Golgi Network (TGN) at low copper concentrations, and in the post-Golgi compartments and the plasma membrane at higher...... led to trapping of the protein in TGN and displayed essentially no activity in a yeast-based functional assay. These were predicted to inhibit the catalytic phosphorylation of the protein. Four mutants showed diffuse post-TGN localization, while two displayed copper dependent trafficking. These six...

  9. Cellular MicroRNA Let-7a Suppresses KSHV Replication through Targeting MAP4K4 Signaling Pathways.

    Directory of Open Access Journals (Sweden)

    Xiaohua Tan

    Full Text Available Kaposi's sarcoma (KS-associated herpesvirus (KSHV is the etiologic agent of KS, the most common AIDS-related malignancy. The majority of KS tumor cells harbor latent KSHV virus but only a small percentage undergoes spontaneous lytic replication. Viral reactivation from latency is crucial for the pathogenesis and development of KS, but the cellular mechanisms underlying the switch between viral latency and replication are not well understood.The level of let-7 miRNAs and MAP4K4 in KSHV infected 293T cells were quantified by real-time PCRs. Let-7 expression was silenced by the miRNA sponge technique. In let-7a transfected 293T cells, the expression of MAP4K4 was measured by real-time PCR and western blot. Luciferease expression was employed to examine the effect of let-7a on the 3'-untranslated region (UTR of the MAP4K4 gene in 293T cells. Real-time PCR was used to quantify the KSHV copy numbers in BC-3 cells in which the expression of let-7a and/or MAP4K4 were altered. Finally, ERK, JNK and p38 protein production and their phosphorylation status were detected by western blots in let-7a or MAP4K4 transfected BCBL-1 cells.The expression of microRNA let-7 was dramatically decreased in KSHV infected 293T cells, but that of MAP4K4 was increased significantly. Let-7a is physically associated with and targets the MAP4K4 3'UTR, and inhibits MAP4K4 expression at both mRNA and protein levels. MAP4K4 stimulates KSHV reactivation from latency, whereas let-7a inhibits the function of MAP4K4 by reversing the function of MAP4K4 on JNK, phospho-JNK and phospho-ERK1/2 levels.Our results establish that let-7a specifically suppresses MAP4K4 expression, and further inhibits KSHV reactivation by interfering with the function of MAP4K4 on the MAPK pathway, highlighting let-7a as a potential treatment for KS.

  10. Inter-domain synergism is required for efficient feeding of cellulose chain into active site of cellobiohydrolase Cel7A

    DEFF Research Database (Denmark)

    Kont, Riin; Kari, Jeppe; Borch, Kim

    2016-01-01

    Structural polysaccharides like cellulose and chitin are abundant and their enzymatic degradation to soluble sugars is an important route in green chemistry. Processive glycoside hydrolases (GHs), like cellobiohydrolase Cel7A of Trichoderma reesei (TrCel7A) are key components of efficient enzyme...... to Ala substitution on on-rates was strongly dependent on the presence of the CBM-linker. This compensation between CBM-linker and Trp-38 indicates synergism between CBM-linker and CD in feeding the cellulose chain into the active site. The inter-domain synergism was pre-requisite for the efficient...... degradation of cellulose in the presence of endoglucanase....

  11. Marker Assisted Transfer of Two Powdery Mildew Resistance Genes PmTb7A.1 and PmTb7A.2 from Triticum boeoticum (Boiss. to Triticum aestivum (L..

    Directory of Open Access Journals (Sweden)

    Ahmed Fawzy Abdelnaby Elkot

    Full Text Available Powdery mildew (PM, caused by Blumeria graminis f. sp. tritici, is one of the important wheat diseases, worldwide. Two PM resistance genes, designated as PmTb7A.1 and PmTb7A.2, were identified in T. boeoticum acc. pau5088 and mapped on chromosome 7AL approximately 48cM apart. Two resistance gene analogue (RGA-STS markers Ta7AL-4556232 and 7AL-4426363 were identified to be linked to the PmTb7A.1 and PmTb7A.2, at a distance of 0.6cM and 6.0cM, respectively. In the present study, following marker assisted selection (MAS, the two genes were transferred to T. aestivum using T. durum as bridging species. As many as 12,317 florets of F1 of the cross T. durum /T. boeoticum were pollinated with T. aestivum lines PBW343-IL and PBW621 to produce 61 and 65 seeds, respectively, of three-way F1. The resulting F1s of the cross T. durum/T. boeoticum//T. aestivum were screened with marker flanking both the PM resistance genes PmTb7A.1 and PmTb7A.2 (foreground selection and the selected plants were backcrossed to generate BC1F1. Marker assisted selection was carried both in BC1F1 and the BC2F1 generations. Introgression of alien chromatin in BC2F1 plants varied from 15.4-62.9 percent. Out of more than 110 BC2F1 plants showing introgression for markers linked to the two PM resistance genes, 40 agronomically desirable plants were selected for background selection for the carrier chromosome to identify the plants with minimum of the alien introgression. Cytological analysis showed that most plants have chromosome number ranging from 40-42. The BC2F2 plants homozygous for the two genes have been identified. These will be crossed to generate lines combining both the PM resistance genes but with minimal of the alien introgression. The PM resistance gene PmTb7A.1 maps in a region very close to Sr22, a stem rust resistance gene effective against the race Ug99. Analysis of selected plants with markers linked to Sr22 showed introgression of Sr22 from T. boeoticum in

  12. Mutation Analyses of COL7A1 Gene in Three Taiwanese Patients with Severe Recessive Dystrophic Epidermolysis Bullosa

    Directory of Open Access Journals (Sweden)

    Sheau-Chiou Chao

    2007-01-01

    Full Text Available Dystrophic epidermolysis bullosa (DEB is a hereditary mechanobullous disorder characterized by fragility of the skin and mucous membranes caused by abnormal anchoring fibrils. Both dominant and recessive DEB are caused by mutations in COL7A1, the gene encoding type VII collagen, the major component of anchoring fibrils. We performed mutation analysis of COL7A1 in three patients with recessive DEB. The diagnosis of DEB was based on the characteristic clinical features and confirmed histopathologically. All 118 exons and flanking intron boundaries of COL7A1 were amplified. Four novel mutations (3373insGG, 7769delG, E1535X, G2061E and two potential splicing mutations were detected. The first three of these mutations resulted in premature termination codons, while G2061E caused a glycine substitution mutation in the triple-helical domain. This is the first report of mutation analyses of the COL7A1 gene in Taiwanese pedigrees with recessive DEB. Each patient had a heterozygous premature termination codon mutation combined with either a glycine substitution mutation in the critical triple-helical collagenous domain or a potential splicing mutation. These genotypes correlate well with the severe clinical phenotype of recessive DEB. [J Formos Med Assoc 2007;106(1:86-91

  13. CLINICAL PRESENTATION AND DISEASE COURSE OF USHER SYNDROME BECAUSE OF MUTATIONS IN MYO7A OR USH2A.

    Science.gov (United States)

    Testa, Francesco; Melillo, Paolo; Bonnet, Crystel; Marcelli, Vincenzo; de Benedictis, Antonella; Colucci, Raffaella; Gallo, Beatrice; Kurtenbach, Anne; Rossi, Settimio; Marciano, Elio; Auricchio, Alberto; Petit, Christine; Zrenner, Eberhart; Simonelli, Francesca

    2017-08-01

    To evaluate differences in the visual phenotype and natural history of Usher syndrome caused by mutations in MYO7A or USH2A, the most commonly affected genes of Usher syndrome Type I (USH1) and Type II (USH2), respectively. Eighty-eight patients with a clinical diagnosis of USH1 (26 patients) or USH2 (62 patients) were retrospectively evaluated. Of these, 48 patients had 2 disease-causing mutations in MYO7A (10 USH1 patients), USH2A (33 USH2 patients), and other USH (5 patients) genes. Clinical investigation included best-corrected visual acuity, Goldmann visual field, fundus photography, electroretinography, and audiologic and vestibular assessments. Longitudinal analysis was performed over a median follow-up time of 3.5 years. Patients carrying mutations in MYO7A had a younger age of onset of hearing and visual impairments than those carrying mutations in USH2A, leading to an earlier diagnosis of the disease in the former patients. Longitudinal analysis showed that visual acuity and visual field decreased more rapidly in subjects carrying MYO7A mutations than in those carrying USH2A mutations (mean annual exponential rates of decline of 3.92 vs. 3.44% and of 8.52 vs. 4.97%, respectively), and the former patients reached legal blindness on average 15 years earlier than the latter. The current study confirmed a more severe progression of the retinal disease in USH1 patients rather than in USH2 patients. Furthermore, most visual symptoms (i.e., night blindness, visual acuity worsening) occurred at an earlier age in USH1 patients carrying mutations in MYO7A.

  14. Outer Retinal Changes Including the Ellipsoid Zone Band in Usher Syndrome 1B due to MYO7A Mutations.

    Science.gov (United States)

    Sumaroka, Alexander; Matsui, Rodrigo; Cideciyan, Artur V; McGuigan, David B; Sheplock, Rebecca; Schwartz, Sharon B; Jacobson, Samuel G

    2016-07-01

    To study transition zones from normal to abnormal retina in Usher syndrome IB (USH1B) caused by myosin 7A (MYO7A) mutations. Optical coherence tomography (OCT) scattering layers in outer retina were segmented in patients (n = 16, ages 2-42; eight patients had serial data, average interval 4.5 years) to quantify outer nuclear layer (ONL) and outer segments (OS) as well as the locus of EZ (ellipsoid zone) edge and its extent from the fovea. Static perimetry was measured under dark-adapted (DA) and light-adapted (LA) conditions. Ellipsoid zone edge in USH1B-MYO7A could be located up to 23° from the fovea. Ellipsoid zone extent constricted at a rate of 0.51°/year with slower rates at smaller eccentricities. A well-defined EZ line could be associated with normal or abnormal ONL and/or OS thickness; detectable ONL extended well beyond EZ edge. At the EZ edge, the local slope of LA sensitivity loss was 2.6 (±1.7) dB/deg for central transition zones. At greater eccentricities, the local slope of cone sensitivity loss was shallower (1.1 ± 0.4 dB/deg for LA) than that of rod sensitivity loss (2.8 ± 1.2 dB/deg for DA). In USH1B-MYO7A, constriction rate of EZ extent depends on the initial eccentricity of the transition. Ellipsoid zone edges in the macula correspond to large local changes in cone vision, but extramacular EZ edges show more pronounced losses on rod-based vision tests. It is advisable to use not only the EZ line but also other structural and functional parameters for estimating natural history of disease and possible therapeutic effects in future clinical trials of USH1B-MYO7A.

  15. A novel nonsense ATP7A pathogenic variant in a family exhibiting a variable occipital horn syndrome phenotype

    Directory of Open Access Journals (Sweden)

    Maria Teresa Bonati

    2017-12-01

    Full Text Available We report on a family with occipital horn syndrome (OHS diagnosed in the proband's late fifties. A novel ATP7A pathogenic variant (c.4222A>T, p.(Lys1408*, representing the first nonsense variant and the second late truncation causing OHS rather than classic Menkes disease, was found to segregate in the family. The predicted maintenance of transmembrane domains is consistent with a residual protein activity, which may explain the mild clinical presentation.

  16. A novel mutation in the MYO7A gene is associated with Usher syndrome type 1 in a Chinese family.

    Science.gov (United States)

    He, Xiaoguang; Peng, Qi; Li, Siping; Zhu, Pengyuan; Wu, Chunqiu; Rao, Chunbao; Lin, Jingqi; Lu, Xiaomei

    2017-08-01

    We aimed to investigate the genetic causes of hearing loss in a Chinese proband with autosomal recessive congenital deafness. The targeted capture of 159 known deafness genes and next-generation sequencing were performed to study the genetic causes of hearing loss in the Chinese family. Sanger sequencing was employed to verify the variant mutations in members of this family. The proband harbored two mutations in the MYO7A gene in the form of compound heterozygosity. She was found to be heterozygous for a novel insertion mutation c.3847_3848 ins TCTG (p.N1285LfsX24) in exon 30 and for the known mutation c.2239_2240delAG (p.R747S fsX16)in exon 19. The novel mutation was absent in the 1000 Genomes Project. These variants were carried in the heterozygous state by the parents and were therefore co-segregated with the genetic disease. Clinical re-assessment, including detailed audiologic and ocular examinations, revealed congenital deafness and retinitis pigmentosa in the proband. Collectively, the combination of audiometric, ophthalmologic and genetic examinations successfully confirmed the phenotype of Usher syndrome type 1 (USH1). This study demonstrates that the novel mutation c.3847_3848insTCTG (p. N1285LfsX24) in compound heterozygosity with c.2239_2240delAG in the MYO7A gene is the main cause of USH1 in the proband. Our study expands the mutational spectrum of MYO7A and provides a foundation for further investigations elucidating the MYO7A-related mechanisms of USH1. Copyright © 2017 Elsevier B.V. All rights reserved.

  17. Characterization of an unusual Salmonella phage type DT7a and report of a foodborne outbreak of salmonellosis.

    Science.gov (United States)

    Lettini, A A; Saccardin, C; Ramon, E; Longo, A; Cortini, E; Dalla Pozza, M C; Barco, L; Guerra, B; Luzzi, I; Ricci, A

    2014-10-17

    Salmonella enterica subsp. enterica serovar 4,[5],12,i:- is a monophasic variant of Salmonella Typhimurium and its occurrence has markedly increased in several European countries in the last ten years. In June 2011, an outbreak of Salmonella 4,[5],12,i:- was reported among attendees of a wedding reception in the North-East of Italy. The source of this outbreak was identified as a cooked pork product served during the wedding reception. All Salmonella isolates from humans and the contaminated pork products were identified as Salmonella 4,[5],12,i:- and phage typed as DT7a. Afterwards, the farm where the pigs were raised was identified and sampled, and Salmonella Typhimurium was isolated from swine fecal samples. Despite the difference in serovar, these Salmonella Typhimurium isolates were also phage typed as DT7a. In the present study, Salmonella isolates from animals, humans and pork products during the outbreak investigation were subtyped by pulsed-field gel electrophoresis (PFGE), Multiple-Locus Variable number tandem repeats Analysis (MLVA), and resistance patterns, aiming to identify the most suitable subtyping methods to characterize isolates associated with this outbreak. In addition, a collection of epidemiologically unrelated strains of Salmonella 4,[5],12,i:- and Salmonella Typhimurium sharing the same phage type (DT7a) was similarly characterized in order to investigate their genetic relationship. This study provides a first snapshot of a rare Salmonella phage type, DT7a, associated with both Salmonella 4,[5],12,i:- and Salmonella Typhimurium. Moreover, the study demonstrated that in this specific context MLVA could be a reliable tool to support outbreak investigations as well as to assess the genetic relatedness among Salmonella isolates. Copyright © 2014 Elsevier B.V. All rights reserved.

  18. Dynamics of the metal binding domains and regulation of the human copper transporters ATP7B and ATP7A.

    Science.gov (United States)

    Yu, Corey H; Dolgova, Natalia V; Dmitriev, Oleg Y

    2017-04-01

    Copper transporters ATP7A and ATP7B regulate copper levels in the human cells and deliver copper to the biosynthetic pathways. ATP7A and ATP7B belong to the P-type ATPases and share much of the domain architecture and the mechanism of ATP hydrolysis with the other, well-studied, enzymes of this type. A unique structural feature of the copper ATPases is the chain of six cytosolic metal-binding domains (MBDs), which are believed to be involved in copper-dependent regulation of the activity and intracellular localization of these enzymes. Although the structures of all the MBDs have been solved, the mechanism of copper-dependent regulation of ATP7B and ATP7A, the roles of individual MBDs, and the relationship between the regulatory and catalytic copper binding are still unknown. We describe the structure and dynamics of the MBDs, review the current knowledge about their functional roles and propose a mechanism of regulation of ATP7B by copper-dependent changes in the dynamics and conformation of the MBD chain. Transient interactions between the MBDs, rather than transitions between distinct static conformations are likely to form the structural basis of regulation of the ATP-dependent copper transporters in human cells. © 2016 IUBMB Life, 69(4):226-235, 2017. © 2017 International Union of Biochemistry and Molecular Biology.

  19. Novel compound heterozygous mutations in MYO7A Associated with Usher syndrome 1 in a Chinese family.

    Directory of Open Access Journals (Sweden)

    Xue Gao

    Full Text Available Usher syndrome is an autosomal recessive disease characterized by sensorineural hearing loss, age-dependent retinitis pigmentosa (RP, and occasionally vestibular dysfunction. The most severe form is Usher syndrome type 1 (USH1. Mutations in the MYO7A gene are responsible for USH1 and account for 29-55% of USH1 cases. Here, we characterized a Chinese family (no. 7162 with USH1. Combining the targeted capture of 131 known deafness genes, next-generation sequencing, and bioinformatic analysis, we identified two deleterious compound heterozygous mutations in the MYO7A gene: a reported missense mutation c.73G>A (p.G25R and a novel nonsense mutation c.462C>A (p.C154X. The two compound variants are absent in 219 ethnicity-matched controls, co-segregates with the USH clinical phenotypes, including hearing loss, vestibular dysfunction, and age-dependent penetrance of progressive RP, in family 7162. Therefore, we concluded that the USH1 in this family was caused by compound heterozygous mutations in MYO7A.

  20. Nonsense variant in COL7A1 causes recessive dystrophic epidermolysis bullosa in Central Asian Shepherd dogs.

    Directory of Open Access Journals (Sweden)

    Julia Niskanen

    Full Text Available A rare hereditary mechanobullous disorder called epidermolysis bullosa (EB causes blistering in the skin and the mucosal membranes. To date, nineteen EB-related genes have been discovered in human and other species. We describe here a novel EB variant in dogs. Two newborn littermates of Central Asian Shepherd dogs with severe signs of skin blistering were brought to a veterinary clinic and euthanized due to poor prognosis. In post-mortem examination, the puppies were shown to have findings in the skin and the mucosal membranes characteristic of EB. A whole-genome sequencing of one of the affected puppies was performed to identify the genetic cause. The resequencing data were filtered under a recessive model against variants from 31 other dog genomes, revealing a homozygous case-specific nonsense variant in one of the known EB-causing genes, COL7A1 (c.4579C>T, p.R1527*. The variant results in a premature stop codon and likely absence of the functional protein in the basement membrane of the skin in the affected dogs. This was confirmed by immunohistochemistry using a COL7A1 antibody. Additional screening of the variant indicated full penetrance and breed specificity at ~28% carrier frequency. In summary, this study reveals a novel COL7A1 variant causing recessive dystrophic EB and provides a genetic test for the eradication of the disease from the breed.

  1. Gene Editing for the Efficient Correction of a Recurrent COL7A1 Mutation in Recessive Dystrophic Epidermolysis Bullosa Keratinocytes

    Directory of Open Access Journals (Sweden)

    Cristina Chamorro

    2016-01-01

    Full Text Available Clonal gene therapy protocols based on the precise manipulation of epidermal stem cells require highly efficient gene-editing molecular tools. We have combined adeno-associated virus (AAV-mediated delivery of donor template DNA with transcription activator-like nucleases (TALE expressed by adenoviral vectors to address the correction of the c.6527insC mutation in the COL7A1 gene, causing recessive dystrophic epidermolysis bullosa in a high percentage of Spanish patients. After transduction with these viral vectors, high frequencies of homology-directed repair were found in clones of keratinocytes derived from a recessive dystrophic epidermolysis bullosa (RDEB patient homozygous for the c.6527insC mutation. Gene-edited clones recovered the expression of the COL7A1 transcript and collagen VII protein at physiological levels. In addition, treatment of patient keratinocytes with TALE nucleases in the absence of a donor template DNA resulted in nonhomologous end joining (NHEJ-mediated indel generation in the vicinity of the c.6527insC mutation site in a large proportion of keratinocyte clones. A subset of these indels restored the reading frame of COL7A1 and resulted in abundant, supraphysiological expression levels of mutant or truncated collagen VII protein. Keratinocyte clones corrected both by homology-directed repair (HDR or NHEJ were used to regenerate skin displaying collagen VII in the dermo-epidermal junction.

  2. Characterization of the first knock-out aldh7a1 zebrafish model for pyridoxine-dependent epilepsy using CRISPR-Cas9 technology.

    Directory of Open Access Journals (Sweden)

    Nikita Zabinyakov

    Full Text Available Pyridoxine dependent epilepsy (PDE is caused by likely pathogenic variants in ALDH7A1 (PDE-ALDH7A1 and inherited autosomal recessively. Neurotoxic alpha-amino adipic semialdehyde (alpha-AASA, piperideine 6-carboxylate and pipecolic acid accumulate in body fluids. Neonatal or infantile onset seizures refractory to anti-epileptic medications are clinical features. Treatment with pyridoxine, arginine and lysine-restricted diet does not normalize neurodevelopmental outcome or accumulation of neurotoxic metabolites. There is no animal model for high throughput drug screening. For this reason, we developed and characterized the first knock-out aldh7a1 zebrafish model using CRISPR-Cas9 technology. Zebrafish aldh7a1 mutants were generated by using a vector free method of CRISPR-Cas9 mutagenesis. Genotype analysis of aldh7a1 knock-out zebrafish was performed by high resolution melt analysis, direct sequencing and QIAxcel system. Electroencephalogram was performed. Alpha-AASA, piperideine 6-carboxylate and pipecolic acid, were measured by liquid chromatography-tandem mass spectrometry. Our knock-out aldh7a1 zebrafish has homozygous 5 base pair (bp mutation in ALDH7A1. Knock-out aldh7a1 embryos have spontaneous rapid increase in locomotion and a rapid circling swim behavior earliest 8-day post fertilization (dpf. Electroencephalogram revealed large amplitude spike discharges compared to wild type. Knock-out aldh7a1 embryos have elevated alpha-AASA, piperideine 6-carboxylate and pipecolic acid compared to wild type embryos at 3 dpf. Knock-out aldh7a1 embryos showed no aldh7a1 protein by western blot compared to wild type. Our knock-out aldh7a1 zebrafish is a well characterized model for large-scale drug screening using behavioral and biochemical features and accurately recapitulates the human PDE-ALDH7A1 disease.

  3. SLUDGE WASHING AND DEMONSTRATION OF THE DWPF FLOWSHEET IN THE SRNL SHIELDED CELLS FOR SLUDGE BATCH 7A QUALIFICATION

    Energy Technology Data Exchange (ETDEWEB)

    Pareizs, J.; Billings, A.; Click, D.

    2011-07-08

    Waste Solidification Engineering (WSE) has requested that characterization and a radioactive demonstration of the next batch of sludge slurry (Sludge Batch 7a*) be completed in the Shielded Cells Facility of the Savannah River National Laboratory (SRNL) via a Technical Task Request (TTR). This characterization and demonstration, or sludge batch qualification process, is required prior to transfer of the sludge from Tank 51 to the Defense Waste Processing Facility (DWPF) feed tank (Tank 40). The current WSE practice is to prepare sludge batches in Tank 51 by transferring sludge from other tanks. Discharges of nuclear materials from H Canyon are often added to Tank 51 during sludge batch preparation. The sludge is washed and transferred to Tank 40, the current DWPF feed tank. Prior to transfer of Tank 51 to Tank 40, SRNL simulates the Tank Farm and DWPF processes with a Tank 51 sample (referred to as the qualification sample). Sludge Batch 7a (SB7a) is composed of portions of Tanks 4, 7, and 12; the Sludge Batch 6 heel in Tank 51; and a plutonium stream from H Canyon. SRNL received the Tank 51 qualification sample (sample ID HTF-51-10-125) following sludge additions to Tank 51. This report documents: (1) The washing (addition of water to dilute the sludge supernate) and concentration (decanting of supernate) of the SB7a - Tank 51 qualification sample to adjust sodium content and weight percent insoluble solids to Tank Farm projections. (2) The performance of a DWPF Chemical Process Cell (CPC) simulation using the washed Tank 51 sample. The simulation included a Sludge Receipt and Adjustment Tank (SRAT) cycle, where acid was added to the sludge to destroy nitrite and reduce mercury, and a Slurry Mix Evaporator (SME) cycle, where glass frit was added to the sludge in preparation for vitrification. The SME cycle also included replication of five canister decontamination additions and concentrations. Processing parameters were based on work with a non

  4. 16-Dehydropregnenolone lowers serum cholesterol by up-regulation of CYP7A1 in hyperlipidemic male hamsters.

    Science.gov (United States)

    Ramakrishna, Rachumallu; Kumar, Durgesh; Bhateria, Manisha; Gaikwad, Anil Nilkanth; Bhatta, Rabi Sankar

    2017-04-01

    16-Dehydropregnenolone (DHP) has been developed and patented as a promising antihyperlipidemic agent by CSIR-Central Drug Research Institute (CSIR-CDRI), India. Although DHP is implicated in controlling cholesterol homeostasis, the mechanism underlying its pharmacological effect in hyperlipidemic disease models is poorly understood. In the present study, we postulated that DHP lowers serum lipids through regulating the key hepatic genes accountable for cholesterol metabolism. The hypothesis was tested on golden Syrian hamsters fed with high-fat diet (HFD) following oral administration of DHP at a dose of 72mg/kg body weight for a period of one week. The serum total cholesterol (TC), triglycerides (TG), low-density lipoprotein cholesterol (LDL-C), high-density lipoprotein cholesterol (HDL-C), and total bile acids (TBA) in feces were measured. Real time comparative gene expression studies were performed for CYP7A1, LXRα and PPARα level in liver tissue of hamsters. The results revealed that the DHP profoundly decreased the levels of serum TC, TG, LDL-C and atherogenic index (AI), whilst elevated the HDL-C/TC ratio. Besides, DHP exhibited an anti-hyperlipidemic effect in the HFD induced hyperlipidemic hamsters by means of: (1) up-regulating the gene expression of CYP7A1 encoded cholesterol 7α-hydroxylase, that promotes the catabolism of cholesterol to bile acid; (2) inducing the gene expression of transcription factors LXRα and PPARα; (3) increasing the TBA excretion through feces. Collectively, the findings presented confer the hypolipidemic activity of DHP via up-regulation of hepatic CYP7A1 pathway that promotes cholesterol-to-bile acid conversion and bile acid excretion. Copyright © 2017 Elsevier Ltd. All rights reserved.

  5. Colletotrilactam A-D, novel lactams from Colletotrichum gloeosporioides GT-7, a fungal endophyte of Uncaria rhynchophylla.

    Science.gov (United States)

    Wei, Bo; Yang, Zhong-Duo; Chen, Xiao-Wei; Zhou, Shuang-Yan; Yu, Hai-Tao; Sun, Jing-Yun; Yao, Xiao-Jun; Wang, Yong-Gang; Xue, Hong-Yan

    2016-09-01

    Four novel lactams, colletotrilactam A-D (1-4), along with six known compounds (5-10) were isolated from the culture broth of Colletotrichum gloeosporioides GT-7, a fungal endophyte of Uncaria rhynchophylla. The structures of these compounds were elucidated by comprehensive NMR spectroscopy. Isolates were tested for monoamine oxidase (MAO) inhibitory activity and compound 9 showed potent MAO inhibitory activity with IC50 value of 8.93±0.34μg/mL, when the IC50 value of iproniazid as a standard was 1.80±0.5μg/mL. Copyright © 2016 Elsevier B.V. All rights reserved.

  6. 7a. Jornada de Mecatrònica : Mecatrònica aplicada a les energies renovables

    OpenAIRE

    Universitat de Vic. Grup de Recerca Mecatrònica i Modelització Aplicada a la Tecnologia de Materials

    2015-01-01

    Tríptic de la 7a Jornada de la Mecatrònica : Modelització i simulació de sistemes, celebrada el 26 de març de 2015 a Ripoll i Vic. La jornada, adreçada a estudiants, professors i empreses interessats en l’àrea de la Mecatrònica, vol donar a conèixer diversos camps d’aplicació d’aquesta disciplina i els estudis que s’hi relacionen, mitjançant ponències, demostracions i tallers.

  7. Final evaluation report for Westinghouse Hanford Company, WRAP-1,208 liter waste drum, docket 94-35-7A, type A packaging

    Energy Technology Data Exchange (ETDEWEB)

    Kelly, D.L., Westinghouse Hanford

    1996-06-12

    This report documents the U.S. Department of Transportation Specification 7A Type A (DOT-7A) compliance test results of the Westinghouse Hanford Company, Waste Receiving and Processing Facility, Module 1 (WRAP-1) Drum. The WRAP-1 Drum was tested for DOE-HQ in August 1994, by Los Alamos National Laboratory, under docket number 94-35-7A. Additionally, comparison and evaluation of the approved, as-tested packaging configuration was performed by WHC in September 1995. The WRAP-1 Drum was evaluated against the performance of the DOT-17C, 208 1 (55-gal) steel drums tested and evaluated under dockets 89-13-7A/90-18-7A and 94-37-7A.

  8. Semaphorin7A promotes tumor growth and exerts a pro-angiogenic effect in macrophages of mammary tumor-bearing mice

    Directory of Open Access Journals (Sweden)

    Ramon eGarcia-Areas

    2014-02-01

    Full Text Available Semaphorins, a large family of molecules involved in the axonal guidance and development of the nervous system, have been recently shown to have both angiogenic and anti-angiogenic properties. Specifically, semaphorin 7A (SEMA7A has been reported to have a chemotactic activity in neurogenesis, and to be an immune modulator via it binding to α1β1integrins. Additionally, SEMA7A has been shown to promote chemotaxis of monocytes, inducing them to produce proinflammatory mediators. In this study we explored the role of SEMA7A in the tumoral context. We show that SEMA7A is highly expressed by DA-3 murine mammary tumor cells in comparison to normal mammary cells (EpH4, and that peritoneal macrophages from mammary tumor-bearing mice also express SEMA7A at higher levels compared to peritoneal macrophages derived from normal control mice. We also show that murine macrophages treated with recombinant murine SEMA7A significantly increased their expression of proangiogenic molecules, such as CXCL2/MIP-2. Gene silencing of SEMA7A in peritoneal elicited macrophages from DA-3 tumor-bearing mice resulted in decreased CXCL2 expression. Mice implanted with SEMA7A silenced tumor cells showed decreased angiogenesis in the tumors compared to the wild type tumors. Furthermore, peritoneal elicited macrophages from mice bearing SEMA7A-silenced tumors produce significantly (p< 0.01 lower levels of angiogenic proteins, such as MIP-2, CXCL1 and MMP-9, compared to macrophages from control DA-3 mammary tumors. We postulate that SEMA7A derived from mammary carcinomas may serve as a monocyte chemoattractant and skew monocytes into a pro-tumorigenic phenotype. A putative relationship between tumor-derived SEMA7A and monocytes could prove valuable in establishing new research avenues towards unraveling important tumor-host immune interactions in breast cancer patients.

  9. Direct interactions of adaptor protein complexes 1 and 2 with the copper transporter ATP7A mediate its anterograde and retrograde trafficking.

    Science.gov (United States)

    Yi, Ling; Kaler, Stephen G

    2015-05-01

    ATP7A is a P-type ATPase in which diverse mutations lead to X-linked recessive Menkes disease or occipital horn syndrome. Recently, two previously unknown ATP7A missense mutations, T994I and P1386S, were shown to cause an isolated distal motor neuropathy without clinical or biochemical features of other ATP7A disorders. These mutant alleles cause subtle defects in ATP7A intracellular trafficking, resulting in preferential plasma membrane localization compared with wild-type ATP7A. We reported previously that ATP7A(P1386S) causes unstable insertion of the eighth and final transmembrane segment, preventing proper position of the carboxyl-terminal tail in a proportion of mutant molecules. Here, we utilize this and other naturally occurring and engineered mutant ATP7A alleles to identify mechanisms of normal ATP7A trafficking. We show that adaptor protein (AP) complexes 1 and 2 physically interact with ATP7A and that binding is mediated in part by a carboxyl-terminal di-leucine motif. In contrast to other ATP7A missense mutations, ATP7A(P1386S) partially disturbs interactions with both APs, leading to abnormal axonal localization in transfected NSC-34 motor neurons and altered calcium-signaling following glutamate stimulation. Our results imply that AP-1 normally tethers ATP7A at the trans-Golgi network in the somatodendritic segments of motor neurons and that alterations affecting the ATP7A carboxyl-terminal tail induce release of the copper transporter to the axons or axonal membranes. The latter effects are intensified by diminished interaction with AP-2, impeding ATP7A retrograde trafficking. Taken together, these findings further illuminate the normal molecular mechanisms of ATP7A trafficking and suggest a pathophysiological basis for ATP7A-related distal motor neuropathy. Published by Oxford University Press 2015. This work is written by (a) US Government employee(s) and is in the public domain in the US.

  10. SLC7A5 Functions as a Downstream Target Modulated by CRKL in Metastasis Process of Gastric Cancer SGC-7901 Cells.

    Directory of Open Access Journals (Sweden)

    Junqing Wang

    Full Text Available SLC7A5, who is also named LAT-1, has been validated as a promoter regulated by miRNA-126 in our previous research for gastric cancer cells. However, the mechanisms driving SLC7A5 to affect the bio-function of gastric cancer cells are unclear, remaining us lots of to elucidate. The aim of this study is to investigate the regulating effect of CRKL, one of the critical genes involving with gastric cancer progression, on SLC7A5 expression. By studying the gastric cancer cell lines and clinical pathological specimens, we found that the expression of SLC7A5 was significantly correlated to CRKL. By depleting CRKL in gastric cancer SGC-7901 cells, the SLC7A5 expression was impaired, and the invasion and migration of SGC-7901 cells were suppressed. Ectopic expression of SLC7A5 could drastically rescue the phenotypes induced by CRKL depletion in this study. Accordingly, we conclude that SLC7A5 functions as a promoter in gastric cancer metastasis, and CRKL could be one of its regulators modulating the expression of SLC7A5 and consequentially affect the metastatic feature of SGC-7901 cells. The findings in this study indicate a regulation relationship between CRKL and SLC7A5, and provide useful evidence for gastric cancer therapeutic strategies.

  11. Simulation analysis of the cellulase Cel7A carbohydrate binding module on the surface of the cellulose Iβ

    Energy Technology Data Exchange (ETDEWEB)

    Alekozai, Emal M. [Univ. of Heidelberg (Germany); Univ. of Tennessee, Knoxville, TN (United States); GhattyVenkataKrishna, Pavan K. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Uberbacher, Edward C. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Crowley, Michael F. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); National Renewable Energy Lab. (NREL), Golden, CO (United States); Smith, Jeremy C. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Univ. of Tennessee, Knoxville, TN (United States); Cheng, Xiaolin [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Univ. of Tennessee, Knoxville, TN (United States)

    2013-08-22

    The Family 7 cellobiohydrolase (Cel7A) from Trichoderma reesei consists of a carbohydrate-binding module (CBM) joined by a linker to a catalytic domain. Cellulose hydrolysis is limited by the accessibility of Cel7A to crystalline substrates, which is perceived to be primarily mediated by the CBM. The binding of CBM to the cellulose I fiber is characterized by combined Brownian dynamics (BD) and molecular dynamics (MD) simulations. Our results confirm that CBM prefers to dock to the hydrophobic than to the hydrophilic fiber faces. Both electrostatic (ES) and van der Waals (VDW) interactions are required for achieving the observed binding preference. The VDW interactions play a more important role in stabilizing the CBM-fiber binding, whereas the ES interactions contribute through the formation of a number of hydrogen bonds between the CBM and the fiber. At long distances, an ES steering effect is also observed that tends to align the CBM in an antiparallel manner relative to the fiber axis. Moreover, the MD results reveal hindered diffusion of the CBM on all fiber surfaces. The binding of the CBM to the hydrophobic surfaces is found to involve partial dewetting at the CBM-fiber interface coupled with local structural arrangements of the protein. The present simulation results complement and rationalize a large body of previous work and provide detailed insights into the mechanism of the CBM-cellulose fiber interactions.

  12. Crystal structure and absolute configuration of (3aS,4S,5R,7aR-2,2,7-trimethyl-3a,4,5,7a-tetrahydro-1,3-benzodioxole-4,5-diol

    Directory of Open Access Journals (Sweden)

    Mario A. Macías

    2015-09-01

    Full Text Available The absolute configuration of the title compound, C10H16O4, determined as 3aS,4S,5R,7aR on the basis of the synthetic pathway, was confirmed by X-ray diffraction. The molecule contains a five- and a six-membered ring that adopt twisted and envelope conformations, respectively. The dihedral angle between the mean planes of the rings is 76.80 (11° as a result of their cis-fusion. In the crystal, molecules are linked by two pairs of O—H...O hydrogen bonds, forming chains along [010]. These chains are further connected by weaker C—H...O interactions along [100], creating (001 sheets that interact only by weak van der Waals forces.

  13. Structural organization of the human type VII collagen gene (COL7A1), composed of more exons than any previously characterized gene

    Energy Technology Data Exchange (ETDEWEB)

    Christiano, A.M.; Chung-Honet, L.C.; Greenspan, D.S.; Hoffman, G.G.; Lee, S.; Cheng, W. (Univ. of Wisconsin, Madison, WI (United States)); Uitto, J. (Thomas Jefferson Univ., Philadelphia, PA (United States))

    1994-05-01

    The human type VII collagen (COL7A1) gene is the locus for mutations in at least some cases of dystrophic epidermolysis bullosa. Here the authors describe the entire intron/exon organization of COL7A1, which is shown to have 118 exons, more than any previously described gene. Despite this complexity, COL7A1 is compact. Consisting of 31,132 bp from transcription start site to polyadenylation site, it is only about three times the size of type VII collagen mRNA. Thus, COL7A1 introns are small. A 71-nucleotide COL7A1 intron is the smallest intron yet reported in a collagen gene, and only one COL7A1 intron is greater than 1 kb in length. All exons in the COL7A1 triple helix coding region that do not begin with sequences corresponding to imperfections of the triple helix begin with intact codons for Gly residues of Gly-X-Y repeats. This is reminiscent of the structure of fibrillar rather than other nonfibrillar collagen genes. In addition, the COL7A1 triple helix coding region contains many exons of recurring sizes (e.g., 25 exons are 36 bp, 12 exons are 45 bp, 8 exons are 63 bp), suggesting an evolutionary origin distinct from those of other nonfibrillar collagen genes. Sequences from the 5[prime] portion of COL7A1 are presented along with the 3766-bp intergenic sequence, which separated COL7A1 from the upstream gene encoding the core I protein of the cytochrome bc[sub 1] complex. The COL7A1 promoter region is found to lack extensive homologies with promoter regions of other genes expressed primarily in skin. 60 refs., 5 figs., 1 tab.

  14. The lumenal loop M672-P707 of the Menkes protein (ATP7A) transfers copper to peptidylglycine monooxygenase

    Energy Technology Data Exchange (ETDEWEB)

    Otoikhian, Adenike [Oregon Health & Sciences University; Barry, Amanda N. [Los Alamos National Laboratory; Mayfield, Mary [Oregon Health & Science University; Nilges, Mark [Illinois EPR Center; Huang, Yiping [Johns Hopkins University; Lutsenko, Svetlana [Johns Hopkins University; Blackburn, Ninian [Oregon Health & Science University

    2012-05-14

    Copper transfer to cuproproteins located in vesicular compartments of the secretory pathway depends on activity of the copper translocating ATPase (ATP7A or ATP7B) but the mechanism of transfer is largely unexplored. Copper-ATPase ATP7A is unique in having a sequence rich in histidine and methionine residues located on the lumenal side of the membrane. The corresponding fragment binds Cu(I) when expressed as a chimera with a scaffold protein, and mutations or deletions of His and/or Met residues in its sequence inhibit dephosphorylation of the ATPase, a catalytic step associated with copper release. Here we present evidence for a potential role of this lumenal region of ATP7A in copper transfer to cuproenzymes. Both Cu(II) and Cu(I) forms were investigated since the form in which copper is transferred to acceptor proteins is currently unknown. Analysis of Cu(II) using EPR demonstrated that at Cu:P ratios below 1:1, 15N-substituted protein had Cu(II) bound by 4 His residues, but this coordination changed as the Cu(II) to protein ratio increased towards 2:1. XAS confirmed this coordination via analysis of the intensity of outer-shell scattering from imidazole residues. The Cu(II) complexes could be reduced to their Cu(I) counterparts by ascorbate, but here again, as shown by EXAFS and XANES spectroscopy, the coordination was dependent on copper loading. At low copper Cu(I) was bound by a mixed ligand set of His + Met while at higher ratios His coordination predominated. The copper-loaded loop was able to transfer either Cu(II) or Cu(I) to peptidylglycine monooxygenase in the presence of chelating resin, generating catalytically active enzyme in a process that appeared to involve direct interaction between the two partners. The variation of coordination with copper loading suggests copper-dependent conformational change which in turn could act as a signal for regulating copper release by the ATPase pump.

