WorldWideScience

Sample records for ps ii cab

  1. Light-induced short-term adaptation mechanisms under redox control in the PS II-LHCII supercomplex: LHC II state transitions and PS II repair cycle

    Science.gov (United States)

    Kruse, Olaf

    2001-05-01

    Oxygenic photosynthesis takes place in the thylakoid membranes of cyanobacteria, algae and higher plants. While cyanobacteria have adapted to relatively constant environments, higher plants had to evolve mechanisms to adapt to continuous environmental changes. These include changes in light intensity, temperature and availability of water. One of the great challenges in plant cell biology is therefore to determine the regulatory mechanisms employed by higher plants and some algae to adapt to these constant environmental changes. The particular emphasis of this review is the description and characterisation of light-induced redox-controlled processes regulating the photosynthetic reactions, which involves maintaining maximal electron transport flow through the PS II-Cytb6f-PS I-FoF1ATPase electron transport chain and minimising light-induced oxidative damage to PS II which drives the highly oxidising water-splitting reaction. Two of the mechanisms involved in such short-term regulation processes are known as light harvesting complex II (LHC II) state transitions and photosystem II (PS II) repair cycle. They are followed by, and indeed may be a precondition in order to establish, the onset of the subsequent long-term mechanisms of regulation. In particular, the redox control of LHC II state transitions by reversible phosphorylation has been in the focus of many investigations, leading to many new results demonstrating the complexity of thylakoid-associated redox control mechanisms.

  2. The Chlamydomonas reinhardtii LI818 gene represents a distant relative of the cabI/II genes that is regulated during the cell cycle and in response to illumination.

    Science.gov (United States)

    Savard, F; Richard, C; Guertin, M

    1996-11-01

    In the green unicellular alga Chlamydomonas reinhardtii, as in higher plants, the expression of the genes encoding the chlorophyll a/b-binding (CAB) polypeptides associated with photosystem I (PSI) and photosystem II (PSII) is regulated by endogenous (circadian clock) and exogenous signals (light and temperature). The circadian clock ensures that the oscillation in the levels of the different cab mRNAs is continuously kept in phase with light/dark (LD) cycles and is maximal by the middle of the day. On the other hand, light controls the amplitude of the oscillations. We report here the cloning and characterization of the C. reinhardtii LI818 gene, which identifies a CAB-related polypeptide and whose expression is regulated quite differently from the cab I/II genes. We show: (1) that in LD synchronized Chlamydomonas cells LI818 mRNA accumulation is subject to dual regulation that involves separable regulation by light and an endogenous oscillator; (2) that LI818 mRNA is fully expressed several hours before the cab I/II mRNAs and that the latter accumulate concomitantly; (3) that blocking the electron flow through PSII using DCMU prevents cells from accumulating cab I/II mRNAs but not LI818 mRNA and (4) that the accumulation of LI818 mRNA is abolished by blocking cytoplasmic protein synthesis, suggesting that these regulatory mechanisms are mediated by labile proteins.

  3. The small CAB-like proteins of the cyanobacterium Synechocystis sp. PCC 6803: their involvement in chlorophyll biogenesis for Photosystem II.

    Science.gov (United States)

    Hernandez-Prieto, Miguel A; Tibiletti, Tania; Abasova, Leyla; Kirilovsky, Diana; Vass, Imre; Funk, Christiane

    2011-09-01

    The five small CAB-like proteins (ScpA-E) of the cyanobacterium Synechocystis sp. PCC 6803 belong to the family of stress-induced light-harvesting-like proteins, but are constitutively expressed in a mutant deficient of Photosystem I (PSI). Using absorption, fluorescence and thermoluminescence measurements this PSI-less strain was compared with a mutant, in which all SCPs were additionally deleted. Depletion of SCPs led to structural rearrangements in Photosystem II (PSII): less photosystems were assembled; and in these, the Q(B) site was modified. Despite the lower amount of PSII, the SCP-deficient cells contained the same amount of phycobilisomes (PBS) as the control. Although the excess PBS were functionally disconnected, their fluorescence was quenched under high irradiance by the activated Orange Carotenoid Protein (OCP). Additionally the amount of OCP, but not of the iron-stress induced protein (isiA), was higher in this SCP-depleted mutant compared with the control. As previously described, the lack of SCPs affects the chlorophyll biosynthesis (Vavilin, D., Brune, D. C., Vermaas, W. (2005) Biochim Biophys Acta 1708, 91-101). We demonstrate that chlorophyll synthesis is required for efficient PSII repair and that it is partly impaired in the absence of SCPs. At the same time, the amount of chlorophyll also seems to influence the expression of ScpC and ScpD. 2011 Elsevier B.V. All rights reserved.