  15. Clinical diagnosis, treatment, and ALDH7A1 mutations in pyridoxine-dependent epilepsy in three Chinese infants.

    Directory of Open Access Journals (Sweden)

    Zhixian Yang

    Full Text Available Pyridoxine-dependent epilepsy (PDE is a rare autosomal recessive disorder that causes seizures in neonates and infants. Mutations of the ALDH7A1 gene are now recognized as the molecular basis PDE and help to define this disease. Three Chinese children with PDE were clinically analyzed, followed by treatment and examination of the ALDH7A1 mutations. The seizures of the 3 patients were all resistant to multiple anticonvulsants (2 to 7 types. For case 1, onset of seizures was at the age of 2 months. His seizures were well controlled by intravenous pyridoxine for several days at the age of 3 months 20 days and recurred at intervals of 13, 14 and 38 days after pyridoxine withdrawn for 3 times. At the age of 7 months, symptoms of PDE appeared and uninterrupted oral pyridoxine started. For case 2, her seizures occurred at 8 days after birth. After administration of multiple antiepileptic drugs observed ineffective, high-dose pyridoxine continuous therapy was taken at the age of 10 months and the significant treatment effect induced a diagnostic PDE. Seizure onset in case 3 was at the first day of birth. He experienced inadvertently pyridoxine therapy several times (first time at 2 days after birth and achieved good therapeutic effect, which was confirmed by physicians until 4 months 10 days. The treatment process in our 3 patients suggested that pyridoxine should be early and purposefully used in patients with early onset seizures. ALDH7A1 gene mutation analysis revealed compound heterozygous mutations in each case: heterozygous c.410G>A (p.G137E and IVS11+1G>A in case 1, heterozygous c.952G>C (p.A318P and heterozygous c.965C>T (p.A322V in case 2, and heterozygous c.902A>T (p.N301I and IVS11+1G>A in case 3. Only p.N301I was reported previously, all other mutations were novel. This is the first time to report cases of Chinese patients diagnosed with PDE by molecular genetic analysis.

  16. Liver Receptor Homolog-1 Is Critical for Adequate Up-regulation of Cyp7a1 Gene Transcription and Bile Salt Synthesis During Bile Salt Sequestration

    NARCIS (Netherlands)

    Out, Carolien; Hageman, Jurre; Bloks, Vincent W.; Gerrits, Han; Gelpke, Maarten D. Sollewijn; Bos, Trijnie; Havinga, Rick; Smit, Martin J.; Kuipers, Folkert; Groen, Albert K.

    Liver receptor homolog-1 (LRH-1) is a nuclear receptor that controls a variety of metabolic pathways. In cultured cells, LRH-1 induces the expression of CYP7A1 and CYP8B1, key enzymes in bile salt synthesis. However, hepatic Cyp7a1 mRNA levels were not reduced upon hepatocyte-specific Lrh-1 deletion

  17. Revertant Mosaicism Due to a Second-Site Mutation in COL7A1 in a Patient with Recessive Dystrophic Epidermolysis Bullosa

    NARCIS (Netherlands)

    Pasmooij, Anna M. G.; Garcia, Marta; Escamez, Maria J.; Nijenhuis, A. Miranda; Azon, Antoni; Cuadrado-Corrales, Natividad; Jonkman, Marcel F.; Del Rio, Marcela

    2010-01-01

    Despite the high incidence of revertant mosaicism (35%) in patients with the genetic skin disease epidermolysis bullosa (EB) due to correcting mutations in the genes COL17A1 and LAMB3, revertant mosaicism has not been described for COL7A1 until recently. Mutations in COL7A1 are responsible for the

  18. Test Plan for Lockheed Idaho Technologies Company (LITCO), ARROW-PAK Packaging, Docket 95-40-7A, Type A Container

    Energy Technology Data Exchange (ETDEWEB)

    Kelly, D.L.

    1995-10-23

    This report documents the U.S. Department of Transportation Specification 7A Type A (DOT-7A) compliance testing to be followed for qualification of the Lockheed Idaho Technologies Company, ARROW-PAK, for use as a Type A Packaging. The packaging configuration being tested is intended for transportation of radioactive solids, Form No. 1, Form No. 2, and Form No. 3.

  19. Nucleation and Grain Refinement of 7A04 Aluminum Alloy Under a Low-Power Electromagnetic Pulse

    Science.gov (United States)

    Bai, Qingwei; Ma, Yonglin; Xing, Shuqing; Bao, Xinyu; Feng, Yanfei; Kang, Xiaolan

    2018-01-01

    The effects of a low-power electromagnetic pulse on the grain size and cooling curve of high-strength aluminum alloy 7A04 were investigated for various pulse duty cycles. This electromagnetic pulse treatment was found to effectively produce fine grains with globular crystals and a uniform microstructure for pulse duty cycles between 20 and 40%. The key factors that affected grain refinement under the electromagnetic pulse included the electromagnetic energy and the conversion frequency between \\varvec{B} and \\varvec{E} . The nucleation rate increased as the nucleation period was extended. A new kinetic condition of magnetic nucleation was explored by decreasing the critical Gibbs free energy in the electromagnetic pulse, which was more sensitive under low undercooling. In addition, the crystal orientation was controlled in such a solidification environment.

  20. Identification of two novel pathogenic compound heterozygous MYO7A mutations in Usher syndrome by whole exome sequencing.

    Science.gov (United States)

    Jia, Ying; Li, Xiaoge; Yang, Dong; Xu, Yi; Guo, Ying; Li, Xin

    2018-01-01

    The current study aims to identify the pathogenic sites in a core pedigree of Usher syndrome (USH). A core pedigree of USH was analyzed by whole exome sequencing (WES). Mutations were verified by polymerase chain reaction (PCR) amplification and Sanger sequencing. Two pathogenic variations (c.849+2T>C and c.5994G>A) in MYO7A were successfully identified and individually separated from parents. One variant (c.849+2T>C) was nonsense mutation, causing the protein terminated in advance, and the other one (c.5994G>A) located near the boundary of exon could cause aberrant splicing. This study provides a meaningful exploration for identification of clinical core genetic pedigrees. Copyright © 2017 Elsevier B.V. All rights reserved.

  1. Role of the P-Type ATPases, ATP7A and ATP7B in brain copper homeostasis

    Directory of Open Access Journals (Sweden)

    Jonathon eTelianidis

    2013-08-01

    Full Text Available Over the past two decades there have been significant advances in our understanding of copper homeostasis and the pathological consequences of copper dysregulation. Cumulative evidence is revealing a complex regulatory network of proteins and pathways that maintain copper homeostasis. The recognition of copper dysregulation as a key pathological feature in prominent neurodegenerative disorders such as Alzheimer’s, Parkinson’s and prion diseases has led to increased research focus on the mechanisms controlling copper homeostasis in the brain. The copper-transporting P-Type ATPases (copper-ATPases, ATP7A and ATP7B, are critical components of the copper regulatory network. Our understanding of the biochemistry and cell biology of these complex proteins has grown significantly since their discovery in 1993. They are large polytopic transmembrane proteins with six copper-binding motifs within the cytoplasmic N-terminal domain, eight transmembrane domains and highly conserved catalytic domains. These proteins catalyze ATP-dependent copper transport across cell membranes for the metallation of many essential cuproenzymes, as well as for the removal of excess cellular copper to prevent copper toxicity. A key functional aspect of these copper transporters is their copper-responsive trafficking between the trans-Golgi network and the cell periphery. ATP7A- and ATP7B-deficiency, due to genetic mutation, underlie the inherited copper transport disorders, Menkes and Wilson diseases, respectively. Their importance in maintaining brain copper homeostasis is underscored by the severe neuropathological deficits in these disorders. Herein we will review and update our current knowledge of these copper transporters in the brain and the central nervous system, their distribution and regulation, their role in normal brain copper homeostasis and how their absence or dysfunction contributes to disturbances in copper homeostasis and neurodegeneration.

  2. VERIFICATION OF THE DEFENSE WASTE PROCESSING FACILITY'S (DWPF) PROCESS DIGESTION METHOD FOR THE SLUDGE BATCH 7A QUALIFICATION SAMPLE

    Energy Technology Data Exchange (ETDEWEB)

    Click, D.; Edwards, T.; Jones, M.; Wiedenman, B.

    2011-03-14

    For each sludge batch that is processed in the Defense Waste Processing Facility (DWPF), the Savannah River National Laboratory (SRNL) performs confirmation of the applicability of the digestion method to be used by the DWPF lab for elemental analysis of Sludge Receipt and Adjustment Tank (SRAT) receipt samples and SRAT product process control samples. DWPF SRAT samples are typically dissolved using a room temperature HF-HNO{sub 3} acid dissolution (i.e., DWPF Cold Chem Method, see DWPF Procedure SW4-15.201) and then analyzed by inductively coupled plasma - atomic emission spectroscopy (ICP-AES). This report contains the results and comparison of data generated from performing the Aqua Regia (AR), Sodium peroxide/Hydroxide Fusion (PF) and DWPF Cold Chem (CC) method digestions of Sludge Batch 7a (SB7a) SRAT Receipt and SB7a SRAT Product samples. The SB7a SRAT Receipt and SB7a SRAT Product samples were prepared in the SRNL Shielded Cells, and the SRAT Receipt material is representative of the sludge that constituates the SB7a Batch or qualification composition. This is the sludge in Tank 51 that is to be transferred into Tank 40, which will contain the heel of Sludge Batch 6 (SB6), to form the Sb7a Blend composition.

  3. Xylanase production by Streptomyces viridosporus T7A in submerged and solid-state fermentation using agro-industrial residues

    Directory of Open Access Journals (Sweden)

    Luiz Romulo Alberton

    2009-11-01

    Full Text Available The study of xylanase production was conducted by Streptomyces viridosporus T7A in submerged (SmF and solid-state fermentation (SSF, using agro-industrial residues and sub-products. Napier grass, sugarcane bagasse and soybean bran were used as carbon source, substrate/support, and nitrogen source, respectively. In SmF, Napier grass (1% v/w supplemented with soybean bran, hydroxyethylcellulose and B complex vitamins were used. Soybean bran (1.5 % w/v, B complex vitamins (0.1%, and hydroxyethilcellulose (0.15% led to an increase in xylanase production (23.41 U/mL. In SSF, the effects of the following parameters were studied: substrate composition (sugarcane bagasse, Napier grass and soybean bran, initial moisture, and inoculum rate. In SSF, the highest xylanase activity (423.9 U/g was reached with: 70 % sugarcane bagasse, 20% Napier grass and 10% soybean meal, 90% of moisture, and 10(7/g substrate.A produção de xilanase por Streptomyces viridosporus T7A foi realizada em fermentação submersa (FSm e fermentação no estado sólido (FES utilizando resíduos e sub-produtos agroindustriais. Capim Napier, bagaço de cana e farelo de soja foram empregados como fonte de carbono, suporte/substrato e fonte nitrogênio, respectivamente. Em FSm, o capim Napier (1 % p/v foi suplementado com farelo de soja (1,5 % p/v, hidroxietilcelulose (0,15 % e vitaminas do complexo B (1,5 % sendo que a produção de xilanase atingiu 23.41 U/mL. Em FES, o efeito dos seguintes parâmetros foi estudado: composição do substrato (bagaço de cana, Capim Napier e farelo de soja, umidade inicial, aeração e taxa de inoculação. A mais elevada produção de xilanase (423,9 U/g foi atingida com 70% bagaço de cana, 20% de capim Napier e 10 % farelo de soja, 90 % de umidade inicial e 10(7 células/g substrato.

  4. Diurnal variation in cholesterol 7?-hydroxylase activity is determined by the -203A>C polymorphism of the CYP7A1 gene

    OpenAIRE

    Vlachov?, Milu?e; Blahov?, Tereza; L?nsk?, V?ra; Len??ek, Martin; Pi?ha, Jan; V?tek, Libor; Kov??, Jan

    2016-01-01

    Aim To determine whether the promoter polymorphism -203A>C of cholesterol-7α-hydroxylase encoding gene (CYP7A1) affects diurnal variation in CYP7A1 enzyme activity. Methods The study included 16 healthy male volunteers – 8 homozygous for -203A and 8 homozygous for the -203C allele of CYP7A1. Three 15-hour examinations (from 7am to 10pm) were carried out for each of the participants: after one-day treatment with cholestyramine; after one-day treatment with chenodeoxycho...

  5. Interleukin-7, a new cytokine targeting the mouse hypothalamic arcuate nucleus: role in body weight and food intake regulation.

    Directory of Open Access Journals (Sweden)

    Laurence Macia

    Full Text Available Body weight is controlled through peripheral (white adipose tissue and central (mainly hypothalamus mechanisms. We have recently obtained evidence that overexpression of interleukin (IL-7, a critical cytokine involved in lymphopoiesis, can protect against the development of diet-induced obesity in mice. Here we assessed whether IL-7 mediated its effects by modulating hypothalamic function. Acute subcutaneous injection of IL-7 prevented monosodium glutamate-induced obesity, this being correlated with partial protection against cell death in the hypothalamic arcuate nucleus (ARC. Moreover, we showed that IL-7 activated hypothalamic areas involved in regulation of feeding behavior, as indicated by induction of the activation marker c-Fos in neural cells located in the ventromedial part of the ARC and by inhibition of food intake after fasting. Both chains of the IL-7 receptor (IL-7Ralpha and gamma(c were expressed in the ARC and IL-7 injection induced STAT-3 phosphorylation in this area. Finally, we established that IL-7 modulated the expression of neuropeptides that tune food intake, with a stimulatory effect on the expression of pro-opiomelanocortin and an inhibitory effect on agouti-related peptide expression in accordance with IL-7 promoting anorectic effects. These results suggest that the immunomodulatory cytokine IL-7 plays an important and unappreciated role in hypothalamic body weight regulation.

  6. Effect of Rotation Rate on Microstructure and Properties of Underwater Friction Stir Welded 7A04-T6 Aluminum Alloy

    Directory of Open Access Journals (Sweden)

    WANG Wen

    2017-10-01

    Full Text Available Underwater friction stir welding (FSW on 7A04-T6 aluminum alloy plates was carried out, and the effect of rotation rate on microstructure and mechanical properties of joints was investigated. The results show that the minimum hardness of underwater FSW joints is located in the thermo-mechanically affected zone. The hardness of welded joints at the high rotation rate of 950r/min exhibits W-shaped distribution, and the average hardness value in the nugget zone is higher than that of welded joints at the low rotation rate of 475, 600, 750r/min. When the rotation rate increases from 475r/min to 750r/min with a constant welding speed of 235mm/min, the precipitated phases in the nugget zone gradually become coarse, and the ultimate tensile strength coefficient of the joint decreases from 89.71% to 82.33%; when rotation rate increases to 950r/min, the precipitated phases dissolve into aluminum matrix during welding, and age after welding. This produces the fine and homogeneous dispersed phases, which results in an increase of the strength coefficient to 89.04% and a certain enhancement of strain hardening capacity and elongation for the joints. All the tensile fracture surfaces exhibit the mixed characteristics of microporous polymerization and cleavage fracture.

  7. Host Cell Copper Transporters CTR1 and ATP7A are important for Influenza A virus replication.

    Science.gov (United States)

    Rupp, Jonathan C; Locatelli, Manon; Grieser, Alexis; Ramos, Andrea; Campbell, Patricia J; Yi, Hong; Steel, John; Burkhead, Jason L; Bortz, Eric

    2017-01-23

    The essential role of copper in eukaryotic cellular physiology is known, but has not been recognized as important in the context of influenza A virus infection. In this study, we investigated the effect of cellular copper on influenza A virus replication. Influenza A/WSN/33 (H1N1) virus growth and macromolecule syntheses were assessed in cultured human lung cells (A549) where the copper concentration of the growth medium was modified, or expression of host genes involved in copper homeostasis was targeted by RNA interference. Exogenously increasing copper concentration, or chelating copper, resulted in moderate defects in viral growth. Nucleoprotein (NP) localization, neuraminidase activity assays and transmission electron microscopy did not reveal significant defects in virion assembly, morphology or release under these conditions. However, RNAi knockdown of the high-affinity copper importer CTR1 resulted in significant viral growth defects (7.3-fold reduced titer at 24 hours post-infection, p = 0.04). Knockdown of CTR1 or the trans-Golgi copper transporter ATP7A significantly reduced polymerase activity in a minigenome assay. Both copper transporters were required for authentic viral RNA synthesis and NP and matrix (M1) protein accumulation in the infected cell. These results demonstrate that intracellular copper regulates the influenza virus life cycle, with potentially distinct mechanisms in specific cellular compartments. These observations provide a new avenue for drug development and studies of influenza virus pathogenesis.

  8. Role of EhRab7A in phagocytosis of type 1 fimbriated E. coli by Entamoeba histolytica.

    Science.gov (United States)

    Verma, Kuldeep; Nozaki, Tomoyoshi; Datta, Sunando

    2016-12-01

    Entamoeba histolytica, the causative agent of amoebic colitis and liver abscess in human, ingests the intestinal bacteria and variety of host cells. Phagocytosis of bacteria by the amebic trophozoite has been reported to be important for the virulence of the parasite. Here, we set out to characterize different stages of phagocytosis of type 1 E. coli and investigated the role of a set of amoebic Rab GTPases in the process. The localizations of the Rab GTPases during different stages of the phagocytosis were investigated using laser scanning confocal microscopy and their functional relevance were determined using fluorescence activated cell sorter based assay as well as colony forming unit assay. Our results demonstrate that EhRab7A is localized on the phagosomes and involved in both early and late stages of type 1 E. coli phagocytosis. We further showed that the E. coli or RBC containing phagosomes are distinct from the large endocytic vacuoles in the parasite which are exclusively used to transport human holotransferrin and low density lipoprotein. Remarkably, type 1 E. coli uptake was found to be insensitive to cytochalasin D treatment, suggesting that the initial stage of E. coli phagocytosis is independent of the formation of actin filaments. © 2016 John Wiley & Sons Ltd.

  9. Calcium carbonate mediates higher lignin peroxidase activity in the culture supernatant of Streptomyces Viridosporus T7A

    Directory of Open Access Journals (Sweden)

    J. M. B. MACEDO

    1999-06-01

    Full Text Available Lignin peroxidase (LiP production has been extensively studied due to the potential use of this enzyme in environmental pollution control. Important aspects of the production of the enzyme by S. viridosporus T7A which have been studied include the improvement of yield and enzyme stabilization. In experiments performed in agitated flasks containing culture media composed of yeast extract as the source of nitrogen, mineral salts and different carbon sources, the use of glucose resulted in the highest values for LiP activity (350 U/L, specific LiP activity (450 U/g and productivity (7 U/L/h. As the profile obtained with glucose-containing medium suggested enzyme instability, the effect of calcium carbonate was evaluated. The addition of CaCO3 in two different concentrations, 0.5% and 5.0%, resulted in higher values of maximum LiP activity, 600 and 900 U/L, respectively. The presence of this salt also anticipated enzyme activity peaks and allowed the detection of higher enzyme activities in the extracellular medium for longer periods of time. These results indicate a positive effect of calcium carbonate on LiP production, which is extremely relevant for industrial processes.

  10. AbSte7, a MAPKK Gene of Alternaria brassicicola, is Involved in Conidiation, Salt/Oxidative Stress, and Pathogenicity.

    Science.gov (United States)

    Xu, Houjuan; Zhang, Qianqian; Cui, Wenjuan; Zhang, Xiaofei; Liu, Weiyang; Zhang, Li; Islam, Md Nurul; Baek, Kwang-Hyun; Wang, Yujun

    2016-07-28

    Alternaria brassicicola (Schwein.) invades Brassicaceae and causes black spot disease, significantly lowering productivity. Mitogen-activated protein kinases (MAPKs) and their upstream kinases, including MAPK kinases (MAPKKs) and MAPKK kinases (MAPKKK), comprise one of the most important signaling pathways determining the pathogenicity of diverse plant pathogens. The AbSte7 gene in the genome of A. brassicicola was predicted to be a homolog of yeast Ste7, a MAPKK; therefore, the function was characterized by generating null mutant strains with a gene replacement method. AbSte7 replacement mutants (RMs) had a slower growth rate and altered colony morphology compared with the wild-type strain. Disruption of the AbSte7 gene resulted in defects in conidiation and melanin accumulation. AbSte7 was also involved in the resistance pathways in salt and oxidative stress, working to negatively regulate salt tolerance and positively regulate oxidative stress. Pathogenicity assays revealed that AbSte7 RMs could not infect intact cabbage leaves, but only formed very small lesions in wounded leaves, whereas typical lesions appeared on both intact and wounded leaves inoculated with the wild-type strain. As the first studied MAPKK in A. brassicicola, these data strongly suggest that the AbSte7 gene is an essential element for the growth, development, and pathogenicity of A. brassicicola.

  11. Interleukin-7, a new cytokine targeting the mouse hypothalamic arcuate nucleus: role in body weight and food intake regulation.

    Science.gov (United States)

    Macia, Laurence; Viltart, Odile; Delacre, Myriam; Sachot, Christelle; Héliot, Laurent; Di Santo, James P; Wolowczuk, Isabelle

    2010-04-01

    Body weight is controlled through peripheral (white adipose tissue) and central (mainly hypothalamus) mechanisms. We have recently obtained evidence that overexpression of interleukin (IL)-7, a critical cytokine involved in lymphopoiesis, can protect against the development of diet-induced obesity in mice. Here we assessed whether IL-7 mediated its effects by modulating hypothalamic function. Acute subcutaneous injection of IL-7 prevented monosodium glutamate-induced obesity, this being correlated with partial protection against cell death in the hypothalamic arcuate nucleus (ARC). Moreover, we showed that IL-7 activated hypothalamic areas involved in regulation of feeding behavior, as indicated by induction of the activation marker c-Fos in neural cells located in the ventromedial part of the ARC and by inhibition of food intake after fasting. Both chains of the IL-7 receptor (IL-7Ralpha and gamma(c)) were expressed in the ARC and IL-7 injection induced STAT-3 phosphorylation in this area. Finally, we established that IL-7 modulated the expression of neuropeptides that tune food intake, with a stimulatory effect on the expression of pro-opiomelanocortin and an inhibitory effect on agouti-related peptide expression in accordance with IL-7 promoting anorectic effects. These results suggest that the immunomodulatory cytokine IL-7 plays an important and unappreciated role in hypothalamic body weight regulation.

  12. Epidermolysis Bullosa Acquisita in an Adult Patient with Previously Unrecognized Mild Dystrophic EB and Biallelic COL7A1 Mutations.

    Science.gov (United States)

    Guerra, Liliana; Condorelli, Angelo Giuseppe; Fortugno, Paola; Calabresi, Valentina; Pedicelli, Cristina; Di Zenzo, Giovanni; Castiglia, Daniele

    2017-11-28

    Circulating anti-type VII collagen autoantibodies are frequently detected in patients with recessive dystrophic epidermolysis bullosa (RDEB). However, evidence supporting their pathogenic role in inducing epidermolysis bullosa acquisita (EBA) has been provided for only 1 individual with dominant dystrophic epidermolysis bullosa (DDEB). We describe here a patient who presented with dystrophic toenails since early childhood and developed trauma-induced skin blisters and oral erosions at age 26 years. Direct immunofluorescence showed IgG deposits with a u-serrated pattern along the cutaneous basement membrane zone, while no change in the expression of collagen VII could be detected by antigen mapping. High-titre anti-collagen VII antibodies were detected by enzyme-linked immunoassay (ELISA). In parallel, sequencing of epidermolysis bullosa (EB) genes identified compound heterozygous COL7A1 missense c.410G>A (p.Arg137Gln) and splicing c.3674C>T (p.Ala1225_Gln1241del) mutations, previously unrecognized in dystrophic epidermolysis bullosa (DEB). Thus, our patient had RDEB "nails-only" and developed mechanobullous EBA in adulthood. These data support a pathogenic role of circulating autoantibodies to collagen VII in inducing EBA in selected patients with DEB. Unforeseen worsening of skin symptoms in DEB should prompt laboratory investigations for EBA.

  13. ACE I/D and MMP-7 A-181G variants and the risk of end stage renal disease.

    Science.gov (United States)

    Rahimi, Zohreh; Abdi, Hamed; Tanhapoor, Maryam; Rahimi, Ziba; Vaisi-Raygani, Asad; Nomani, Hamid

    2017-03-01

    The variants of angiotensin converting enzyme (ACE) and matrix metalloproteinases (MMPs) genes might be involved in the pathogenesis of end stage renal disease (ESRD) and hypertension. We studied the ACE insertion/deletion (I/D) and MMP-7 A-181G variants in 99 unrelated ESRD patients and 117 individuals without renal complications from Western Iran with Kurdish ethnic background. The frequency of ACE I/D variants was not significantly different between ESRD patients and controls. However, the presence of ACE D allele increased the risk of hypertension in ESRD patients by 2.14-fold (P=0.036). The MMP-7 -181 AG genotype increased the risk of ESRD by 2.04 times (P=0.026). The present study indicated the absence of an association between the ACE I/D polymorphism with the risk of ESRD. However, the ACE D allele increased the risk of hypertension in ESRD patients. Also, the present study suggests a role for MMP-7 AG genotype in the pathogenesis of ESRD.

  14. STAT5 phosphorylation in T cell subsets from septic patients in response to recombinant human interleukin-7: a pilot study.

    Science.gov (United States)

    Demaret, Julie; Dupont, Guillaume; Venet, Fabienne; Friggeri, Arnaud; Lepape, Alain; Rimmelé, Thomas; Morel, Jérôme; Monneret, Guillaume

    2015-04-01

    Septic shock is characterized by lymphocyte alterations associated with increased risk of nosocomial infections and mortality. IL-7, a cytokine required for T cell survival, is thought as a novel therapy for septic patients with severe lymphopenia. We assessed CD4(+) lymphocyte responsiveness to rhIL-7 in septic shock patients ex vivo. Thirteen septic shock patients and 10 controls were included. The MFI of pSTAT5, a key signaling molecule for IL-7, was measured by flow cytometry in CD4(+)FOXP3- (Teffs) and CD4(+)FOXP3(+) (Tregs) lymphocytes after whole-blood incubation with increasing doses of rhIL-7. The basal level of pSTAT5 in nonstimulated T cells was higher in patients. However, the maximal activation level in response to the highest doses of rhIL-7 was similar in both groups. Importantly, low doses of rhIL-7 preferentially activated Teff versus Treg in patients and nonsurvivors tended to present with decreased pSTAT5 expression. This pilot study is the first to highlight, in septic patients, the interest of pSTAT5 measurement in whole blood for the monitoring of rhIL-7 therapy. Such a method could represent an innovative, biologic tool for monitoring leukocyte pharmacological responses to biotherapies in daily clinical practice in other clinical contexts. © Society for Leukocyte Biology.

  15. A founder synonymous COL7A1 mutation in three Danish families with dominant dystrophic epidermolysis bullosa pruriginosa identifies exonic regulatory sequences required for exon 87 splicing

    DEFF Research Database (Denmark)

    Covaciu, C; Grosso, F; Pisaneschi, E

    2011-01-01

    shoulders. DEB-Pr is caused by either dominant (DDEB-Pr) or recessive mutations in the COL7A1 gene encoding type VII collagen (COLVII). The full spectrum of COL7A1 mutations in DEB-Pr remains elusive and the genotype-phenotype correlation is largely incomplete. Here, we report and functionally characterize...... a previously unrecognized translationally silent exonic COL7A1 mutation that results in skipping of exon 87 and is associated with DDEB-Pr phenotypes in several members of three apparently unrelated Danish families. A haplotype segregation study suggested a common ancestor in these kindred. Functional splicing...... analysis of the mutant exon by a COL7A1 minigene construct and computational prediction for splicing regulatory cis-sequences prove that the mutation alters the activity of an exonic splicing enhancer (ESE) critical for exon inclusion. These findings substantiate for the first time the involvement...

  16. Locked Nucleic Acid-Based In Situ Hybridization Reveals miR-7a as a Hypothalamus-Enriched MicroRNA with a Distinct Expression Pattern

    DEFF Research Database (Denmark)

    Herzer, S; Silahtaroglu, A; Meister, B

    2012-01-01

    MicroRNAs (miRNAs) are short (22 nucleotides) non-coding ribonucleic acid (RNA) molecules that post-transcriptionally repress expression of protein-coding genes by binding to 3'-untranslated regions of the target mRNAs. In order to identify miRNAs selectively expressed within the hypothalamus...... present in the hypothalamus, miR-7a, was the only miRNA found to be enriched in the hypothalamus, with low or no expression in other parts of the central nervous system (CNS). Within the hypothalamus, strong miR-7a expression was distinct and restricted to some hypothalamic nuclei and adjacent areas. mi......R-7a expression was particularly prominent in the subfornical organ, suprachiasmatic, paraventricular, periventricular, supraoptic, dorsomedial and arcuate nuclei. Identical expression patterns for miR-7a was seen in mouse and rat hypothalamus. By combining LNA-FISH with immunohistochemistry...

  17. Single-molecule Imaging Analysis of Elementary Reaction Steps of Trichoderma reesei Cellobiohydrolase I (Cel7A) Hydrolyzing Crystalline Cellulose Iα and IIII*

    Science.gov (United States)

    Shibafuji, Yusuke; Nakamura, Akihiko; Uchihashi, Takayuki; Sugimoto, Naohisa; Fukuda, Shingo; Watanabe, Hiroki; Samejima, Masahiro; Ando, Toshio; Noji, Hiroyuki; Koivula, Anu; Igarashi, Kiyohiko; Iino, Ryota

    2014-01-01

    Trichoderma reesei cellobiohydrolase I (TrCel7A) is a molecular motor that directly hydrolyzes crystalline celluloses into water-soluble cellobioses. It has recently drawn attention as a tool that could be used to convert cellulosic materials into biofuel. However, detailed mechanisms of action, including elementary reaction steps such as binding, processive hydrolysis, and dissociation, have not been thoroughly explored because of the inherent challenges associated with monitoring reactions occurring at the solid/liquid interface. The crystalline cellulose Iα and IIII were previously reported as substrates with different crystalline forms and different susceptibilities to hydrolysis by TrCel7A. In this study, we observed that different susceptibilities of cellulose Iα and IIII are highly dependent on enzyme concentration, and at nanomolar enzyme concentration, TrCel7A shows similar rates of hydrolysis against cellulose Iα and IIII. Using single-molecule fluorescence microscopy and high speed atomic force microscopy, we also determined kinetic constants of the elementary reaction steps for TrCel7A against cellulose Iα and IIII. These measurements were performed at picomolar enzyme concentration in which density of TrCel7A on crystalline cellulose was very low. Under this condition, TrCel7A displayed similar binding and dissociation rate constants for cellulose Iα and IIII and similar fractions of productive binding on cellulose Iα and IIII. Furthermore, once productively bound, TrCel7A processively hydrolyzes and moves along cellulose Iα and IIII with similar translational rates. With structural models of cellulose Iα and IIII, we propose that different susceptibilities at high TrCel7A concentration arise from surface properties of substrate, including ratio of hydrophobic surface and number of available lanes. PMID:24692563

  18. Occipital horn syndrome and classical Menkes syndrome caused by deep intronic mutations, leading to the activation of ATP7A pseudo-exon

    DEFF Research Database (Denmark)

    Yasmeen, Saiqa; Lund, Katrine; De Paepe, Anne

    2014-01-01

    in the ATP7A gene can be identified in 95-98% of the Menkes disease patients by standard screening techniques. Investigation of RNA isolated from the fibroblasts of eleven patients with no identified mutations was performed, and revealed inclusion of new pseudo-exons into the ATP7A mRNA from three unrelated...... mechanism, which has hitherto been overlooked.European Journal of Human Genetics advance online publication, 4 September 2013; doi:10.1038/ejhg.2013.191....

  19. ATP7A Gene Addition to the Choroid Plexus Results in Long-term Rescue of the Lethal Copper Transport Defect in a Menkes Disease Mouse Model

    Science.gov (United States)

    Donsante, Anthony; Yi, Ling; Zerfas, Patricia M; Brinster, Lauren R; Sullivan, Patricia; Goldstein, David S; Prohaska, Joseph; Centeno, Jose A; Rushing, Elisabeth; Kaler, Stephen G

    2011-01-01

    Menkes disease is a lethal infantile neurodegenerative disorder of copper metabolism caused by mutations in a P-type ATPase, ATP7A. Currently available treatment (daily subcutaneous copper injections) is not entirely effective in the majority of affected individuals. The mottled-brindled (mo-br) mouse recapitulates the Menkes phenotype, including abnormal copper transport to the brain owing to mutation in the murine homolog, Atp7a, and dies by 14 days of age. We documented that mo-br mice on C57BL/6 background were not rescued by peripheral copper administration, and used this model to evaluate brain-directed therapies. Neonatal mo-br mice received lateral ventricle injections of either adeno-associated virus serotype 5 (AAV5) harboring a reduced-size human ATP7A (rsATP7A) complementary DNA (cDNA), copper chloride, or both. AAV5-rsATP7A showed selective transduction of choroid plexus epithelia and AAV5-rsATP7A plus copper combination treatment rescued mo-br mice; 86% survived to weaning (21 days), median survival increased to 43 days, 37% lived beyond 100 days, and 22% survived to the study end point (300 days). This synergistic treatment effect correlated with increased brain copper levels, enhanced activity of dopamine-β-hydroxylase, a copper-dependent enzyme, and correction of brain pathology. Our findings provide the first definitive evidence that gene therapy may have clinical utility in the treatment of Menkes disease. PMID:21878905

  20. Effect of pH and temperature on the global compactness, structure, and activity of cellobiohydrolase Cel7A from Trichoderma harzianum.

    Science.gov (United States)

    Colussi, Francieli; Garcia, Wanius; Rosseto, Flávio Rodolfo; de Mello, Bruno Luan Soares; de Oliveira Neto, Mário; Polikarpov, Igor

    2012-01-01

    Due to its elevated cellulolytic activity, the filamentous fungus Trichoderma harzianum (T. harzianum) has considerable potential in biomass hydrolysis application. Cellulases from Trichoderma reesei have been widely used in studies of cellulose breakdown. However, cellulases from T. harzianum are less-studied enzymes that have not been characterized biophysically and biochemically as yet. Here, we examined the effects of pH and temperature on the secondary and tertiary structures, compactness, and enzymatic activity of cellobiohydrolase Cel7A from T. harzianum (Th Cel7A) using a number of biophysical and biochemical techniques. Our results show that pH and temperature perturbations affect Th Cel7A stability by two different mechanisms. Variations in pH modify protonation of the enzyme residues, directly affecting its activity, while leading to structural destabilization only at extreme pH limits. Temperature, on the other hand, has direct influence on mobility, fold, and compactness of the enzyme, causing unfolding of Th Cel7A just above the optimum temperature limit. Finally, we demonstrated that incubation with cellobiose, the product of the reaction and a competitive inhibitor, significantly increased the thermal stability of Th Cel7A. Our studies might provide insights into understanding, at a molecular level, the interplay between structure and activity of Th Cel7A at different pH and temperature conditions.

  1. Structure of acostatin, a dimeric disintegrin from Southern copperhead (Agkistrodon contortrix contortrix), at 1.7 A resolution.

    Science.gov (United States)

    Moiseeva, Natalia; Bau, Robert; Swenson, Stephen D; Markland, Francis S; Choe, Jun Yong; Liu, Zhi Jie; Allaire, Marc

    2008-04-01

    Disintegrins are a family of small (4-14 kDa) proteins that bind to another class of proteins, integrins. Therefore, as integrin inhibitors, they can be exploited as anticancer and antiplatelet agents. Acostatin, an alphabeta heterodimeric disintegrin, has been isolated from the venom of Southern copperhead (Agkistrodon contortrix contortrix). The three-dimensional structure of acostatin has been determined by macromolecular crystallography using the molecular-replacement method. The asymmetric unit of the acostatin crystals consists of two heterodimers. The structure has been refined to an R(work) and R(free) of 18.6% and 21.5%, respectively, using all data in the 20-1.7 A resolution range. The structure of all subunits is similar and is well ordered into N-terminal and C-terminal clusters with four intramolecular disulfide bonds. The overall fold consists of short beta-sheets, each of which is formed by a pair of antiparallel beta-strands connected by beta-turns and flexible loops of different lengths. Conformational flexibility is found in the RGD loops and in the C-terminal segment. The interaction of two N-terminal clusters via two intermolecular disulfide bridges anchors the alphabeta chains of the acostatin dimers. The C-terminal clusters of the heterodimer project in opposite directions and form a larger angle between them in comparison with other dimeric disintegrins. Extensive interactions are observed between two heterodimers, revealing an alphabetabetaalpha acostatin tetramer. Further experiments are required to identify whether the alphabetabetaalpha acostatin complex plays a functional role in vivo.

  2. SNOMED2HL7: A tool to normalize and bind SNOMED CT concepts to the HL7 Reference Information Model.

    Science.gov (United States)

    Perez-Rey, D; Alonso-Calvo, R; Paraiso-Medina, S; Munteanu, C R; Garcia-Remesal, M

    2017-10-01

    Current clinical research and practice requires interoperability among systems in a complex and highly dynamic domain. There has been a significant effort in recent years to develop integrative common data models and domain terminologies. Such efforts have not completely solved the challenges associated with clinical data that are distributed among different and heterogeneous institutions with different systems to encode the information. Currently, when providing homogeneous interfaces to exploit clinical data, certain transformations still involve manual and time-consuming processes that could be automated. There is a lack of tools to support data experts adopting clinical standards. This absence is especially significant when links between data model and vocabulary are required. The objective of this work is to present SNOMED2HL7, a novel tool to automatically link biomedical concepts from widely used terminologies, and the corresponding clinical context, to the HL7 Reference Information Model (RIM). Based on the recommendations of the International Health Terminology Standards Development Organisation (IHTSDO), the SNOMED Normal Form has been implemented within SNOMED2HL7 to decompose and provide a method to reduce the number of options to store the same information. The binding of clinical terminologies to HL7 RIM components is the core of SNOMED2HL7, where terminology concepts have been annotated with the corresponding options within the interoperability standard. A web-based tool has been developed to automatically provide information from the normalization mechanisms and the terminology binding. SNOMED2HL7 binding coverage includes the majority of the concepts used to annotate legacy systems. It follows HL7 recommendations to solve binding overlaps and provides the binding of the normalized version of the concepts. The first version of the tool, available at http://kandel.dia.fi.upm.es:8078, has been validated in EU funded projects to integrate real world

  3. The preparation and physico-chemical characterization of aluminum hydroxide/TLR7a, a novel vaccine adjuvant comprising a small molecule adsorbed to aluminum hydroxide.

    Science.gov (United States)

    Malyala, Padma; Laera, Donatello; Cianetti, Simona; Bufali, Simone; Aggravi, Marianna; Ianni, Elvira; Judge, Casey; Otten, Gillis; Singh, Manmohan; O' Hagan, Derek T

    2018-02-05

    Adjuvants are necessary to enable vaccine development against a significant number of challenging pathogens for which effective vaccines are not available [1]. We engineered a novel small-molecule immune potentiator (SMIP), a benzonaphthyridine agonist targeting toll-like receptor 7 (TLR7), as a vaccine adjuvant. TLR7 agonist (TLR7a) was engineered to be adsorbed onto aluminum hydroxide (AlOH), and the resulting AlOH/TLR7a was evaluated as a vaccine adjuvant [2-6]. AlOH/TLR7a exploits the flexibility of AlOH formulations, has an application in many vaccine candidates, and induced good efficacy and safety profiles against all tested antigens (bacterial- and viral-derived protein antigens, toxoids, glycoconjugates, etc.) in many animal models, including non-human primates [7]. In this paper, we describe the outcome of the physico-chemical characterization of AlOH/TLR7a. Reverse phase ultra-performance liquid chromatography (RP-UPLC), confocal microscopy, flow cytometry (FC), zeta potential (ZP) and phosphophilicity assays were used as tools to demonstrate the association of TLR7a to AlOH and to characterize this novel formulation. Raman spectroscopy, nuclear magnetic resonance and mass spectroscopy were also used to investigate the interaction between TLR7a and AlOH (data not shown). This pivotal work paved the way for AlOH/TLR7a to progress into the clinic for evaluation as an adjuvant platform for vaccines against challenging preventable diseases. Copyright © 2018. Published by Elsevier Inc.

  4. Let-7a Inhibits T-Cell Proliferation and IFN-γ Secretion by Down-Regulating STAT3 Expression in Patients with Psoriasis.

    Science.gov (United States)

    Hu, Xiao-Ping; Xie, Qian; Chen, Chao-Feng; Zhang, Wei; Yu, Bo

    2017-01-01

    This study aimed to explore the effects of STAT3 targeting by let-7a on T-cell proliferation and IFN-γ secretion in psoriasis. From January 2013 to January 2015, 40 patients with psoriasis (psoriasis group) and 38 volunteers undergoing plastic surgery (control group) were enrolled in this study. Pearson correlation analysis was performed to evaluate the correlation between let-7a and STAT3 expression. T-cells were isolated and subjected to different transfection methods. A dual luciferase reporter assay was carried out to confirm STAT3 as a target gene of let-7a. Let-7a, STAT3 and IFN-γ mRNA expression was detected by quantitative real-time fluorescent polymerase chain reaction (qRT-PCR), and pSTAT3 protein levels were determined by Western blot. T-cell proliferation was evaluated with a cell counting kit-8 (CCK-8) assay. The level of STAT3 mRNA and pSTAT3 was higher, but let-7a expression was lower in the psoriasis group than the control group. Pearson correlation analysis indicated that STAT3 expression was negatively correlated with let-7a expression. T-cells transfected with inhibitors exhibited greater IFN-γ mRNA expression and T-cell proliferation than transfected T-cells and T-cells transfected with a non-sense sequence, while T-cells transfected with let-7a mimics exhibited lower IFN-γ mRNA expression and T-cell proliferation than transfected T-cells and T-cells transfected with a non-sense sequence. This suggested that siRNA-STAT3 could reverse the increase in IFN-y mRNA expression and T-cell proliferation induced by let-7a inhibitors. Our results demonstrated that let-7a inhibits T-cell proliferation and IFN-γ secretion by down-regulating STAT3 in psoriasis. © 2017 The Author(s). Published by S. Karger AG, Basel.