  4. New layered tin(II) thiophosphates ASnPS4 (A = K, Rb, Cs): synthesis, structure, glass formation, and the modulated CsSnPS4.

    Science.gov (United States)

    Banerjee, Santanu; Malliakas, Christos D; Kanatzidis, Mercouri G

    2012-11-05

    The layered compounds KSnPS(4) (1), RbSnPS(4) (2), and CsSnPS(4) (3) were synthesized using the chalcophosphate flux technique at high temperature and are rare examples of divalent Sn(II) thiophosphates. Orange polyhedral crystals of compound 1 crystallize in the monoclinic space group P2(1)/c with a = 6.6673(13) Å, b = 11.9697(24) Å, c = 8.7604(18), and β=127.347(8)° in a 2-dimensional layered structure. Compound 2 is isostructural to 1. Yellow block shaped crystals of compound 3 crystallize in the monoclinic superspace group P2(1)(αβ0)0 with a commensurate q-vector at 1/4a* + 1/4c* with a = 18.0477(14) Å, b = 6.2021(5) Å, and c = 6.8415(5) Å. The structure of all three compounds contains SnS(3) pyramids, which is an extremely rare solid state chalcogenide coordination environment. All three compounds are semiconductors having well-defined band-gaps between 2.0 and 2.2 eV. The compounds are congruently melting and can be obtained as glasses by rapid quenching of the melt, which subsequently crystallize upon heating.

  5. [PS II photochemical efficiency in flag leaf of wheat varieties and its adaptation to strong sun- light intensity on farmland of Xiangride in Qinghai Province, Northwest China].

    Science.gov (United States)

    Shi, Sheng-Bo; Chen, Wen-Jie; Shi, Rui; Li, Miao; Zhang, Huai-Gang; Sun, Ya-Nan

    2014-09-01

    Taking four wheat varieties developed by Northwest Institute of Plateau Biology, Chinese Academy of Sciences, as test materials, with the measurement of content of photosynthetic pigments, leaf area, fresh and dry mass of flag leaf, the PS II photochemistry efficiency of abaxial and adaxial surface of flag leaf and its adaptation to strong solar radiation during the period of heading stage in Xiangride region were investigated with the pulse-modulated in-vivo chlorophyll fluorescence technique. The results indicated that flag leaf angle mainly grew in horizontal state in Gaoyuan 314, Gaoyuan 363 and Gaoyuan 584, and mainly in vertical state in Gaoyuan 913 because of its smaller leaf area and larger width. Photosynthetic pigments were different among the 4 varieties, and positively correlated with intrinsic PS II photochemistry efficiencies (Fv/Fm). In clear days, especially at noon, the photosynthetic photoinhibition was more serious in abaxial surface of flag leaf due to directly facing the solar radiation, but it could recover after reduction of sunlight intensity in the afternoon, which meant that no inactive damage happened in PS II reaction centers. There were significant differences of PS II actual and maximum photochemical efficiencies at the actinic light intensity (ΦPS II and Fv'/Fm') between abaxial and adaxial surface, and their relative variation trends were on the contrary. The photochemical and non-photochemical quenching coefficients (qP and NPQ) had a similar tendency in both abaxial and adaxial surfaces. Although ΦPS II and qP were lower in adaxial surface of flag leaf, the Fv'/Fm' was significantly higher, which indicated that the potential PS II capture efficiency of excited energy was higher. The results demonstrated that process of photochemical and non-photochemical quenching could effectively dissipate excited energy caused by strong solar radiation, and there were higher adaptation capacities in wheat varieties natively cultivated in

  6. [Effects of NO3- stress on photosynthetic rate, photochemical efficiency of PS II and light energy allocation in cucumber seedling leaves].

    Science.gov (United States)