  5. Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Heli; Juo, Z. Sean; Shim, Ann Hye-Ryong; Focia, Pamela J.; Chen, Xiaoyan; Garcia, K. Christopher; He, Xiaolin (Stanford-MED); (NWU)

    2010-10-18

    Repulsive signaling by Semaphorins and Plexins is crucial for the development and homeostasis of the nervous, immune, and cardiovascular systems. Sema7A acts as both an immune and a neural Semaphorin through PlexinC1, and A39R is a Sema7A mimic secreted by smallpox virus. We report the structures of Sema7A and A39R complexed with the Semaphorin-binding module of PlexinC1. Both structures show two PlexinC1 molecules symmetrically bridged by Semaphorin dimers, in which the Semaphorin and PlexinC1 {beta} propellers interact in an edge-on, orthogonal orientation. Both binding interfaces are dominated by the insertion of the Semaphorin's 4c-4d loop into a deep groove in blade 3 of the PlexinC1 propeller. A39R appears to achieve Sema7A mimicry by preserving key Plexin-binding determinants seen in the mammalian Sema7A complex that have evolved to achieve higher affinity binding to the host-derived PlexinC1. The complex structures support a conserved Semaphorin-Plexin recognition mode and suggest that Plexins are activated by dimerization.

  6. miR-Let7A Controls the Cell Death and Tight Junction Density of Brain Endothelial Cells under High Glucose Condition.

    Science.gov (United States)

    Song, Juhyun; Yoon, So Ra; Kim, Oh Yoen

    2017-01-01

    Hyperglycemia-induced stress in the brain of patients with diabetes triggers the disruption of blood-brain barrier (BBB), leading to diverse neurological diseases including stroke and dementia. Recently, the role of microRNA becomes an interest in the research for deciphering the mechanism of brain endothelial cell damage under hyperglycemia. Therefore, we investigated whether mircoRNA Let7A (miR-Let7A) controls the damage of brain endothelial (bEnd.3) cells against high glucose condition. Cell viability, cell death marker expressions (p-53, Bax, and cleaved poly ADP-ribose polymerase), the loss of tight junction proteins (ZO-1 and claudin-5), proinflammatory response (interleukin-6, tumor necrosis factor-α), inducible nitric oxide synthase, and nitrite production were confirmed using MTT, reverse transcription-PCR, quantitative-PCR, Western blotting, immunofluorescence, and Griess reagent assay. miR-Let7A overexpression significantly prevented cell death and loss of tight junction proteins and attenuated proinflammatory response and nitrite production in the bEnd.3 cells under high glucose condition. Taken together, we suggest that miR-Let7A may attenuate brain endothelial cell damage by controlling cell death signaling, loss of tight junction proteins, and proinflammatory response against high glucose stress. In the future, the manipulation of miR-Let7A may be a novel solution in controlling BBB disruption which leads to the central nervous system diseases.

  7. [Effect of Heshouwuyin on the expression of Cox7a2 protein in testis tissue of exercised-induced fatigue rat].

    Science.gov (United States)

    Zhao, Xiu-Jun; Guo, Yin; Song, Qing-Liang; Li, Li; Jiang, Yan; Sun, Yi-Chong; Qu, Yin-E; Gao, Fu-Lu

    2013-03-01

    To explore the effect of Heshouwuyin on the expression of cytochrome C oxidase7a2 (Cox7a2) in testis tissue of rats with exercised-induced fatigue. Fifty SD rats were divided into normal control group (A group), Heshouwuyin administered normal group (B group), model control group (C group), Heshouwuyin treated group (D group) and Heshouwuyin prevented group (E group) randomly with 10 rats for each. The exercise-induced fatigue models in rats of C, D, E groups were established. The rats in D group were treated with Heshouwuyin [20 g/(kg x d), contained crude drug 9.6 g/mL] for 60 days (during the 42 days of modeling and after the 18 days of modeling). The rats in E group were also treated with Heshouwuyin for 60 days (but before the 18 days of modeling and during the 42 days of modeling). Beckmancoulter Unicel Dxl 800 was used to detect the level of serum testosterone, according to the manufacture's instructions. Western blot and RT-PCR were used to observe the differential expression of Cox7a2. The level of serum testosterone in C group was decreased compared with A group (P < 0.05), which implied the success of modeling. Compared with group A, the level of serum testosterone in B, D, E groups were increased (P < 0.05). Cox7a2 protein was expressed mainly in leydig cell and spermatocyte. Compared with A,B, D, E groups, the expression of Cox7a2 protein and mRNA in C group increased (P < 0.05), and there no significant difference was observed between group A and B, as well as group D and E. The expression of Cox7a2 was down-regulated by Heshouwuyin.

  8. Hempseed oil induces reactive oxygen species- and C/EBP homologous protein-mediated apoptosis in MH7A human rheumatoid arthritis fibroblast-like synovial cells.

    Science.gov (United States)

    Jeong, Mini; Cho, Jaewook; Shin, Jong-Il; Jeon, Yong-Joon; Kim, Jin-Hyun; Lee, Sung-Joon; Kim, Eun-Soo; Lee, Kyungho

    2014-07-03

    The medicinal efficacy of hempseed (Cannabis sativa L.), which is rich in polyunsaturated fatty acids, in atopic dermatitis, inflammation, and rheumatoid arthritis (RA) has been suggested for centuries. Hempseed has been used as a treatment for these diseases in Korean and Chinese folk medicine. The aim of the study is to investigate the effects of hempseed oil (HO) on MH7A human RA fibroblast-like synovial cells. MH7A cells were used to study the anti-rheumatoid effects of hempseed (Cannabis sativa L., cv. Cheungsam/Cannabaceae) oil by investigating cell viability, apoptosis, lipid accumulation, oxidative stress, and endoplasmic reticulum (ER) stress-induced apoptosis. HO treatment reduced the survival rate of MH7A cells and promoted apoptotic cell death in a time- and dose-dependent manner. Both lipid accumulation and the level of intracellular reactive oxygen species (ROS) increased in HO-treated MH7A cells. Co-treatment with the antioxidant Tiron effectively abrogated the cytotoxic effects of HO; the ROS level was reduced, cell viability was recovered, and apoptotic cell death was significantly diminished. Moreover, HO-treated cells exhibited increased expression of the major ER stress markers, glucose-regulated protein 78 and C/EBP homologous protein (CHOP). The siRNA-mediated knockdown of CHOP prevented HO-induced apoptosis. Our results suggest that HO treatment induced lipid accumulation, ROS production, CHOP expression, and apoptosis in MH7A cells, and that CHOP functions as an anti-rheumatoid factor downstream of HO in MH7A cells. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  9. Crystal structures of wild-type Trichoderma reesei Cel7A catalytic domain in open and closed states

    Energy Technology Data Exchange (ETDEWEB)

    Bodenheimer, Annette M. [Molecular and Structural Biochemistry Department, North Carolina State University, Raleigh NC USA; Neutron Sciences Directorate, Oak Ridge National Laboratory, TN USA; Meilleur, Flora [Molecular and Structural Biochemistry Department, North Carolina State University, Raleigh NC USA; Neutron Sciences Directorate, Oak Ridge National Laboratory, TN USA

    2016-11-07

    Trichoderma reesei Cel7A efficiently hydrolyses cellulose. We report here the crystallographic structures of the wild-type TrCel7A catalytic domain (CD) in an open state and, for the first time, in a closed state. Molecular dynamics (MD) simulations indicate that the loops along the CD tunnel move in concerted motions. Together, the crystallographic and MD data suggest that the CD cycles between the tense and relaxed forms that are characteristic of work producing enzymes. Analysis of the interactions formed by R251 provides a structural rationale for the concurrent decrease in product inhibition and catalytic efficiency measured for product-binding site mutants.

  10. Validation of semaphorin 7A and ala-β-his-dipeptidase as biomarkers associated with the conversion from clinically isolated syndrome to multiple sclerosis.

    Science.gov (United States)

    Cantó, Ester; Tintoré, Mar; Villar, Luisa Maria; Borrás, Eva; Alvarez-Cermeño, Jose Carlos; Chiva, Cristina; Sabidó, Eduard; Rovira, Alex; Montalban, Xavier; Comabella, Manuel

    2014-11-13

    In a previous proteomics study using pooled cerebrospinal fluid (CSF) samples, we proposed apolipoprotein AI, apolipoprotein AIV, vitronectin, plasminogen, semaphorin 7A, and ala-β-his-dipeptidase as candidate biomarkers associated with the conversion to clinically definite multiple sclerosis (CDMS) in patients with clinically isolated syndromes (CIS). Here, we aimed to validate these results in individual CSF samples using alternative techniques. In a first replication study, levels of apolipoproteins AI and AIV, vitronectin, and plasminogen were measured by ELISA in CSF and serum of 56 CIS patients (29 patients who converted to CDMS (MS converters) and 27 patients who remained with CIS during follow-up (MS non-converters)) and 26 controls with other neurological disorders. Semaphorin 7A and ala-β-his-dipeptidase levels were determined by selected reaction monitoring (SRM) in CSF of 36 patients (18 MS converters, 18 non-converters) and 20 controls. In a second replication study, apolipoprotein AI levels were measured by ELISA in CSF of 74 CIS patients (47 MS converters, 27 non-converters) and 50 individual controls, and levels of semaphorin 7A and ala-beta-his-dipeptidase were determined by SRM in 49 patients (24 MS converters, 25 non-converters) and 22 controls. CSF levels of apolipoprotein AI were increased (P = 0.043) and levels of semaphorin 7A and ala-β-his-dipeptidase decreased (P = 4.4 × 10(-10) and P = 0.033 respectively) in MS converters compared to non-converters. No significant differences were found in serum levels for apolipoproteins AI and AIV, vitronectin, and plasminogen. Findings with semaphorin 7A and ala-β-his-dipeptidase were also validated in the second replication study, and CSF levels for these two proteins were again decreased in MS converters versus non-converters (P = 1.2 × 10(-4) for semaphorin 7A; P = 3.7 × 10(-8) for ala-β-his-dipeptidase). Conversely, apolipoprotein AI findings were not replicated and CSF levels for this

  11. The influence of different linker modifications on the catalytic activity and cellulose affinity of cellobiohydrolase Cel7A from Hypocrea jecorina

    DEFF Research Database (Denmark)

    Badino, Silke Flindt; Bathke, Jenny Kim; Sørensen, Trine Holst

    2017-01-01

    , of the linker and its glycans, have been widely discussed, but experimental evidence remains sparse. One of the most studied cellulose degrading enzymes is the multi-domain cellobiohydrolase Cel7A from Hypocrea jecorina. Here, we designed variants of Cel7A with mutations in the linker region to elucidate...... interactions. However, a variant with several inserted glycosylation sites near the CBM also showed lower affinity for the substrate compared to the wild-type, and we suggest that substrate interactions of the glycans depend on their exact location as well as other factors such as changes in structure...

  12. Itens alimentares no consumo alimentar de crianças de 7 a 10 anos Food items in the food intake of children aged seven to ten years

    OpenAIRE

    Patrícia de Fragas Hinnigi; Denise Pimental Bergamaschi

    2012-01-01

    OBJETIVO: Descrever os itens alimentares mais representativos para o consumo total de energia, carboidratos, proteínas e lipídios de crianças de 7 a 10 anos. MÉTODOS: Elaborou-se uma lista com todos os alimentos consumidos com suas respectivas quantidades e quantificou-se a composição da dieta em energia e macronutrientes. A lista foi baseada em informações fornecidas pelo preenchimento de três Diários Alimentares (DA) por 85 escolares de 7 a 10 anos que frequentavam uma escola pública na cid...

  13. Psyche--the meeting of mind and soul: current psychoanalytic views on the mental representation of god.

    Science.gov (United States)

    Clemens, Norman A

    2013-11-01

    The author presents an overview of two contemporary, related psychoanalytic perspectives on religious phenomena. Based on data from systematic interviews, Ana-Maria Rizzuto explores the way the human mind forms the idea of God as it evolves through the various stages of childhood and adult development. The object-representation of God is greatly influenced by the mental representations of mother, father, and other important adults in the child's life. Object relations theory and the writings of Winnicott play an important role in these concepts. William Meissner, a Jesuit priest as well as a psychoanalyst, addresses Freud's views of religious belief as an illusion, or when accepted with certainty as real, as a delusion. Instead, Meissner sees religious belief as a developmental process that resides in the mental realm of transitional phenomena where spirituality, creativity, appreciation of beauty, transcendental states, play, and the psychoanalytic process itself also take place. In psychoanalytic treatment, religious phenomena are not exempt from exploration and understanding, perhaps resulting in more mature development of object representations, ego functions, and the superego functions of conscience and ego ideal as well as more mature religious life.

  14. [Is the psyche antiquated? A typology of psychotherapeutic critique of civilization in the works of Alexander Mitscherlich].

    Science.gov (United States)

    Roelcke, V

    1995-08-01

    In the oeuvre of the psychotherapist Alexander Mitscherlich, one of the founding-fathers of psychosomatic medicine in post-war Germany, three basic types of critique of civilization can be identified. They each imply a specific conception of the relation between modernity and psychological disorder. Mitscherlich's ideas on the topic have evolved in a manner consistent with his appropriation of psychoanalysis and his confrontation with the causes and consequences of human behaviour during the time of national socialism.

  15. From social pathologies to individual psyches: psychiatry navigating socio-political currents in 20th-century Latvia.

    Science.gov (United States)

    Lūse, Agita

    2011-03-01

    The paper explores psychiatry's responses to the twentieth-century socio-political currents in Latvia by focusing on social objectives, clinical ideologies, and institutional contexts of Soviet mental health care. The tradition of German biological psychiatry in which Baltic psychiatrists had been trained blended well with the materialistic monism of Soviet psychoneurology. Pavlov's teaching of the second signal system was well suited to Soviet ideological needs: speech stimuli were seen as a vehicle for moulding the individual's mind. The transformation in diagnostic practices during the 1970s and 1980s reflected the demise of optimism about the capacity of the self to model itself to the needs of the society. Latvian psychiatry was prepared to embrace more individualistic and pessimistic theories of the self.

  16. Synchronicité le rapport entre physique et psyché de Pauli et Jung à Chopra

    CERN Document Server

    Teodorani, Massimo

    2015-01-01

    De mystérieux événements synchrones semblent parsemer nos vies. Tandis qu'une pensée affleure, un fait, qui renferme toujours un sens profond dont le but est de conduire nos vies vers leur destin, se produit à l'improviste, dans un synchronisme parfait. L'objectif de ce livre est de démontrer que le phénomène de la « synchronicité » est depuis longtemps étudié, en particulier par les physiciens quantiques. Ces recherches plongent leurs racines dans l'alliance durable et harmonieuse entre le grand psychologue analytique Carl Gustav Jung et le physicien quantique Wolfgang Pauli.

  17. A Review of AA Psych Corps Involvement in the Allocation of Soldiers to corps and Employment. Executive Summary

    Science.gov (United States)

    1990-11-01

    Allocation interviews conducted. 9 Specialist testing and interviews (The Australian Army Intelligence Corps (Aust Int Corps), Army Adult Tradesmen’ s...M the total psychological processing battery and interview were only marginally more predictive than Test AGC (a group intelligence test ) an its own...SOLDIERS TO CORPS AND EWIMEr was distributed within the Australian Army PsIchology Corps. Th enclosed executive ’aaury represents a shorter document that

  18. Bulletproofing the Psyche: Mindfulness Interventions in the Training Environment to Improve Resilience in the Military and Veteran Communities

    National Research Council Canada - National Science Library

    Kate Hendricks Thomas; Sarah Plummer Taylor

    2015-01-01

    .... Social work and health promotion professionals working to prevent and treat mental health problems like depression and stress injuries must understand the confluence of warrior culture and mental...

  19. Bulletproofing the Psyche: Mindfulness Interventions in the Training Environment to Improve Resilience in the Military and Veteran Communities

    Directory of Open Access Journals (Sweden)

    Kate Hendricks Thomas

    2016-02-01

    Full Text Available While clinical health services exist for service members with existing mental health conditions like posttraumatic stress, they are not stemming the rising tide of service suicides. A new approach to mental health intervention and suicide prevention in military-connected personnel is required, one that speaks to the participatory, hardworking ethos of military culture. Social work and health promotion professionals working to prevent and treat mental health problems like depression and stress injuries must understand the confluence of warrior culture and mental health issues in the veteran community. While the research literature does not yet address this confluence issue directly, programs exist that provide guidance, and a mindfulness-based training protocol may provide the answer. The purpose of this review is to provide programming recommendations based on a review of successful exemplars in treatment settings, the limited evaluation of best practices currently available when working with this priority population in prevention settings, and a cultural analysis of the military veteran community.

  20. Novel glycine substitution mutations in COL7A1 reveal that the Pasini and Cockayne-Touraine variants of dominant dystrophic epidermolysis bullosa are allelic.

    Science.gov (United States)

    Kon, A; Nomura, K; Pulkkinen, L; Sawamura, D; Hashimoto, I; Uitto, J

    1997-11-01

    Mutations in the type VII collagen gene (COL7A1) have been shown to underlie dystrophic epidermolysis bullosa (DEB). The dominantly inherited forms of DEB have been divided into two clinical subcategories, the Pasini (DDEB-P) and the Cockayne-Touraine (DDEB-CT) variants, on the basis of the presence or absence of albopapuloid lesions. In this study, we have examined the molecular basis of DDEB in two Japanese families, one with DDEB-P and the other with DDEB-CT. Mutation detection strategy consisted of polymerase chain reaction amplification of COL7A1 from genomic DNA, followed by heteroduplex analysis and direct nucleotide sequencing. The results revealed heterozygous glycine substitution mutations, G2076D and G2034R, in these families, respectively. Thus, these two variants of DDEB are allelic, and subtle differences in the clinical presentation may reflect the precise position of the mutation along the type VII collagen molecule. Alternatively, the nature of the substituting amino acid (D versus R) may influence the clinical phenotype. This is the first demonstration of a COL7A1 mutation in DDEB-P, and brings the total number of dominant DEB variants with underlying glycine substitutions in COL7A1 to five, including the pretibial and localized variants as well as the Bart's syndrome, in addition to DDEB-P and DDEB-CT.

  1. Study of the BPP7a peptide and its {beta}-cyclodextrin complex: physicochemical characterization and complete sequence specific NMR assignments

    Energy Technology Data Exchange (ETDEWEB)

    Lula, Ivana; Sousa, Frederico B. de; Denadai, Angelo M.L.; Sinisterra, Ruben D.; Ianzer, Danielle; Santos, Robson A.S., E-mail: sinisterra@ufmg.br [Departamento de Quimica, Instituto de Ciencias Exatas and Departamento de Fisiologia e Biofisica, Instituto de Ciencias Biologicas, Universidade Federal de Minas Gerais, Belo Horizonte, MG, (Brazil); Camargo, Antonio C.M. de [Center for Applied Toxinology (CAT-CEPID), Instituto Butantan, Sao Paulo, SP (Brazil)

    2011-09-15

    The BPP7a heptapeptide, p-Glu1Asp2Gly3Pro4Ile5Pro6Pro7, forms an association complex with {beta}-cyclodextrin in a 1:1 molar ratio. The peptide and its complex were characterized by circular dichroism (CD) and isothermal titration calorimetry (ITC), which showed a very weak interaction between the {beta}-cyclodextrin and the peptide. Assignments of all hydrogen resonances of the peptide alone and as a complex were made using {sup 1}H nuclear magnetic resonance (NMR) experiments at 400 and 600 MHz. High resolution diffusion ordered spectroscopy (HR-DOSY) experiments were carried out to establish the self-aggregation state of BPP7a. It was also shown that the {beta}-cyclodextrin breaks the molecular clusters leading to complex formation. In addition, the anti-hypertensive activity of the BPP7a/{beta}-cyclodextrin complex was evaluated in spontaneous hypertensive rats (SHR), showing increased activity compared to that of pure BPP7a. (author)

  2. Purification, cloning and characterisation of two forms of thermostable and highly active cellobiohydrolase I (Cel7A) produced by the industrial strain of Chrysosporium lucknowense

    NARCIS (Netherlands)

    Gusakov, A.V.; Sinitsyn, A.P.; Salanovich, T.N.; Bukhtojarov, F.E.; Markov, A.V.; Ustinov, B.B.; Zeijl, C.V.; Punt, P.; Burlingame, R.

    2005-01-01

    Two forms of cellobiohydrolase I (CBH I, Cel7A) were purified from the culture ultrafiltrate of a mutant strain of the fungus Chrysosporium lucknowense, an industrial producer of cellulases and hemicellulases. The enzymes had different molecular masses (52 and 65 kDa, SDS-PAGE data) but the same pI

  3. Characterization of (1'R,4S,4aR,7S,7aR)-dihydronepetalactol as a semiochemical for lacewings, including Chrysopa spp. and Peyerimhoffina gracilis.

    Science.gov (United States)

    Hooper, A M; Donato, B; Woodcock, C M; Park, J H; Paul, R L; Boo, K S; Hardie, J; Pickett, J A

    2002-04-01

    The enantiomerically pure diastereoisomers (1R,4S,4aR,7S,7aR)- (1) and (1R,4R,4aR,7S,7aR)-dihydronepetalactol (2) were synthesized diastereoselectively from a renewable resource, (4aS,7S,7aR)-nepetalactone (3), isolated as the main constituent of the essential oil of the catmint plant Nepeta cataria. The stereochemistry of the compounds was determined by NMR spectroscopy and X-ray crystallography, and the compounds were identified, respectively, as neomatatabiol and isoneomatatabiol, natural products from Actinidia polygama, for which the lactol stereochemistry was previously incompletely defined. Compound 1 was found to catch significant numbers of three species of lacewing in the field: in Korea. Chrysopa cognata, and in the United Kingdom, Nineta vittata and most notably Peverimhoffina gracilis. All species caught in significant numbers were found more frequently in traps releasing 1 than 2, while more C. cognata, C. formosa, and C. phyllochroma were found in traps releasing (1R,4aS,7S,7aR)-nepetalactol (4). The catch of P. gracilis with 1 is of particular interest as this lacewing has only recently been recorded in the United Kingdom. Where sexed, the lacewings of all species trapped were found to be male, implying a possible pheromonal role for these or structurally related compounds.

  4. Six new Phytophthora species from ITS Clade 7a including two sexually functional heterothallic hybrid species detected in natural ecosystems in Taiwan.

    NARCIS (Netherlands)

    Jung, T.; Jung, M.H.; Scanu, B.; Seress, D.; Kovács, G.M.; Maia, C.; Pérez-Sierra, A.; Chang, T.-T.; Chandelier, A.; Heungens, K.; Poucke, van K.; Abad-Campos, P.; Léon, M.; Cacciola, S.O.; Bakonyi, J.

    2017-01-01

    During a survey of Phytophthora diversity in natural ecosystems in Taiwan six new species were detected. Multigene phylogeny based on the nuclear ITS, ß-tubulin and HSP90 and the mitochondrial cox1 and NADH1 gene sequences demonstrated that they belong to ITS Clade 7a with P. europaea, P. uniformis,

  5. Design and Validation of a Conformation-Sensitive Capillary Electrophoresis System for Mutation Identification of the COL7A1 Gene with Automated Peak Comparison

    NARCIS (Netherlands)

    van den Akker, Peter C.; Hettema, Wendy; Meijer, Rowdy; Jonkman, Marcel F.; Hofstra, Robert M. W.; Scheffer, Hans

    2009-01-01

    Dystrophic epidermolysis bullosa is a heritable skin disease in which blisters occur because of a defect in type VII collagen resulting from mutations in the COL7A1 gene that is composed of 118 exons. Although a few mutations are specific to certain populations owing to founder effects, and although

  6. Novel and de novo glycine substitution mutations in the type VII collagen gene (COL7A1) in dystrophic epidermolysis bullosa : Implications for genetic counseling

    NARCIS (Netherlands)

    Rouan, F; Pulkkinen, L; Jonkman, MF; Cserhalmi-Friedman, PB; Christiano, AM; Uitto, J

    1998-01-01

    The dystrophic forms of epidermolysis bullosa (DEB) are due to mutations in the type VII collagen gene (COL7A1). In dominant DEB, a characteristic genetic lesion is a glycine substitution mutation within the collagenous domain of the protein. In this study, we have examined the molecular basis of

  7. Dominant dystrophic epidermolysis bullosa (Pasini) caused by a novel glycine substitution mutation in the type VII collagen gene (COL7A1)

    NARCIS (Netherlands)

    Jonkman, MF; Moreno, G; Rouan, F; Oranje, AP; Pulkkinen, L; Uitto, J

    A 12 y old girl with the albopapuloid variant (Pasini) of dominant dystrophic epidermolysis bullosa is studied. The albopapuloid lesions developed within the first year of life, contained milia and were associated with pruritus. Mutation detection of the COL7A1 gene revealed a G-->A transition at

  8. Somatic mosaicism for the COL7A1 mutation p.Gly2034Arg in the unaffected mother of a patient with dystrophic epidermolysis bullosa pruriginosa

    NARCIS (Netherlands)

    van den Akker, P. C.; Pasmooij, A. M. G.; Meijer, R.; Scheffer, H.; Jonkman, M. F.

    Dystrophic epidermolysis bullosa (DEB) is a heritable blistering disorder caused by mutations in the type VII collagen gene, COL7A1. Although revertant mosaicism is well known in DEB, 'forward' somatic mosaicism, in which a pathogenic mutation arises on a wild-type (WT) background, extending beyond

  9. Somatic mosaicism for the COL7A1 mutation p.Gly2034Arg in the unaffected mother of a patient with dystrophic epidermolysis bullosa pruriginosa

    NARCIS (Netherlands)

    Akker, P.C. van den; Pasmooij, A.M.; Meijer, R.; Scheffer, H.; Jonkman, M.F.

    2015-01-01

    Dystrophic epidermolysis bullosa (DEB) is a heritable blistering disorder caused by mutations in the type VII collagen gene, COL7A1. Although revertant mosaicism is well known in DEB, 'forward' somatic mosaicism, in which a pathogenic mutation arises on a wild-type (WT) background, extending beyond

  10. Design and validation of a conformation-sensitive capillary electrophoresis system for mutation identification of the COL7A1 gene with automated peak comparison.

    NARCIS (Netherlands)

    Akker, P.C. van den; Hettema, W.; Meijer, R.; Jonkman, M.F.; Hofstra, R.M.; Scheffer, H.

    2009-01-01

    Dystrophic epidermolysis bullosa is a heritable skin disease in which blisters occur because of a defect in type VII collagen resulting from mutations in the COL7A1 gene that is composed of 118 exons. Although a few mutations are specific to certain populations owing to founder effects, and although

  11. The International Dystrophic Epidermolysis Bullosa Patient Registry : An Online Database of Dystrophic Epidermolysis Bullosa Patients and Their COL7A1 Mutations

    NARCIS (Netherlands)

    van den Akker, Peter C.; Jonkman, Marcel F.; Rengaw, Trebor; Bruckner-Tuderman, Leena; Has, Cristina; Bauer, Johann W.; Klausegger, Alfred; Zambruno, Giovanna; Castiglia, Daniele; Mellerio, Jemima E.; McGrath, John A.; van Essen, Anthonie J.; Hofstra, Robert M. W.; Swertz, Morris A.

    2011-01-01

    Dystrophic epidermolysis bullosa (DEB) is a heritable blistering disorder that can be inherited autosomal dominantly (DDEB) or recessively (RDEB) and covers a group of several distinctive phenotypes. A large number of unique COL7A1 mutations have been shown to underlie DEB. Although general

  12. The interaction effects of pri-let-7a-1 rs10739971 with PGC and ERCC6 gene polymorphisms in gastric cancer and atrophic gastritis.

    Directory of Open Access Journals (Sweden)

    Qian Xu

    Full Text Available BACKGROUND: The aim of this study was to investigate the interaction effects of pri-let-7a-1 rs10739971 with pepsinogen C (PGC and excision repair cross complementing group 6 (ERCC6 gene polymorphisms and its association with the risks of gastric cancer and atrophic gastritis. We hoped to identify miRNA polymorphism or a combination of several polymorphisms that could serve as biomarkers for predicting the risk of gastric cancer and its precancerous diseases. METHODS: Sequenom MassARRAY platform method was used to detect polymorphisms of pri-let-7a-1 rs10739971 G → A, PGC rs4711690 C → G, PGC rs6458238 G → A, PGC rs9471643 G → C, and ERCC6 rs1917799 in 471 gastric cancer patients, 645 atrophic gastritis patients and 717 controls. RESULTS: An interaction effect of pri-let-7a-1 rs10739971 polymorphism with ERCC6 rs1917799 polymorphism was observed for the risk of gastric cancer (P interaction = 0.026; and interaction effects of pri-let-7a-1 rs10739971 polymorphism with PGC rs6458238 polymorphism (P interaction = 0.012 and PGC rs9471643 polymorphism (P interaction = 0.039 were observed for the risk of atrophic gastritis. CONCLUSION: The combination of pri-let-7a-1 rs10739971 polymorphism and ERCC6 and PGC polymorphisms could provide a greater prediction potential than a single polymorphism on its own. Large-scale studies and molecular mechanism research are needed to confirm our findings.

  13. Molecular cloning, mRNA expression and tissue distribution analysis of Slc7a11 gene in alpaca (Lama paco) skins associated with different coat colors.

    Science.gov (United States)

    Tian, Xue; Meng, Xiaolin; Wang, Liangyan; Song, Yunfei; Zhang, Danli; Ji, Yuankai; Li, Xuejun; Dong, Changsheng

    2015-01-25

    Slc7a11 encoding solute carrier family 7 member 11 (amionic amino acid transporter light chain, xCT), has been identified to be a critical genetic regulator of pheomelanin synthesis in hair and melanocytes. To better understand the molecular characterization of Slc7a11 and the expression patterns in skin of white versus brown alpaca (lama paco), we cloned the full length coding sequence (CDS) of alpaca Slc7a11 gene and analyzed the expression patterns using Real Time PCR, Western blotting and immunohistochemistry. The full length CDS of 1512bp encodes a 503 amino acid polypeptide. Sequence analysis showed that alpaca xCT contains 12 transmembrane regions consistent with the highly conserved amino acid permease (AA_permease_2) domain similar to other vertebrates. Sequence alignment and phylogenetic analysis revealed that alpaca xCT had the highest identity and shared the same branch with Camelus ferus. Real Time PCR and Western blotting suggested that xCT was expressed at significantly high levels in brown alpaca skin, and transcripts and protein possessed the same expression pattern in white and brown alpaca skins. Additionally, immunohistochemical analysis further demonstrated that xCT staining was robustly increased in the matrix and root sheath of brown alpaca skin compared with that of white. These results suggest that Slc7a11 functions in alpaca coat color regulation and offer essential information for further exploration on the role of Slc7a11 in melanogenesis. Copyright © 2014 Elsevier B.V. All rights reserved.

  14. cDNA cloning and chromosomal mapping of the mouse type VII collagen gene (Col7a1): Evidence for rapid evolutionary divergence of the gene

    Energy Technology Data Exchange (ETDEWEB)

    Li, Kehua; Christiano, A.M.; Chu, Mon Li; Uitto, J. (Jefferson Medical College, Philadelphia, PA (United States) Thomas Jefferson Univ., Philadelphia, PA (United States)); Copeland, N.G.; Gilbert, D.J. (NCI-Federick Cancer Research and Development Center, Federick, MD (United States))

    1993-06-01

    Type VII collagen is the major component of anchoring fibrils, critical attachment structures at the dermal-epidermal basement membrane zone. Genetic linkage analyses with recently cloned human type VII collagen cDNAs have indicated that the corresponding gene, COL7A1, is the candidate gene in the dystrophic forms of epidermolysis bullosa. To gain insight into the evolutionary conservation of COL7A1, in this study the authors have isolated mouse type VII collagen cDNAs by screening a mouse epidermal keratinocyte cDNA library with a human COL7A1 cDNA. Two overlapping mouse cDNAs were isolated, and Northern hybridization of mouse epidermal keratinocyte RNA with one of them revealed the presence of a mRNA transcript of [approximately]9.5 kb, the approximate size of the human COL7A1 mRNA. Nucleotide sequencing of the mouse cDNAs revealed a 2760-bp open reading frame that encodes the 5[prime] half of the collagenous domain and a segment of the NC-1, the noncollagenous amino-terminal domain of type VII collagen. Comparison of the mouse amino acid sequences with the corresponding human sequences deduced from cDNAs revealed 82.5% identity. The evolutionary divergence of the gene was relatively rapid in comparison to other collagen genes. Despite the high degree of sequence variation, several sequences, including the size and the position of noncollagenous imperfections and interruptions within the Gly-X-Y repeat sequence, were precisely conserved. Finally, the mouse Col7a1 gene was located by interspecific backcross mapping to mouse Chromosome 9, a region that corresponds to human chromosome 3p21, the position of human COL7Al. This assignment confirms and extends the relationship between the mouse and the human chromosomes in this region of the genome. 33 refs., 5 figs., 1 tab.

  15. Differential processing of let-7a precursors influences RRM2 expression and chemosensitivity in pancreatic cancer: role of LIN-28 and SET oncoprotein.

    Directory of Open Access Journals (Sweden)

    Yangzom Doma Bhutia

    Full Text Available Overexpression of ribonucleotide reductase subunit M2 (RRM2, involved in deoxyribonucleotide synthesis, drives the chemoresistance of pancreatic cancer to nucleoside analogs (e.g., gemcitabine. While silencing RRM2 by synthetic means has shown promise in reducing chemoresistance, targeting endogenous molecules, especially microRNAs (miRNAs, to advance chemotherapeutic outcomes has been poorly explored. Based on computational predictions, we hypothesized that the let-7 tumor suppressor miRNAs will inhibit RRM2-mediated gemcitabine chemoresistance in pancreatic cancer. Reduced expression of the majority of let-7 miRNAs with an inverse relationship to RRM2 expression was identified in innately gemcitabine-resistant pancreatic cancer cell lines. Direct binding of let-7 miRNAs to the 3' UTR of RRM2 transcripts identified post-transcriptional regulation of RRM2 influencing gemcitabine chemosensitivity. Intriguingly, overexpression of human precursor-let-7 miRNAs led to differential RRM2 expression and chemosensitivity responses in a poorly differentiated pancreatic cancer cell line, MIA PaCa-2. Defective processing of let-7a precursors to mature forms, in part, explained the discrepancies observed with let-7a expressional outcomes. Consistently, the ratios of mature to precursor let-7a were progressively reduced in gemcitabine-sensitive L3.6pl and Capan-1 cell lines induced to acquire gemcitabine resistance. Besides known regulators of let-7 biogenesis (e.g., LIN-28, short hairpin RNA library screening identified several novel RNA binding proteins, including the SET oncoprotein, to differentially impact let-7 biogenesis and chemosensitivity in gemcitabine-sensitive versus -resistant pancreatic cancer cells. Further, LIN-28 and SET knockdown in the cells led to profound reductions in cellular proliferation and colony-formation capacities. Finally, defective processing of let-7a precursors with a positive correlation to RRM2 overexpression was

  16. Two novel mutations on exon 8 and intron 65 of COL7A1 gene in two Chinese brothers result in recessive dystrophic epidermolysis bullosa.

    Directory of Open Access Journals (Sweden)

    Ying Lin

    Full Text Available Dystrophic epidermolysis bullosa is an inherited bullous dermatosis caused by the COL7A1 gene mutation in autosomal dominant or recessive mode. COL7A1 gene encodes type VII collagen - the main component of the anchoring fibrils at the dermal-epidermal junction. Besides the 730 mutations reported, we identified two novel COL7A1 gene mutations in a Chinese family, which caused recessive dystrophic epidermolysis bullosa (RDEB. The diagnosis was established histopathologically and ultrastructurally. After genomic DNA extraction from the peripheral blood sample of all subjects (5 pedigree members and 136 unrelated control individuals, COL7A1 gene screening was performed by polymerase chain reaction amplification and direct DNA sequencing of the whole coding exons and flanking intronic regions. Genetic analysis of the COL7A1 gene in affected individuals revealed compound heterozygotes with identical novel mutations. The maternal mutation is a 2-bp deletion at exon 8 (c.1006_1007delCA, leading to a subsequent reading frame-shift and producing a premature termination codon located 48 amino acids downstream in exon 9 (p.Q336EfsX48, consequently resulting in the truncation of 2561 amino acids downstream. This was only present in two affected brothers, but not in the other unaffected family members. The paternal mutation is a 1-bp deletion occurring at the first base of intron 65 (c.IVS5568+1delG that deductively changes the strongly conserved GT dinucleotide at the 5' donor splice site, results in subsequent reading-through into intron 65, and creates a stop codon immediately following the amino acids encoded by exon 65 (GTAA→TAA. This is predicted to produce a truncated protein lacking of 1089 C-terminal amino acids downstream. The latter mutation was found in all family members except one of the two unaffected sisters. Both mutations were observed concurrently only in the two affected brothers. Neither mutation was discovered in 136 unrelated Chinese

  17. Prenatal treatment of mosaic mice (Atp7a mo-ms) mouse model for Menkes disease, with copper combined by dimethyldithiocarbamate (DMDTC)

    DEFF Research Database (Denmark)

    Lenartowicz, Małgorzata; Krzeptowski, Wojciech; Koteja, Paweł

    2012-01-01

    Menkes disease is a fatal neurodegenerative disorder in infants caused by mutations in the gene ATP7A which encodes a copper (Cu) transporter. Defects in ATP7A lead to accumulated copper in the small intestine and kidneys and to copper deficiencies in the brain and the liver. The copper level...... and 18 with a combination of CuCl(2) (50 mg/kg) and dimethyldithiocarbamate (DMDTC) (280 mg/kg) leads to an increase in survival to about 76±25.3 days, whereas treatment with CuCl(2) alone (50 mg/kg) only leads to survival for about 21 days ±5 days. These copper-DMDTC treated mutants showed an improved...

  18. Prevalência de sobrepeso e obesidade em escolares de 7 a 10 anos de idade, em Florianópolis

    OpenAIRE

    Forte, Cézar Figueiredo

    2003-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Ciências da Saúde. Programa de Pós-Graduação em Ciências Médicas. Objetivo: Estudar as características epidemiológicas do sobrepeso e obesidade nas crianças escolares de 7 a 10 anos de idade no município de Florianópolis.

  19. Cellulose hydrolysis and binding with Trichoderma reesei Cel5A and Cel7A and their core domains in ionic liquid solutions.

    Science.gov (United States)

    Wahlström, Ronny; Rahikainen, Jenni; Kruus, Kristiina; Suurnäkki, Anna

    2014-04-01

    Ionic liquids (ILs) dissolve lignocellulosic biomass and have a high potential as pretreatment prior to total enzymatic hydrolysis. ILs are, however, known to inactivate cellulases. In this article, enzymatic hydrolysis of microcrystalline cellulose (MCC) and enzyme binding onto the cellulosic substrate were studied in the presence of cellulose-dissolving ILs. Two different ILs, 1,3-dimethylimidazolium dimethylphosphate ([DMIM]DMP) and 1-ethyl-3-methylimidazolium acetate ([EMIM]AcO), and two monocomponent cellulases, Trichoderma reesei cellobiohydrolase Cel7A and endoglucanase Cel5A, were used in the study. The role and IL sensitivity of the carbohydrate-binding module (CBM) were studied by performing hydrolysis and binding experiments with both the intact cellulases, and their respective core domains (CDs). Based on hydrolysis yields and substrate binding experiments for the intact enzymes and their CDs in the presence of ILs, the function of the CBM appeared to be very IL sensitive. Binding data suggested that the CBM was more important for the substrate binding of endoglucanase Cel5A than for the binding of cellobiohydrolase Cel7A. The CD of Cel7A was able to bind well to cellulose even without a CBM, whereas Cel5A CD had very low binding affinity. Hydrolysis also occurred with Cel5A CD even if this protein had very low binding affinity in all the studied matrices. Binding and hydrolysis were less affected by the studied ILs for Cel7A than for Cel5A. To our knowledge, this is the first systematic study of IL effects on cellulase substrate binding. © 2013 Wiley Periodicals, Inc.