    Su, Xiu-Rong; Wang, Xiu-Feng; Yang, Feng-Juan; Wei, Min

    2007-07-01

    This paper studied the effects of different NO3- concentration on the photosynthetic rate, photochemical efficiency, and absorbed light energy allocation in cucumber seedling leaves. The results indicated that when the available NO3- concentration in the medium was low (14-98 mmol NO3- x L(-1)), an appropriate supplement of NO3- could enhance the capability of cucumber leaves in capturing light energy, and promote the photosynthesis. However, with further increase of NO3-, the photochemical efficiency of PS II decreased, electron transfer restrained, and net photosynthetic rate as well as the absorbed light energy used in photochemical reaction of PS II decreased. At the same time, the light energy used in antenna heat dissipation increased, while the photochemical efficiency decreased. After treated with 140 and 182 mmol NO3- x L(-1) for 6 days, the photosynthetic rate (P(n)) was decreased by 35% and 78%, respectively, maximal PS II efficiency at open centers in the absence of NPQ (F(v)/F(m)), antenna efficiency at open centers in the presence of NPQ (F(v)'/F(m)'), actual PS II efficiency (phi (PSII ) and photochemical quenching (q(P)) were lower, non-photochemical quenching (NPQ) was higher, and the deviation from full balance between PS I and PS II (beta/alpha - 1) was improved significantly, compared with the control. The fluctuant ranges of these chlorophyll fluorescence parameters were increased at higher NO3- concentration, compared with those at lower NO3- concentration. The absorbed light energy allocated to the photochemical reaction of PS II (P) was reduced by high light intensity and high NO3- concentration. Meanwhile, the proportion allocated in antenna heat dissipation (D) increased significantly. Antenna heat dissipation was the main way for excessive energy dissipation.

  7. The importance of a highly active and DeltapH-regulated diatoxanthin epoxidase for the regulation of the PS II antenna function in diadinoxanthin cycle containing algae.

    Science.gov (United States)

    Goss, Reimund; Ann Pinto, Elizabeth; Wilhelm, Christian; Richter, Michael

    2006-10-01

    The present study focuses on the regulation of diatoxanthin (Dtx) epoxidation in the diadinoxanthin (Ddx) cycle containing algae Phaeodactylum tricornutum, Thalassiosira pseudonana, Cyclotella meneghiniana and Prymnesium parvum and its significance for the control of the photosystem II (PS II) antenna function. Our data show that Dtx epoxidase can exhibit extremely high activities when algal cells are transferred from high light (HL) to low light (LL). Under HL conditions, Dtx epoxidation is strongly inhibited by the light-driven proton gradient. Uncoupling of the cells during HL illumination restores the high epoxidation rates observed during LL. In Ddx cycle containing algae, non-photochemical quenching of chlorophyll fluorescence (NPQ) is directly correlated with the Dtx concentration and independent of the presence of the proton gradient. This means that a fast conversion of PS II from the heat dissipating state back to the light-harvesting state can only be realized by an efficient removal of the quenching pigment Dtx. It is proposed that the high Dtx epoxidation rates during LL illumination serve exactly this purpose. The inhibition of Dtx epoxidation by the DeltapH, on the other hand, ensures rapid increases in the Dtx concentration when photoprotection under conditions of HL illumination is required. The regulation of the PS II antenna function in Ddx cycle containing algae is different to that in violaxanthin (Vx) cycle containing plants, where for the zeaxanthin (Zx)-dependent NPQ the presence of a proton gradient is mandatory. In the green alga Chlorella vulgaris conversion of PS II from the heat dissipating state back to the light-harvesting state is controlled by the DeltapH, whose relaxation after a transition from HL to darkness or LL rapidly abolishes the thermal dissipation of excitation energy, including the Zx-dependent NPQ. Due to the inability of Zx to quench fluorescence in the absence of the DeltapH a fast epoxidation of Zx to Vx in LL is not

  8. Human Factors Guidelines for the Evaluation of the Locomotive Cab

    Science.gov (United States)

    1995-09-01

    This document presents human factors guidelines for the evaluation of the locomotive cab. These guidelines are part of : an effort to evaluate working conditions and safety in the locomotive cab. The guidelines will serve as a decision : making tool ...

  9. Engaging with Community Advisory Boards (CABs) in Lusaka Zambia: perspectives from the research team and CAB members.

    Science.gov (United States)

    Mwinga, Alwyn; Moodley, Keymanthri

    2015-06-03

    The use of a Community Advisory Board (CAB) is one method of ensuring community engagement in community based research. To identify the process used to constitute CABs in Zambia, this paper draws on the perspectives of both research team members and CAB members from research groups who used CABs in Lusaka. Enabling and restricting factors impacting on the functioning of the CAB were identified. All studies approved by the University of Zambia Bioethics Research Committee (UBNZABREC) from 2008 - 2012 were reviewed to identify those studies that were likely to include a CAB. Eight teams with studies that included a CAB were identified. For each of these studies, consent was obtained to conduct an informal interview with a research team member and to obtain contact details for one CAB member. In total 14 interviews were conducted with 8 research team members and 6 CAB members from 12-30 August 2013. Identification of potential CAB members from the community and their participation in developing the terms of reference for CABs was perceived to have contributed to the success of the CAB. Due to the trust that the community had in members of their community the CABs were then in a stronger position to influence community participation in the research. Training of CAB members was identified as a factor that enhanced the functioning of a CAB. Lack of commitment and low literacy levels of CAB members posed a threat to the role of the CAB. Although compensation in the form of a stipend was not provided, CAB members were provided with transport reimbursements for attending meetings. Selection of CAB members from within the community contributed to community confidence in the CAB, enhancing its ability to act as an effective link between study team and community. This contributed positively to the conduct of the study and enhanced community awareness and acceptance of the research. However, establishment of study specific CABs has the potential to compromise CAB independence