  20. The role of human parietal area 7A as a link between sequencing in hand actions and in overt speech production

    Directory of Open Access Journals (Sweden)

    Stefan eHeim

    2012-12-01

    Full Text Available Research on the evolutionary basis of the human language faculty has proposed the mirror neuron system as a link between motor processing and speech development. Consequently, most work has focussed on the left inferior frontal cortex, in particular Broca's region, and the left inferior parietal cortex. However, the direct link between planning of hand motor and speech actions remains to be elucidated. Thus, the present study investigated whether sequencing of hand motor actions vs. speech motor actions has a common neural denominator. For the hand motor task, 25 subjects performed single, repeated, or sequenced button presses with either the left or right hand. The speech task was in analogy; the same subjects produced the syllable "po" once or repeatedly, or a sequence of different syllables (po-pi-po. Speech motor vs. hand motor effectors resulted in increased perisylvian activation including Broca's region (left area 44 and areas medially adjacent to left area 45. In contrast, common activation for sequenced vs. repeated production of button presses and syllables revealed the effector-independent involvement of left area 7A in the superior parietal lobule (SPL in sequencing. These data demonstrate that sequencing of vocal gestures, an important precondition for ordered utterances and ultimately human speech, shares area 7A, rather than inferior parietal regions, as a common cortical module with hand motor sequencing. Interestingly, area 7A has previously also been shown to be involved in the observation of hand and non-hand actions. In combination with the literature, the present data thus suggest a distinction between area 44, which is specifically recruited for (cognitive aspects of speech, and SPL area 7A for general aspects of motor sequencing. In sum, the study demonstrates a yet little considered role of the superior parietal lobule in the origins of speech, and may be discussed in the light of embodiment of speech and language in the

  1. The Role of Human Parietal Area 7A as a Link between Sequencing in Hand Actions and in Overt Speech Production.

    Science.gov (United States)

    Heim, Stefan; Amunts, Katrin; Hensel, Tanja; Grande, Marion; Huber, Walter; Binkofski, Ferdinand; Eickhoff, Simon B

    2012-01-01

    Research on the evolutionary basis of the human language faculty has proposed the mirror neuron system as a link between motor processing and speech development. Consequently, most work has focused on the left inferior frontal cortex, in particular Broca's region, and the left inferior parietal cortex. However, the direct link between planning of hand motor and speech actions has yet to be elucidated. Thus, the present study investigated whether motor sequencing of hand vs. speech actions has a common neural denominator. For the hand motor task, 25 subjects performed single, repeated, or sequenced button presses with either the left or right hand. The speech task was in analogy; the same subjects produced the syllable "po" once or repeatedly, or a sequence of different syllables ("po-pi-po"). Speech motor vs. hand motor effectors resulted in increased perisylvian activation including Broca's region (left area 44 and areas medially adjacent to left area 45). In contrast, common activation for sequenced vs. repeated production of button presses and syllables revealed the effector-independent involvement of left area 7A in the superior parietal lobule (SPL) in sequencing. These data demonstrate that sequencing of vocal gestures, an important precondition for ordered utterances and ultimately human speech, shares area 7A, rather than inferior parietal regions, as a common cortical module with hand motor sequencing. Interestingly, area 7A has previously also been shown to be involved in the observation of hand and non-hand actions. In combination with the literature, the present data thus suggest a distinction between area 44, which is specifically recruited for (cognitive aspects of) speech, and SPL area 7A for general aspects of motor sequencing. In sum, the study demonstrates a previously underspecified role of the SPL in the origins of speech, and may be discussed in the light of embodiment of speech and language in the motor system.

  2. An ensemble study of HyMeX IOP6 and IOP7a: sensitivity to physical and initial and boundary condition uncertainties

    Science.gov (United States)

    Hally, A.; Richard, E.; Ducrocq, V.

    2014-05-01

    The first Special Observation Period of the HyMeX campaign took place in the Mediterranean between September and November 2012 with the aim of better understanding the mechanisms which lead to heavy precipitation events (HPEs) in the region during the autumn months. Two such events, referred to as Intensive Observation Period 6 (IOP6) and Intensive Observation Period 7a (IOP7a), occurred respectively on 24 and 26 September over south-eastern France. IOP6 was characterised by moderate to weak low-level flow which led to heavy and concentrated convective rainfall over the plains near the coast, while IOP7a had strong low-level flow and consisted of a convective line over the mountainous regions further north and a band of stratiform rainfall further east. Firstly, an ensemble was constructed for each IOP using analyses from the AROME, AROME-WMED, ARPEGE and ECMWF operational models as initial (IC) and boundary (BC) conditions for the research model Meso-NH at a resolution of 2.5 km. A high level of model skill was seen for IOP7a, with a lower level of agreement with the observations for IOP6. Using the most accurate member of this ensemble as a CTRL simulation, three further ensembles were constructed in order to study uncertainties related to cloud physics and surface turbulence parameterisations. Perturbations were introduced by perturbing the time tendencies of the warm and cold microphysical and turbulence processes. An ensemble where all three sources of uncertainty were perturbed gave the greatest degree of dispersion in the surface rainfall for both IOPs. Comparing the level of dispersion to that of the ICBC ensemble demonstrated that when model skill is low (high) and low-level flow is weak to moderate (strong), the level of dispersion of the ICBC and physical perturbation ensembles is (is not) comparable. The level of sensitivity to these perturbations is thus concluded to be case dependent.

  3. An ensemble study of HyMeX IOP6 and IOP7a: sensitivity to physical and initial and boundary condition uncertainties

    Directory of Open Access Journals (Sweden)

    A. Hally

    2014-05-01

    Full Text Available The first Special Observation Period of the HyMeX campaign took place in the Mediterranean between September and November 2012 with the aim of better understanding the mechanisms which lead to heavy precipitation events (HPEs in the region during the autumn months. Two such events, referred to as Intensive Observation Period 6 (IOP6 and Intensive Observation Period 7a (IOP7a, occurred respectively on 24 and 26 September over south-eastern France. IOP6 was characterised by moderate to weak low-level flow which led to heavy and concentrated convective rainfall over the plains near the coast, while IOP7a had strong low-level flow and consisted of a convective line over the mountainous regions further north and a band of stratiform rainfall further east. Firstly, an ensemble was constructed for each IOP using analyses from the AROME, AROME-WMED, ARPEGE and ECMWF operational models as initial (IC and boundary (BC conditions for the research model Meso-NH at a resolution of 2.5 km. A high level of model skill was seen for IOP7a, with a lower level of agreement with the observations for IOP6. Using the most accurate member of this ensemble as a CTRL simulation, three further ensembles were constructed in order to study uncertainties related to cloud physics and surface turbulence parameterisations. Perturbations were introduced by perturbing the time tendencies of the warm and cold microphysical and turbulence processes. An ensemble where all three sources of uncertainty were perturbed gave the greatest degree of dispersion in the surface rainfall for both IOPs. Comparing the level of dispersion to that of the ICBC ensemble demonstrated that when model skill is low (high and low-level flow is weak to moderate (strong, the level of dispersion of the ICBC and physical perturbation ensembles is (is not comparable. The level of sensitivity to these perturbations is thus concluded to be case dependent.

  4. SLC3A1 and SLC7A9 Mutations in Autosomal Recessive or Dominant Canine Cystinuria: A New Classification System

    Science.gov (United States)

    Brons, A.-K.; Henthorn, P. S.; Raj, K.; Fitzgerald, C. A.; Liu, J.; Sewell, A. C.; Giger, U.

    2013-01-01

    Background Cystinuria, one of the first recognized inborn errors of metabolism, has been reported in many dog breeds. Hypothesis/Objectives To determine urinary cystine concentrations, inheritance and mutations in the SLC3A1 and SLC7A9 genes associated with cystinuria in 3 breeds. Animals Mixed and purebred Labrador Retrievers (n=6), Australian Cattle Dogs (6), Miniature Pinschers (4) and 1 mixed breed dog with cystine urolithiasis, relatives and control dogs. Methods Urinary cystinuria and aminoaciduria was assessed and exons of the SLC3A1 and SLC7A9 genes were sequenced from genomic DNA. Results In each breed, male and female dogs, independent of neuter status, were found to form calculi. A frameshift mutation in SLC3A1 (c.350delG) resulting in a premature stop codon was identified in autosomal-recessive (AR) cystinuria in Labrador Retrievers and mixed breed dogs. A 6 bp deletion (c.1095_1100del) removing 2 threonines in SLC3A1 was found in autosomal-dominant (AD) cystinuria with a more severe phenotype in homozygous than in heterozygous Australian Cattle Dogs. A missense mutation in SLC7A9 (c.964G>A) was discovered in AD cystinuria in Miniature Pinschers with only heterozygous affected dogs observed to date. Breed specific DNA tests were developed, but the prevalence of each mutation remains unknown. Conclusions and clinical importance These studies describe the first AD inheritance and the first putative SLC7A9 mutation to cause cystinuria in dogs and expand our understanding of this phenotypically and genetically heterogeneous disease, leading to a new classification system for canine cystinuria and better therapeutic management and genetic control in these breeds. PMID:24001348

  5. A Founder Mutation in MYO7A Underlies a Significant Proportion of Usher Syndrome in Indigenous South Africans: Implications for the African Diaspora.

    Science.gov (United States)

    Roberts, Lisa; George, Siddiqah; Greenberg, Jacquie; Ramesar, Raj S

    2015-10-01

    Research over the past 25 years at the University of Cape Town has led to the identification of causative mutations in 17% of the 1416 families in the Retinal Degenerative Diseases (RDD) biorepository in South Africa. A low rate of mutation detection has been observed in patients of indigenous African origin, hinting at novel genes and mutations in this population. Recently, however, data from our translational research program showed two unrelated indigenous African families with Usher syndrome (USH), with the same homozygous MYO7A mutation. Therefore, the extent to which this mutation contributes toward the disease burden in South Africa was investigated. Cohorts of unrelated indigenous South African probands with different RDD diagnoses were tested for the MYO7A c.6377delC mutation. Familial cosegregation analysis was performed for homozygous probands, clinical data were evaluated, and SNP haplotypes were analyzed. This homozygous MYO7A mutation underlies a remarkable 43% of indigenous African USH cases investigated in this study, the majority of which (60%) were diagnosed clinically with Type 2 USH. All homozygotes shared a common haplotype. This mutation does not appear to cause nonsyndromic vision loss. Of interest is the origin of this common mutation relevant to the Bantu population migration into southern Africa. Further investigation of the phenotype may elucidate the disease biology, and perhaps reveal a larger cohort with the same mutation, with which to assess the impact of environmental and genetic modifiers and evaluate therapeutic trials.

  6. A Conditioned Medium of Umbilical Cord Mesenchymal Stem Cells Overexpressing Wnt7a Promotes Wound Repair and Regeneration of Hair Follicles in Mice

    Directory of Open Access Journals (Sweden)

    Liang Dong

    2017-01-01

    Full Text Available Mesenchymal stem cells (MSCs can affect the microenvironment of a wound and thereby accelerate wound healing. Wnt proteins act as key mediators of skin development and participate in the formation of skin appendages such as hair. The mechanisms of action of MSCs and Wnt proteins on skin wounds are largely unknown. Here, we prepared a Wnt7a-containing conditioned medium (Wnt-CM from the supernatant of cultured human umbilical cord-MSCs (UC-MSCs overexpressing Wnt7a in order to examine the effects of this CM on cutaneous healing. Our results revealed that Wnt-CM can accelerate wound closure and induce regeneration of hair follicles. Meanwhile, Wnt-CM enhanced expression of extracellular matrix (ECM components and cell migration of fibroblasts but inhibited the migratory ability and expression of K6 and K16 in keratinocytes by enhancing expression of c-Myc. However, we found that the CM of fibroblasts treated with Wnt-CM (HFWnt-CM-CM can also promote wound repair and keratinocyte migration; but there was no increase in the number of hair follicles of regeneration. These data indicate that Wnt7a and UC-MSCs have synergistic effects: they can accelerate wound repair and induce hair regeneration via cellular communication in the wound microenvironment. Thus, this study opens up new avenues of research on the mechanisms underlying wound repair.

  7. A dual discrimination mode for improved specificity towards let-7a detection via a single-base mutated padlock probe-based exponential rolling circle amplification.

    Science.gov (United States)

    Li, Ruixue; Wang, Yinan; Wang, Pei; Lu, Jianzhong

    2017-07-07

    MicroRNA (miRNA) family members are usually highly homologous sequences, and it is a challenging task to selectively detect one miRNA member from other family members in medical diagnosis. Here, we describe the design of a dual discrimination mode for improved specificity towards let-7a detection over the other members of the let-7 family, in which an intentional base mutation was introduced into the padlock probe of an exponential rolling circle amplification. The inherent discrimination power of the padlock probe and the introduced base mutation constituted a dual discrimination mode, which provided enhanced specificity for let-7a, even over single-base mismatched family sequences. Furthermore, the assay enabled the quantitative detection of let-7a in a dynamic range from 200 amol to 100 fmol. This technique has also been successfully applied to real small RNA samples extracted from human lung cancers. For the first time, through intentionally mutating one base on the padlock probe of the exponential rolling circle amplification (RCA), we improved the discrimination capability for let-7 family members, while maintaining adequate sensitivity. Overall, this dual discrimination mode and the high amplification strategy have the potential to be extended to other short, but highly homologous, miRNA sequences. Copyright © 2017 John Wiley & Sons, Ltd.

  8. Altered localisation of the copper efflux transporters ATP7A and ATP7B associated with cisplatin resistance in human ovarian carcinoma cells

    Directory of Open Access Journals (Sweden)

    Reedijk Jan

    2008-06-01

    Full Text Available Abstract Background Copper homeostasis proteins ATP7A and ATP7B are assumed to be involved in the intracellular transport of cisplatin. The aim of the present study was to assess the relevance of sub cellular localisation of these transporters for acquired cisplatin resistance in vitro. For this purpose, localisation of ATP7A and ATP7B in A2780 human ovarian carcinoma cells and their cisplatin-resistant variant, A2780cis, was investigated. Methods Sub cellular localisation of ATP7A and ATP7B in sensitive and resistant cells was investigated using confocal fluorescence microscopy after immunohistochemical staining. Co-localisation experiments with a cisplatin analogue modified with a carboxyfluorescein-diacetate residue were performed. Cytotoxicity of the fluorescent cisplatin analogue in A2780 and A2780cis cells was determined using an MTT-based assay. The significance of differences was analysed using Student's t test or Mann-Whitney test as appropriate, p values of Results In the sensitive cells, both transporters are mainly localised in the trans-Golgi network, whereas they are sequestrated in more peripherally located vesicles in the resistant cells. Altered localisation of ATP7A and ATP7B in A2780cis cells is likely to be a consequence of major abnormalities in intracellular protein trafficking related to a reduced lysosomal compartment in this cell line. Changes in sub cellular localisation of ATP7A and ATP7B may facilitate sequestration of cisplatin in the vesicular structures of A2780cis cells, which may prevent drug binding to genomic DNA and thereby contribute to cisplatin resistance. Conclusion Our results indicate that alterations in sub cellular localisation of transport proteins may contribute to cisplatin resistance in vitro. Investigation of intracellular protein localisation in primary tumour cell cultures and tumour tissues may help to develop markers of clinically relevant cisplatin resistance. Detection of resistant tumours

  9. The NifA-RpoN regulon of Mesorhizobium loti strain R7A and its symbiotic activation by a novel LacI/GalR-family regulator.

    Directory of Open Access Journals (Sweden)

    John T Sullivan

    Full Text Available Mesorhizobium loti is the microsymbiont of Lotus species, including the model legume L. japonicus. M. loti differs from other rhizobia in that it contains two copies of the key nitrogen fixation regulatory gene nifA, nifA1 and nifA2, both of which are located on the symbiosis island ICEMlSym(R7A. M. loti R7A also contains two rpoN genes, rpoN1 located on the chromosome outside of ICEMlSym(R7A and rpoN2 that is located on ICEMlSym(R7A. The aims of the current work were to establish how nifA expression was activated in M. loti and to characterise the NifA-RpoN regulon. The nifA2 and rpoN2 genes were essential for nitrogen fixation whereas nifA1 and rpoN1 were dispensable. Expression of nifA2 was activated, possibly in response to an inositol derivative, by a novel regulator of the LacI/GalR family encoded by the fixV gene located upstream of nifA2. Other than the well-characterized nif/fix genes, most NifA2-regulated genes were not required for nitrogen fixation although they were strongly expressed in nodules. The NifA-regulated nifZ and fixU genes, along with nifQ which was not NifA-regulated, were required in M. loti for a fully effective symbiosis although they are not present in some other rhizobia. The NifA-regulated gene msi158 that encodes a porin was also required for a fully effective symbiosis. Several metabolic genes that lacked NifA-regulated promoters were strongly expressed in nodules in a NifA2-dependent manner but again mutants did not have an overt symbiotic phenotype. In summary, many genes encoded on ICEMlSym(R7A were strongly expressed in nodules but not free-living rhizobia, but were not essential for symbiotic nitrogen fixation. It seems likely that some of these genes have functional homologues elsewhere in the genome and that bacteroid metabolism may be sufficiently plastic to adapt to loss of certain enzymatic functions.

  10. The NifA-RpoN Regulon of Mesorhizobium loti Strain R7A and Its Symbiotic Activation by a Novel LacI/GalR-Family Regulator

    Science.gov (United States)

    Sullivan, John T.; Brown, Steven D.; Ronson, Clive W.

    2013-01-01

    Mesorhizobium loti is the microsymbiont of Lotus species, including the model legume L. japonicus. M. loti differs from other rhizobia in that it contains two copies of the key nitrogen fixation regulatory gene nifA, nifA1 and nifA2, both of which are located on the symbiosis island ICEMlSymR7A. M. loti R7A also contains two rpoN genes, rpoN1 located on the chromosome outside of ICEMlSymR7A and rpoN2 that is located on ICEMlSymR7A. The aims of the current work were to establish how nifA expression was activated in M. loti and to characterise the NifA-RpoN regulon. The nifA2 and rpoN2 genes were essential for nitrogen fixation whereas nifA1 and rpoN1 were dispensable. Expression of nifA2 was activated, possibly in response to an inositol derivative, by a novel regulator of the LacI/GalR family encoded by the fixV gene located upstream of nifA2. Other than the well-characterized nif/fix genes, most NifA2-regulated genes were not required for nitrogen fixation although they were strongly expressed in nodules. The NifA-regulated nifZ and fixU genes, along with nifQ which was not NifA-regulated, were required in M. loti for a fully effective symbiosis although they are not present in some other rhizobia. The NifA-regulated gene msi158 that encodes a porin was also required for a fully effective symbiosis. Several metabolic genes that lacked NifA-regulated promoters were strongly expressed in nodules in a NifA2-dependent manner but again mutants did not have an overt symbiotic phenotype. In summary, many genes encoded on ICEMlSymR7A were strongly expressed in nodules but not free-living rhizobia, but were not essential for symbiotic nitrogen fixation. It seems likely that some of these genes have functional homologues elsewhere in the genome and that bacteroid metabolism may be sufficiently plastic to adapt to loss of certain enzymatic functions. PMID:23308282

  11. The NifA-RpoN Regulon of Mesorhizobium loti Strain R7A and Its Symbiotic Activation by a Novel LacI/GalR-Family Regulator

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, John T.; Brown, Steven D.; Ronson, Clive W.; de Crécy-Lagard, Valerie

    2013-01-07

    Mesorhizobium loti is the microsymbiont of Lotus species, including the model legume L. japonicus. M. loti differs from other rhizobia in that it contains two copies of the key nitrogen fixation regulatory gene nifA, nifA1 and nifA2, both of which are located on the symbiosis island ICEMlSymR7A. M. loti R7A also contains two rpoN genes, rpoN1 located on the chromosome outside of ICEMlSymR7A and rpoN2 that is located on ICEMlSymR7A. The aims of the current work were to establish how nifA expression was activated in M. loti and to characterise the NifA-RpoN regulon. The nifA2 and rpoN2 genes were essential for nitrogen fixation whereas nifA1 and rpoN1 were dispensable. Expression of nifA2 was activated, possibly in response to an inositol derivative, by a novel regulator of the LacI/GalR family encoded by the fixV gene located upstream of nifA2. Other than the well-characterized nif/fix genes, most NifA2-regulated genes were not required for nitrogen fixation although they were strongly expressed in nodules. The NifA-regulated nifZ and fixU genes, along with nifQ which was not NifA-regulated, were required in M. loti for a fully effective symbiosis although they are not present in some other rhizobia. The NifA-regulated gene msi158 that encodes a porin was also required for a fully effective symbiosis. Several metabolic genes that lacked NifA-regulated promoters were strongly expressed in nodules in a NifA2-dependent manner but again mutants did not have an overt symbiotic phenotype. In summary, many genes encoded on ICEMlSymR7A were strongly expressed in nodules but not free-living rhizobia, but were not essential for symbiotic nitrogen fixation. It seems likely that some of these genes have functional homologues elsewhere in the genome and that bacteroid metabolism may be sufficiently plastic to adapt to loss of certain enzymatic functions.

  12. Java 7 A Beginner's Tutorial

    CERN Document Server

    Kurniawan, Budi

    2011-01-01

    A Books24x7's TOP 10 title for 4 consecutive years! Java is an easy language to learn. However, you need to master more than the language syntax to be a professional Java programmer. For one, object-oriented programming (OOP) skill is key to developing robust and effective Java applications. In addition, knowing how to use the vast collection of libraries makes development more rapid. This book introduces you to important programming concepts and teaches how to use the Java core libraries. It is a guide to building real-world applications, both desktop and Web-based. The coverage is the

  13. High glucose derived endothelial microparticles increase active caspase-3 and reduce microRNA-Let-7a expression in endothelial cells.

    Science.gov (United States)

    Bammert, Tyler D; Hijmans, Jamie G; Reiakvam, Whitney R; Levy, Ma'ayan V; Brewster, Lillian M; Goldthwaite, Zoe A; Greiner, Jared J; Stockelman, Kelly A; DeSouza, Christopher A

    2017-11-18

    The experimental aim of this study was to determine the effects of high glucose-induced endothelial microparticles (EMPs) on endothelial cell susceptibility to apoptosis. Human umbilical vein endothelial cells (HUVECs) were cultured (3rd passage) and plated in 6-well plates at a density of 5.0 × 10 5  cells/condition. Cells were incubated with media containing 25 mM d-glucose (concentration representing a diabetic glycemic state) or 5 mM d-glucose (normoglycemic condition) for 48 h to generate EMPs. EMP identification (CD144 + expression) and concentration was determined by flow cytometry. HUVECs (3 × 10 6  cells/condition) were treated with EMPs generated from either the normal or high glucose conditions for 24 h. Intracellular concentration of active caspase-3 was determined by enzyme immunoassay. Cellular expression of miR-Let7a, an anti-apoptotic microRNA, was determined by RT-PCR using the ΔΔCT normalized to RNU6. High glucose-derived EMPs significantly increased both basal (1.5 ± 0.1 vs 1.0 ± 0.1 ng/mL) and staurosporine-stimulated (2.2 ± 0.2 vs 1.4 ± 0.1 ng/mL) active caspase-3 compared with normal glucose EMPs. Additionally, the expression of miR-Let-7a was markedly reduced (∼140%) by high glucose EMPs (0.43 ± 0.17 fold vs control). These results demonstrate that hyperglycemic-induced EMPs increase endothelial cell active caspase-3. This apoptotic effect may be mediated, at least in part, by a reduction in miR-Let-7a expression. Copyright © 2017 Elsevier Inc. All rights reserved.

  14. PCR-SSCP analysis of the type VII collagen gene (COL7A1): Detection of a point mutation in five patients

    Energy Technology Data Exchange (ETDEWEB)

    Dunnil, M.G.S.; Richards, A.J.; Pope, F.M. [and others

    1994-09-01

    Type VII collagen is the major component of anchoring fibrils, structures which extend below the lamina densa of the epidermal basement membrane in stratified squamous epithelia. Genetic linkage studies and two mutation reports have implicated the type VII collagen gene, COL7A1, in dystrophic epidermolysis bullosa (DEB), an inherited disorder characterized by blistering and scarring of the skin and mucous membranes after minor trauma. We have used PCR-SSCP of genomic DNA to screen exons of COL7A1 for mutations in recessive DEB patients. Band mobility shifts were detected in exon FN4-B in five patients. Sequencing revealed a C to T transition changing a codon for arginine into a stop codon, homozygous in two related patients and heterozygous in the others. We are currently searching for a second mutation in these three heterozygous patients who are presumably genetic compounds. Screening for an informative Xho I restriction site altered by the mutation showed parental heterozygosity but no evidence for the mutation in 50 normal chromosomes. Segregation of COL7A1 markers in these patients suggests that the mutation has arisen independently in at least two of our families. The premature stop mutation in the 5{prime} end of the gene predicts a severely shortened collagen VII molecule. The homozygote formation of anchoring fibrils would be impaired providing an explanation at the molecular level for the ultrastructural findings of reduced numbers or absence of anchoring fibrils in this disease. In conclusion, these data strongly suggest that this novel premature stop mutation is the cause of DEB in the homozygotes and contributes to the disease in the other patients. The important role of anchoring fibrils in dermal-epidermal adhesion is also underlined.

  15. Impact of Different Standard Type A7A Drum Closure-Ring Practices on Gasket Contraction and Bolt Closure Distance– 15621

    Energy Technology Data Exchange (ETDEWEB)

    Ketusky, Edward [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Blanton, Paul [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Bobbitt, John H. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2015-03-11

    The Department of Energy, the Savannah River National Laboratory, several manufacturers of specification drums, and the United States Department of Transportation (DOT) are collaborating in the development of a guidance document for DOE contractors and vendors who wish to qualify containers to DOT 7A Type A requirements. Currently, the effort is focused on DOT 7A Type A 208-liter (55-gallons) drums with a standard 12-gauge bolted closure ring. The U.S. requirements, contained in Title 49, Part 178.350 “Specification 7A; general packaging, Type A specifies a competent authority review of the packaging is not required for the transport of (Class 7) radioactive material containing less than Type A quantities of radioactive material. For Type AF drums, a 4 ft. regulatory free drop must be performed, such that the drum “suffers maximum damage.” Although the actual orientation is not defined by the specification, recent studies suggest that maximum damage would result from a shallow angle top impact, where kinetic energy is transferred to the lid, ultimately causing heavy damage to the lid, or even worse, causing the lid to come off. Since each vendor develops closure recommendations/procedures for the drums they manufacture, key parameters applied to drums during closing vary based on vendor. As part of the initial phase of the collaboration, the impact of the closure variants on the ability of the drum to suffer maximum damage is investigated. Specifically, closure testing is performed varying: 1) the amount of torque applied to the closure ring bolt; and, 2) stress relief protocol, including: a) weight of hammer; and, b) orientation that the hammer hits the closure ring. After closure, the amount of drum lid gasket contraction and the distance that the closure bolt moves through the closure ring is measured.

  16. Estudio comparativo de habilidades de precálculo en niños de 7 años de instituciones educativas estatales y particulares, Lima 2012.

    OpenAIRE

    Quiroz Ramírez, Katia Lucia; Saavedra Sánchez, Violeta Patricia; Valencia Salinas, María Claudia

    2013-01-01

    El presente estudio tuvo como principal propósito, establecer la comparación entre las habilidades de precálculo de los niños de 7 años, de instituciones particulares y estatales de Lima. Para ello se consideró el instrumento de evaluación del precálculo de Neva Milicic y Schmidt el cual posee 10 sub test los cuales son Conceptos Básicos, Percepción visual, Correspondencia termino a término, Números ordinales, Reproducción de figuras y secuencia, Reconocimiento de Figuras Ge...

  17. Relación de la lateralidad con los procesos de escritura en niños de 6 y 7 años de edad

    OpenAIRE

    Sanabria-Táutiva, Nancy Graciela

    2016-01-01

    Al abordar la escritura los estudiantes deben ir adquiriendo unas conductas motrices manuales básicas, de ahí que es de gran importancia el adecuado desarrollo de la lateralidad para evitar dificultades en el proceso de escritura. El objetivo del trabajo fue establecer la relación existente entre el desarrollo de la lateralidad y el proceso de escrituras en 30 estudiantes entre 6 y 7 años de edad, de educación básica primaria en la institución Francisco José de Caldas, sede rural Bermejal ...

  18. Pensamiento lógico matemático en alumnos de 6-7 años en tareas de seriaciones

    OpenAIRE

    Morales, Rodolfo

    2013-01-01

    El objetivo general de este estudio es caracterizar y describir el pensamiento lógico matemático de alumnos de 6-7 años en tareas de seriaciones. Presentamos un estudio de caso donde participaron 3 alumnas de dichas edades. Las tareas propuestas aluden a tareas de seriaciones de atributos cualitativos con uno, dos o tres elementos en el núcleo. Como primer resultado, presentamos una clasificación de tipos de seriaciones que las alumnas de estos niveles deberían ser capaces de abordar. Entre l...

  19. Evidências de validade convergente do SON-R 2½-7[a] com o WPPSI-III e WISC-III Evidences of convergent validity of SON-R 2½-7[a] with WPPSI-III and WISC-III

    Directory of Open Access Journals (Sweden)

    Camila Akemi Karino

    2011-01-01

    Full Text Available Um processo de validação adequado é fundamental para assegurar uma interpretação correta dos resultados de um teste. Assim, este estudo investigou a validade convergente do teste não-verbal de inteligência SON-R 2½-7[a] com o WPPSI-III e o WISC-III. O teste é a versão abreviada do SON-R 2½-7, de origem holandesa, normatizado e validado em vários países da Europa. No total, 109 crianças de três estados brasileiros participaram do estudo. A correlação entre o SON-R 2½-7[a] e o WPPSI-III foi igual a 0,75 e com o WISC-III foi de 0,69. Esses coeficientes de validade são muito semelhantes aos encontrados em estudos feitos com o SON-R 2½-7 em outros países. Conclui-se que os resultados indicam uma validade convergente satisfatória do teste SON-R 2½-7[a].An adequate validation process is fundamental to ensure sound interpretations of test results. Thus, this study aimed to investigate the convergent validity of the SON-R 2½-7[a] with the WPPSI-III and the WISC-III. The test is an abridged edition of the SON-R 2½-7, a Dutch non-verbal intelligence test, with normatization and validation studies done in several European countries. A total of 109 children from three Brazilian states participated in the study. The correlations of the SON-R 2½-7[a] with the WPPSI-III and with the WISC-III were .75 and .69, respectively. The validation coefficients encountered are very similar to the ones found in studies with the SON-R 2½-7 in other countries. The results imply a satisfactory convergent validity of the SON-R 2½-7[a].

  20. A CGG-repeat expansion mutation in ZNF713 causes FRA7A: association with autistic spectrum disorder in two families.

    Science.gov (United States)

    Metsu, Sofie; Rainger, Jacqueline K; Debacker, Kim; Bernhard, Birgitta; Rooms, Liesbeth; Grafodatskaya, Daria; Weksberg, Rosanna; Fombonne, Eric; Taylor, Martin S; Scherer, Stephen W; Kooy, R Frank; FitzPatrick, David R

    2014-11-01

    We report de novo occurrence of the 7p11.2 folate-sensitive fragile site FRA7A in a male with an autistic spectrum disorder (ASD) due to a CGG-repeat expansion mutation (∼450 repeats) in a 5' intron of ZNF713. This expanded allele showed hypermethylation of the adjacent CpG island with reduced ZNF713 expression observed in a proband-derived lymphoblastoid cell line (LCL). His unaffected mother carried an unmethylated premutation (85 repeats). This CGG-repeat showed length polymorphism in control samples (five to 22 repeats). In a second unrelated family, three siblings with ASD and their unaffected father were found to carry FRA7A premutations, which were partially or mosaically methylated. In one of the affected siblings, mitotic instability of the premutation was observed. ZNF713 expression in LCLs in this family was increased in three of these four premutation carriers. A firm link cannot yet be established between ASD and the repeat expansion mutation but plausible pathogenic mechanisms are discussed. © 2014 WILEY PERIODICALS, INC.

  1. Targeted next generation sequencing identified a novel mutation in MYO7A causing Usher syndrome type 1 in an Iranian consanguineous pedigree.

    Science.gov (United States)

    Kooshavar, Daniz; Razipour, Masoumeh; Movasat, Morteza; Keramatipour, Mohammad

    2018-01-01

    Usher syndrome (USH) is characterized by congenital hearing loss and retinitis pigmentosa (RP) with a later onset. It is an autosomal recessive trait with clinical and genetic heterogeneity which makes the molecular diagnosis much difficult. In this study, we introduce a pedigree with two affected members with USH type 1 and represent a cost and time effective approach for genetic diagnosis of USH as a genetically heterogeneous disorder. Target region capture in the genes of interest, followed by next generation sequencing (NGS) was used to determine the causative mutations in one of the probands. Then segregation analysis in the pedigree was conducted using PCR-Sanger sequencing. Targeted NGS detected a novel homozygous nonsense variant c.4513G > T (p.Glu1505Ter) in MYO7A. The variant is segregating in the pedigree with an autosomal recessive pattern. In this study, a novel stop gained variant c.4513G > T (p.Glu1505Ter) in MYO7A was found in an Iranian pedigree with two affected members with USH type 1. Bioinformatic as well as pedigree segregation analyses were in line with pathogenic nature of this variant. Targeted NGS panel was showed to be an efficient method for mutation detection in hereditary disorders with locus heterogeneity. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. Funcionamento diferencial dos itens do teste não-verbal de inteligência SON-R 2½-7[a

    Directory of Open Access Journals (Sweden)

    Camila Akemi Karino

    Full Text Available A presença de uma quantidade considerável de itens com funcionamento diferencial (DIF pode tornar um teste menos válido. Assim, este estudo investigou a existência de DIF no teste de inteligência SON-R 2½-7[a]. O teste é a versão abreviada do SON-R 2½-7, normatizado e validado em vários países da Europa. Os dados de 1.200 crianças da normatização brasileira foram utilizados para identificar a presença de DIF em relação à gênero e região, usando o método da TRI. Os resultados indicaram que, de um total de 60 itens, 5 itens apresentaram DIF entre os sexos e 13 itens apresentaram DIF entre as regiões. Conclui-se que há adequabilidade da maioria dos itens, o que viabiliza o uso do SON-R 2½-7[a] em contexto nacional.

  3. Delphinidin, a specific inhibitor of histone acetyltransferase, suppresses inflammatory signaling via prevention of NF-{kappa}B acetylation in fibroblast-like synoviocyte MH7A cells

    Energy Technology Data Exchange (ETDEWEB)

    Seong, Ah-Reum; Yoo, Jung-Yoon; Choi, KyungChul [Department of Biochemistry and Molecular Biology, Center for Chronic Metabolic Disease Research, College of Medicine, Yonsei University, Seoul (Korea, Republic of); Lee, Mee-Hee [Department of Biochemistry and Molecular Biology, Center for Chronic Metabolic Disease Research, College of Medicine, Yonsei University, Seoul (Korea, Republic of); Brain Korea 21 Project for Medical Sciences, Yonsei University, College of Medicine, Seoul (Korea, Republic of); Lee, Yoo-Hyun [Department of Food Science and Nutrition, The University of Suwon, Kyunggi-do (Korea, Republic of); Lee, Jeongmin [Department of Medical Nutrition, Kyung Hee University, Kyunggi-do (Korea, Republic of); Jun, Woojin [Department of Food and Nutrition, Chonnam National University, Gwangju (Korea, Republic of); Kim, Sunoh, E-mail: sunoh@korea.ac.kr [Jeollanamdo Institute of Natural Resources Research, Jeonnam (Korea, Republic of); Yoon, Ho-Geun, E-mail: yhgeun@yuhs.ac [Department of Biochemistry and Molecular Biology, Center for Chronic Metabolic Disease Research, College of Medicine, Yonsei University, Seoul (Korea, Republic of); Brain Korea 21 Project for Medical Sciences, Yonsei University, College of Medicine, Seoul (Korea, Republic of)

    2011-07-08

    Highlights: {yields} Delphinidin is a novel inhibitor of p300/CBP histone acetyltransferase. {yields} Delphinidin prevents the hyperacetylation of p65 by inhibiting the HAT activity of p300/CBP. {yields} Delphinidin efficiently suppresses the expression of inflammatory cytokines in MH7A cells via hypoacetylation of NF-{kappa}B. {yields} Delphinidin inhibits cytokine release in the Jurkat T lymphocyte cell line. -- Abstract: Histone acetyltransferase (HAT) inhibitors (HATi) isolated from dietary compounds have been shown to suppress inflammatory signaling, which contributes to rheumatoid arthritis. Here, we identified a novel HATi in Punica granatum L. known as delphinidin (DP). DP did not affect the activity of other epigenetic enzymes (histone deacetylase, histone methyltransferase, or sirtuin1). DP specifically inhibited the HAT activities of p300/CBP. It also inhibited p65 acetylation in MH7A cells, a human rheumatoid arthritis synovial cell line. DP-induced hypoacetylation was accompanied by cytosolic accumulation of p65 and nuclear localization of IKB{alpha}. Accordingly, DP treatment inhibited TNF{alpha}-stimulated increases in NF-{kappa}B function and expression of NF-{kappa}B target genes in these cells. Importantly, DP suppressed lipopolysaccharide-induced pro-inflammatory cytokine expression in Jurkat T lymphocytes, demonstrating that HATi efficiently suppresses cytokine-mediated immune responses. Together, these results show that the HATi activity of DP counters anti-inflammatory signaling by blocking p65 acetylation and that this compound may be useful in preventing inflammatory arthritis.

  4. Adaptação da Pavlovian Temperament Survey para a realidade brasileira-versão 7 a 14 anos

    Directory of Open Access Journals (Sweden)

    Raquel Souza Lobo Guzzo

    Full Text Available Este estudo faz parte de um processo que objetiva adaptar à realidade brasileira uma escala para avaliação do temperamento de crianças e adolescentes. Optou-se pela Pavlovian Temperament Survey - PTS - versão 7 a 14 anos, construída na Alemanha e destinada a avaliar a expressão comportamental das propriedades do Sistema Nervoso Central, conforme entendido por Pavlov. A PTS é composta por 252 itens e avalia três dimensões de temperamento: Força de Excitação, Força de Inibição e Mobilidade. Sua adaptação envolveu o processo de tradução, retrotradução e comparação entre a versão original e a que foi traduzida para o português e retrotraduzida para o alemão. Foram realizadas sucessivas análises e revisões até que os itens do instrumento estivessem adequados e apresentassem uma linguagem clara, assegurando sua compreensão pelos pais ou responsáveis. Em estudos preliminares, a PTS 7 a 14 anos obteve índices satisfatórios de consistência interna e indicadores favoráveis de validade.

  5. Identification of essential residues for binding and activation in the human 5-HT7(a receptor by molecular modeling and site-directed mutagenesis

    Directory of Open Access Journals (Sweden)

    Agata Antonina Rita eImpellizzeri

    2015-05-01

    Full Text Available The human 5-HT7 receptor is expressed in both the central nervous system and peripheral tissues and is a potential drug target in behavioral and psychiatric disorders.We examined molecular determinants of ligand binding and G protein activation by the human 5-HT7(a receptor. The role of several key residues in the 7th transmembrane domain and helix 8 were elucidated combining in silico and experimental mutagenesis. Several single and two double point mutations of the 5-HT7(a wild type receptor were made (W7.33V, E7.35T, E7.35R, E7.35D, E7.35A, R7.36V, Y7.43A, Y7.43F, Y7.43T, R8.52D, D8.53K; E7.35T-R7.36V, R8.52D-D8.53K, and their effects upon ligand binding were assessed by radioligand binding using a potent agonist (5-CT and a potent antagonist (SB269970. In addition, the ability of the mutated 5-HT7(a receptors to activate G protein after 5-HT-stimulation was determined through activation of adenylyl cyclase. In silico investigation on mutated receptors substantiated the predicted importance of TM7 and showed critical roles of residues E7.35, W7.33, R7.36 and Y7.43 in agonist and antagonist binding and conformational changes of receptor structure affecting adenylyl cyclase activation. Experimental data showed that mutants E7.35T and E7.35R were incapable of ligand binding and adenylyl cyclase activation, consistent with a requirement for a negatively charged residue at this position. The mutant R8.52D was unable to activate adenylyl cyclase, despite unaffected ligand binding, consistent with the R8.52 residue playing an important role in the receptor-G protein interface. The mutants Y7.43A and Y7.43T displayed reduced agonist binding and AC agonist potency, not seen in Y7.43F, consistent with a requirement for an aromatic residue at this position. Knowledge of the molecular interactions important in h5-HT7 receptor ligand binding and G protein activation will aid the design of selective h5-HT7 receptor ligands for potential pharmacological use.

  6. Investigation of iron metabolism in mice expressing a mutant Menke's copper transporting ATPase (Atp7a protein with diminished activity (Brindled; Mo (Br (/y .