  10. Structural and optical properties of tin (II) sulfide thin films deposited using organophosphorus precursor (Ph3PS)

    Science.gov (United States)

    Assili, Kawther; Alouani, Khaled; Vilanova, Xavier

    2017-02-01

    Tin sulfide (SnS) thin films have been deposited onto glass substrates using triphenylphosphine sulfide (Ph3PS) as a sulfur precursor in a chemical vapor deposition reactor in a temperature range of 250 °C-400 °C. The influence of the sulphidisation temperature in the crystal structure, surface morphology, chemical composition and optical properties has been investigated. X-ray diffraction, energy dispersive analysis of x-rays, and Raman spectroscopy showed that pure SnS thin films have been successfully obtained at 250 °C. All the deposited films were polycrystalline and showed orthorhombic structure, with a preferential orientation according to the direction . The optical measurements showed that the films deposited exhibited a direct allowed transition and have a relatively high absorption coefficient. The presence of mixed tin sulfide phases granted by the variation of the sulphidisation temperature has affected the optical properties of the deposited films. The refractive index (n) and extinction coefficient (k), has low values compared to conventional semiconductor materials. The grown films can be considered as a good light absorbing material and a promising candidate for application in optoelectronic devices.

  11. A multicenter, phase II study of bortezomib (PS-341) in patients with unresectable or metastatic gastric and gastroesophageal junction adenocarcinoma.

    Science.gov (United States)

    Shah, Manish A; Power, Derek G; Kindler, Hedy L; Holen, Kyle D; Kemeny, Margaret M; Ilson, David H; Tang, Laura; Capanu, Marinela; Wright, John J; Kelsen, David P

    2011-12-01

    The transcription factor nuclear factor-kB (NFkB) is implicated in gastric cancer carcinogenesis and survival, and its inhibition by proteosome inhibition is associated with preclinical gastric cancer anti-tumor activity. We examined the single agent efficacy of bortezomib, a selective proteasome inhibitor, in gastric adenocarcinoma. We performed a phase II trial of bortezomib in patients with advanced gastric adenocarcinoma. Bortezomib 1.3 mg/m(2) was administered on days 1, 4, 8, and 11 every 21 days. The primary endpoint was objective response rate(RR); the null hypothesis was RR <1% versus the alternative ≥15%. One response in the first stage(15 patients) was required before proceeding with an additional 18 patients. If at least 2 or more responses out of 33 were observed, further study with bortezomib was warranted. Correlative studies evaluated pre-treatment tumor expression of NFkB, IkB, p53, p21, and cyclin D1. We enrolled 16 patients (15 evaluable for response) from four institutions. No patients demonstrated an objective response(95% CI, 0-22%); one patient achieved stable disease. Fourteen out of 16 patients experienced ≥ grade 2 toxicity. The most common toxicity was fatigue in six patients (n = 4 grade 2, n = 2 grade 3). Seven patients experienced neuropathy (n = 5 grade 1, and 1 each grade 2 and 3). Seven (60%) had high cytoplasmic staining for NFkB. Single agent bortezomib is inactive in metastatic gastric adenocarcinoma and should not be pursued. Future study of proteasome inhibition in gastric adenocarcinoma should be considered in combination with targeted inhibition of other non-overlapping oncogenic pathways as a potential rational approach.

  12. 49 CFR 229.121 - Locomotive cab noise.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Locomotive cab noise. 229.121 Section 229.121... § 229.121 Locomotive cab noise. (a) Performance standards for locomotives. (1) When tested for static noise in accordance with paragraph (a)(3) of this section, all locomotives of each design or model that...