    Directory of Open Access Journals (Sweden)

    Sukru Gulec

    Full Text Available During iron deficiency, perturbations in copper homeostasis have frequently been documented. Previous studies in iron-deprived rats demonstrated that enterocyte and hepatic copper levels increase and a copper transporter (the Menkes Copper ATPase; Atp7a is induced in the duodenal epithelium in parallel to iron transport-related genes (e.g. Dmt1, Dcytb, Fpn1. Moreover, two ferroxidase proteins involved in iron homeostasis, hephaestin expressed in enterocytes and ceruloplasmin, produced and secreted into blood by the liver, are copper-dependent enzymes. We thus aimed to test the hypothesis that Atp7a function is important for the copper-related compensatory response of the intestinal epithelium to iron deficiency. Accordingly, iron homeostasis was studied for the first time in mice expressing a mutant Atp7a protein with minimal activity (Brindled [Mo (Br (/y ]. Mutant mice were rescued by perinatal copper injections, and, after a 7-8 week recovery period, were deprived of dietary iron for 3 weeks (along with WT littermates. Adult Mo (Br (/y mice displayed copper-deficiency anemia but had normal iron status; in contrast, iron-deprived Mo (Br (/y mice were iron deficient and more severely anemic with partial amelioration of the copper-deficient phenotype. Intestinal iron absorption in both genotypes (WT and Mo (Br (/y increased ∼3-fold when mice consumed a low-iron diet and ∼6-fold when mice were concurrently bled. WT mice exhibited no alterations in copper homeostasis in response to iron deprivation or phlebotomy. Conversely, upregulation of iron absorption was associated with increased enterocyte and liver copper levels and serum ferroxidase (ceruloplasmin activity in Mo (Br (/y mice, typifying the response to iron deprivation in many mammalian species. We thus speculate that a copper threshold exists that is necessary to allow appropriate regulate of iron absorption. In summary, Mo (Br (/y mice were able to adequately regulate iron absorption

  7. Effect of Post Weld Heat Treatment on Microstructure and Mechanical Properties of Submerged Friction Stir Welded 7A04 Aluminum Alloy

    Directory of Open Access Journals (Sweden)

    HAO Ya-xin

    2016-06-01

    Full Text Available 7A04 aluminum alloy plate was jointed by submerged friction stir welding(SFSW, and welded joints were treated (Post Weld Heat Treatment, PWHT, and the effect of post weld heat treatment on the microstructure and mechanical properties in SFSW was investigated. The results show that PWHT joints exhibit dispersively distributed fine precipitates phase morphology, are significantly superior than the feature of the small amount of precipitates with dispersed distribution in SFSW joints. Compared with SFSW joints, the mechanical properties of joints are improved significantly by PWHT. The average hardness of the weld joints nugget zone is increased by 39.7HV, and the tensile strength is increased by 67MPa, reaches 96.1% of the base material, strain hardening capacity of the joints is also enhanced, the tensile fracture exhibits mixed fracture feature of microporous polymerization and cleavage.

  8. Characterization of Vadose Zone Sediment: Borehole C3103 Located in the 216-B-7A Crib Near the B Tank Farm

    Energy Technology Data Exchange (ETDEWEB)

    Lindenmeier, Clark W.; Serne, R JEFFREY.; Bjornstad, Bruce N.; Last, George V.; Lanigan, David C.; Lindberg, Michael J.; Clayton, Ray E.; Legore, Virginia L.; Kutnyakov, Igor V.; Baum, Steven R.; Geiszler, Keith N.; Valenta, Michelle M.; Vickerman, Tanya S.

    2002-12-01

    This report summarizes data collected from samples in borehole C3103. Borehole C3103 was completed to further characterize the nature and extent of vadose zone contaminants supplied by intentional liquid discharges into the crib 216-B7A/7B between 1954 and 1967. These cribs received dilute waste streams from the bismuth phosphate fuel reprocessing program in the 1950's and decontamination waste in the 1960's. Elevated concentrations of several constituents were primarily measured at different depth intervals. The primary radionuclides present in this borehole are cesium-137 and uranium near the top of the borehole. Chemical characteristics attributed to wastewater-soil interaction at different locations within this zone are elevated pH, sodium, fluoride, carbonate nitrate, and sulphate

  9. Effect of oxidation time on the microstructure and properties of ceramic coatings prepared by microarc oxidation on 7A04 superhard aluminum alloy

    Science.gov (United States)

    Xiao, Feng; Chen, Hui; Miao, Jingguo; Du, Juan

    2017-07-01

    Under the sodium aluminates’ system, microarc oxidation treatment was conducted on the superhard aluminum alloy 7A04 for different times. The microstructure of microarc oxidation ceramic layer was investigated by using scanning electron microscopy (SEM) and X-ray diffraction (XRD). The influences of different oxidation times on the adhesion strength of ceramic layer and substrate, the morphology of surface and cross-section, the phase composition and the electrochemical properties were studied. The results indicated that the connection of the coating and substrate appears to be metallurgical bonding and dense ceramic layer, and the surface is in a “volcanic vent” morphology, which is composed of γ-Al2O3 and little α-Al2O3. The corrosion resistance of ceramic layer is improved significantly in contrast with that of the substrate.

  10. Efectos del uso de videojuegos en niños de 7 a 12 años. Una aproximación mediante encuesta

    Directory of Open Access Journals (Sweden)

    Marina Ferrer López

    2012-04-01

    Full Text Available Este artículo da a conocer los primeros resultados de la encuesta realizada entre niños de 7 a 12 años de de la Comunidad de Madrid sobre el uso de videojuegos. Las niñas y los niños estudiados usan masivamente los videojuegos. Los padres, en contra de lo recomendado por los especialistas en Educación, apenas juegan con los menores. Son los niños los que seleccionan los videojuegos que hay en casa. Y en torno al 50% de los niños entre 11 y 12 años conocen un juego de contenido adulto polémico como el GTA San Andreas.

  11. Structure of a putative trans-editing enzyme for prolyl-tRNA synthetase from Aeropyrum pernix K1 at 1.7 A resolution.

    Science.gov (United States)

    Murayama, Kazutaka; Kato-Murayama, Miyuki; Katsura, Kazushige; Uchikubo-Kamo, Tomomi; Yamaguchi-Hirafuji, Machiko; Kawazoe, Masahito; Akasaka, Ryogo; Hanawa-Suetsugu, Kyoko; Hori-Takemoto, Chie; Terada, Takaho; Shirouzu, Mikako; Yokoyama, Shigeyuki

    2005-01-01

    The crystal structure of APE2540, the putative trans-editing enzyme ProX from Aeropyrum pernix K1, was determined in a high-throughput manner. The crystal belongs to the monoclinic space group P2(1), with unit-cell parameters a = 47.4, b = 58.9, c = 53.6 A, beta = 106.8 degrees. The structure was solved by the multiwavelength anomalous dispersion method at 1.7 A and refined to an R factor of 16.8% (Rfree = 20.5%). The crystal structure includes two protein molecules in the asymmetric unit. Each monomer consists of eight beta-strands and seven alpha-helices. A structure-homology search revealed similarity between the trans-editing enzyme YbaK (or cysteinyl-tRNAPro deacylase) from Haemophilus influenzae (HI1434; 22% sequence identity) and putative ProX proteins from Caulobacter crescentus (16%) and Agrobacterium tumefaciens (21%).

  12. Predictores cognitivos de la capacidad de planificación en niños de 6 y 7 años de edad

    Directory of Open Access Journals (Sweden)

    Florencia Stelzer

    2016-02-01

    Full Text Available La planificación implica la habilidad para identificar y organizar secuencias de acciones con el fin de alcanzar metas específicas. En la literatura se observan resultados dispares respecto de cuáles son los mejores predictores de esta capacidad en niños. Nuestro objetivo en este trabajo fue identificar en qué medida la voluntad de control, el control inhibitorio perceptual, la memoria de trabajo y la inteligencia fluida explican tal capacidad en niños que inician la educación primaria básica. La muestra estuvo conformada por 289 participantes de entre 6 y 7 años de edad. Los resultados indicaron que únicamente la inteligencia fluida y la memoria de trabajo se asociaban y explicaban la capacidad de planificar. Discutimos las implicaciones de estos resultados para el diseño de futuras investigaciones.

  13. Predictores cognitivos de la capacidad de planificación en niños de 6 y 7 años de edad

    Directory of Open Access Journals (Sweden)

    Florencia Stelzer

    2016-01-01

    Full Text Available La planificación implica la habilidad para identificar y organizar secuencias de acciones con el fin de alcanzar metas específicas. En la literatura se observan resultados dispares respecto de cuáles son los mejores predictores de esta capacidad en niños. Nuestro objetivo en este trabajo fue identificar en qué medida la voluntad de control, el control inhibitorio perceptual, la memoria de trabajo y la inteligencia fluida explican tal capacidad en niños que inician la educación primaria básica. La muestra estuvo conformada por 289 participantes de entre 6 y 7 años de edad. Los resultados indicaron que únicamente la inteligencia fluida y la memoria de trabajo se asociaban y explicaban la capacidad de planificar. Discutimos las implicaciones de estos resultados para el diseño de futuras investigaciones.

  14. A high resolution neutron scattering study of Tb2Mo2O7: A geometrically frustrated and disorder-free spin glass

    Energy Technology Data Exchange (ETDEWEB)

    Ehlers, Georg [ORNL; Gardner, Jason [Indiana University; Qiu, Y. [National Institute of Standards and Technology (NIST); Rule, K [Helmholtz-Zentrum Berlin; Greedan, John E [McMaster University; Stewart, John Ross [ISIS Facility, Rutherford Appleton Laboratory; Fouquet, Peter [Institut Laue-Langevin (ILL); Cornelius, A. L. [University of Nevada, Las Vegas; Adriano, Cris [ORNL; Pagliuso, P G [Instituto de Fisica Gleb Wataghin, Unicamp, Brazil

    2010-01-01

    Neutron scattering, muon spin relaxation, and de susceptibility studies have been carried out on polycrystalline Tb{sub 2}Ti{sub 2}O{sub 7}, a pyrochlore antiferromagnet in which the Tb{sup 3+} moments reside on a network of corner-sharing tetrahedra. Unlike other geometrically frustrated systems, Tb{sub 2}Ti{sub 2}O{sub 7} remains paramagnetic down to {approx}0.07 K, rather than ordering into a conventional Neel or spin-glass-like state, despite the fact that short-range antiferromagnetic correlations (AFC) develop at {approx}50 K. At the first AFC wave vector, its low-lying, relatively flat magnetic excitation spectrum softens partially below 30 K.

  15. Generación y continuación de patrones por dos alumnas de 6-7 años en tareas de seriaciones

    Directory of Open Access Journals (Sweden)

    Rodolfo Morales

    2017-07-01

    Full Text Available Presentamos un estudio de casos a través de entrevistas semiestructuradas para describir la generación de patrones y la continuación de seriaciones cualitativas que realizan dos alumnas de 6-7 años. Describimos el trabajo realizado por las alumnas en diez tareas de patrones lógicos construidas de acuerdo a tres criterios: (a atributos, (b número de elementos en el núcleo y (c variación de atributos entre elementos. Los resultados evidencian que las alumnas generan diferentes tipos de patrones y continúan diferentes tipos de seriaciones (reiterativas y no reiterativas, con distinto número de elementos en el núcleo.

  16. Electromagnetic dissociation of 3.7 A GeV sup 2 sup 4 Mg and sup 2 sup 8 Si projectiles in nuclear emulsion

    CERN Document Server

    Jilany, M A

    2002-01-01

    This paper presents exhaustively the results of the electromagnetic dissociation of 3.7 A GeV sup 2 sup 4 Mg and sup 2 sup 8 Si projectiles in nuclear emulsion. The reaction mechanism involved in the electromagnetic collisions and the virtual photon spectra are discussed in the framework of the classical model of Weizsaecker and Williams. The number of electromagnetic interactions, the mean free paths, the production cross sections, the charge spectra of projectile fragments and the decay modes of the visible channels are analyzed and their dependences on the projectile charge and the incident energy are investigated. The present values are obtained in systematic agreement with those found experimentally and theoretically. The emission of a single hydrogen isotope is the dominant process in all samples and shows a similar energy spectrum. The relative rate as a function of the threshold energy for various reaction channels are parameterized in terms of an exponential function.

  17. Investigation of an "alternate water supply system" in enzymatic hydrolysis in the processive endocellulase Cel7A from Rasamsonia emersonii by molecular dynamics simulation.

    Science.gov (United States)

    Sun, Xun; Qian, Meng-Dan; Guan, Shan-Shan; Shan, Ya-Ming; Dong, Ying; Zhang, Hao; Wang, Song; Han, Wei-Wei

    2017-02-01

    Cel7A from Rasamsonia emersonii is one of the processive endocellulases classified under family 7 glycoside hydrolase. Molecular dynamics simulations were carried out to obtain the optimized sliding and hydrolyzing conformations, in which the reducing ends of sugar chains are located on different sites. Hydrogen bonds are investigated to clarify the interactions between protein and substrate in either conformation. Nine hydrogen bonding interactions are identified in the sliding conformation, and six similar interactions are also found correspondingly in the hydrolyzing conformation. In addition, four strong hydrophobic interactions are also determined. The domain cross-correlation map analysis shows movement correlation of protein including autocorrelation between residues. The root mean square fluctuations analysis represents the various flexibilities of different fragment in the two conformations. Comparing the two conformations reveals the water-supply mechanism of selective hydrolysis of cellulose in Cel7A. The mechanism can be described as follow. When the reducing end of substrate slides from the unhydrolyzing site (sliding conformation) to the hydrolyzing site (hydrolyzing conformation), His225 is pushed down and rotated, the rotation leads to the movement of Glu209 with the interstrand hydrogen bonding in β-sheet. It further makes Asp211 close to the hydrolysis center and provides a water molecule bounding on its carboxyl in the previous unhydrolyzing site. After the hydrolysis takes place and the product is excluded from the enzyme, the Asp211 comes back to its initial position. In summary, Asp211 acts as an elevator to transport outer water molecules into the hydrolysis site for every other glycosidic bond. © 2016 Wiley Periodicals, Inc.

  18. Target size dependence of relativistic hadron emission from S-32 nuclear collisions at 3.7-A-GeV and 200-A-GeV

    CERN Document Server

    Abdelsalam, A; Hafiz, M E

    2012-01-01

    The behavior of the relativistic hadron (shower particle) multiplicity for (32)S-nucleus interactions is investigated. The experiment is carried out at 3.7A GeV (Dubna energy) and 200A GeV (SPS energy) to search for the incident energy effect on the interactions inside the different emulsion target nuclei. Data are presented in terms of the number of emitted relativistic hadrons in both forward and backward angular zones. The dependence on the target size is presented. For this purpose the statistical events are separated into groups according to the interactions with H, CNO, Em, and AgBr target nuclei. The separation of events, into these groups, is executed based on predictions of Glauber's multiple scattering theory. Features suggestive of a decay mechanism seem to be a characteristic of the backward emission of relativistic hadrons. The results strongly support the assumption that the relativistic hadrons may already be emitted during the de-excitation of the excited target nucleus, in a behavior like tha...

  19. Intestinal transport of HDND-7, a novel hesperetin derivative, in in vitro MDCK cell and in situ single-pass intestinal perfusion models.

    Science.gov (United States)

    Chen, Ruonan; Li, Lan; Shen, Chenlin; Huang, Cheng; Ma, Taotao; Meng, Xiaoming; Qian, Zhengyue; Li, Yangyang; Li, Jun

    2017-08-01

    1. Hesperetin (HDND) possesses extensive bioactivities, however, its poor solubility and low bioavailability limit its application. HDND-7, a derivative of HDND, has better solubility and high bioavailability. In this study, we investigated the intestinal absorption mechanisms of HDND-7. 2. MDCK cells were used to examine the transport mechanisms of HDND-7 in vitro, and a rat in situ intestinal perfusion model was used to characterize the absorption of HDND-7. The concentration of HDND-7 was determined by HPLC. 3. In MDCK cells, HDND-7 was effectively absorbed in a concentration-dependent manner in both directions. Moreover, HDND-7 showed pH-dependent and TEER-independent transport in both directions. The transport of HDND-7 was significantly reduced at 4 °C or in the presence of NaN3. Furthermore, the efflux of HDND-7 was apparently reduced in the presence of MRP2 inhibitors MK-571 or probenecid. However, P-gp inhibitor verapamil had no effect on the transport of HDND-7. The in situ intestinal perfusion study indicated HDND-7 was well-absorbed in four intestinal segments. Furthermore, MRP2 inhibitors may slightly increase the absorption of HDND-7 in jejunum. 4. In summary, all results indicated that HDND-7 might be absorbed mainly by passive diffusion via transcellular pathway, MRP2 but P-gp may participate in the efflux of HDND-7.

  20. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... Health Administration 282 views 52:29 Intro to CPRS For Nursing Students 15: Notes Tab - Writing a ... Administration 139 views New 1:35 Intro to CPRS For Nursing Students 10: Medications Tab - Duration: 5: ...

  1. Itens alimentares no consumo alimentar de crianças de 7 a 10 anos Food items in the food intake of children aged seven to ten years

    Directory of Open Access Journals (Sweden)

    Patrícia de Fragas Hinnigi

    2012-06-01

    Full Text Available OBJETIVO: Descrever os itens alimentares mais representativos para o consumo total de energia, carboidratos, proteínas e lipídios de crianças de 7 a 10 anos. MÉTODOS: Elaborou-se uma lista com todos os alimentos consumidos com suas respectivas quantidades e quantificou-se a composição da dieta em energia e macronutrientes. A lista foi baseada em informações fornecidas pelo preenchimento de três Diários Alimentares (DA por 85 escolares de 7 a 10 anos que frequentavam uma escola pública na cidade de São Paulo. Obteve-se o agrupamento dos alimentos em 129 itens, calculou-se o percentual de contribuição de cada item no consumo alimentar dos nutrientes e identificaram-se aqueles que contribuíram com até 95% da ingestão total de calorias e dos nutrientes selecionados. RESULTADOS: Os itens "Arroz branco, arroz à grega, arroz com legumes" e "Feijão marrom, preto, branco, lentilha" contribuíram de forma importante para o consumo de energia e carboidratos. O item "Leite integral fluido, leite integral em pó" foi representativo para o consumo de lipídios, além de proteínas e energia. Ressalta-se a importância no consumo em energia e carboidratos das bebidas doces (refrigerantes e sucos industrializados na dieta deste grupo populacional. CONCLUSÕES: É evidente a participação do arroz no consumo alimentar total de energia e carboidratos; do feijão em energia, carboidratos e proteínas; do leite em energia, proteínas e lipídios; carnes em energia, proteínas e lipídios; e pão em energia e carboidratos. Merece destaque a participação das bebidas doces no consumo total de energia e carboidratos e das guloseimas no consumo total de lipídios.OBJECTIVE: To describe the most representative food items regarding the total intake of energy, carbohydrates, proteins and lipids in children with ages between 7 and 10 years. METHODS: A list was prepared with all food intake and quantities, and the diet composition in relation to energy

  2. Postural assessment of girls between 7 and 10 years of age Avaliação postural em meninas de 7 a 10 anos

    Directory of Open Access Journals (Sweden)

    Patrícia Jundi Penha

    2005-02-01

    Full Text Available Postural alterations are often found in children and teenagers. In this stage of development, the posture undergoes many adjustments and adaptations due to changes of the body and to demanding psychosocial factors. PURPOSE: To identify which postural alterations occur most often in students between 7 and 10 years of age, to identify preventive measures, and to provide information to parents and teachers about the problem of bad posture. METHODS: Thirty three girls in each of 4 age groups between 7 and 10 years of age were assessed, resulting in a sample of 132 subjects. Photos of each girl in the sagittal and frontal planes were examined for postural deviations. RESULTS: The main postural deviations found were knock-knee, medial rotation of the hip, antepulsion, pelvic anteversion, knee hyperextension, lumbar hyperlordosis, valgus ankle, imbalanced shoulders, lateral pelvic inclination, scoliosis, trunk rotation, thoracic hyperkyphosis, winged scapula, shoulder protraction, abducted scapula, medial rotation of shoulders, and head tilt. CONCLUSION: High incidences of postural alterations occur in children of school age. Some of these reflect normal postural development, and get corrected during the child's growth. On the other hand, some alterations are asymmetries that can be caused by daily demands on the body and can result in negative impacts on the quality of life during childhood and adulthood. We emphasize the importance of providing information to parents and teachers about the problem of bad posture.Alterações posturais são freqüentemente encontradas em crianças e adolescentes. Nessa fase, a postura sofre uma série de ajustes e adaptações às mudanças no próprio corpo e à demanda psicossocial que lhe é apresentada, ocorrendo uma grande transformação na busca de um equilíbrio compatível com suas condições. OBJETIVO: Identificar quais as alterações posturais mais freqüentes em escolares, de 7 a 10 anos, com intuito de

  3. Simvastatin promotes NPC1-mediated free cholesterol efflux from lysosomes through CYP7A1/LXRα signalling pathway in oxLDL-loaded macrophages.

    Science.gov (United States)

    Xu, Xiaoyang; Zhang, Aolin; Halquist, Matthew S; Yuan, Xinxu; Henderson, Scott C; Dewey, William L; Li, Pin-Lan; Li, Ningjun; Zhang, Fan

    2017-02-01

    Statins, 3-hydroxyl-3-methylglutaryl coenzyme A reductase inhibitors, are the first-line medications prescribed for the prevention and treatment of coronary artery diseases. The efficacy of statins has been attributed not only to their systemic cholesterol-lowering actions but also to their pleiotropic effects that are unrelated to cholesterol reduction. These pleiotropic effects have been increasingly recognized as essential in statins therapy. This study was designed to investigate the pleiotropic actions of simvastatin, one of the most commonly prescribed statins, on macrophage cholesterol homeostasis with a focus on lysosomal free cholesterol egression. With simultaneous nile red and filipin staining, analysis of confocal/multi-photon imaging demonstrated that simvastatin markedly attenuated unesterified (free) cholesterol buildup in macrophages loaded with oxidized low-density lipoprotein but had little effect in reducing the sizes of cholesteryl ester-containing lipid droplets; the reduction in free cholesterol was mainly attributed to decreases in lysosome-compartmentalized cholesterol. Functionally, the egression of free cholesterol from lysosomes attenuated pro-inflammatory cytokine secretion. It was determined that the reduction of lysosomal free cholesterol buildup by simvastatin was due to the up-regulation of Niemann-Pick C1 (NPC1), a lysosomal residing cholesterol transporter. Moreover, the enhanced enzymatic production of 7-hydroxycholesterol by cytochrome P450 7A1 and the subsequent activation of liver X receptor α underscored the up-regulation of NPC1. These findings reveal a novel pleiotropic effect of simvastatin in affecting lysosomal cholesterol efflux in macrophages and the associated significance in the treatment of atherosclerosis. © 2016 The Authors. Journal of Cellular and Molecular Medicine published by John Wiley & Sons Ltd and Foundation for Cellular and Molecular Medicine.

  4. Identification of a member of the catalase multigene family on wheat chromosome 7A associated with flour b* colour and biological significance of allelic variation.

    Science.gov (United States)

    Li, Dora A; Walker, Esther; Francki, Michael G

    2015-12-01

    Carotenoids (especially lutein) are known to be the pigment source for flour b* colour in bread wheat. Flour b* colour variation is controlled by a quantitative trait locus (QTL) on wheat chromosome 7AL and one gene from the carotenoid pathway, phytoene synthase, was functionally associated with the QTL on 7AL in some, but not all, wheat genotypes. A SNP marker within a sequence similar to catalase (Cat3-A1snp) derived from full-length (FL) cDNA (AK332460), however, was consistently associated with the QTL on 7AL and implicated in regulating hydrogen peroxide (H2O2) to control carotenoid accumulation affecting flour b* colour. The number of catalase genes on chromosome 7AL was investigated in this study to identify which gene may be implicated in flour b* variation and two were identified through interrogation of the draft wheat genome survey sequence consisting of five exons and a further two members having eight exons identified through comparative analysis with the single catalase gene on rice chromosome 6, PCR amplification and sequencing. It was evident that the catalase genes on chromosome 7A had duplicated and diverged during evolution relative to its counterpart on rice chromosome 6. The detection of transcripts in seeds, the co-location with Cat3-A1snp marker and maximised alignment of FL-cDNA (AK332460) with cognate genomic sequence indicated that TaCat3-A1 was the member of the catalase gene family associated with flour b* colour variation. Re-sequencing identified three alleles from three wheat varieties, TaCat3-A1a, TaCat3-A1b and TaCat3-A1c, and their predicted protein identified differences in peroxisomal targeting signal tri-peptide domain in the carboxyl terminal end providing new insights into their potential role in regulating cellular H2O2 that contribute to flour b* colour variation.

  5. Aislamiento y caracterización de Escherichia coliO157:H7 a partir de carne molida de bovino en Lima-Perú

    Directory of Open Access Journals (Sweden)

    Carmen R. Méndez

    2013-12-01

    Full Text Available El objetivo del estudio fue aislar y caracterizar E. coliO157:H7 a partir de carne molida fresca de bovino obtenida en diferentes mercados de abastos. Se analizaron 195 muestras; para el aislamiento y enumeración de E. coli se utilizó la técnica del Numero Más probable mediante tubos múltiples; para el aislamiento y caracterización de E. coliO157:H7 el enriquecimiento selectivo y el análisis bioquímico, las colonias características se confirmaron mediante pruebas serológicas. Para determinar la presencia de shigatoxina (stx1, stx2 e intimina (eae A se empleó la técnica de PCR multiplex en tiempo real y para enterohemolisina la prueba de hemólisis. El 87.18% de la muestras fue positivo para E. coliy el 77.95% presentó un recuento igual o superior a 50 NMP/g. Se obtuvieron 3 (1.54% cepas de E. coliO157:H7, una stx1 +/ stx2 +/ eaeA – y enterohemolisina -, una stx1 +/ stx2 -/ eaeA + y enterohemolisina – y la otra stx1 -/ stx2 -/ eaeA – y enterohemolisina +. También se obtuvieron 4 cepas (2.05% de E. coli O157 no H7, ninguna presentó factores de virulencia. El estudio reveló el riesgo potencial de que E. coliO157:H7 afecte a la población de Lima.

  6. Características del desarrollo motor en niños de 3 a 7 años de la ciudad de Barranquilla

    Directory of Open Access Journals (Sweden)

    Lilia Angélica Campo Ternera

    2011-01-01

    Full Text Available Abstract This research paper presents the characteristics of motor development in children 3 to 7 years in the city of Barranquilla. The study was developed from the empirical analytical paradigm correlational design and the measuring of the study variables was made by the Battelle Developmental Inventory. The results revealed the issues in each of the areas assessed (muscle control, body coordination, locomotion, fine motor, perceptual motor skills. Lower performance scores than expected for age were found and therefore reflect greater need for care and stimulation, that aspects is importance because children who do not develop during this period mature motor patterns, would present difficulties in acquiring more complex skills. Resumen El presente artículo de investigación expone las características del desarrollo motor en niños de 3 a 7 años en la ciudad de Barranquilla. El estudio se desarrolló a partir del paradigma empírico analítico con un diseño correlacional y para la medición de las variables de estudio se utilizó el Inventario de Desarrollo Battelle. Los resultados obtenidos revelaron los aspectos en cada una de las áreas evaluadas: (Control muscular, Coordinación corporal, Locomoción, Motricidad fina, Motricidad perceptiva. Se presentaron puntajes de desempeño más bajos de lo esperado para la edad y por lo tanto reflejan mayor necesidad de atención y estimulación, aspectos de suma importancia teniendo en cuenta que aquellos niños que no desarrollen durante este periodo patrones motores maduros, presentarán posteriormente dificultades en la adquisición de habilidades más complejas.

  7. S100A7, a novel Alzheimer's disease biomarker with non-amyloidogenic alpha-secretase activity acts via selective promotion of ADAM-10.

    Directory of Open Access Journals (Sweden)

    Weiping Qin

    Full Text Available Alzheimer's disease (AD is the most common cause of dementia among older people. At present, there is no cure for the disease and as of now there are no early diagnostic tests for AD. There is an urgency to develop a novel promising biomarker for early diagnosis of AD. Using surface-enhanced laser desorption ionization-mass spectrometry SELDI-(MS proteomic technology, we identified and purified a novel 11.7-kDa metal- binding protein biomarker whose content is increased in the cerebrospinal fluid (CSF and in the brain of AD dementia subjects as a function of clinical dementia. Following purification and protein-sequence analysis, we identified and classified this biomarker as S100A7, a protein known to be involved in immune responses. Using an adenoviral-S100A7 expression system, we continued to examine the potential role of S100A7 in AD amyloid neuropathology in in vitro model of AD. We found that the expression of exogenous S100A7 in primary cortico-hippocampal neuron cultures derived from Tg2576 transgenic embryos inhibits the generation of beta-amyloid (Abeta(1-42 and Abeta(1-40 peptides, coincidental with a selective promotion of "non- amyloidogenic" alpha-secretase activity via promotion of ADAM (a disintegrin and metalloproteinase-10. Finally, a selective expression of human S100A7 in the brain of transgenic mice results in significant promotion of alpha-secretase activity. Our study for the first time suggests that S100A7 may be a novel biomarker of AD dementia and supports the hypothesis that promotion of S100A7 expression in the brain may selectively promote alpha-secretase activity in the brain of AD precluding the generation of amyloidogenic peptides. If in the future we find that S1000A7 protein content in CSF is sensitive to drug intervention experimentally and eventually in the clinical setting, S100A7 might be developed as novel surrogate index (biomarker of therapeutic efficacy in the characterization of novel drug agents for

  8. Comportamiento de la aeromicrobiota en dos depósitos del Archivo Nacional de la República de Cuba durante 7 años de estudio

    Directory of Open Access Journals (Sweden)

    Sofía Flavia Borrego Alonso

    2014-05-01

    Full Text Available En depósitos de archivos, bibliotecas y museos donde se conservan obras de valor patrimonial, la presencia de elevadas concentraciones fúngicas en el aire con potencialidades para degradar los soportes orgánicos constituyen un riesgo elevado para la preservación de ese patrimonio. En países de clima tropical estos efectos dañinos pueden potenciarse por los valores altos de humedad relativa y temperatura existentes durante la mayor parte del año. Los objetivos de este trabajo fueron: evaluar el comportamiento de la concentración microbiana aérea en el interior de dos depósitos del Archivo Nacional de la República de Cuba (ARNAC en 7 años así como determinar la densidad y frecuencia relativa de los géneros y especies fúngicas para conocer su impacto ecológico y ambiental. Los muestreos microbiológicos se realizaron en la Fototeca y la Mapoteca empleando medios de cultivo apropiados y un método de sedimentación. Se determinó cualitativamente la actividad celulolítica, amilolítica y proteolítica, así como la excreción de ácidos y pigmentos. En la Fototeca la concentración fúngica se mantuvo más alta que en la Mapoteca durante el estudio y los géneros fúngicos predominantes fueron Aspergillus, Penicillium y Cladosporium aunque en algunos años Curvularia, Alternaria y Fusarium se detectaron a densidades relativas considerables, fundamentalmente en Fototeca. Las especies fúngicas de mayor impacto ecológico en los depósitos correspondieron a los géneros Aspergillus y Cladosporium. La mayoría de las cepas aisladas degradaron celulosa, gelatina y almidón, todas excretaron ácidos y más del 50% produjeron pigmentos de colores diversos.

  9. Influencias de la densidad y podas sobre la producción de Pinus taeda L. a los 7 años de edad.

    Directory of Open Access Journals (Sweden)

    Rubén Costas

    2010-08-01

    Full Text Available En un ensayo con 3 niveles de densidad y 12 tratamientos de poda, se evaluaron los efectos de la densidad, la altura de poda, el número de levantes de poda y la interacción entre la densidad y las podas sobre la producción de la masa de Pinus taeda L. a los 7 años de edad. Las variables evaluadas fueron el diámetro a la altura de pecho medio (DAP, la altura media, el volumen individual, el volumen por unidad de superficie, el área basal, el diámetro máximo sobre muñón (DMSM, el coeficiente de forma de Girard (CFG, el diámetro de ramas (DRBC y el ángulo de inserción de las ramas (ARBC en la base de la copa. En los tratamientos con mayor densidad de plantación se observaron mayores volúmenes por unidad de superficie, área basal y CFG que en los tratamientos con menor densidad. Estos produjeron mayores DAP, volúmenes individuales, DMSM, DRBC y ARBC que los tratamientos con mayores densidades. Los tratamientos con menores alturas finales de poda produjeron mayores DAP, volúmenes individuales, área basal y volúmenes por unidad de superficie que los tratamientos con mayores alturas de poda. Los menores DMSM se obtuvieron con alturas finales de poda de 3,30 m y 4,40 m realizadas a los 4 años de edad y los mayores DMSM ocurrieron al no efectuarse podas a los 5 años hasta 5,50 m y 6,60 m. No se encontraron diferencias significativas entre los valores medios de DRBC, ARBC y CFG producidos por los 12 tratamientos de poda. La interacción entre densidad y los tratamientos de poda no fue significativa para ninguna de las variables respuestas.

  10. The Pressure-Induced Structural Response of A2Hf2O7 (A=Y, Sm, Eu, Gd, Dy, Yb) Compounds from 0.1-50 GPa

    Science.gov (United States)

    Turner, K. M.; Rittman, D.; Heymach, R.; Turner, M.; Tracy, C.; Mao, W. L.; Ewing, R. C.

    2016-12-01

    A2B2O7 (A, B= cations) compounds have structures that make their properties conducive to many applications; for example they are a proposed waste-form for actinides generated in the nuclear fuel cycle. This interest in part is due to their structural responses to extreme environments of high P, T, or under intense irradiation. Depending on their cationic radius ratio, ra/rb, A2B2O7 compounds either crystallize as pyrochlore (ra/rb=1.46-1.7) or "defect fluorite" (ra/rb>1.46). The structure types are similar: they are derivatives of ideal fluorite with two cations and 1/8 missing anions. In pyrochlore, the cations and anion vacancy are ordered. In "defect fluorite"-structured oxides, the cations and anion vacancies are random. A2B2O7 compounds rarely amorphize in extreme environments. Rather, they disorder and undergo phase transitions; this resistance to amorphization contributes to the durability of this potential actinide waste-form. Under high-pressure, A2B2O7 compounds are known to disorder or form a cottunite-like phase. Their radius ratio affects their response to extreme environments; "defect fluorite" type compounds tend to disorder, and pyrochlore type compounds tend to form the cottunite-like phase. We have examined six A2Hf2O7 compounds (A=Y, Sm, Eu, Gd, Dy, Yb) in situ to 50 GPa. By keeping the B-site constant (Hf), we examined the effect of a changing radius ratio on the pressure-induced structural response of hafnates. We used symmetric DACs, ruby fluorescence, stainless steel gaskets, and methanol: ethanol (4:1 by volume) pressure medium. We characterized these materials with in situ Raman spectroscopy at Stanford University, and synchrotron X-Ray Diffraction (XRD) at APS 16 BM-D and ALS 12.2.2. The compounds were pyrochlore structured (Sm, Eu, Gd) and "defect-fluorite" structured (Y, Dy, Yb) hafnates . These compounds undergo a slow phase transition to a high-pressure cotunnite-like phase between 18-30 GPa. They undergo disordering of their cation

  11. PERCEPCIÓN DE LOS NIÑOS (AS DE 7 A 12 AÑOS ACERCA DE LAS DROGAS EN AMÉRICA LATINA

    Directory of Open Access Journals (Sweden)

    Marciana Fernandes Moll

    2015-01-01

    Full Text Available Introducción. El presente artículo tiene como objetivo analizar la percepción de los niños de 7 a12 años acerca de la temática de las drogas, durante el periodo 1992-2012. uno de los problemas más reiterativos en las poblaciones infantiles es el uso del alcohol, tabaco y demás drogas ilícitas, cuya exposición inicia a edades cada vez más tempranas, motivo por el que es fundamental la participación de equipos de trabajo en conjunto con padres, educadores, psicólogos, psiquiatras, trabajadores sociales, poderes públicos, a lo que debe aunarse una estrategia global de promoción  de la salud para enfrentar el fenómeno de las drogas en la niñez.Métodos. Para desarrollar esta investigación se empleó la revisión bibliográfica integrativa. Para recolectar información se utilizó diversos artículos completos, indexados en bases de datos LILACS y SCIELO, de los que se recuperó 54 artículos, aunque solo diez se relacionan con la temática en estudio.Resultados. En ninguno de los estudios se estableció  diferencia de percepción entre los niños (as a partir de aspectos como  sexo, edad, condiciones económicas, sociales y familiares; no obstante, se relaciona países, sí se detectó diferencias, aunque mínimas, principalmente en lo que respecta al abordaje del tema, el cual se enfoca en el consumo en sí y no en las percepciones que construyen los niños en relación con el consumoConclusión. Los niños perciben como inapropiado el consumo de drogas tanto lícitas como ilícitas, puesto que producen múltiples consecuencias que producen alteraciones en la salud y en la apariencia física, así como bajo rendimiento escolar y deterioro en las relaciones familiares y sociales. 

  12. Targeting the Enterohepatic Bile Acid Signaling Induces Hepatic Autophagy via a CYP7A1–AKT–mTOR Axis in MiceSummary

    Directory of Open Access Journals (Sweden)

    Yifeng Wang

    2017-03-01

    Full Text Available Background & Aims: Hepatic cholesterol accumulation and autophagy defects contribute to hepatocyte injury in fatty liver disease. Bile acid synthesis is a major pathway for cholesterol catabolism in the liver. This study aims to understand the molecular link between cholesterol and bile acid metabolism and hepatic autophagy activity. Methods: The effects of cholesterol and cholesterol 7α-hydroxylase (CYP7A1 expression on autophagy and lysosome function were studied in cell models. The effects and mechanism of disrupting enterohepatic bile acid circulation on hepatic autophagy were studied in mice. Results: The results first showed differential regulation of hepatic autophagy by free cholesterol and cholesterol ester, whereby a modest increase of cellular free cholesterol, but not cholesterol ester, impaired lysosome function and caused marked autolysosome accumulation. We found that CYP7A1 induction, either by cholestyramine feeding in mice or adenovirus-mediated CYP7A1 expression in hepatocytes, caused strong autophagy induction. Mechanistically, we showed that CYP7A1 expression markedly attenuated growth factor/AKT signaling activation of mechanistic target of rapamycin (mTOR, but not amino acid signaling to mTOR in vitro and in vivo. Metabolomics analysis further found that CYP7A1 induction not only decreased hepatic cholesterol but also altered phospholipid and sphingolipid compositions. Collectively, these results suggest that CYP7A1 induction interferes with growth factor activation of AKT/mTOR signaling possibly by altering membrane lipid composition. Finally, we showed that cholestyramine feeding restored impaired hepatic autophagy and improved metabolic homeostasis in Western diet–fed mice. Conclusions: This study identified a novel CYP7A1–AKT–mTOR signaling axis that selectively induces hepatic autophagy, which helps improve hepatocellular integrity and metabolic homeostasis. Keywords: Cholesterol

  13. Molecular characterization of plasmids pS7a and pS7b from Lactococcus lactis subsp. lactis bv. diacetylactis S50 as a base for the construction of mobilizable cloning vectors.

    Science.gov (United States)

    Strahinic, I; Kojic, M; Tolinacki, M; Fira, D; Topisirovic, L

    2009-01-01

    Strain Lactococcus lactis subsp. lactis bv. diacetylactis S50 harbours five theta-replicating plasmids (pS6, pS7a, pS7b, pS80 and pS140). The aim of this study was to characterize domains involved in the replication and conjugative mobilization of the small plasmids pS7a and pS7b, which are structurally very similar. Complete nucleotide sequences of pS7a and pS7b were determined by cloning DNA fragments of different sizes into Escherichia coli vectors. Linearized plasmids and four EcoRI fragments of the pS7a and pS7b were cloned into an origin probe vector. Constructed plasmids (pSEV10, pSK10, pISE1a and pISE1b) were able to replicate in the strain L. lactis subsp. cremoris MG1363. In addition, experiments showed that plasmids pS7a and pS7b contained oriT sequences and their conjugative transfer directly depended on the presence of pS80 in donor cells. Plasmids pS7a and pS7b contained typical lactococcal theta replication origin and repB gene that enable them to replicate in the strain L. lactis subsp. cremoris MG1363. Plasmid pS80 plays a key role in the conjugative transfer of small plasmids. Plasmids pS7a and pS7b-based derivatives could be valuable tools for genetic manipulation, studying processes of plasmid maintenance and horizontal gene transfer in lactococci.

  14. A new polymorphism biomarker rs629367 associated with increased risk and poor survival of gastric cancer in chinese by up-regulated miRNA-let-7a expression.