  13. Green Cabs vs. Uber in New York City

    DEFF Research Database (Denmark)

    Korsholm Poulsen, Lasse; Dekkers, Daan; Wagenaar, Nicolaas

    2016-01-01

    This paper reports on the process and outcomes of big data analytics of ride records for Green cabs and Uber in the outer boroughs of New York City (NYC), USA. Uber is a new entrant to the taxi market in NYC and is rapidly eating away market share from the NYC Taxi & Limousine Commission's (NYCTLC......) Yellow and Green cabs. The problem investigated revolves around where exactly Green cabs are losing market share to Uber outside Manhattan and what, if any, measures can be taken to preserve market share? Two datasets were included in the analysis including all rides of Green cabs and Uber respectively...... from April-September 2014 in New York excluding Manhattan and NYC's two airports. Tableau was used as the visual analytics tool, and PostgreSQL in combination with PostGIS was used as the data processing engine. Our findings show that the performance of Green cabs in isolated zip codes differ...

  14. Highly Flexible Protein-Peptide Docking Using CABS-Dock.

    Science.gov (United States)

    Ciemny, Maciej Paweł; Kurcinski, Mateusz; Kozak, Konrad Jakub; Kolinski, Andrzej; Kmiecik, Sebastian

    2017-01-01

    Protein-peptide molecular docking is a difficult modeling problem. It is even more challenging when significant conformational changes that may occur during the binding process need to be predicted. In this chapter, we demonstrate the capabilities and features of the CABS-dock server for flexible protein-peptide docking. CABS-dock allows highly efficient modeling of full peptide flexibility and significant flexibility of a protein receptor. During CABS-dock docking, the peptide folding and binding process is explicitly simulated and no information about the peptide binding site or its structure is used. This chapter presents a successful CABS-dock use for docking a potentially therapeutic peptide to a protein target. Moreover, simulation contact maps, a new CABS-dock feature, are described and applied to the docking test case. Finally, a tutorial for running CABS-dock from the command line or command line scripts is provided. The CABS-dock web server is available from http://biocomp.chem.uw.edu.pl/CABSdock/ .

  15. Correlated behavior of the EPR signal of cytochrome b-559 heme Fe(III) ligated by OH- and the multiline signal of the Mn cluster in PS-II membrane fragments.

    Science.gov (United States)

    Fiege, R; Shuvalov, V A

    1996-05-27

    EPR signals of Cyt b-559 heme Fe(III) ligated by OH- and the multiline signal of the Mn cluster in PS-II membrane fragments have been investigated. In 2,3-dicyano-5,6-dichloro-p-benzoquinone-oxidized PS-II membrane fragments the light-induced decrease of the EPR signal of the heme Fe(III)-OH- is accompanied by the appearance of the EPR multiline signal of the Mn cluster. Addition of F- ions, which act as a stronger ligand for heme Fe(III) than OH-, decreases to the same extent the dark- and light-induced signal of the heme Fe(III)-OH- and the light-induced multiline signal of the Mn cluster. These results are discussed in terms of the light-induced formation of a bound OH' radical shared between the Cyt b-559 heme Fe and the Mn cluster as a first step of water oxidation.

  16. Clean Cities case study : Barwood Cab Fleet study summary

    Science.gov (United States)

    1999-05-21

    Barwood Cab Fleet Study Summary is the second in a new series called 'Alternative Fuel Information Case Studies', designed to present real-world experiences with alternative fuels to fleet managers and other industry stakeholders.

  17. Cab technology integration laboratory demonstration with moving map technology

    Science.gov (United States)

    2013-03-31

    A human performance study was conducted at the John A. Volpe National Transportation Systems Center (Volpe Center) using a locomotive research simulatorthe Cab Technology Integration Laboratory (CTIL)that was acquired by the Federal Railroad Ad...

  18. Two transcription factors, CabA and CabR, are independently involved in multilevel regulation of the biosynthetic gene cluster encoding the novel aminocoumarin, cacibiocin.

    Science.gov (United States)

    Wolański, Marcin; Łebkowski, Tomasz; Kois-Ostrowska, Agnieszka; Zettler, Judith; Apel, Alexander K; Jakimowicz, Dagmara; Zakrzewska-Czerwińska, Jolanta

    2016-04-01

    Aminocoumarins are potent antibiotics belonging to a relatively small group of secondary metabolites produced by actinomycetes. Genome mining of Catenulispora acidiphila has recently led to the discovery of a gene cluster responsible for biosynthesis of novel aminocoumarins, cacibiocins. However, regulation of the expression of this novel gene cluster has not yet been analyzed. In this study, we identify transcriptional regulators of the cacibiocin gene cluster. Using a heterologous expression system, we show that the CabA and CabR proteins encoded by cabA and cabR genes in the cacibiocin gene cluster control the expression of genes involved in the biosynthesis, modification, regulation, and potentially, efflux/resistance of cacibiocins. CabA positively regulates the expression of cabH (the first gene in the cabHIYJKL operon) and cabhal genes encoding key enzymes responsible for the biosynthesis and halogenation of the aminocoumarin moiety, respectively. We provide evidence that CabA is a direct inducer of cacibiocin production, whereas the second transcriptional factor, CabR, is involved in the negative regulation of its own gene and cabT-the latter of which encodes a putative cacibiocin transporter. We also demonstrate that CabR activity is negatively regulated in vitro by aminocoumarin compounds, suggesting the existence of analogous regulation in vivo. Finally, we propose a model of multilevel regulation of gene transcription in the cacibiocin gene cluster by CabA and CabR.