    Directory of Open Access Journals (Sweden)

    Qian Xu

    Full Text Available BACKGROUND: Variant in pri-miRNA could affect miRNA expression and mature process or splicing efficiency, thus altering the hereditary susceptibility and prognosis of cancer. We aimed to assess miRNA-let-7 single nucleotide polymorphisms (SNP associated with the risk and prognosis of gastric cancer (GC as predicting biomarkers, and furthermore, its possible mechanisms. METHODS: A two-stage case-control study was designed to screen four miRNA SNPs (pri-let-7a-2 rs629367 and rs1143770, pri-let-7a-1 rs10739971, pri-let-7f-2 rs17276588 in 107 GC patients, 107 atrophic gastritis (AG, and matched 124 controls using PCR-RFLP. Two promising SNPs were validated in another independent 1949 samples (including 579 gastric cancer patients, 649 atrophic gastritis and 721 controls using Sequenom MassARRAY platform and sequencing. RESULTS: We found that pri-let-7a-2 rs629367 CC variant genotype was associated with increased risks of gastric cancer and atrophic gastritis by 1.83-fold and 1.86-fold, respectively. For gastric cancer prognosis, patients with rs629367 CC genotype had significantly poorer survival than patients with AA genotype (log-rank P = 0.004. We further investigated the let-7a expression levels in serum and found that let-7a expression elevated gradually for rs629367 AA, CA, CC genotype in the atrophic gastritis group (P = 0.043. Furthermore, we confirmed these findings in vitro study by overexpressing let-7a carrying pri-let-7a-2 wild-type A or polymorphic-type C allele (P<0.001. CONCLUSIONS: pri-let-7a-2 rs629367 CC genotype could increase the risks of gastric cancer as well as atrophic gastritis and was also associated with poor survival of gastric cancer, which possibly by affecting the mature let-7a expression, and could serve as a predicting biomarker for high-risk and poor prognosis of gastric cancer.

  15. Compound heterozygosity for COL7A1 mutations in twins with dystrophic epidermolysis bullosa: A recessive paternal deletion/insertion mutation and a dominant negative maternal glycine substitution result in a severe phenotype

    Energy Technology Data Exchange (ETDEWEB)

    Christiano, A.M.; Uitto, J. [Thomas Jefferson Univ., Philadelphia, PA (United States); Anton-Lamprecht, I.; Ebschner, U. [Universitaet Heidelberg (Germany); Amano, S.; Burgeson, R.E. [Harvard Medical School, Charlestown, MA (United States)

    1996-04-01

    We have previously demonstrated genetic linkage between the type VII collagen gene (COL7A1) and the dominant (DDEB) and recessive (RDEB) forms of dystrophic epidermolysis bullosa (DEB) and have subsequently identified pathogenetic mutations in several families. Mutations in DDEB identified thus far are glycine substitutions in the collagenous domain of COL7A1, while the most severe forms of RDEB result from premature termination codon (PTC) mutations on both alleles. In this study, we performed mutation analysis in the COL7A1 gene in twins who displayed a severe DEB phenotype. Mutational analysis revealed a paternal 2-bp deletion/1-bp insertion in exon 56, designated 5103CC{yields}G, which results in a frameshift and downstream PTC. Analysis of the maternal COL7A1 allele revealed a glycine-to-arginine substitution in exon 91 (G2351R). Careful questioning of the mother revealed that she and her father had a history of shedding of toenails and occasional poorly heating erosions, consistent with a mild form of DDEB. Immunoprecipitation of type VII collagen from fibroblasts of the twins revealed a marked reduction in intracellular protein production, consistent with the drastic reduction in mRNA transcript from the paternal mutant allele, while the majority of polypeptides bearing the glycine substitution appeared to be degraded intracellularly. Thus, the severe RDEB phenotype in the probands results from compound heterozygosity for one glycine substitution and one PTC mutation in COL7A1. 40 refs., 7 figs.

  16. Genetic Correction of Induced Pluripotent Stem Cells From a Deaf Patient With MYO7A Mutation Results in Morphologic and Functional Recovery of the Derived Hair Cell-Like Cells.

    Science.gov (United States)

    Tang, Zi-Hua; Chen, Jia-Rong; Zheng, Jing; Shi, Hao-Song; Ding, Jie; Qian, Xiao-Dan; Zhang, Cui; Chen, Jian-Ling; Wang, Cui-Cui; Li, Liang; Chen, Jun-Zhen; Yin, Shan-Kai; Huang, Tao-Sheng; Chen, Ping; Guan, Min-Xin; Wang, Jin-Fu

    2016-05-01

    The genetic correction of induced pluripotent stem cells (iPSCs) induced from somatic cells of patients with sensorineural hearing loss (caused by hereditary factors) is a promising method for its treatment. The correction of gene mutations in iPSCs could restore the normal function of cells and provide a rich source of cells for transplantation. In the present study, iPSCs were generated from a deaf patient with compound heterozygous MYO7A mutations (c.1184G>A and c.4118C>T; P-iPSCs), the asymptomatic father of the patient (MYO7A c.1184G>A mutation; CF-iPSCs), and a normal donor (MYO7A(WT/WT); C-iPSCs). One of MYO7A mutation sites (c.4118C>T) in the P-iPSCs was corrected using CRISPR/Cas9. The corrected iPSCs (CP-iPSCs) retained cell pluripotency and normal karyotypes. Hair cell-like cells induced from CP-iPSCs showed restored organization of stereocilia-like protrusions; moreover, the electrophysiological function of these cells was similar to that of cells induced from C-iPSCs and CF-iPSCs. These results might facilitate the development of iPSC-based gene therapy for genetic disorders. Induced pluripotent stem cells (iPSCs) were generated from a deaf patient with compound heterozygous MYO7A mutations (c.1184G>A and c.4118C>T). One of the MYO7A mutation sites (c.4118C>T) in the iPSCs was corrected using CRISPR/Cas9. The genetic correction of MYO7A mutation resulted in morphologic and functional recovery of hair cell-like cells derived from iPSCs. These findings confirm the hypothesis that MYO7A plays an important role in the assembly of stereocilia into stereociliary bundles. Thus, the present study might provide further insight into the pathogenesis of sensorineural hearing loss and facilitate the development of therapeutic strategies against monogenic disease through the genetic repair of patient-specific iPSCs. ©AlphaMed Press.

  17. The Vh2 and Vh4 scab resistance genes in two differential hosts derived from Russian apple R12740-7A map to the same linkage group of apple

    NARCIS (Netherlands)

    Bus, V.G.M.; Rikkerink, E.H.A.; Weg, van de W.E.; Rusholme, R.L.; Gardiner, S.E.; Bassett, H.C.M.; Kodde, L.P.; Parisi, L.; Laurens, F.N.D.; Meulenbroek, E.J.; Plummer, K.M.

    2005-01-01

    Russian apple R12740-7A is the designation for an accession grown from seed collected in Russia, which was found to be highly resistant to apple scab. The resistance has historically been attributed to a naturally pyramided complex involving three major genes: one race-nonspecific gene, Vr,

  18. Phenotype of Usher syndrome type II assosiated with compound missense mutations of c.721 C>T and c.1969 C>T in MYO7A in a Chinese Usher syndrome family.

    Science.gov (United States)

    Zhai, Wei; Jin, Xin; Gong, Yan; Qu, Ling-Hui; Zhao, Chen; Li, Zhao-Hui

    2015-01-01

    To identify the pathogenic mutations in a Chinese pedigree affected with Usher syndrome type II (USH2). The ophthalmic examinations and audiometric tests were performed to ascertain the phenotype of the family. To detect the genetic defect, exons of 103 known RDs -associated genes including 12 Usher syndrome (USH) genes of the proband were captured and sequencing analysis was performed to exclude known genetic defects and find potential pathogenic mutations. Subsequently, candidate mutations were validated in his pedigree and 100 normal controls using polymerase chain reaction (PCR) and Sanger sequencing. The patient in the family occurred hearing loss (HL) and retinitis pigmentosa (RP) without vestibular dysfunction, which were consistent with standards of classification for USH2. He carried the compound heterozygous mutations, c.721 C>T and c.1969 C>T, in the MYO7A gene and the unaffected members carried only one of the two mutations. The mutations were not present in the 100 normal controls. We suggested that the compound heterozygous mutations of the MYO7A could lead to USH2, which had revealed distinguished clinical phenotypes associated with MYO7A and expanded the spectrum of clinical phenotypes of the MYO7A mutations.

  19. Phenotype of Usher syndrome type II assosiated with compound missense mutations of c.721 C>T and c.1969 C>T in MYO7A in a Chinese Usher syndrome family

    Directory of Open Access Journals (Sweden)

    Wei Zhai

    2015-08-01

    Full Text Available AIM:To identify the pathogenic mutations in a Chinese pedigree affected with Usher syndrome type II (USH2.METHODS:The ophthalmic examinations and audiometric tests were performed to ascertain the phenotype of the family. To detect the genetic defect, exons of 103 known RDs -associated genes including 12 Usher syndrome (USH genes of the proband were captured and sequencing analysis was performed to exclude known genetic defects and find potential pathogenic mutations. Subsequently, candidate mutations were validated in his pedigree and 100 normal controls using polymerase chain reaction (PCR and Sanger sequencing.RESULTS:The patient in the family occurred hearing loss (HL and retinitis pigmentosa (RP without vestibular dysfunction, which were consistent with standards of classification for USH2. He carried the compound heterozygous mutations, c.721 C>T and c.1969 C>T, in the MYO7A gene and the unaffected members carried only one of the two mutations. The mutations were not present in the 100 normal controls.CONCLUSION:We suggested that the compound heterozygous mutations of the MYO7A could lead to USH2, which had revealed distinguished clinical phenotypes associated with MYO7A and expanded the spectrum of clinical phenotypes of the MYO7A mutations.

  20. Wnt-5a and Wnt-7a are expressed in the developing chick limb bud in a manner suggesting roles in pattern formation along the proximodistal and dorsoventral axes.

    Science.gov (United States)

    Dealy, C N; Roth, A; Ferrari, D; Brown, A M; Kosher, R A

    1993-10-01

    The Wnt gene family encodes a group of secreted signalling molecules that have been implicated in the regulation of cell fate and pattern formation during embryogenesis. We have examined the patterns of expression of two members of the chicken Wnt family, Wnt-5a and Wnt-7a, during development of the chick limb bud. Wnt-5a is expressed in the apical ectodermal ridge which directs outgrowth of limb mesoderm. Wnt-5a also exhibits three quantitatively distinct domains of expression along the proximodistal (PD) axis of the limb mesoderm that may correspond to the regions which will give rise to the three distinct PD segments of the limb, the autopod, zeugopod, and stylopod. In contrast, Wnt-7a expression in the limb bud is specifically limited to the dorsal ectoderm. These observations suggest possible roles for Wnt-5a and Wnt-7a in pattern formation along the PD and dorsoventral axes of the developing chick limb bud. In addition, Wnt-5a and Wnt-7a exhibit spatially discrete domains of expression in several other regions of the chick embryo consistent with developmental roles for these genes in a variety of other tissues.

  1. A dor e a constituição psíquica The pain and the psyché’s constitution

    Directory of Open Access Journals (Sweden)

    Ana Celina Garcia Albornoz

    2004-12-01

    Full Text Available Este artigo aborda uma temática que atinge a todos: a infância e a adolescência marcadas pelas privações. O abandono, a negligência e o abuso físico, sexual e psicológico de crianças e de adolescentes são fatos reais e freqüentes na vida dos mesmos. A literatura psicanalítica sustenta a idéia de que as vivências de privação geram importantes seqüelas no desenvolvimento emocional, podendo marcar de forma peculiar a vida das pessoas para sempre. O percurso teórico realizado neste artigo aponta que crianças e adolescentes vitimizados apresentam dificuldades para investir em si mesmos e nos outros, o que os torna portadores de sintomas dificultadores da adaptação pessoal, social, escolar, institucional e familiar. É fundamental que eles possam elaborar as suas vivências passadas traumáticas, retomar o desenvolvimento de forma saudável e atualizar os seus potenciais.This paper concerns a theme which affects everyone: childhood and adolescence at risk. Abandonment, neglect as well as physical, sexual and psychological abuse of children and adolescents are real and often recurrent in their lives. Psychoanalytic literature sustains the idea that early experiences of deprivation cause important sequels to emotional development and might leave everlasting consequences. The theoretical approach developed in this study shows that children and adolescents who are victimized present difficulties investing in themselves and in others. As a result, they present symptoms of difficult adjustment in personal, social, school, institutional and family areas. It is essential for them to overcome such traumatic past experiences in order to enable such children and adolescents to develop in a more healthier way and to enhance their potential.

  2. Animální modely psychóz - hodnocení EEG a hladin monoaminů v CNS u potkana

    OpenAIRE

    Lipski, Michaela

    2017-01-01

    The present work describes animal models of psychosis with the aim on monoamine levels and behavioral/EEG findings. The general part is focused on reporting biochemical and EEG findings in patients with schizophrenia, followed by animal models of schizophrenia and their EEG findings. In the special part, results of behavioral and EEG parameters in three animal models of psychosis are presented. A study by Palenicek et al, 2013 described serotoninergic animal model and showed that 4-bromo-2,5-...

  3. From soma to psyche: the crucial connection. Part 2. 'Cross-cultural medicine' decoded: learning about 'us' in the act of learning about 'them'.

    Science.gov (United States)

    Marcus, L; Marcus, A

    1988-01-01

    The scorpion's bite--a culturally inept response to a medical emergency. Margaret Clark's criteria--keys to cultural barriers in medical care. Clifford Geertz's injunction: to view the culturally "different" as mirrors of the unacknowledged self. The case of José--scandal of his "compartmentalized" treatment. How much context may a physician be willing to absorb? Shawcross's The Quality of Mercy: western medical teams in Cambodian refugee camps--their good intentions versus their ethnocentric gaffes. The elderly as avatars of a "culture within a culture." Their beliefs, fears, dreams, and intimations--a "terra incognita" for service providers. Sardonic recoil against them (as in Shem's novel House of God) by residents--a professionally sanctioned response, deflecting what might otherwise be unendurable demands on their varied quotas of pity. Sisela Bok's moral claims: (1) for the integrity of decision making among the sick; (2) for the autonomy of the "dying response" among the aged. Steinberg's The Ethnic Myth: indictment of those using cultural difference to "explain" (or rationalize) health--and other--deficits rooted in historic, social, or economic inequity.

  4. Something black in the American Psyche: formal innovation and Freudian imagery in the comics of Winsor McCay and Robert Crumb.

    Science.gov (United States)

    Shannon, Edward A

    2010-01-01

    Winsor McCay’s Little Nemo in Slumberland anticipates Robert Crumb’s work. McCay’s innocent dreamscapes seem antithetical to the sexually explicit work of anti-capitalist Crumb, but Nemo looks forward to Crumb in subject and form. Nemo’s presentation of class, gender, and race, and its pre-Freudian sensibility are ironic counterpoints to Crumb’s political, Freudian comix.

  5. Psychosocial predictors of quality of life and weight loss two years after bariatric surgery: Results from the Toronto Bari-PSYCH study.

    Science.gov (United States)

    Sockalingam, Sanjeev; Hawa, Raed; Wnuk, Susan; Santiago, Vincent; Kowgier, Matthew; Jackson, Timothy; Okrainec, Allan; Cassin, Stephanie

    2017-07-01

    Studies exploring the impact of pre-surgery psychiatric status as a predictor of health related quality of life (QOL) after bariatric surgery have been limited to short-term follow-up and variable use of psychosocial measures. We examined the effect of pre-operative psychiatric factors on QOL and weight loss 2-years after surgery. 156 patients participated in this prospective cohort study, the Toronto Bariatric Psychosocial Cohort Study, between 2010 and 2014. Patients were assessed pre-surgery for demographic factors, weight, psychiatric diagnosis using the MINI International Neuropsychiatric Interview and symptom measures for QOL, depression and anxiety at pre-surgery and at 1 and 2years post-surgery. At 2-years post-bariatric surgery, patients experienced a significant decrease in mean weight (-48.43kg, 95% [-51.1, -45.76]) and an increase only in physical QOL (+18.91, 95% [17.01, 20.82]) scores as compared to pre-surgery. Multivariate regression analysis identified pre-surgery physical QOL score (psurgery weight (psurgery. Bariatric surgery had a sustained impact on physical QOL but not mental QOL at 2-years post-surgery. A history of mood disorder unexpectedly increased physical QOL scores and weight loss following surgery. Further research is needed to determine if these results are due to bariatric surgery candidate selection within this program. Copyright © 2017 Elsevier Inc. All rights reserved.

  6. Complete nucleotide sequence of pHN7A8, an F33:A-:B- type epidemic plasmid carrying blaCTX-M-65, fosA3 and rmtB from China.

    Science.gov (United States)

    He, Liangying; Partridge, Sally R; Yang, Xiaoyun; Hou, Jianxia; Deng, Yuting; Yao, Qiongfen; Zeng, Zhenling; Chen, Zhangliu; Liu, Jian-Hua

    2013-01-01

    To characterize a representative self-transmissible multidrug resistance plasmid pHN7A8 isolated from an Escherichia coli from a dog in China, classified as F33:A-:B- by replicon sequence typing and carrying the bla(TEM-1b), bla(CTX-M-65), fosA3 and rmtB genes conferring resistance to penicillins, cephalosporins, fosfomycin and aminoglycosides, respectively. pHN7A8 was sequenced using a whole-genome shotgun approach and the sequence analysed by comparison with reference plasmids. pHN7A8 is a circular molecule of 76 878 bp. bla(CTX-M-65), fosA3 and rmtB are found in known contexts, interspersed with different mobile elements including ISEcp1, IS1, Tn2, IS1294, IS903 and four copies of IS26. This multiresistance region has only a single nucleotide difference from that of pXZ, an F2:A-:B- plasmid isolated from poultry in China. The pHN7A8 backbone carries genes encoding addiction and partitioning systems that promote plasmid maintenance and has a similar organization to pXZ, as well as IncFII plasmids such as R100, pC15-1a/pEK516 and pHK23, isolated in Japan, Canada/the UK and China, respectively, but with varying levels of identity, suggesting recombination. pHN7A8 is a chimera that may have resulted from the acquisition, by recombination in the plasmid backbone, of the multiresistance region found in pXZ. This region appears to have evolved from the resistance determinant R100 through the stepwise integration of multiple antimicrobial resistance determinants from different sources by the actions of mobile elements and recombination. The successful dissemination of this multidrug resistance plasmid presents further challenges for the prevention and treatment of Enterobacteriaceae infections.

  7. Physical mapping of a 7A.7D translocation in the wheat-Thinopyrum ponticum partial amphiploid BE-1 using multicolour genomic in situ hybridization and microsatellite marker analysis.

    Science.gov (United States)

    Sepsi, A; Molnár, I; Molnár-Láng, M

    2009-09-01

    The absence of chromosome 7D in the wheat-Thinopyrum ponticum partial amphiploid BE-1 was detected previously by multicolour genomic in situ hybridization, sequential FISH (fluorescence in situ hybridization) using repetitive DNA probes, and SSR marker analysis. In the present study the previous cytogenetic and SSR marker analyses were expanded to include 25 other SSR markers assigned to wheat chromosomes 7A and 7D to confirm the presence of a 7A.7D translocation and to specify its composition. An almost complete chromosome 7A and a short chromosome segment derived from the terminal region of 7DL were detected, confirming the presence of a terminal translocation involving the distal regions of 7AL and 7DL. In both cases the position of the translocation breakpoint was different from that of known deletion lines. The identification of the 7AL.7DL translocation and its breakpoint position provides a new physical landmark for future physical mapping studies, opening up the possibility of more precise localization of genes or molecular markers within the terminal regions of 7DL and 7AL.

  8. Glucomannan and glucomannan plus spirulina added to pork significantly block dietary cholesterol effects on lipoproteinemia, arylesterase activity, and CYP7A1 expression in Zucker fa/fa rats.

    Science.gov (United States)

    González-Torres, Laura; Vázquez-Velasco, Miguel; Olivero-David, Raúl; Bastida, Sara; Benedí, Juana; González, Rafaela Raposo; González-Muñoz, Ma José; Sánchez-Muniz, Francisco J

    2015-12-01

    Zucker fa/fa rats easily develop dyslipidemia and obesity. Restructured pork (RP) is a suitable matrix for including functional ingredients. The effects of glucomannan- RP or glucomannan plus spirulina-enriched RP on plasma lipid/lipoprotein levels, cytochrome P450 7A1 (CYP7A1) expression, and arylesterase activity in growing fa/fa rats fed high-energy, high-fat cholesterol-enriched diets were tested. Groups of six rats each received diet containing 15% control-RP (C), 15% glucomannan-RP diet (G), 15% glucomannan + spirulina-RP diet (GS), and same diets enriched with 2.4% cholesterol and 0.49% cholic acid (cholesterol-enriched control (HC), cholesterol-enriched glucomannan (HG), and cholesterol-enriched glucomannan + spirulina (HGS) diets) over a 7-week period. C diet induced obesity, severe hyperglycemia, moderate hypercholesterolemia, and hypertriglyceridemia. Those facts were not significantly modified by G or GS diets. G diet increased CYP7A1 expression but decreased the total cholesterol/high density lipoproteins (HDL)-cholesterol ratio (p food intake, body weight gain, and plasma glucose (p foods and notably blocked the dietary cholesterol effects. In addition, HGS-RP improved the glucomannan hypolipidemic effects, increased arylesterase/HDL-cholesterol activity, and decreased insulin resistance.

  9. PODAAC-GHWSA-3UR7A

    Data.gov (United States)

    National Aeronautics and Space Administration — The WindSat Polarimetric Radiometer, launched on January 6, 2003 aboard the Department of Defense Coriolis satellite, was designed to measure the ocean surface wind...

  10. Song 7, 'A Seeing off Song'

    OpenAIRE

    Hu Qianma

    2011-01-01

    .wav audio file This song says, please be careful on your way. When you leave, I sincerely bless you. When you come back, I’ll restrain the dog to allow you to enter my home. Please don’t forget the people who love you. We bless and support you constantly. 这首歌的歌意为,在你的路上要小心。在你离别的时候我真心实意地祝福你。当你回来的时候我会为你挡着狗让你进入我的家。不要忘记爱你的人们。我们时常都祝福和支持你。 གླུ་འདིའི་ནང་དོན་ནི་ཁྱོད་ཀྱི་ལམ་ནང་དུ་སེམས་ཆུང་བྱོས། ཁྱོད་འགྲོ་བའི་དུས་སུ་ངས་སེམས་པ་རྣམ་དག་གིས་ཁྱོད་ལ་སྨོན་ལམ་འདེབས། ཁྱོད་ཕྱིར་ལོག་པའི་དུས་སུ་ངས་ཁྱི་བཀ...

  11. Landsat 7 - A challenge to America

    Science.gov (United States)

    Colvocoresses, Alden P.

    Factors in favor of Landsat 7 are discussed; they include: reasonable cost, a base on which to examine global change, and the need for comprehensive and continuous satellite coverage of the earth at moderate (5-30 m) resolution, in view of various occurrences on the earth's surface, ranging from the Chernobyl disaster to deforestation to the Persian Gulf conflict. Attention is given to proposed parameters for Landsat 7 and suggested actions that should be taken by Congress, the Administration, and the public to implement this space program.

  12. PODAAC-GHAMS-3GR7A

    Data.gov (United States)

    National Aeronautics and Space Administration — The Advanced Microwave Scanning Radiometer (AMSR-E) was launched on 4 May 2002, aboard NASA's Aqua spacecraft. The National Space Development Agency of Japan (NASDA)...

  13. 7 A GIS Estimation of Soil Loss

    African Journals Online (AJOL)

    Administrator

    mountains dominate the northern part of the catchment, the south lowland flatly slopes to join the sea. The area slopes from the north, as high as 850 m above sea .... loam, loamy a b. map = x 5.41 mapmaximum (a.map) a c. map = x 2.25 mapmaximum (a.map). Owusu: Estimation of soil loss in the Densu basin in Ghana. 45 ...

  14. Exo-exo synergy between Cel6A and Cel7A from Hypocrea jecorina: Role of carbohydrate binding module and the endo-lytic character of the enzymes.

    Science.gov (United States)

    Badino, Silke F; Christensen, Stefan J; Kari, Jeppe; Windahl, Michael S; Hvidt, Søren; Borch, Kim; Westh, Peter

    2017-08-01

    Synergy between cellulolytic enzymes is essential in both natural and industrial breakdown of biomass. In addition to synergy between endo- and exo-lytic enzymes, a lesser known but equally conspicuous synergy occurs among exo-acting, processive cellobiohydrolases (CBHs) such as Cel7A and Cel6A from Hypocrea jecorina. We studied this system using microcrystalline cellulose as substrate and found a degree of synergy between 1.3 and 2.2 depending on the experimental conditions. Synergy between enzyme variants without the carbohydrate binding module (CBM) and its linker was strongly reduced compared to the wild types. One plausible interpretation of this is that exo-exo synergy depends on the targeting role of the CBM. Many earlier works have proposed that exo-exo synergy was caused by an auxiliary endo-lytic activity of Cel6A. However, biochemical data from different assays suggested that the endo-lytic activity of both Cel6A and Cel7A were 10 3 -10 4 times lower than the common endoglucanase, Cel7B, from the same organism. Moreover, the endo-lytic activity of Cel7A was 2-3-fold higher than for Cel6A, and we suggest that endo-like activity of Cel6A cannot be the main cause for the observed synergy. Rather, we suggest the exo-exo synergy found here depends on different specificities of the enzymes possibly governed by their CBMs. Biotechnol. Bioeng. 2017;114: 1639-1647. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  15. Evaluación Informatizada de la Atención para Niños de 7 a 11 Años: El DiViSA-UAM y el TACIUAM

    OpenAIRE

    M.ª Ángeles Quiroga Estévez; José Santacreu Mas; Alejandra Montoro; Agustín Martínez-Molina; Pei Chun Shih

    2011-01-01

    El objetivo de este estudio ha sido elaborar dos test informatizados que midan los componentes de la atención que permiten caracterizar a los niños diagnosticados TDAH. Para su elaboración se han tenido en cuenta los estudios sobre desarrollo de la atención así como las críticas recibidas por los instrumentos de evaluación disponibles, en un claro intento por superarlas. Ambos test se administraron a 423 escolares (de 2º a 6º) de 7 a 11 años de edad. Los datos obtenidos muestran el patrón de ...

  16. Landscapes of The Mind: The Setting as Psyche in Nathaniel Hawthorne's The Scarlet Letter And F. Scott Fitzgerald's The Great Gatsby Landscapes of The Mind: The Setting as Psyche in Nathaniel Hawthorne's The Scarlet Letter And F. Scott Fitzgerald's The Great Gatsby

    Directory of Open Access Journals (Sweden)

    Cruce Stark

    2009-09-01

    Full Text Available In the closing moment of F. Scott Fitzgerald's The Great Gateby, Nick returns for one last look at what once was Gateby's house. But instead of physical buildings, he has a vision of an earlier time, a vision of the "old island" that "flowered once for Dutch sailor's eyes -- a fresh green breast of the new world." "For a transitory enchanted moment," Nick thinks, "man must have held his breath in the presence of this continent, compelled into an aesthetic contemplation he neither understood nor desired, face to face for the last time in history with something commensurate to his capacity for wonder (182." In the closing moment of F. Scott Fitzgerald's The Great Gateby, Nick returns for one last look at what once was Gateby's house. But instead of physical buildings, he has a vision of an earlier time, a vision of the "old island" that "flowered once for Dutch sailor's eyes -- a fresh green breast of the new world." "For a transitory enchanted moment," Nick thinks, "man must have held his breath in the presence of this continent, compelled into an aesthetic contemplation he neither understood nor desired, face to face for the last time in history with something commensurate to his capacity for wonder (182."

  17. Localization of a gene for autosomal dominant Larsen syndrome to chromosome region 3p21.1-14.1 in the proximity of, but distinct from the COL7A1 locus

    Energy Technology Data Exchange (ETDEWEB)

    Vujic, M.; Hallstensson, K.; Wahlstroem, J. [East Hospital, Gothenburg (Sweden)] [and others

    1995-11-01

    Larsen syndrome (LS) is a skeletal dysplasia (osteochondrodysplasia) in which multiple dislocations of the large joints are the major feature. Nosology in this group of diseases, which constitutes 8% of Mendelian disorders in man, is primarily based on clinical and radiographic features. Hopes for more accurate classification grounds are currently being met by progress in elucidation of underlying genetic defects. We have performed linkage analysis in a large Swedish kindred with autosomal dominant LS and found the gene (LAR1) to be strongly linked to chromosome 3p markers (Z{sub max} = 13.4 at {theta} = .00). Recombination analysis indicates that the LAR1 locus is located in a region defined distally by D3S1581 and proximally by D3S1600, which cytogenetically maps to chromosome region 3p21.1-14.1. Linkage and recombination analysis of a COL7A1 PvuII intragenic polymorphism versus LS and chromosome 3 markers indicate that COL7A1 is located close to, but distinct from, the LAR1 locus. 33 refs., 6 figs., 3 tabs.

  18. Quantitative real-time RT-PCR validation of differential mRNA expression of SPARC, FADD, Fascin, COL7A1, CK4, TGM3, ECM1, PPL and EVPL in esophageal squamous cell carcinoma

    Directory of Open Access Journals (Sweden)

    Wang Yuan

    2006-02-01

    Full Text Available Abstract Background Esophageal squamous cell carcinoma (ESCC is one of the most malignant tumors and typically presents at an advanced and rapidly fatal stage. To better understand the role of genetics in the etiology and prevention of ESCC and to identify potential susceptibility genes as well as early detection markers, we previously compared tumor and matched normal tissues from ESCC patients from a high-risk area of China using cDNA expression microarrays and identified 41 differentially-expressed genes (13 over-expressed and 28 under-expressed. Methods In the current study, we validated and quantitated differential mRNA expression in a sample of nine of these 41 genes, including four that were over-expressed (SPARC, FADD, Fascin, COL7A1, and five that were under-expressed (CK4, TGM3, ECM1, PPL, EVPL, in 75 new ESCC patients using quantitative Real-time RT-PCR and the 2-ΔΔCT method to examine both tumor and matched normal tissue. In addition, we examined expression patterns for these genes by selected demographic and clinical characteristics. Results Four previously over-expressed (tumor ≥2-fold normal genes were all increased in the majority of new ESCC patients: SPARC was increased in 71% of patients, Fascin in 70%, FADD in 63%, and COL7A1 in 57%. Five previously under-expressed (tumor ≤0.5-fold normal genes similarly showed decreased mRNA expression in two-thirds or more of patients: CK4 was decreased in 83% of patients, TGM3 in 77%, ECM1 in 73%, and PPL and EVPL in 67% each. In subset analyses, associations with age (for COL7A1, family history (for PPL and ECM1, and alcohol use (for SPARC and Fascin were also noted. Conclusion These data indicate that these nine genes have consistent differential mRNA expression, validating results of our previous cDNA array results, and affirming their potential role in the early detection of ESCC.

  19. Evaluación de un libro electrónico multimedia para el aprendizaje de la lectura y escritura en niños (6-7 años)

    OpenAIRE

    Briceño Marcano, Milagros; Romero Tena, Rosalía

    2011-01-01

    La investigación evalúa un libro electrónico multimedia basado en estrategias de aprendizaje que facilitan el proceso de lectura y escritura en niños de 6-7años. Partiendo del libro electrónico diseñado y desarrollado se construyeron los instrumentos de evaluación. Para la validación se utilizó el Método Delphi. Con la versión final se realizó la evaluación por parte de expertos en contenido, tecnología y docentes usuarios. Se evaluaron los aspectos funcionales y de utilidad, cont...

  20. Una propuesta multimediática para la enseñanza y aprendizaje de la música en niños de 7 a 11 años : un enfoque educomunicativo

    OpenAIRE

    Vásquez Sena, Marcos

    2009-01-01

    La presente tesis es una propuesta verbo-audio-visual para la enseñanza y el aprendizaje de la música para niños de 7 a 11 años. La óptica bajo la cual se elabora este estudio es el enfoque de la Comunicación Educativa, en donde se resalta la importancia de las tecnologías de información y comunicación (TIC) en el proceso de enseñanza y aprendizaje, dentro de la educación formal como factor esencial para la formación integral del educando. Este planteamiento teórico realiza una conjugación de...

  1. Case Report: Whole exome sequencing reveals a novel frameshift deletion mutation p.G2254fs in COL7A1 associated with autosomal recessive dystrophic epidermolysis bullosa [version 1; referees: 2 approved, 1 approved with reservations

    Directory of Open Access Journals (Sweden)

    Shamsudheen Karuthedath Vellarikkal

    2016-05-01

    Full Text Available Dystrophic epidermolysis bullosa simplex (DEB is a phenotypically diverse inherited skin fragility disorder. It is majorly manifested by appearance of epidermal bullae upon friction caused either by physical or environmental trauma. The phenotypic manifestations also include appearance of milia, scarring all over the body and nail dystrophy. DEB can be inherited in a recessive or dominant form and the recessive form of DEB (RDEB is more severe. In the present study, we identify a novel p.G2254fs mutation in COL7A1 gene causing a sporadic case of RDEB by whole exome sequencing (WES. Apart from adding a novel frameshift Collagen VII mutation to the repertoire of known mutations reported in the disease, to the best of our knowledge, this is the first report of a genetically characterized case of DEB from India.

  2. Case Report: Whole exome sequencing reveals a novel frameshift deletion mutation p.G2254fs in COL7A1 associated with autosomal recessive dystrophic epidermolysis bullosa [version 2; referees: 2 approved, 1 approved with reservations

    Directory of Open Access Journals (Sweden)

    Shamsudheen Karuthedath Vellarikkal

    2016-07-01

    Full Text Available Dystrophic epidermolysis bullosa simplex (DEB is a phenotypically diverse inherited skin fragility disorder. It is majorly manifested by appearance of epidermal bullae upon friction caused either by physical or environmental trauma. The phenotypic manifestations also include appearance of milia, scarring all over the body and nail dystrophy. DEB can be inherited in a recessive or dominant form and the recessive form of DEB (RDEB is more severe. In the present study, we identify a novel p.G2254fs mutation in COL7A1 gene causing a sporadic case of RDEB by whole exome sequencing (WES. Apart from adding a novel frameshift Collagen VII mutation to the repertoire of known mutations reported in the disease, to the best of our knowledge, this is the first report of a genetically characterized case of DEB from India.

  3. Data of evolutionary structure change: 1EY7A-2PW7A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQG...LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETK-----VEKYGPEASAFTKKMYENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQG

  4. The FACT-G7: a rapid version of the functional assessment of cancer therapy-general (FACT-G) for monitoring symptoms and concerns in oncology practice and research.

    Science.gov (United States)

    Yanez, B; Pearman, T; Lis, C G; Beaumont, J L; Cella, D

    2013-04-01

    Health-related quality-of-life (HRQOL) assessments in research and clinical oncology settings are increasingly important. HRQOL instruments need to be rapid and still maintain the ability to capture the most relevant patient issues in a valid and reliable manner. The current study develops and validates the FACT-G7, a rapid version of the Functional Assessment of Cancer Therapy-General (FACT-G). Oncology patients with advanced cancer (N = 533) from 11 diseases sites ranked the symptoms and concerns they viewed as 'the very most important' when undergoing cancer treatment, completed the FACT-G, and additional HRQOL measures. Oncology patients' scores were referenced across a general US population sample (N = 2000). We selected the highest priority cancer-related symptoms and concerns endorsed by patients for inclusion in the FACT-G7. Fatigue and ability to enjoy life were ranked the most highly. The results provide preliminary support for the FACT-G7's internal consistency reliability (α = 0.74) and validity as evidenced by moderate-to-strong relationships with expected criteria. The references for the general population are summarized. The FACT-G7 can be used to assess top-rated symptoms and concerns for a broad spectrum of advanced cancers in clinical practice and research.

  5. Proto-oncogene FBI-1 (Pokemon/ZBTB7A) Represses Transcription of the Tumor Suppressor Rb Gene via Binding Competition with Sp1 and Recruitment of Co-repressors*S⃞

    Science.gov (United States)

    Jeon, Bu-Nam; Yoo, Jung-Yoon; Choi, Won-Il; Lee, Choong-Eun; Yoon, Ho-Geun; Hur, Man-Wook

    2008-01-01

    FBI-1 (also called Pokemon/ZBTB7A) is a BTB/POZ-domain Krüppel-like zinc-finger transcription factor. Recently, FBI-1 was characterized as a proto-oncogenic protein, which represses tumor suppressor ARF gene transcription. The expression of FBI-1 is increased in many cancer tissues. We found that FBI-1 potently represses transcription of the Rb gene, a tumor suppressor gene important in cell cycle arrest. FBI-1 binds to four GC-rich promoter elements (FREs) located at bp –308 to –188 of the Rb promoter region. The Rb promoter also contains two Sp1 binding sites: GC-box 1 (bp –65 to –56) and GC-box 2 (bp –18 to –9), the latter of which is also bound by FBI-1. We found that FRE3 (bp –244 to –236) is also a Sp1 binding element. FBI-1 represses transcription of the Rb gene not only by binding to the FREs, but also by competing with Sp1 at the GC-box 2 and the FRE3. By binding to the FREs and/or the GC-box, FBI-1 represses transcription of the Rb gene through its POZ-domain, which recruits a co-repressor-histone deacetylase complex and deacetylates histones H3 and H4 at the Rb gene promoter. FBI-1 inhibits C2C12 myoblast cell differentiation by repressing Rb gene expression. PMID:18801742

  6. Propiedades psicométricas de la Prueba de Procesamiento Fonológico “PROFON” en niños de 4 a 7 años de edad

    Directory of Open Access Journals (Sweden)

    Jaime Castro Martínez

    2011-12-01

    Full Text Available Este estudio exploró las propiedades psicométricas de la Prueba de Procesamiento Fonológico de Lara, Serra, Aguilar y Flórez (2005 en una muestra de 478 niños de 4 a 7 años de edad en Bogotá y Chía en varios niveles socioeconómicos. Se analizó con pruebas de dificultad, discriminación, matriz de relaciones tetracóricas, coeficiente Alfa de Cronbach y análisis de componentes principales con rotación varimax para validez de constructo. Los resultados mostraron, en conciencia fonológica, un buen rendimiento menos en cuatro ítems, correspondencia del análisis de factores con la división es subescalas y niveles, y alta confiabilidad con bajo nivel de discriminación en la subescala de memoria fonológica. Los resultados se discutieron con base en los componentes de la habilidad de procesamiento fonológico.

  7. Evaluación Informatizada de la Atención para Niños de 7 a 11 Años: El DiViSA-UAM y el TACIUAM

    Directory of Open Access Journals (Sweden)

    M.ª Ángeles Quiroga Estévez

    2011-01-01

    Full Text Available El objetivo de este estudio ha sido elaborar dos test informatizados que midan los componentes de la atención que permiten caracterizar a los niños diagnosticados TDAH. Para su elaboración se han tenido en cuenta los estudios sobre desarrollo de la atención así como las críticas recibidas por los instrumentos de evaluación disponibles, en un claro intento por superarlas. Ambos test se administraron a 423 escolares (de 2º a 6º de 7 a 11 años de edad. Los datos obtenidos muestran el patrón de desarrollo de cada uno de los índices que aportan las pruebas: eficacia general de la atención, inexactitud, olvidos, organización de la ejecución y distracción-precipitación. Los índices de fiabilidad de estos índices se hallan en el rango 0.77 a 0.96 que se considera satisfactorio. En la discusión se reseña la utilidad que pueden tener ambos test para la valoración del perfil atencional en el niño, sea con un objetivo académico o clínico.

  8. PhD Dissertation Proposal - Introduction to Dark Mix Concept: Gamma Measurements of Capsule Mixture

    Energy Technology Data Exchange (ETDEWEB)

    Meaney, Kevin Daniel [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-10-06

    Presentation slides: Intro to Inertial Confinement Fusion; Types of Mixture in ICF capsules; Previous mixture experiments; Dark Mix Concept; Measuring Dark Mix with Gamma Cherenkov Detector; Dissertation Outline.

  9. Exigência de lisina para aves de reposição de 7 a 12 semanas de idade Requirement of lysine for rearing egg-type pullets from 7 to 12 weeks of age

    Directory of Open Access Journals (Sweden)

    José Humberto Vilar da Silva

    2000-12-01

    Full Text Available Os objetivos deste trabalho foram estimar as exigências de lisina e avaliar seus efeitos na fase de produção de ovos em 200 poedeiras leves (PL Lohmann Selected Leghorn, e 200 poedeiras semipesadas (PSP Isa Brown de 7 a 12 semanas. As aves foram distribuídas em delineamento em blocos ao acaso e alimentadas com ração basal contendo 16,0% de proteína bruta (PB e 2900 kcal/kg de energia metabolizável (EM suplementada com L-lisina HCl para os níveis de 0,50; 0,55; 0,60; 0,65; e 0,70% de lisina total nas rações. Na fase de postura, 160 aves de cada linhagem foram alimentadas com ração de produção contendo 16,5% de PB, 2900 kcal de EM, 2,9% de Ca+2 e 0,755% de lisina. As estimativas das exigências de lisina obtidas pelo ganho de peso, para a fase de 7 a 12 semanas de idade, foram de 0,64%, ou consumo de 368 mg diário para as PL, e de 0,66%, ou consumo de 395 mg diário para as PSP. Produção de ovos, conversão por massa e conversão por dúzia de ovos das linhagens foram afetadas de forma quadrática pelos níveis de lisina da ração. O consumo de ração das PL em produção foi afetado de forma quadrática e das PSP de forma linear. Durante a fase de crescimento, as PL apresentaram menor ganho de peso e consumo de ração e pior conversão alimentar que as PSP. Durante a fase de postura, as PSP apresentaram maiores produção e massa de ovos, menor consumo e melhores conversões por massa e por dúzia de ovos que as PL.The objectives of this work were to estimate the requirement of lysine from 7 to 12 weeks and to evaluate their effect on the egg production phase. Two hundred egg-white pullets (EW, and two hundred egg-brown pullets (EB strains were allotted in randomized block design, and fed a basal diet with 16.0% of crude protein (CP and 2,900 kcal/kg metabolizable energy (ME, supplemented with L-lysine HCl for the level of 0.50, 0.55, 0.60, 0.65, and 0.70% of total lysine in the diet. In the laying period, 160 birds from each

  10. Níveis de sódio na ração de frangas de 7 a 12 semanas de idade Sodium levels for pullets aged between 7 and 12 weeks

    Directory of Open Access Journals (Sweden)

    Marcelo Luís Gomes Ribeiro

    2008-08-01

    Full Text Available O experimento foi realizado para estimar as exigências de sódio em frangas leves (LV e semipesadas (SP, durante a fase de recria (7 a 12 semanas de idade. O delineamento experimental foi inteiramente ao acaso, em esquema fatorial com seis níveis de sódio (0,04; 0,10; 0,16; 0,21; 0,27 e 0,32 % e duas linhagens (LV e SP, que resultaram em doze tratamentos, com cinco repetições de seis aves. Foram avaliados o consumo de ração (CR, consumo de água (CAG, ganho de peso diário (GPD, conversão alimentar (CA, temperatura retal (TR, comprimento da crista (CC, matéria seca das excretas (MSF e umidade das excretas (UF. Não houve interação dos níveis de sódio (NS com a linhagem sobre as variáveis estudadas. O CR não foi afetado pelos NS, porém as frangas SP consumiram mais ração que as LV. Os NS proporcionaram efeito quadrático para o GPD e CA, e a linhagem LV apresentou maior CC que a SP. O aumento do NS da ração elevou o CAG, a UF e diminuiu a MSF, mas a TR não foi alterada. Recomenda-se de 7 a 12 semanas de idade 0,22%, ou o consumo de 123 e 140 mg de sódio para as LV e SP, respectivamente.The experiments were carried out to determine sodium requirements for light (LS and egg-brown (EBS pullets from 7 to 12 weeks of age. It was used a completely randomized design according to a 6x2 factorial (sodium levels: 0.04; 0.10; 0.16; 0.21; 0.27 and 0.32% X 2 strains, with five replicates of six pullets per experimental unit. Feed intake, water intake, daily weight gain, feed: gain ratio, rectal temperature, and comb size were evaluated, as well as feces dry matter and humidity. In the two experiments, there was no interaction (P>0.05 between sodium levels (SL and strains on the studied variables. Feed intake was not affected by LS, but it was greater in EBS than in LS birds (P <0.05. LS had significant effects on daily weight gain and feed: gain ratio according to the quadratic model, and comb size was greater in LS compared to EBS birds

  11. In-situ studies on the micro-structure evolution of A2W2O7 (A = Li, Na, K) during melting by high temperature Raman spectroscopy and density functional theory

    Science.gov (United States)

    Wang, Jian; You, Jinglin; Wang, Min; Lu, Liming; Wan, Songming; Sobol, A. A.

    2017-10-01

    In-situ high temperature Raman spectroscopic (HTRS) technique in combination with density functional theory (DFT) analysis has been adopted to investigate the micro-structure of solid and molten A2W2O7 (A = Li, Na, K). The [WO6] octahedra were found to be connected to each other by corner and edge sharing in the crystalline Li2W2O7 and K2W2O7 compounds. In the crystal lattice of Na2W2O7, on the other hand, the [WO4] tetrahedra and [WO6] octahedra were found to coexist and paired by corner sharing. Although the structural diversity has clearly led to distinct Raman spectra of the crystalline A2W2O7 compounds, the spectra of their melts tended to be analogous, showing the typical vibration modes of (W2O7)2 - dimer. A mechanism was then proposed to explain the structure evolution occurring during the melting process of A2W2O7. The effect of A+ cation on the Raman bands of (W2O7)2 - dimer in molten A2W2O7 has also been investigated. Both the wavenumber and full width at half-height (FWHH) of the characteristic band assigned to the symmetrical stretching vibration mode of Wsbnd Onb (non-bridging oxygen) in (W2O7)2 - were found to decrease in the sequence of Li+, Na+ and K+, indicating the cation effect on the mean bond length and its distribution range of Wsbnd Onb. In addition, the relative intensity of this band was also influenced by the cation and it was increased in the order of Li2W2O7, Na2W2O7 and K2W2O7, which has been explained by the charge transfer process and confirmed by Mulliken overlap population analysis.

  12. Sustained Uptake of a Hospital-Based Handwashing with Soap and Water Treatment Intervention (Cholera-Hospital-Based Intervention for 7 Days [CHoBI7]): A Randomized Controlled Trial.

    Science.gov (United States)

    George, Christine Marie; Jung, Danielle S; Saif-Ur-Rahman, K M; Monira, Shirajum; Sack, David A; Mahamud-ur Rashid; Mahmud, Md Toslim; Mustafiz, Munshi; Rahman, Zillur; Bhuyian, Sazzadul Islam; Winch, Peter J; Leontsini, Elli; Perin, Jamie; Begum, Farzana; Zohura, Fatema; Biswas, Shwapon; Parvin, Tahmina; Sack, R Bradley; Alam, Munirul

    2016-02-01

    Diarrhea is the second leading cause of death in children under 5 years of age globally. The time patients and caregivers spend at a health facility for severe diarrhea presents the opportunity to deliver water, sanitation, and hygiene (WASH) interventions. We recently developed Cholera-Hospital-Based Intervention for 7 days (CHoBI7), a 1-week hospital-based handwashing with soap and water treatment intervention, for household members of cholera patients. To investigate if this intervention could lead to sustained WASH practices, we conducted a follow-up evaluation of 196 intervention household members and 205 control household members enrolled in a randomized controlled trial of the CHoBI7 intervention 6 to 12 months post-intervention. Compared with the control arm, the intervention arm had four times higher odds of household members' handwashing with soap at a key time during 5-hour structured observation (odds ratio [OR]: 4.71, 95% confidence interval [CI]: 2.61, 8.49) (18% versus 50%) and a 41% reduction in households in the World Health Organization very high-risk category for stored drinking water (OR: 0.38, 95% CI: 0.15, 0.96) (58% versus 34%) 6 to 12 months post-intervention. Furthemore, 71% of observed handwashing with soap events in the intervention arm involved the preparation and use of soapy water, which was promoted during the intervention, compared to 9% of control households. These findings demonstrate that the hospital-based CHoBI7 intervention can lead to significant increases in handwashing with soap practices and improved stored drinking water quality 6 to 12 months post-intervention. © The American Society of Tropical Medicine and Hygiene.

  13. Prevalência de má oclusão em crianças de 7 a 12 anos de idade Prevalence of malocclusion in children aged 7 to 12 years

    Directory of Open Access Journals (Sweden)

    Marcio Rodrigues de Almeida

    2011-08-01

    Full Text Available OBJETIVO: verificar a prevalência de más oclusões em 3.466 crianças com 7 a 12 anos de idade, matriculadas em escolas públicas nas cidades de Lins/SP e Promissão/SP. MÉTODOS: considerou-se a relação sagital entre as arcadas dentárias, a relação interarcadas no sentido transversal e a relação de incisivos nos sentidos vertical e horizontal. Na relação intra-arcada avaliou-se a prevalência de diastemas, apinhamentos e perdas dentárias. RESULTADOS: entre as más oclusões, 55,25% das crianças apresentaram uma relação molar de Classe I, seguida de 38% de Classe II e 6,75% de Classe III. Na relação de incisivos houve prevalência de mordida aberta em 17,65% dos casos, seguida de 13,28% para mordida profunda e 5,05% de mordida cruzada anterior. A mordida cruzada posterior foi encontrada em 13,3% das crianças. Na relação intra-arcada, 31,88% das crianças mostraram diastemas; 31,59%, apinhamento; e 4,65%, perdas dentárias.OBJECTIVE: This study determined the prevalence of malocclusion in a group of 3,466 children aged 7 to 12 years enrolled in public school in the cities of Lins and Promissão, in the state of São Paulo, Brazil. METHODS: It was analyzed the sagittal relationships between dental arches, the transverse relationship between arches, and the vertical and horizontal relations of incisors. The prevalence of diastemas, crowding and tooth losses were evaluated. RESULTS: Among the types of malocclusion, 55.25% of the children had a Class I molar relationship; 38%, Class II; and 6.75%, Class III. The analysis of incisor relationships revealed 17.65% of open bite, followed by 13.28% of deep bite and 5.05% of anterior crossbite; 13.3% of the children had a posterior crossbite. The analysis of relationships between arches showed that 31.88% of the children had diastemas; 31.59%, crowding; and 4.65, tooth losses.

  14. Análise postural fotogramétrica de crianças saudáveis de 7 a 10 anos: confiabilidade interexaminadores Photogrammetric postural analysis on healthy seven to ten-year-old children: interrater reliability

    Directory of Open Access Journals (Sweden)

    MM Santos

    2009-08-01

    Full Text Available OBJETIVOS: Testar a concordância interexaminadores da fotogrametria aplicada para avaliar o alinhamento postural em crianças. MÉTODOS: Foram mensurados 33 variáveis obtidas de imagens de 122 crianças saudáveis, 58 meninos (8,39±0,97 anos e 64 meninas (8,42±1,06 anos, na faixa etária de 7 a 10 anos. Foi utilizada uma máquina fotográfica digital Sony® 6.0MP DSC-T9, posicionada sobre um tripé (Vanguard VT-131 com altura de 90 cm, a uma distância de 300 cm da criança. Os pontos anatômicos de interesse foram marcados com adesivos coloridos (Pimaco® sobre esferas de isopor de 1 cm de diâmetro. Registros fotográficos foram obtidos com a criança em trajes de banho, em posição ortostática, nas vistas frontal anterior, posterior, lateral esquerda e direita. Cada registro fotográfico foi analisado por três examinadores previamente treinados que usaram o Software de Avaliação Postural (SAPo. O programa estatístico SAS/STAT v.9 foi usado para obtenção dos coeficientes de correlação interclasse (CCI. RESULTADOS: Os resultados demonstram uma excelente concordância interexaminadores (CCI>0,90 para 28 variáveis (84,85% e boa concordância (0,80> CCI>0,89 para 5 variáveis (15,15%, mesmo na vigência de uma categorização rigorosa. CONCLUSÃO: O método testado demonstrou ser viável e com potencial para gerar dados de referência sobre o alinhamento postural de crianças.OBJECTIVES: To test the interrater agreement of photogrammetry used to assess postural alignment among children. METHODS: Thirtythree variables were measured from images of 122 healthy children aged seven to ten years, that is, 58 boys (8.39±0.97 years and 64 girls (8.42±1.06 years. A digital camera (Sony® 6.0 MP DSC-T9 was positioned on a tripod (Vanguard VT-131 at a height of 90 cm and at a distance of 300 cm from the child. The anatomical points of interest were marked with colored adhesives (Pimaco® on polystyrene spheres of 1 cm in diameter. The

  15. Le pouvoir managérial dans les sociétés de contrôle. Socialisation de la psyché dans les organisations hypermodernes

    OpenAIRE

    Fridlender, Jean-Marc

    2008-01-01

    Building on the theories of power put forward by Foucault and those developed in clinical sociology, our research explores the psycho-sociological aspects of managerial power and how it impacts on modern societies. More specifically, our thesis considers the dynamic functioning of the managerial structure of power in corporations. We describe a global mediation control process of socialization based on a functional correspondence between psychic structures and organizational structures, throu...

  16. Uma investigação sobre a aquisição de estrutura argumental dos predicados psicológicos = An investigation on the acquisition of psych predicates argument structure

    Directory of Open Access Journals (Sweden)

    Naves, Rozana Reigota

    2012-01-01

    Full Text Available Neste artigo, apresentamos resultados de pesquisa de campo com foco na aquisição de verbos psicológicos, empreendida com 30 sujeitos de 4 a 7 anos, e 30 sujeitos de 9 a 10 anos. O intuito é investigar a questão teórica conhecida como “problema de mapeamento dos verbos psicológicos”, que consiste na possibilidade de inversão sintática de papéis temáticos em pares de verbos de significado “reversível” como temer e assustar. Buscamos testar a hipótese de que o problema de mapeamento dos verbos psicológicos tem implicações para o processo de aquisição da linguagem e que verbos psicológicos são mais difíceis de adquirir do que verbos de ação. Pressupomos haver uma propensão inata para o mapeamento de argumentos com base em traços semânticos, organizados hierarquicamente, e defendemos que o papel temático de Experienciador é preferido para posição de sujeito, quando em contraposição a um papel temático menos agentivo e menos volitivo, como o Tema

  17. 77 FR 19531 - 7(a) Loan Program; Eligible Passive Companies

    Science.gov (United States)

    2012-04-02

    ...) loan that includes working capital and/or the purchase of other assets, including intangible assets...(a) loan including working capital for use by the Operating Company, the regulation requires the... capital when the Eligible Passive Company applies for a loan primarily to finance the acquisition of real...

  18. TTC7A mutations disrupt intestinal epithelial apicobasal polarity

    NARCIS (Netherlands)

    Bigorgne, Amélie E; Farin, Henner F; Lemoine, Roxane; Mahlaoui, Nizar; Lambert, Nathalie; Gil, Marine; Schulz, Ansgar; Philippet, Pierre; Schlesser, Patrick; Abrahamsen, Tore G; Oymar, Knut; Davies, E Graham; Ellingsen, Christian Lycke; Leteurtre, Emmanuelle; Moreau-Massart, Brigitte; Berrebi, Dominique; Bole-Feysot, Christine; Nischke, Patrick; Brousse, Nicole; Fischer, Alain; Clevers, Hans; de Saint Basile, Geneviève

    Multiple intestinal atresia (MIA) is a rare cause of bowel obstruction that is sometimes associated with a combined immunodeficiency (CID), leading to increased susceptibility to infections. The factors underlying this rare disease are poorly understood. We characterized the immunological and

  19. Windows 7 A quick, hands-on introduction

    CERN Document Server

    Lee, Wei-Meng

    2009-01-01

    This compact book offers the quickest path for Windows users to get started with Microsoft's Windows 7 operating system. You get the essential information you need to upgrade or install the system and configure it to fit your activities, along with a tour of Windows 7's features and built-in applications. Microsoft has learned from the mistakes of Windows Vista, and Windows 7 shows it-this new OS is much faster and more stable. With Windows 7: Up and Running, you'll learn what's new and what's changed from XP and Vista, and get advice on ways to use this system for work, entertainment, inst

  20. 78 FR 12633 - 504 and 7(a) Loan Programs Updates

    Science.gov (United States)

    2013-02-25

    ... an applicant lists a minor child as a majority owner and CEO of a concern, but a parent of the child... child's ownership and position to determine who actually controls the business, and consider the... provide strict criteria including procedures for ``careful review'' of any person with 20% ownership in...

  1. TRPM7: a unique channel involved in magnesium homeostasis.

    Science.gov (United States)

    Paravicini, Tamara M; Chubanov, Vladimir; Gudermann, Thomas

    2012-08-01

    TRPM7 is a ubiquitously expressed cation channel with a fused alpha kinase domain. It is highly permeable to magnesium and calcium, and is negatively gated by intracellular Mg(2+) and Mg-ATP. Substrates for the TRPM7 kinase domain include annexinA1 and myosin IIA heavy chain, and there is evidence to suggest a functional interaction between the channel and kinase domains. Alterations in the expression and activity of TRPM7 have profound effects on cell proliferation and differentiation. Genetic deletion of TRPM7 in model systems demonstrates that this channel is critical for cellular growth and embryonic development. Here, we provide a brief overview of the activity of TRPM7 and the associated regulatory mechanisms. We will then discuss the biological functions of TRPM7, emphasizing its role in development and the potential pathophysiological significance of TRPM7 in neurological and cardiovascular disease. Copyright © 2012 Elsevier Ltd. All rights reserved.

  2. Desarrollo de la percepción musical consciente, aplicando el método Brainin, en niños y niñas de 7 años inscritos en el programa curso básico de música de la Universidad de Caldas

    OpenAIRE

    Aristizábal Villegas, Luz Helena

    2007-01-01

    Tesis (Maestría en Educación. Docencia).Universidad de Manizales. Facultad de Ciencias Sociales y Humanas, 2007 Estudio de tipo cuasi-experimental, que buscó desarrollar la percepción musical consciente en niños y niñas de 7 años, pertenecientes al grupo de Teoría Musical de Primer Año, inscritos al Programa Curso Básico en Música de la Universidad de Caldas, mediante la aplicación del método “Desarrollo del intelecto musical” creado por Valeri Brainin.

  3. Medición de potencia en la configuración 7A2 del reactor RP-0 usando la técnica de ruido neutrónico acoplado a una cámara de ionización compensada

    OpenAIRE

    Bruna, Rubén; Paredes, P.; Oré, Julio

    2002-01-01

    Se presentan los resultados de las mediciones de ruido neutrónico realizadas en el reactor RP-0 en la configuración 7A2, utilizando la barra BC3 para alcanzar la criticidad. Estas mediciones se realizaron utilizando una cámara de ionización compensada (CIC) ubicada en la posición E2. Finalmente, se presenta la calibración en potencia de la cámara de marcha 4 de la instrumentación del reactor.

  4. (6aS,11aR,11cS-8-Sulfanylidene-2,3,5,6,6a,7,11,11a,11b,11c-decahydro-3a,7a-diaza-1H,4H-benzo[de]anthracen-3a-ium chloride hemihydrate

    Directory of Open Access Journals (Sweden)

    Liang Wang

    2011-07-01

    Full Text Available The title compound, C15H23N2S+·Cl−·0.5H2O, was prepared from (6aS,11aR,11cS-2,3,5,6,6a,7,11,11a,11b,11c-decahydro-3a,7a-diaza-1H,4H-benzo[de]anthracene-8-one (sophocarpine and Lawesson's reagent. The thione-substituted ring is in an envelope conformation and the three other six-membered rings are in chair conformations. In the crystal, anions and cations are linked by N—H...Cl and weak C—H...Cl hydrogen bonds. One 0.5-occupancy solvent water molecule lies on a twofold rotation axis and another 0.25-occupancy solvent water molecule is in a general position. The H atoms of these water molecules were not located or included in the refinement.

  5. "Verklig etablering från vilket en affärsmässigt motiverad verksamhet bedrivs." : En utredning om vad som krävs för att en verklig etablering enligt 39a kap. 7a§ IL ska föreligga.

    OpenAIRE

    Joshi, Shriti

    2012-01-01

    CFC lagstiftningen har i syfte att förhindra eller försvåra skatteplanering genom transaktioner med lågbeskattade utländska juridiska personer som leder till att skattebasen i Sverige minskar. Lagstiftningen innebär att en delägare i ett lågbe-skattat utländskt bolag kan beskattas löpande för sin andel av det överskott som uppkommer. Efter EU- domstolens dom i Cadbury Schweppes målet 2006 , införde regeringen en ny undantagsregel i 39a kap. 7a § IL för att harmonisera de svenska CFC reglerna ...

  6. Site investigation SFR. Hydrochemical characterisation of groundwater in the SFR repository. Sampling and analysis during 2010. Extended investigations in KFR7A: 48.0 to 74.7 m KFR08: 63.0 to 104.0 m and KFR19: 95.6 to 110.0 m

    Energy Technology Data Exchange (ETDEWEB)

    Nilsson, Kersti (Geosigma AB (Sweden))

    2011-03-15

    This report presents chemistry data from the extended sampling in SFR, performed every five years. The extended sampling yielded groundwater chemistry data in accordance with SKB chemistry class 3, 4 and 5 and included all water bearing borehole sections. Supplementary, more extensive, hydrochemical groundwater investigations were performed in three borehole sections: KFR7A:1 (48.0-74.7 m borehole length; 134.0-134.9 m.b.s.l.), KFR08:1 (63.0-104.0 m borehole length; 91.5-95.1 m.b.s.l.) and KFR19:1 (95.6-110.0 m borehole length; 58.2-54.5 m.b.s.l.) with a second purpose to supply important additional data to the SFR extension project. Samples for chemical analyses (major constituents, trace metals and isotopes) were collected in all three borehole sections and on-line measurements of pH, redox potential (Eh) and water temperature were also performed. The measurements were conducted in a flow through cell at the orifice of the boreholes. In addition, on-line measurements of electrical conductivity (EC) and dissolved oxygen were conducted in KFR19:1. Furthermore, enrichments of humic and fulvic acids for determination of delta13C and 14C in organic material were performed in all three sections and sampling for analyses of dissolved gas was performed in KFR08:1 and KFR19:1. The three borehole sections with redox measurements showed stable water composition during the sampling periods. The chloride concentrations amounted to between 2,790 mg/L (KFR19:1) and 3,670 mg/L (KFR7A:1). All of the measured redox potentials (Eh) reached stable and consistent values (-153 mV in KFR7A:1, -156 mV in KFR08:1 and -168 mV in KFR19:1). All three borehole sections showed relatively high oxygen-18 values indicating a clearly marine origin of the groundwaters. No major changes of the water chemistry in the four boreholes included in the annual hydrochemistry monitoring program have been noticed during 2010. A slow shift towards lower chloride concentrations can be noticed when data for a

  7. About Face

    Medline Plus

    Full Text Available ... feeling better, you may have PTSD (posttraumatic stress disorder). Watch the intro This is AboutFace In these videos, Veterans, family members, and clinicians share their experiences ...

  8. MOVES Degree Update: Curriculum Revision Proposal

    OpenAIRE

    Darken, Chris

    2012-01-01

    MOVES Research & Education Systems Seminar: Presentation; Session 1: Educational Initiatives and Status, Moderator: Chris Darken; MOVES Degree Update, Speaker Chris Darken Outline: Brief intro to MOVES Masters degree, Pressures driving the proposed curriculum revision, Salient features of the proposal

  9. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... Health Administration 83 views 5:45 VA Community Care - Virtru Pro - Duration: 2:35. Veterans Health Administration 410 views 2:35 Intro to CPRS For Nursing Students 15: Notes Tab - Writing a Note - Duration: ...

  10. CADDIS Volume 4. Data Analysis: Exploratory Data Analysis

    Science.gov (United States)

    Intro to exploratory data analysis. Overview of variable distributions, scatter plots, correlation analysis, GIS datasets. Use of conditional probability to examine stressor levels and impairment. Exploring correlations among multiple stressors.

  11. About Face

    Medline Plus

    Full Text Available ... and you're not feeling better, you may have PTSD (posttraumatic stress disorder). Watch the intro This ... Choose a topic below to hear what they have to say. What is PTSD? → How does PTSD ...

  12. digging history: an interaction of archaeology with school history in a ...

    African Journals Online (AJOL)

    Their version of technological development in Southern. Africa; for instance ... high school has fanned an • Archaeology and African .... heavy tools made from cobbles of andesite rock. .... ists, using the methods learnt about in the intro-.

  13. New pneumococcal conjugate vaccine introductions in four sub ...

    African Journals Online (AJOL)

    dose vials without preserva- tive, raising concerns about the risk of Adverse Events. Following Immunisations (AEFIs) when first intro- duced in low-income settings8. As more vaccines are added to routine immunisation schedules, questions have ...

  14. CADDIS Volume 2. Sources, Stressors and Responses: Unspecified Toxic Chemicals - Simple Conceptual Diagram

    Science.gov (United States)

    Intro to the unspecified toxic chemicals module, when to list toxic chemicals as a candidate cause, ways to measure toxic chemicals, simple and detailed conceptual diagrams for toxic chemicals, toxic chemicals module references and literature reviews.

  15. CADDIS Volume 2. Sources, Stressors and Responses: Unspecified Toxic Chemicals - Detailed Conceptual Diagram

    Science.gov (United States)

    Intro to the unspecified toxic chemicals module, when to list toxic chemicals as a candidate cause, ways to measure toxic chemicals, simple and detailed conceptual diagrams for toxic chemicals, toxic chemicals module references and literature reviews.

  16. CADDIS Volume 2. Sources, Stressors and Responses: Unspecified Toxic Chemicals

    Science.gov (United States)

    Intro to the unspecified toxic chemicals module, when to list toxic chemicals as a candidate cause, ways to measure toxic chemicals, simple and detailed conceptual diagrams for toxic chemicals, toxic chemicals module references and literature reviews.

  17. Manufacturing: A Report on the Industry 2004

    Science.gov (United States)

    2004-06-01

    processes. They also need a basic understanding of global economies and cultures to exploit the opportunities presented in outsourcing and global balancing...throughout life. Changing the U.S. culture to value continuous learning will create and maintain a workforce that is technically competent and skilled. d...From http://www.mamtc.com/lean/intro_intro.asp. Retrieved March 27, 2004. Molina del Villar, Tania. Zarate Gutiérrez, Ricardo. “ Cambio Estructural

  18. Do asexual morphs of the peach-potato aphid, Myzus persicae, utilise the aphid sex pheromone? Behavioural and electrophysiological responses of M. persicae virginoparae to (4aS,7S,7aR)-nepetalactone and its effect on aphid performance.

    Science.gov (United States)

    Fernández-Grandon, G Mandela; Woodcock, Christine M; Poppy, Guy M

    2013-08-01

    The aphid sex pheromone component (4aS,7S,7aR)-nepetalactone is considered to be a potential tool for enhancing biological control of aphids. Studies have confirmed its potential to attract parasitoids, increase parasitism rates in the field and also alter the spatial distribution of parasitoids. An important aspect that has been overlooked is the impact that the introduction of nepetalactone may have on aphid populations already present in field or glasshouse environments. The most prevalent pest aphid populations in glasshouse and field environments are the asexual morphs, which are capable of exponential growth if populations are not controlled. The short-term implications of the sex pheromone on asexual aphids were observed through their behavioural response. Using Y-tube olfactometry, it is shown that virginoparae of the peach-potato aphid, Myzus persicae, are repelled by high concentrations of nepetalactone. Long-term effects of the pheromone which may span the aphid's life, or even generations, were assessed via mean relative growth rate (MRGR) and the intrinsic rate of natural increase (rm). Electroantennography also demonstrated that asexual female aphids are able to detect aphid sex pheromone components. To our knowledge, this is the first time it has been reported that M. persicae virginoparae are able to detect aphid sex pheromone components or that their behavioural response and/or performance has been studied. The implications of these results and their significance in understanding semiochemical communication are discussed.

  19. Prevalência de cárie dentária em escolares de 7 a 12 anos de idade, na cidade de Araraquara, SP (Brasil, 1979 Prevalence of dental caries in 7-12 year-old school children of Araraquara, S. Paulo, Brazil, in 1979

    Directory of Open Access Journals (Sweden)

    Maria do Carmo Costa Vasconcellos

    1982-12-01

    Full Text Available São apresentados os resultados de levantamento epidemiológico de cárie dentária em escolares de 7 a 12 anos de idade da cidade de Araraquara, SP, Brasil, cuja água de abastecimento público é fluoretada. O objetivo do estudo é verificar a prevalência de caria dentária e o nível de assistência odontológica oferecido a esta população. A população de estudo compõe-se de escolares nascidos e sempre residentes na cidade e escolares não nascidos e/ou nem sempre residentes na cidade; são comparados os índices CPO-D obtidos para os dois grupos.The results of a survey of the prevalence of dental caries in 7-12 year-old school children of Araraquara, S. Paulo, Brazil users of fluoridated water are presented. The purpose of the survey was to discover both the prevalence of dental caries and the amount of dental treatment offered to the school population. The data have been organized to show the DMF index difference between children born and reared in the city and those neither born nor continuously resident in the city. As no significant statistical difference was observed between these groups (except among the 12 year olds the fluoride concentration in public water was examined and its absence was detected.

  20. Like father, like son: assessment of the morphological affinities of A.L. 288-1 (A. afarensis, Sts 7 (A. africanus and Omo 119-73-2718 (Australopithecus sp. through a three-dimensional shape analysis of the shoulder joint.

    Directory of Open Access Journals (Sweden)

    Julia Arias-Martorell

    Full Text Available The postcranial evidence for the Australopithecus genus indicates that australopiths were able bipeds; however, the morphology of the forelimbs and particularly that of the shoulder girdle suggests that they were partially adapted to an arboreal lifestyle. The nature of such arboreal adaptations is still unclear, as are the kind of arboreal behaviors in which australopiths might have engaged. In this study we analyzed the shape of the shoulder joint (proximal humerus and glenoid cavity of the scapula of three australopith specimens: A.L. 288-1 (A. afarensis, Sts 7 (A. africanus and Omo 119-73-2718 (Australopithecus sp. with three-dimensional geometric morphometrics. The morphology of the specimens was compared with that of a wide array of living anthropoid taxa and some additional fossil hominins (the Homo erectus specimen KNM-WT 15000 and the H. neanderthalensis specimen Tabun 1. Our results indicate that A.L. 288-1 shows mosaic traits resembling H. sapiens and Pongo, whereas the Sts 7 shoulder is most similar to the arboreal apes and does not present affinities with H. sapiens. Omo 119-73-2718 exhibits morphological affinities with the more arboreal and partially suspensory New World monkey Lagothrix. The shoulder of the australopith specimens thus shows a combination of primitive and derived traits (humeral globularity, enhancement of internal and external rotation of the joint, related to use of the arm in overhead positions. The genus Homo specimens show overall affinities with H. sapiens at the shoulder, indicating full correspondence of these hominin shoulders with the modern human morphotype.

  1. Like Father, Like Son: Assessment of the Morphological Affinities of A.L. 288–1 (A. afarensis), Sts 7 (A. africanus) and Omo 119–73–2718 (Australopithecus sp.) through a Three-Dimensional Shape Analysis of the Shoulder Joint

    Science.gov (United States)

    Arias-Martorell, Julia; Potau, Josep Maria; Bello-Hellegouarch, Gaëlle; Pérez-Pérez, Alejandro

    2015-01-01

    The postcranial evidence for the Australopithecus genus indicates that australopiths were able bipeds; however, the morphology of the forelimbs and particularly that of the shoulder girdle suggests that they were partially adapted to an arboreal lifestyle. The nature of such arboreal adaptations is still unclear, as are the kind of arboreal behaviors in which australopiths might have engaged. In this study we analyzed the shape of the shoulder joint (proximal humerus and glenoid cavity of the scapula) of three australopith specimens: A.L. 288–1 (A. afarensis), Sts 7 (A. africanus) and Omo 119–73–2718 (Australopithecus sp.) with three-dimensional geometric morphometrics. The morphology of the specimens was compared with that of a wide array of living anthropoid taxa and some additional fossil hominins (the Homo erectus specimen KNM-WT 15000 and the H. neanderthalensis specimen Tabun 1). Our results indicate that A.L. 288–1 shows mosaic traits resembling H. sapiens and Pongo, whereas the Sts 7 shoulder is most similar to the arboreal apes and does not present affinities with H. sapiens. Omo 119–73–2718 exhibits morphological affinities with the more arboreal and partially suspensory New World monkey Lagothrix. The shoulder of the australopith specimens thus shows a combination of primitive and derived traits (humeral globularity, enhancement of internal and external rotation of the joint), related to use of the arm in overhead positions. The genus Homo specimens show overall affinities with H. sapiens at the shoulder, indicating full correspondence of these hominin shoulders with the modern human morphotype. PMID:25651542

  2. Like father, like son: assessment of the morphological affinities of A.L. 288-1 (A. afarensis), Sts 7 (A. africanus) and Omo 119-73-2718 (Australopithecus sp.) through a three-dimensional shape analysis of the shoulder joint.

    Science.gov (United States)

    Arias-Martorell, Julia; Potau, Josep Maria; Bello-Hellegouarch, Gaëlle; Pérez-Pérez, Alejandro

    2015-01-01

    The postcranial evidence for the Australopithecus genus indicates that australopiths were able bipeds; however, the morphology of the forelimbs and particularly that of the shoulder girdle suggests that they were partially adapted to an arboreal lifestyle. The nature of such arboreal adaptations is still unclear, as are the kind of arboreal behaviors in which australopiths might have engaged. In this study we analyzed the shape of the shoulder joint (proximal humerus and glenoid cavity of the scapula) of three australopith specimens: A.L. 288-1 (A. afarensis), Sts 7 (A. africanus) and Omo 119-73-2718 (Australopithecus sp.) with three-dimensional geometric morphometrics. The morphology of the specimens was compared with that of a wide array of living anthropoid taxa and some additional fossil hominins (the Homo erectus specimen KNM-WT 15000 and the H. neanderthalensis specimen Tabun 1). Our results indicate that A.L. 288-1 shows mosaic traits resembling H. sapiens and Pongo, whereas the Sts 7 shoulder is most similar to the arboreal apes and does not present affinities with H. sapiens. Omo 119-73-2718 exhibits morphological affinities with the more arboreal and partially suspensory New World monkey Lagothrix. The shoulder of the australopith specimens thus shows a combination of primitive and derived traits (humeral globularity, enhancement of internal and external rotation of the joint), related to use of the arm in overhead positions. The genus Homo specimens show overall affinities with H. sapiens at the shoulder, indicating full correspondence of these hominin shoulders with the modern human morphotype.

  3. Propiedades psicométricas del test de competencias motoras Bruininks Oseretsky en versión corta para niños entre 4 y 7 años en Chía y Bogotá, D.C., Colombia

    Directory of Open Access Journals (Sweden)

    María Eugenia Serrano-Gómez

    2015-10-01

    Full Text Available Antecedentes. Existen importantes pruebas de valoración que miden habilidades o competencias motoras en el niño; a pesar de ello y teniendo presente que la intervención debe basarse en la rigurosidad que exigen los procesos de evaluación del movimiento corporal humano, Colombia carece de estudios que demuestren la validez y confiabilidad de un test de medición que permita emitir un juicio valorativo relacionado con las competencias motoras infantiles. Objetivo. El presente estudio se centró en determinar las propiedades psicométricas del test de competencias motoras Bruininks Oseretsky segunda edición (BOT 2. Materiales y métodos. Se realizó una evaluación de pruebas diagnósticas con 24 niños aparentemente sanos, de ambos géneros, entre 4 y 7 años y residentes en las ciudades de Chía y Bogotá, D.C. La evaluación fue realizada por tres evaluadores expertos: el análisis para consistencia interna se realizó utilizando el coeficiente Alfa de Cronbach; el análisis de reproducibilidad se estableció a través del coeficiente de correlación intraclase (CCI y para el análisis de la validez concurrente se utilizó el coeficiente de correlación de Pearson, considerando α=0.05. Resultados. Para la totalidad de las pruebas se encontraron altos índices de confiabilidad y validez. Conclusiones. El BOT 2 es un instrumento válido y confiable que puede ser utilizado para la evaluación e identificación del nivel de desarrollo en que se encuentran las competencias motoras del niño.

  4. Aislamiento, caracterización y subtipificación de cepas de Escherichia coli O157:H7 a partir de productos cárnicos y leche Isolation, characterization and typing of Escherichia coli O157:H7 strains from beef products and milk

    Directory of Open Access Journals (Sweden)

    M. L. Roldán

    2007-06-01

    Full Text Available Escherichia coli productor de toxina Shiga (Stx (STEC O157:H7 es un patógeno asociado a enfermedades transmitidas por alimentos, fundamentalmente de origen animal. Se investigó la presencia de E. coli O157 en 250 muestras de carne picada y hamburguesas obtenidas de comercios de las ciudades de Santa Fe y Santo Tomé (Pcia. de Santa Fe y en 150 muestras de leche provenientes de tanques de enfriado de tambos de la región, utilizando enriquecimiento selectivo y separación inmunomagnética. A partir de 3 muestras de carne (1,2% se aislaron cepas E. coli O157:H7 stx2, eae, y ehxA positivas, que pudieron ser diferenciadas mediante electroforesis de campo pulsado, fagotipificación y genotipificación de stx. No se aislaron cepas STEC O157:H7 a partir de las muestras de leche. Estos hallazgos confirman la participación de los alimentos de origen animal en la epidemiología de las enfermedades producidas por E. coli O157:H7.Shiga toxin (Stx-producing Escherichia coli (STEC is an emergent pathogen associated with foodborne diseases, especially foodstuffs of animal origin. A total of 250 beef samples (ground beef and hamburgers obtained from retail outlets in Santa Fe and Santo Tomé cities, and 150 milk samples from bulk tank milk from dairy barns of the region were analyzed by selective enrichment and immunomagnetic separation. Escherichia coli O157:H7 stx2, eae and ehxA positive strains were isolated from three (1.2% beef samples. The strains could be differentiated by pulsed-field gel electrophoresis, phagetyping and genotyping of stx. The milk samples were negative for STEC O157. These findings confirm the role of food of animal origin in the epidemiology of E. coli O157:H7 - associated diseases.

  5. Níveis séricos de retinol em escolares de 7 a 17 anos no município do Rio de Janeiro Serum retinol levels in school children, 7 to 17 years old in Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Rejane Andréa Ramalho

    2004-12-01

    Full Text Available OBJETIVO: Avaliar o estado nutricional quanto à vitamina A em escolares de 7 a 17 anos. Foram analisados 574 escolares, com idade entre 7 e 17 anos, regularmente matriculados na rede municipal de ensino no Rio de Janeiro. MÉTODOS: Os níveis séricos de retinol foram determinados pelo método Bessey-Lowry modificado e o ponto de corte utilizado para caracterizar inadequação sérica de retinol foi OBJECTIVE: The vitamin A nutritional status assesment in scholars whose age is from 7 to 17 years old is the aim of this study. Data from 574 scholars have been analyzed, they were from 7 to 17 years old, and matriculated in the public educational system of Rio de Janeiro. METHODS: The serum retinol levels were assessed by the modified Bessey-Lowry method and the reference point to qualify the inadequate serum retinol level was <1,05µmol/L. RESULTS: The current study has identified that 10.30% of the scholars have presented low serum retinol levels. Considering the age group, the study shows that the younger scholars can present highier percentages of inadequate serul retinol levels (11.98% for those who is 7 to 10 years old, and 7.92% for those who is from 10 to 17 years old. CONCLUSIONS: Although the serum retinol levels tends to raise according to the age, they are still low and its frequency is relevant to focus the atention to the youngest scholars, including them in micronutrients deficiency combat programs.

  6. Prevalencia y riesgo anual de infección por tuberculosis en la población escolar de 7 años de edad de Ceuta Prevalence and annual risk of tuberculosis infection in the school population aged 7 years old in Ceuta (Spain

    Directory of Open Access Journals (Sweden)

    José María Sánchez Romero

    2012-06-01

    Full Text Available Objetivo: Conocer la prevalencia de la infección tuberculosa y el riesgo anual de infección en la población escolar de Ceuta. Método: Estudio transversal. Se realizó la prueba de la tuberculina (2UT RT-23 Tween 80 a los niños de 7 años de edad escolarizados en Ceuta en 2008. Se consideraron positivos los niños no vacunados con una induración >5mm a las 72 horas. Resultados: Se estudiaron 612 niños. La prevalencia de la infección fue del 0,98% (intervalo de confianza del 95%, margen de error del 2,5%. Su distribución mostró diferencias entre las tres zonas de salud, y fue mayor en las zonas más deprimidas, donde llegó al 2,07%. El riesgo anual de infección fue del 0,15%. Conclusiones: La prevalencia de la infección es de las más altas de España, según los últimos estudios realizados. Los resultados no se corresponden con los datos epidemiológicos de tuberculosis de Ceuta, al tener en cuenta los casos importados.Objective: To determine the prevalence of tuberculosis infection and annual risk of infection in the school population of Ceuta. Method: A cross-sectional study was conducted. A tuberculin test (2UT RT-23 Tween 80 was given to 7-year-old schoolchildren in Ceuta in 2008. A positive result was considered as an induration of >5mm at 72hours in unvaccinated children. Results: A total of 612 children were studied. The prevalence of tuberculosis infection was 0.98% (95% confidence interval with a 2.5% margin of error. The distribution showed differences among three health areas, and was greatest in the most deprived area (2.07%. The annual risk of infection was 0.15%. Conclusions According to the most recent studies, the prevalence of tuberculosis infection in Ceuta is one of the highest of Spain. Our results do not agree with the epidemiological data for tuberculosis in Ceuta, which also includes imported cases.