  19. The cabABC Operon Essential for Biofilm and Rugose Colony Development in Vibrio vulnificus.

    Directory of Open Access Journals (Sweden)

    Jin Hwan Park

    2015-09-01

    Full Text Available A transcriptome analysis identified Vibrio vulnificus cabABC genes which were preferentially expressed in biofilms. The cabABC genes were transcribed as a single operon. The cabA gene was induced by elevated 3',5'-cyclic diguanylic acid (c-di-GMP and encoded a calcium-binding protein CabA. Comparison of the biofilms produced by the cabA mutant and its parent strain JN111 in microtiter plates using crystal-violet staining demonstrated that CabA contributed to biofilm formation in a calcium-dependent manner under elevated c-di-GMP conditions. Genetic and biochemical analyses revealed that CabA was secreted to the cell exterior through functional CabB and CabC, distributed throughout the biofilm matrix, and produced as the biofilm matured. These results, together with the observation that CabA also contributes to the development of rugose colony morphology, indicated that CabA is a matrix-associated protein required for maturation, rather than adhesion involved in the initial attachment, of biofilms. Microscopic comparison of the structure of biofilms produced by JN111 and the cabA mutant demonstrated that CabA is an extracellular matrix component essential for the development of the mature biofilm structures in flow cells and on oyster shells. Exogenously providing purified CabA restored the biofilm- and rugose colony-forming abilities of the cabA mutant when calcium was available. Circular dichroism and size exclusion analyses revealed that calcium binding induces CabA conformational changes which may lead to multimerization. Extracellular complementation experiments revealed that CabA can assemble a functional matrix only when exopolysaccharides coexist. Consequently, the combined results suggested that CabA is a structural protein of the extracellular matrix and multimerizes to a conformation functional in building robust biofilms, which may render V. vulnificus to survive in hostile environments and reach a concentrated infective dose.

  20. The cabABC Operon Essential for Biofilm and Rugose Colony Development in Vibrio vulnificus

    Science.gov (United States)

    Park, Jin Hwan; Jo, Youmi; Jang, Song Yee; Kwon, Haenaem; Irie, Yasuhiko; Parsek, Matthew R.; Kim, Myung Hee; Choi, Sang Ho

    2015-01-01

    A transcriptome analysis identified Vibrio vulnificus cabABC genes which were preferentially expressed in biofilms. The cabABC genes were transcribed as a single operon. The cabA gene was induced by elevated 3′,5′-cyclic diguanylic acid (c-di-GMP) and encoded a calcium-binding protein CabA. Comparison of the biofilms produced by the cabA mutant and its parent strain JN111 in microtiter plates using crystal-violet staining demonstrated that CabA contributed to biofilm formation in a calcium-dependent manner under elevated c-di-GMP conditions. Genetic and biochemical analyses revealed that CabA was secreted to the cell exterior through functional CabB and CabC, distributed throughout the biofilm matrix, and produced as the biofilm matured. These results, together with the observation that CabA also contributes to the development of rugose colony morphology, indicated that CabA is a matrix-associated protein required for maturation, rather than adhesion involved in the initial attachment, of biofilms. Microscopic comparison of the structure of biofilms produced by JN111 and the cabA mutant demonstrated that CabA is an extracellular matrix component essential for the development of the mature biofilm structures in flow cells and on oyster shells. Exogenously providing purified CabA restored the biofilm- and rugose colony-forming abilities of the cabA mutant when calcium was available. Circular dichroism and size exclusion analyses revealed that calcium binding induces CabA conformational changes which may lead to multimerization. Extracellular complementation experiments revealed that CabA can assemble a functional matrix only when exopolysaccharides coexist. Consequently, the combined results suggested that CabA is a structural protein of the extracellular matrix and multimerizes to a conformation functional in building robust biofilms, which may render V. vulnificus to survive in hostile environments and reach a concentrated infective dose. PMID:26406498