  7. Malocclusion prevalence and its relation to facial type and muscular activity in school students from 7 to 12 years of age in Bahia, Brazil = Malocusão, tipo facial e avaliação muscular em escolares de 7 a 12 anos de idade na Bahia, Brasil

    Directory of Open Access Journals (Sweden)

    Ribeiro, Camila Oliveira

    2015-01-01

    Full Text Available Objetivo: Avaliar a oclusão de escolares através do Índice de Estética Dentária (IED, do tipo facial utilizando antropometria, e a eletromiografia como recurso para avaliar a função muscular. Metodologia: A amostra constou de 324 escolares do gênero masculino e feminino, com idades de 7 a 12 anos, residentes em São Francisco do Conde, Bahia. A oclusão foi avaliada por intermédio do IED conforme a metodologia proposta pela Organização Mundial de Saúde. Com a cabeça na posição natural, o padrão facial foi analisado mediante a determinação da distância entre a altura facial morfológica e a largura bizigomática através de um paquímetro digital. A avaliação muscular foi tomada a partir da aquisição de registros eletromiográficos. Resultados: Verificaram-se diferenças estatisticamente significantes entre a severidade da oclusão e o tipo facial (p=0,039. A comparação com o potencial elétrico dos músculos não mostrou diferenças significantes. De acordo com a classificação do IED, 22,8% dos pacientes apresentaram oclusão normal ou leve alteração, 21% maloclusão definida, 20,1% maloclusão severa e 36,1% maloclusão muito severa ou deformadora. Conclusão: Este estudo revelou alto percentual de maloclusões de variados graus, reforçando a importância da atenção a ser dada a esta patologia nos programas institucionais de saúde bucal

  8. Avaliação dos benefícios proporcionados pelo AASI em crianças e jovens da faixa etária de 7 a 14 anos Assessment of benefit of hearing AIDS in children and young people from ages 7 to 14

    Directory of Open Access Journals (Sweden)

    Cibele Cristina Boscolo

    2006-08-01

    Full Text Available A presença de perda auditiva pode acarretar sérias conseqüências no desenvolvimento de fala e aprendizagem. Um recurso importante para a reabilitação do deficiente auditivo é o AASI. Para estar bem adaptado, o AASI deve fornecer benefícios para os usuários. A avaliação do benefício proporcionado pelo AASI, por meio de questionários de auto-avaliação, é fundamental. O presente estudo procurou verificar os benefícios proporcionados pelo AASI por meio de um questionário aplicado às crianças e adolescentes usuários de AASI, na faixa etária de 7 a 14 anos. Foram avaliados 19 deficientes auditivos, de ambos os sexos. Verificamos que em relação ao uso do AASI, 12 (63% deficientes auditivos utilizam o AASI em todos os lugares que vão, retirando-os apenas para tomar banho e dormir, 5 (23% referem utilizar o AASI somente em casa e na terapia fonoaudiológica Em relação ao benefício proporcionado pelo AASI na rotina caseira, 14 (73% ouvem melhor a televisão, 15 (78% ouvem melhor o telefone ou campainha, 12 (63% ouvem melhor os pais chamarem pelo nome. No ambiente escolar, verificou-se que o AASI promove uma melhor recepção da fala do professor estando ele próximo ao aluno. Em situações sociais, 15 sujeitos (78% relataram que com o AASI brincam melhor com seus amigos, 12 (63% ouvem melhor os amigos , 16 (84% conseguem ouvir os carros na rua, e 9 (47% referiram que conseguem ouvir uma pessoa falando em local de ruído. O uso desse instrumento possibilitou verificar os benefícios oferecidos pelo AASI às crianças e jovens deficientes auditivos.The presence of hearing loss can have serious consequences on speech development and learning. Personal sound amplification devices (hearing aids are an important resource for hearing rehabilitation of the deaf are. To be well adapted, aids should supply benefits for users. It is essential to assess the benefits provided by the devices, by means of self-evaluation questionnaires. The

  9. Fatores de risco cardiovascular em crianças de 7 a 10 anos de área urbana, Vitória, Espírito Santo, Brasil Cardiovascular risk factors in 7-to-10-year-old children in Vitória, Espírito Santo State, Brazil

    Directory of Open Access Journals (Sweden)

    Maria del Carmen Bisi Molina

    2010-05-01

    Full Text Available O objetivo do estudo foi identificar a ocorrência simultânea de fatores de risco cardiovascular em crianças de 7 a 10 anos de Vitória, Espírito Santo, Brasil, e investigar variáveis socioeconômicas associadas. Foram pesquisadas 1.282 crianças e obtidos dados antropométricos e medidas da pressão arterial com aparelho automático. Dados socioeconômicos, de alimentação e de atividade física foram obtidos com base em questionário. Para avaliação da ocorrência simultânea de fatores de risco cardiovascular foi desenvolvido um índice a partir da presença de excesso de peso, pressão arterial elevada, alimentação de baixa qualidade e lazer sedentário > 4h/dia. Presença simultânea de quatro fatores de risco cardiovascular foi identificada como risco alto. Classe socioeconômica e escolaridade materna foram incluídas no modelo de regressão logística. Cerca de 34% das crianças apresentaram dois fatores de risco cardiovascular, 20% três fatores e 6,4 quatro fatores de risco cardiovascular. A escolaridade materna se manteve associada ao risco cardiovascular alto (OR: 7,36, IC95%: 2,09-25,97 e médio (OR: 2,57, IC95%: 1,58-4,20. Baixa escolaridade materna foi o fator mais importante associado ao risco cardiovascular.The study aimed to identify the simultaneous occurrence of cardiovascular risk factors in children 7 to 10 years of age in Vitória, Espírito Santo State, Brazil, and investigate associated socioeconomic variables. In a sample of 1,282 children, anthropometric data were obtained and blood pressure was measured with an automatic device. Socioeconomic, nutritional, and physical activity data were obtained with a questionnaire. To evaluate the simultaneous occurrence of cardiovascular risk factors, an index was developed including overweight, high blood pressure, poor eating, and sedentary leisure > 4hours/day. The simultaneous presence of four cardiovascular risk factors was defined as high risk. Socioeconomic status

  10. Fatores associados ao estado nutricional de escolares de 7 a 10 anos: aspectos sociodemográficos, de consumo alimentar e estado nutricional dos pais Factors associated with nutritional status of 7-10 year-old schoolchildren: sociodemographic variables, dietary and parental nutritional status

    Directory of Open Access Journals (Sweden)

    Carla de O. Bernardo

    2012-09-01

    Full Text Available OBJETIVO: Estimar a prevalência de sobrepeso/obesidade em escolares e investigar sua associação com o estado nutricional dos pais, fatores sociodemográficos e de consumo alimentar. MÉTODO: Estudo transversal realizado com 1.223 escolares de 7 a 10 anos de Florianópolis, SC. Foram coletados dados socioeconômicos e medidas antropométricas autorreferidas dos pais, e medidas antropométricas diretas e de consumo alimentar do dia anterior dos escolares. O diagnóstico nutricional dos escolares foi definido a partir do Índice de Massa Corporal (IMC para idade e sexo de acordo com dados de referência da Organização Mundial de Saúde (2007 e o dos pais segundo os pontos de corte do IMC também da Organização Mundial de Saúde (1995. Realizou-se análise bivariada e multivariada por meio da regressão de Poisson. RESULTADOS: Prevalência de sobrepeso/obesidade de 36,2% nos meninos e 32,7% nas meninas. Nos pais e mães a prevalência foi de, respectivamente, 56,3% e 27,5%. Dos fatores investigados, no modelo final permaneceram associados ao sobrepeso/obesidade nos escolares o estado nutricional das mães (p = 0,001 e dos pais (p = 0,050. A prevalência de sobrepeso/obesidade foi 1,58 vezes maior em escolares com mães e 1,41 vezes maior em escolares com pais com sobrepeso/obesidade, quando comparados a mães e pais sem o problema. CONCLUSÃO: Observou-se elevada prevalência de sobrepeso/obesidade nos escolares, e esta se associou ao estado nutricional de pais e mães. Isso evidencia a necessidade de ações de prevenção do ganho excessivo de peso ainda na infância que atuem também no ambiente familiar do escolar, a fim de reduzir a obesidade neste grupo populacional.OBJECTIVE: To estimate the prevalence of overweight / obesity in schoolchildren, and to investigate its association with parents' nutritional status, socioeconomic factors and food consumption. METHODS: Cross-sectional study with 1,223 schoolchildren, 7 to 10 years old from

  11. Dental caries and dental fluorosis in 7-12-year-old schoolchildren in Catalão, Goiás, Brazil Cárie e fluorose dentária em escolares de 7 a 12 anos de idade em Catalão, Goiás, Brasil

    Directory of Open Access Journals (Sweden)

    Priscila Ariede Petinuci Bardal

    2005-03-01

    Full Text Available INTRODUCTION: Over the last two decades, the prevalence of dental caries in children has decreased and the prevalence of dental fluorosis has increased. Knowledge on the epidemiologic conditions of a population is fundamental for the planning of health programs. OBJECTIVES: To determine the prevalence of dental caries and dental fluorosis among schoolchildren, in Catalão, Goiás, Brazil. METHODS: A random sample of 432 schoolchildren aged 7-12-years old was obtained. WHO (1997 criteria for dental caries and fluorosis diagnosis were used. RESULTS: The DMFT indexes were 0.97; 1.20; 1.80; 1.62; 2.40 and 2.51 for 7, 8, 9, 10, 11 and 12 years old, respectively. Analysis of dental fluorosis for the same ages presented higher prevalence at 12 years old and for the female gender. The percentage of questionable dental fluorosis (Dean's classification was 34.0%. Only 3% of the sample presented dental fluorosis with scores very mild, mild and moderate. CONCLUSIONS: The prevalence of caries in schoolchildren of Catalão, Goiás, Brazil, was low. In average, private schools showed better results than public schools; however, all schools presented a low DMFT index. In this study, dental fluorosis is not a public health problem and has not damaged dental esthetics.INTRODUÇÃO: Nas últimas duas décadas, a prevalência de cárie dentária tem diminuído e a prevalência de fluorose dentária tem aumentado. Para se planejar programas de saúde é fundamental conhecer o perfil epidemiológico das populações. OBJETIVOS: Determinar a prevalência de cárie dentária e fluorose dentária em escolares do município de Catalão, Goiás, Brasil. MÉTODOS: A amostra randomizada foi composta por 432 escolares de 7 a 12 anos de idade. Os critérios utilizados para determinar a prevalência de cárie dentária e fluorose seguiram a metodologia proposta pela OMS, 1997. RESULTADOS: Os valores do Índice CPOD foram de 0,97; 1,20; 1,80; 1,62; 2,40 e 2,51 para as idades de

  12. APA District Branch / State Association Directory

    Science.gov (United States)

    ... 785) 233-7154 Fax: (785) 234-2433 kansas.psych.org Kentucky Kentucky Psychiatric Medical Association Miranda Sloan, ... 635-5070 Fax: (573) 635-7823 www.missouri.psych.org Montana Montana Psychiatric Association Leonard Lantz, Acting ...

  13. articles

    African Journals Online (AJOL)

    SA), Cert Child Psych (SA). C Krüger, MB BCh, MMed (Psych), FCPsych (SA), MD (Warwick, UK) ... disorders and suicide attempts, particularly among adolescents. Numerous .... disorder (46%), attention deficit hyperactivity disorder (40%) and.

  14. (3aRS,7aSR-7a-Methoxy-2-oxo-2,3,3a,4,5,6,7,7a-octahydro-1-benzofuran-4,4-dicarbonitrile

    Directory of Open Access Journals (Sweden)

    María González

    2012-12-01

    Full Text Available The racemic title compound, C11H12N2O3, contains a [4.3.0]bicyclic unit in which the shared C—C bond adopts a cis configuration. The five- and six-membered rings are in twisted envelope (with the bridgehead C atom bearing the methoxy substituent as the flap and distorted chair conformations, respectively. In the crystal, the molecules are linked via weak C—H...O iteractions, forming ladder-like chains along [010].

  15. Reprodución social de familias de niños menores de 7 años Reprodução social de famílias de crianças menores de 7 anos Social reproduction of families with children under the age of 7

    Directory of Open Access Journals (Sweden)

    Luisa Dolores Ortega Saldaña

    2005-09-01

    Full Text Available Por medio de muestreo casual-estratificado-proporcional, en este estudio se caracterizaron las formas de reproducción social de 80 familias con niños menores de 7 años, residentes en el área de influencia del HU-USP. Los perfiles de reproducción social fueron construidos utilizándose una base teórico-metodológica-operacional que pre definió tres grupos sociales homogéneos. De la muestra total, 36,1% fueron más excluidas, tanto en el momento de la producción como en el de consumo, 48,2% parecían luchar por la integración en la vida social y 15,7% presentaron inserción calificada en la producción, mostrándose protegidas de la precariedad del trabajo, con un patrón diferenciado de consumo y de representación colectiva y con mayor posibilidad de uso del espacio geo-social. Los resultados demostraron que la metodología utilizada es adecuada para caracterizar los perfiles de reproducción social, evidenciando que los grupos sociales que componen una misma sociedad presentaron condiciones de trabajo y de vida distintas y que cada grupo social está expuesto a determinados patrones de fortalecimiento y de desgaste.Por meio de amostragem casual-estratificada-proporcional, este estudo caracterizou as formas de reprodução social de 80 famílias com crianças menores de 7 anos, residentes na área de abrangência do HU-USP. Os perfis de reprodução social foram construídos utilizando-se uma base teórico-metodológica-operacional que pré-definiu três grupos sociais homogêneos. Da amostra total, 36,1% foram mais excluídas, tanto no momento da produção como do consumo, 48,2% pareciam lutar pela integração na vida social e 15,7% apresentaram inserção qualificada na produção, mostrando-se protegidas da precarização do trabalho, com um padrão diferenciado de consumo e de representação coletiva e com maior possibilidade de uso do espaço geossocial. Os resultados demonstraram que a metodologia utilizada é adequada para

  16. 450 EAST AFRICAN MEDICAL JOURNAL

    African Journals Online (AJOL)

    9 September 2007. BODY DYSMORPHIC DISORDER: CASE REPORT. GM. Mareko, MBChB, MMed (Psych) (Nrb), Psychiatrist, Kenyatta National Hospital, PO. Box 26-00202, Nairobi, Kenya,. C.]. Othieno, MBChB, MMed (Psych) (Nrb), Senior Lecturer, M.W. Kuria, MBChB, MMed (Psych) (Nrb), Lecturer, ].N. Kiarie, MBChB ...

  17. Role kanabinoidního systému v neurobiologii a léčbě psychotických onemocnění - experimentální studie v animálních modelech psychóz

    OpenAIRE

    Nováková, Pavlína

    2014-01-01

    Throughout the scientific world the topic of cannabis usage and its link with psychosis seems to be discussed intensively. Considering the fact that the Czech Republic is a country with one of the highest prevalence of cannabis usage in the world it becomes a sensitive issue even in our circumstances. In the theoretical part of the work we attempted to review current knowledge of a link between cannabinoid system, canabis usage and psychosis and to point out possible future therapeutic potent...

  18. 心理動詞の使役性 : 日英仏語の比較研究

    OpenAIRE

    羽鳥, 百合子

    1997-01-01

    There is a striking contrast between Japanese psychological verbs (psych-verbs) that are essentially Experiencer-as-Subject verbs and English psych-verbs that are mostly Experiencer-as-Object verbs. French psych-verbs share both properties in that they are basically EO verbs, but can alternate into ES verbs by a lexical binding operation. This paper aims to characterize the lexical semantic properties of the psych-verbs of each language and to give an account of the fact that English psych-ve...

  19. Drugs use by six to seven-year-old children from an elementary school in Celaya, Guanajuato, México Uso de drogas en niños de 6 a 7 años de una escuela primaria de Celaya, Guanajuato, México Uso de drogas entre crianças de 6 a 7 anos de uma escola primária de Celaya, Guanajuato, México

    Directory of Open Access Journals (Sweden)

    María de Lourdes García Campos

    2008-08-01

    Full Text Available This study aimed to identify the use of drugs by six to seven-year-old students from an elementary school in Celaya, Gto., Mexico. It is a cross-sectional exploratory study with non-probabilistic sample. Thirty-nine students, both genders, were interviewed, and the use of drugs was identified, not only among students, but also among people close to them. The whole sample (100% was 7 years old, 61.5% female, 77% reported their mothers smoked, and 25% she consumed alcohol; 24.3% reported their father smoked, and 48.6% he consumed alcohol; 30.6% of the scholars had already consumed alcohol once (beer, 8.1% had tried cigarettes, but not other drugs.El objetivo del presente estudio fue identificar el uso de drogas entre escolares de 6 a 7 años de edad de una escuela primaria de Celaya, Gto., México. Se realizó un estudio exploratorio transversal. El muestreo fue no probabilístico, entrevistando a 39 escolares de ambos sexos e identificando que el uso de drogas ocurre entre ellos y entre las personas más próximas. El 100% tenía 7 años de edad, 61.5% era del sexo femenino, refirió el 77% que su madre fumaba y el 25% ingería alcohol; el 24.3% que su papá fumaba y el 48,6% que consumía alcohol, el 30,6% de los escolares ya había ingerido bebidas alcohólicas (cerveza alguna vez, el 8,1% ya había experimentado con el cigarro, no ocurriendo con otras drogas.O objetivo deste estudo foi identificar o uso de drogas entre escolares de 6 a 7 anos de idade de uma escola primária de Celaya, Gto. México. Realizou-se um estudo exploratório transversal com amostra não-probabilística. Foram entrevistados 39 escolares de ambos os sexos, e identificou-se que o uso de drogas ocorre tanto entre eles como entre as pessoas mais próximas. Toda a amostra (100% tinha 7 anos de idade, 61,5% eram do sexo feminino. Dentre eles, 77% mencionaram que a mãe fumava, e 25% que a mesma ingeria álcool; 24,3% referiram que o pai fumava e 48,6% que o mesmo consumia

  20. YES 2K7: A Mentorship Program for Young Engineers and Scientists

    Science.gov (United States)

    Boice, Daniel C.; Asbell, E.; Reiff, P.

    2007-10-01

    The Young Engineers and Scientists 2007 (YES 2K7) Program is a community partnership between Southwest Research Institute (SwRI), and local high schools in San Antonio, Texas (USA). YES has been highly successful during the past 15 years, with YES 2K7 continuing this trend. The YES program provides talented high school juniors and seniors a bridge between classroom instruction and real world, research experiences in physical sciences (including space science and astronomy) and engineering. YES 2K7 consists of two parts: 1) an intensive three-week summer workshop held at SwRI where students experience the research environment first-hand; develop skills and acquire tools for solving scientific problems, attend mini-courses and seminars on electronics, computers and the Internet, careers, science ethics, and other topics; and select individual research projects to be completed during the academic year; and 2) a collegial mentorship where students complete individual research projects under the guidance of their mentors during the academic year and earn honors credit. At the end of the school year, students publicly present and display their work, acknowledging their accomplishments and spreading career awareness to other students and teachers. YES 2K7 developed a website for the Magnetospheric Multiscale Mission (MMS) from the perspective of 20 high school students (yesserver.space.swri.edu). Over the past 15 years, all YES graduates have entered college, several have worked for SwRI, and three scientific publications have resulted. Student evaluations indicate the effectiveness of YES on their academic preparation and choice of college majors. Acknowledgements: We acknowledge funding and support from the NASA MMS Mission, SwRI, Northside Independent School District, and local charitable foundations.

  1. Magnetic Resonance Project 35-26-7: A Cuban Case of Engineering Physics and Biophysics

    Science.gov (United States)

    Cabal Mirabal, Carlos A.

    The Magnetic Resonance Project 35-26-7 started in December 1987, commissioned by the [then] Cuban Prime Minister, Fidel Castro, who—concerned about introducing technological advancement into the Cuban health [system]—had for some months taken an interest in the possibility of building magnetic resonance imaging (MRI) equipment for medical diagnosis in Cuba (Zito M, Argüelles MM et al, Y sin embargo-: ciencia: hablan 30 investigadores cubanos. Editoria April, Habana, pp 56-66, 1999; Cabal, Biofísica Médica. In: Fidel Castro Dìas-Balart (eds) Cuba. Amanecer del Tercer Milenio. Ciencia, Sociedad y Tecnología: Biofísica Médica. Debate Editorial, Madrid, pp 31-48, 2002). Many of the companies producing MRI equipment were unable to deliver this technology to Cuba due to the bloqueo, the United States embargo against Cuba. Those who were later to advance the project's progress in scientific technology initially regarded the implementation of such a project in a developing country as unfeasible due to its complexity. But Fidel's belief and confidence and in turn the Cuban scientists' commitment to him and to Cuban science proved to be an undeniable factors for its success.

  2. Preliminary analysis of species partitioning in the DWPF melter. Sludge batch 7A

    Energy Technology Data Exchange (ETDEWEB)

    Choi, A. S. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Smith III, F. G. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); McCabe, D. J. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2017-01-01

    The work described in this report is preliminary in nature since its goal was to demonstrate the feasibility of estimating the off-gas carryover from the Defense Waste Processing Facility (DWPF) melter based on a simple mass balance using measured feed and glass pour stream (PS) compositions and time-averaged melter operating data over the duration of one canister-filling cycle. The DWPF has been in radioactive operation for over 20 years processing a wide range of high-level waste (HLW) feed compositions under varying conditions such as bubbled vs. non-bubbled and feeding vs. idling. So it is desirable to find out how the varying feed compositions and operating parameters would have impacted the off-gas entrainment. However, the DWPF melter is not equipped with off-gas sampling or monitoring capabilities, so it is not feasible to measure off-gas entrainment rates directly. The proposed method provides an indirect way of doing so.

  3. Phosphorylation regulates activity of 7-dehydrocholesterol reductase (DHCR7), a terminal enzyme of cholesterol synthesis.

    Science.gov (United States)

    Prabhu, Anika V; Luu, Winnie; Sharpe, Laura J; Brown, Andrew J

    2017-01-01

    Cholesterol is essential for survival, but too much or too little can cause disease. Thus, cholesterol levels must be kept within close margins. 7-dehydrocholesterol reductase (DHCR7) is a terminal enzyme of cholesterol synthesis, and is essential for embryonic development. Largely, DHCR7 research is associated with the developmental disease Smith-Lemli-Opitz syndrome, which is caused by mutations in the DHCR7 gene. However, little is known about what regulates DHCR7 activity. Here we provide evidence that phosphorylation plays a role in controlling DHCR7 activity, which may provide a means to divert flux from cholesterol synthesis to vitamin D production. DHCR7 activity was significantly decreased when we used pharmacological inhibitors against two important kinases, AMP-activated protein kinase and protein kinase A. Moreover, mutating a known phosphorylated residue, S14, also decreased DHCR7 activity. Thus, we demonstrate that phosphorylation modulates DHCR7 activity in cells, and contributes to the overall synthesis of cholesterol, and probably vitamin D. Copyright © 2016 Elsevier Ltd. All rights reserved.

  4. Demographic aspects in cervical vertebral bodies' size and shape (C3-C7): a skeletal study.

    Science.gov (United States)

    Ezra, David; Masharawi, Youssef; Salame, Khalil; Slon, Viviane; Alperovitch-Najenson, Deborah; Hershkovitz, Israel

    2017-01-01

    This cross-sectional study was conducted on the skeletal remains of individuals of known sex, age, and ethnic origin. The vertebral bodies of levels C3-C7 were measured and analyzed. Whereas many studies were performed on the size and shape of the vertebral bodies in the thoracic and lumbar spines, few have focused on the cervical vertebral bodies. Thus, there is insufficient data in the literature on the anatomy of the cervical spine, especially based on large study populations. To establish a large database on cervical vertebral bodies' size and shape and analyze their association with demographic parameters. The population studied was composed of 277 individuals, adult males and females of African American (AA) and European American (EA) origin. The skeletal remains are housed at the Hamman-Todd Osteological collection (Cleveland Museum of Natural History, Cleveland, OH). A 3-D digitizer was used to measure the size and shape of the C3-C7 vertebral bodies. Descriptive statistics were carried out for all measurements. t Test and one-way analysis of variance were performed to assess differences in vertebral bodies' size and shape between different demographical groups (by age, sex, and ethnicity). The vertebral bodies and foramina are significantly wider, more elongated, and higher in males compared to females. AA females and males manifest significantly greater vertebral bodies (width and length) in the upper and midcervical region (vertebrae C3-C5) than EA females and males. Nevertheless, the heights of the C3 and C4 vertebral bodies are significantly smaller among the AA population, regardless of sex. The vertebral foramina's width does not differ significantly between the two ethnic groups, independent of sex, whereas they tend to be elongated in the EA group (significant for C3, C5, C7). For most vertebrae, no significant differences were found in the superior facets' length between AA and EA males and females. Cervical vertebral bodies become wider and more elongated with age, although the changes in the latter dimension are much more pronounced than in the former. Notably, the body shape of the cervical vertebrae changes gradually from a more round shape (C3 length/width index=0.84) to a more oval one (C7 length/width index =0.65). This is due to the fact that the width dimensions increase by almost 40% from C3 to C7, whereas the length dimensions increase only by approximately 10%. Furthermore, there is a significant reduction in body height with age in C3-C6. In contrast, no significant changes in vertebral foramen size with age were found. The cervical vertebral bodies' shape and size are sex-dependent phenomena, that is, in all parameters studied, the dimensions were greater in males than in females. For the midcervical level, there is a difference in body shape between individuals of different ethnic origins. The cervical vertebral bodies also exhibit considerable size and shape changes with age, that is, they become more elongated (oval shaped), wider, and shorter. In contrast, vertebral foramen size is age independent. Copyright © 2016. Published by Elsevier Inc.

  5. Genotypic and phenotypic spectrum of pyridoxine-dependent epilepsy (ALDH7A1 deficiency)

    DEFF Research Database (Denmark)

    Mills, Philippa B; Footitt, Emma J; Mills, Kevin A

    2010-01-01

    with suspected or clinically proven pyridoxine-dependent epilepsy and to characterize further the phenotypic spectrum of antiquitin deficiency. Urinary L-alpha-aminoadipic semialdehyde concentration was determined by liquid chromatography tandem mass spectrometry. When this was above the normal range, DNA...... to pyridoxine. These findings support the use of biochemical and DNA tests for antiquitin deficiency and a clinical trial of pyridoxine in infants and children with epilepsy across a broad range of clinical scenarios....

  6. Microsoft Windows 7: A survey of its awareness and the likely ...

    African Journals Online (AJOL)

    The study employed stratified random sampling to group sampled organizations into large, medium, and small. Similarly, individuals interviewed were stratified into CEOs, IT PROS, and Users. Convenience sampling was also employed to get quick response using Nigeria as a case study. Hardware compatibility was also ...

  7. Semaphorin7A regulates neuroglial plasticity in the adult hypothalamic median eminence

    NARCIS (Netherlands)

    Parkash, Jyoti; Messina, Andrea; Langlet, Fanny; Cimino, Irene; Loyens, Anne; Mazur, Danièle; Gallet, Sarah; Balland, Eglantine; Malone, Samuel A.; Pralong, François; Cagnoni, Gabriella; Schellino, Roberta; De Marchis, Silvia; Mazzone, Massimiliano; Pasterkamp, R. Jeroen|info:eu-repo/dai/nl/197768814; Tamagnone, Luca; Prevot, Vincent; Giacobini, Paolo

    2015-01-01

    Reproductive competence in mammals depends on the projection of gonadotropin-releasing hormone (GnRH) neurons to the hypothalamic median eminence (ME) and the timely release of GnRH into the hypothalamic-pituitary-gonadal axis. In adult rodents, GnRH neurons and the specialized glial cells named

  8. Data of evolutionary structure change: 1CZ7A-2ZFLA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available .871000289916992 95.42500305175781 > -0.1850000023841858 -0.930999...0940094 -0.8569999933242798 -0.004999999888241291 -0.5139999985694885 ...yChain> 35.8489990234375 -11.144000053405762 62.944000244140625 ...61581421 0.39399999380111694 -0.1860000044107437 > 1.0045499801635742 59.507999420166016 tion> -0.5299999713897705 -0.8389999866485596<

  9. Salmonella roggeveld 51 :-:1,7 A New Serotype | Brede | South ...

    African Journals Online (AJOL)

    A new Salmonella, S. roggeveld 51 : - : 1,7 is described. So far this Salmonella seems to be geographically restricted to the western Cape Province. A total of 18 different isolations, all performed at the Department of Medical Microbiology, University of Stellenbosch, between 1962 and 1969 gives some insight into the ...

  10. Structural insights into the inhibition of cellobiohydrolase Cel7A by xylo‐oligosaccharides

    DEFF Research Database (Denmark)

    Momeni, Majid Haddad; Ubhayasekera, Wimal; Sandgren, Mats

    2015-01-01

    residue is shifted ~ 2.4 Å towards the catalytic center compared with binding of cello‐oligosaccharides. Furthermore, partial occupancy of two consecutive xylose residues at subsites ‐2 and ‐1 suggests an alternative binding mode for XOS in the vicinity of the catalytic center. Interestingly, the ‐1...

  11. 17 CFR 260.7a-29 - Incorporation of exhibits as such.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Incorporation of exhibits as... Incorporation of exhibits as such. (a) Any exhibit or part thereof previously or concurrently filed with the...) and § 229.10(d) of this chapter, be incorporated by reference as an exhibit to any application...

  12. Cooperative Monitoring Center Occasional Paper/7: A Generic Model for Cooperative Border Security

    Energy Technology Data Exchange (ETDEWEB)

    Netzer, Colonel Gideon

    1999-03-01

    This paper presents a generic model for dealing with security problems along borders between countries. It presents descriptions and characteristics of various borders and identifies the threats to border security, while emphasizing cooperative monitoring solutions.

  13. Page 1 Fault tolerance in multiprocessor systems 105 Figure 7. (a) A ...

    Indian Academy of Sciences (India)

    array is implemented on a single chip or wafer, the provision of fault-tolerance poses many extra problems not encountered in multichip or non wafer-scale architectures. First, the chip area should be utilised very efficiently. It has been shown (Mead & Conway 1980) that the probability of finding a fault-free circuit on.

  14. Description of the CEEH health effect model. CEEH scientific report no. 7a

    Energy Technology Data Exchange (ETDEWEB)

    Boenloekke, J.H.; Sigsgaard, T. (Aarhus Univ. Dept. of of Public Health, AArhus (Denmark)); Brandt, J.; Frohn, L.M. (Aarhus Univ. National Environmental Research Institute, Dept. of Atmospheric Environment, Roskilde (Denmark)); Flachs, E.M.; Broennum-Hansen, H. (Univ. of Southern Denmark. National Institute of Public Health, Copenhagen (Denmark)); Siggaard-Andersen4, M.-L. (Univ. of Copenhagen. Niels Bohr Institute, Copenhagen (Denmark))

    2011-11-15

    This report is based on a number of up-to-date reviews of the existing literature on health effects from air pollution at the population level and conclude with recommendations for CEEH. The pollutants in the CEEH models have been selected based on the following criteria: 1) They stem from combustion sources either directly or via chemical transformations. This may include evaporation or dust from the energy sources themselves (i.e. from wear and tear). Other pollution derived from energy production but not liberated to the air is not included (e.g. heavy metals in soil deposits). However, heavy metals, dioxins and possibly PAHs that are emitted to the air, deposit on soil or in water and end up by being ingested should ideally be covered by CEEH. 2) Be possible to model in the CEEH settings both in terms of emissions, chemical transformations and transport. 3) Be sufficiently investigated in terms of documented health effects and in terms of the costs associated with these health effects. Combustion sources and accordingly combustion products are highly diverse and widespread. In practice, therefore, not all sources that contribute to health effects in humans can be included in the CEEH models. Other sources than combustion contribute some of the pollutants and as a result a brief discussion of the relevance and effect of such non-combustion derived air pollutants is included in this report. For a more comprehensive discussion of secondary pollutants from e.g. agricultural activities the reader is referred to CEEH report no. 3. The EVA model was based on existing European models such as EcoSense 4.0 from ExternE and used the same air pollution products as these in the versions available in 2003-4. With time EVA has changed independently from its predecessors. A more recent version of the ExternE methods is now available (ExternE, 2005). The pollutants ontained by ExternE are provided in table 1. Pollutants originally included in EVA are the following: SO2, O3, PM2.5, nitrate, sulphate, dioxin, Pb, and Hg. Additional national and international reports that have been reviewed in the process of creating the CEEH model include US-EPA, WHO, OECD, DEFRA (UK), COMEAP (UK), APHEA, NEEDS and CAFE (EU) reports. As there is consensus that the most important health effects (also in terms of costs) stem from particles, CEEH should include effects of particles composed of nitrates and sulphates as well as primary particles in the size fractions PM10 and PM2.5 as both size fractions are used in CRFs for a range of health effects. Effects of particulate matter include all-cause or cause-specific morbidity (as hospital admissions) and mortality for both adults and infants. Ozone should be modelled in CEEH for use in a CRF on long-term effects on all respiratory mortality. The gaseous pollutants SO2 and NO2 should also be modelled. In contrast to other recent reviews, but from the point of view that independent effects of SO2 do seem to exist and that they are plausible from a mechanistic point of view and despite the risk of double counting effects in CEEH we propose a short-term CRF of SO2. This is particularly warranted as we suggest a slightly conservative CRF of particles on cause-specific mortality (see the chapter on particles) which miss some of the effect of air pollution. Recent Danish evidence (Andersen Z, et al., 2010) of an effect of long-term NO2 on COPD incidence has prompted us to use NO2 rather than PM for the CRF for this disease. Further we propose to: 1) Use estimates for fine particulate matter (PM2.5) effects when available as the coarser fractions' contribution cannot be separated sufficiently and would lead to double counting. If the evidence is insufficient for fine but sufficient for coarse particles estimates for the latter can be used instead. 2) Regarding mortality, only use estimates from population (prospective) studies as in other recent reviews (primarily NEEDS 2007 and COMEAP 2009). 3) In contrast to other recent reviews which use all-cause mortality we recommend the use of cause-specific estimates because these form a better basis for specific cost calculation although from a health perspective the total effect appears to be better covered by all-cause estimates. 4) Only include estimates if based on several independent sources or based on single high quality and large studies endorsed by other reviews, i.e. assuring that the evidence is solid and the risk of double counting is neglible. CRF that include 1 in the 95% CI are thus not considered even if endorsed by recent review such as COMEAP or NEEDS. 5) Recommended CEEH Concentration-Response functions (CRF). The general approach to estimating the effects of pollutants on health uses the relative risk (RR) found in the epidemiological studies, expressed as % change in end-point per unit pollutant (concentration) (CRF).

  15. P2RX7: A bipolar and unipolar disorder candidate susceptibility gene?

    Science.gov (United States)

    Green, Elaine K; Grozeva, Detelina; Raybould, Rachel; Elvidge, Gareth; Macgregor, Stuart; Craig, Ian; Farmer, Anne; McGuffin, Peter; Forty, Liz; Jones, Lisa; Jones, Ian; O'Donovan, Mick C; Owen, Mike J; Kirov, George; Craddock, Nick

    2009-12-05

    The chromosomal region 12q24 has been previously implicated by linkage studies of both bipolar disorder and unipolar mood disorder and we have reported two pedigrees segregating both bipolar disorder and Darier's disease that show linkage across this region. The gene P2RX7 is located in this chromosomal region and has been recently reported as a susceptibility gene for bipolar disorder and unipolar depression. The non-synonymous SNP rs2230912 (resulting in amino-acid polymorphism Q460R) showed the strongest association and has been postulated to be pathogenically relevant. We have investigated this gene in a large UK case-control sample (bipolar I disorder N = 687, unipolar recurrent major depression N = 1,036, controls N = 1,204). Neither rs2230912 nor any of 8 other SNPs genotyped across P2RX7 was found to be associated with mood disorder in general, nor specifically with bipolar or unipolar disorder. Further, sequencing of our two chromosome 12-linked bipolar-Darier families showed no evidence of rare variants at P2RX7 that could explain the linkage. Our data do not provide support for rs2230912 or the other polymorphisms studied within the P2RX7 locus, being involved in susceptibility to mood disorders. 2009 Wiley-Liss, Inc.

  16. Characterization of two cysteine proteases secreted by Blastocystis ST7, a human intestinal parasite.

    Science.gov (United States)

    Wawrzyniak, Ivan; Texier, Catherine; Poirier, Philippe; Viscogliosi, Eric; Tan, Kevin S W; Delbac, Frédéric; El Alaoui, Hicham

    2012-09-01

    Blastocystis spp. are unicellular anaerobic intestinal parasites of both humans and animals and the most prevalent ones found in human stool samples. Their association with various gastrointestinal disorders raises the questions of its pathogenicity and of the molecular mechanisms involved. Since secreted proteases are well-known to be implicated in intestinal parasite virulence, we intended to determine whether Blastocystis spp. possess such pathogenic factors. In silico analysis of the Blastocystis subtype 7 (ST7) genome sequence highlighted 22 genes coding proteases which were predicted to be secreted. We characterized the proteolytic activities in the secretory products of Blastocystis ST7 using specific protease inhibitors. Two cysteine proteases, a cathepsin B and a legumain, were identified in the parasite culture supernatant by gelatin zymographic SDS-PAGE gel and MS/MS analysis. These proteases might act on intestinal cells and disturb gut function. This work provides serious molecular candidates to link Blastocystis spp. and intestinal disorders. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  17. ASAM v2.7: a compressible atmospheric model with a Cartesian cut cell approach

    Directory of Open Access Journals (Sweden)

    M. Jähn

    2015-02-01

    Full Text Available In this work, the fully compressible, three-dimensional, nonhydrostatic atmospheric model called All Scale Atmospheric Model (ASAM is presented. A cut cell approach is used to include obstacles and orography into the Cartesian grid. Discretization is realized by a mixture of finite differences and finite volumes and a state limiting is applied. Necessary shifting and interpolation techniques are outlined. The method can be generalized to any other orthogonal grids, e.g., a lat–long grid. A linear implicit Rosenbrock time integration scheme ensures numerical stability in the presence of fast sound waves and around small cells. Analyses of five two-dimensional benchmark test cases from the literature are carried out to show that the described method produces meaningful results with respect to conservation properties and model accuracy. The test cases are partly modified in a way that the flow field or scalars interact with cut cells. To make the model applicable for atmospheric problems, physical parameterizations like a Smagorinsky subgrid-scale model, a two-moment bulk microphysics scheme, and precipitation and surface fluxes using a sophisticated multi-layer soil model are implemented and described. Results of an idealized three-dimensional simulation are shown, where the flow field around an idealized mountain with subsequent gravity wave generation, latent heat release, orographic clouds and precipitation are modeled.

  18. Frizzled7: A Promising Achilles’ Heel for Targeting the Wnt Receptor Complex to Treat Cancer

    Directory of Open Access Journals (Sweden)

    Toby Phesse

    2016-05-01

    Full Text Available Frizzled7 is arguably the most studied member of the Frizzled family, which are the cognate Wnt receptors. Frizzled7 is highly conserved through evolution, from Hydra through to humans, and is expressed in diverse organisms, tissues and human disease contexts. Frizzled receptors can homo- or hetero-polymerise and associate with several co-receptors to transmit Wnt signalling. Notably, Frizzled7 can transmit signalling via multiple Wnt transduction pathways and bind to several different Wnt ligands, Frizzled receptors and co-receptors. These promiscuous binding and functional properties are thought to underlie the pivotal role Frizzled7 plays in embryonic developmental and stem cell function. Recent studies have identified that Frizzled7 is upregulated in diverse human cancers, and promotes proliferation, progression and invasion, and orchestrates cellular transitions that underscore cancer metastasis. Importantly, Frizzled7 is able to regulate Wnt signalling activity even in cancer cells which have mutations to down-stream signal transducers. In this review we discuss the various aspects of Frizzled7 signalling and function, and the implications these have for therapeutic targeting of Frizzled7 in cancer.

  19. Russkije idut, no eto skoreje G7, a ne G8 / Brian Love

    Index Scriptorium Estoniae

    Love, Brian

    2005-01-01

    Venemaa ületab takistuse maailma suurriigina tunnustamises 2006. a. jaanuaris, kui ta aastaks saab G8 eesistujaameti. Vaatamata toimunud muutustele on Venemaa endiselt külaline, kui kohtuvad G7 rahandusministrid ja keskpankade juhid

  20. The relationship between P2X4 and P2X7: a physiologically important interaction?

    Directory of Open Access Journals (Sweden)

    Eilidh eCraigie

    2013-08-01

    Full Text Available Purinergic signaling within the kidney is becoming an important focus in the study of renal health and disease. The effectors of ATP signaling, the P2Y and P2X receptors, are expressed to varying extents in and along the nephron. There are many studies demonstrating the importance of the P2Y2 receptor on kidney function, and other P2 receptors are now emerging as participants in renal regulation. The P2X4 receptor has been linked to epithelial sodium transport in the nephron and expression levels of the P2X7 receptor are up-regulated in certain pathophysiological states. P2X7 antagonism has been shown to ameliorate rodent models of DOCA salt-induced hypertension and P2X4 null mice are hypertensive. Interestingly, polymorphisms in the genetic loci of P2X4 and P2X7 have been linked to blood pressure variation in human studies. In addition to the increasing evidence linking these two P2X receptors to renal function and health, a number of studies link the two receptors in terms of physical associations between their subunits, demonstrated both in vitro and in vivo. This review will analyze the current literature regarding interactions between P2X4 and P2X7 and assess the potential impact of these with respect to renal function.