  1. Consortium for Algal Biofuel Commercialization (CAB-COMM) Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Mayfield, Stephen P. [Univ. of California, San Diego, CA (United States)

    2015-12-04

    The Consortium for Algal Biofuel Commercialization (CAB-Comm) was established in 2010 to conduct research to enable commercial viability of alternative liquid fuels produced from algal biomass. The main objective of CAB-Comm was to dramatically improve the viability of algae as a source of liquid fuels to meet US energy needs, by addressing several significant barriers to economic viability. To achieve this goal, CAB-Comm took a diverse set of approaches on three key aspects of the algal biofuels value chain: crop protection; nutrient utilization and recycling; and the development of genetic tools. These projects have been undertaken as collaboration between six academic institutions and two industrial partners: University of California, San Diego; Scripps Institution of Oceanography; University of Nebraska, Lincoln; Rutgers University; University of California, Davis; Johns Hopkins University; Sapphire Energy; and Life Technologies.

  2. Clean Cities Case Study: Barwood Cab Fleet Study Summary

    Energy Technology Data Exchange (ETDEWEB)

    Whalen, P.

    1999-05-21

    Barwood Cab Fleet Study Summary is the second in a new series called ''Alternative Fuel Information Case Studies,'' designed to present real-world experiences with alternative fuels to fleet managers and other industry stakeholders.

  3. Low frequency sound reproduction in irregular rooms using CABS (Control Acoustic Bass System)

    DEFF Research Database (Denmark)

    Celestinos, Adrian; Nielsen, Sofus Birkedal

    2011-01-01

    of an irregular room model using the FDTD (Finite Difference Time Domain) method has been presented. CABS has been simulated in the irregular room model. Measurements of CABS in a real irregular room have been performed. The performance of CABS was affected by the irregular shape of the room due to the corner...

  4. Last PS magnet refurbished

    CERN Document Server

    2009-01-01

    PS Magnet Refurbishment Programme Completed. The 51st and final refurbished magnet was transported to the PS on Tuesday 3 February. The repair and consolidation work on the PS started back in 2003 when two magnets and a busbar connection were found to be faulty during routine high-voltage tests. The cause of the fault was a combination of age and radiation on electrical insulation. After further investigation the decision was taken to overhaul half of the PS’s 100 magnets to reduce the risk of a similar fault. As from 20 February the PS ring will start a five-week test programme to be ready for operation at the end of March.

  5. Assessment of Proposed Cab Glass Coating for FAA Control Towers

    Science.gov (United States)

    2015-11-16

    Government’s approval or disapproval of its ideas or findings. i Standard Form 298 (Rev. 8-98) Prescribed by ANSI Std. Z39-18 REPORT...droplets from rain in such a way that one would expect improved visibility through the coated windows. 15. SUBJECT TERMS Cab glass, coatings...distribution of water droplets from rain (left is uncoated, right is coated

  6. Inside the PS tunnel

    CERN Multimedia

    1974-01-01

    Pre-start work is going on at the end of the PS long shut-down. The photo shows secondary beams drawn from an internal target (bottom) towards South Hall, behind the shielding wall (top) (see also photo 7409012X).

  7. PS Control Room

    CERN Multimedia

    CERN PhotoLab

    1963-01-01

    The good old PS Control Room, all manual. For each parameter, a knob or a button to control it; for each, a light or meter or oscilloscope to monitor it; carefully written pages serve as the data bank; phones and intercom for communication. D.Dekkers is at the microphone, M.Valvini sits in front.

  8. PS auxiliary magnet

    CERN Multimedia

    CERN PhotoLab

    1974-01-01

    Units of the PS auxiliary magnet system. The picture shows how the new dipoles, used for vertical and horizontal high-energy beam manipulation, are split for installation and removal so that it is not necessary to break the accelerator vacuum. On the right, adjacent to the sector valve and the windings of the main magnet, is an octupole of the set.

  9. PS injection area

    CERN Multimedia

    1974-01-01

    Looking against the direction of protons in the main ring (left): the beam coming from the linac 1 either goes to the booster (on the right) or is deflected towards the PS to be directly injected into section 26 (facing the camera). Also shown the start of the TT2 line, ejected from straight section 16 to go towards the ISR passing over the beam line from the linac. (see Photo Archive 7409009)

  10. PS injection area

    CERN Multimedia

    1974-01-01

    To the right is the PS ring viewed along the direction of the protons. At the left the injection line coming from the 50 MeV Linac 1 (bottom) and going towards the 800 MeV booster, or deflected to the right to be injected directly into straight section 16. The drumlike element behind the (blue) dipole magnet is a 'debuncher' (a 200 MHz cavity). See photos 7409014X and 7409009.

  11. Field assessment of enclosed cab filtration system performance using particle counting measurements.

    Science.gov (United States)

    Organiscak, John A; Cecala, Andrew B; Noll, James D

    2013-01-01

    Enclosed cab filtration systems are typically used on mobile mining equipment to reduce miners' exposure to airborne dust generated during mining operations. The National Institute for Occupational Safety and Health (NIOSH) Office of Mine Safety and Health Research (OMSHR) has recently worked with a mining equipment manufacturer to examine a new cab filtration system design for underground industrial minerals equipment. This cab filtration system uses a combination of three particulate filters to reduce equipment operators' exposure to dust and diesel particulates present in underground industrial mineral mines. NIOSH initially examined this cab filtration system using a two-instrument particle counting method at the equipment company's manufacturing shop facility to assess several alternative filters. This cab filtration system design was further studied on several pieces of equipment during a two- to seven-month period at two underground limestone mines. The two-instrument particle counting method was used outside the underground mine at the end of the production shifts to regularly test the cabs' long-term protection factor performance with particulates present in the ambient air. This particle counting method showed that three of the four cabs achieved protection factors greater than 1,000 during the field studies. The fourth cab did not perform at this level because it had a damaged filter in the system. The particle counting measurements of submicron particles present in the ambient air were shown to be a timely and useful quantification method in assessing cab performance during these field studies.

  12. Operators' perception of comfort in two tractor cabs.

    Science.gov (United States)

    Ferrari, E; Cavallo, E

    2013-01-01

    Workspace characteristics affect the perceived comfort level of the operator and uncomfortable working conditions have been found to have a negative impact on productivity and safety. The comfort of the operator is increasingly recognized by manufacturers as a product's added value. Comfort can positively distinguish a product and increase its competitiveness. The concept of comfort is controversial, and a clear operational definition is missing. Nevertheless, it is widely accepted that comfort is a subjective phenomenon that can be evaluated by the final users. In this study, comfort aspects of the tractor workspace interior (i.e., the cab) were investigated. Users with various levels of expertise and two medium-power utility tractors of different brands were used in a 2 x 2 mixed-factorial experimental design. Participants were involved in a dynamic assessment of the cabs, and their opinions about the different workspaces were collected through a questionnaire. Additionally, objective measurements were taken on both tractors, and subjective data were compared with objective data. Results indicate significant differences in terms of the ease of locating and operating the controls (i.e., rear-mounted three-point linkage, hydraulic system, and power take-off), the ease of starting the tractor, the ease exiting the cab, the required level of concentration in executing the tasks, the adequacy of lateral visibility from the driving station, and the level of noise at the operator's position. This article provides guidance for improving the comfort of tractor workspace interiors. Agricultural machinery manufactures would benefit from research results, differentiating themselves from competitors.

  13. At PS170 (APPLE)

    CERN Multimedia

    CERN PhotoLab

    1983-01-01

    APPLE stands for Antiproton-Proton to Pair of LEptons (an acronym of the ancestor experiment PAPLEP), the PS170 experiment setup at LEAR to study e+e-pair production in antiproton-proton annihilation by Padova-(CEN) Saclay- Torino Collaboration. It consisted of a liquid hydrogen target surrounded by several layers of proportional chambers in the vertical field of a C-magnet (this photo), a gas Cerenkov counter, wire chambers, hodoscopes, and an electromagnetic calorimeter (see photo 8302539X, 8302540X). See also photo 8301539X for the setup assembly at an early stage.

  14. Beyond iPS!

    Directory of Open Access Journals (Sweden)

    Editorial

    2012-01-01

    Full Text Available It’s undoubtedly a jubilant moment for scientists and clinicians working in the stem cell arena as Prof. Gurdon and Prof. Shinya Yamanaka have been chosen for the Nobel Prize in Physiology & Medicine this year. The mystery of cell biology is something unfathomable and probably the work of this duo as well as the other scientists, who have put their hands on in- vitro de-differentiation have opened our eyes to a new window or a new paradigm in cell biology. The iPS invention has brought a lot of hope in terms of potential direct benefits to treat several diseases, which have no definite options at the moment. But, we envisage that several spin-offs could come out of this invention and one very significant spin-off finding recently witnessed is the finding by Prof. Masaharu Seno and his team of researchers at the Okayama University, Japan (Chen L, et al. 2012, PLoS ONE 7(4:e33544.doi:10.1371/journal.pone.0033544. According to Prof. Seno, mouse iPS cells (miPS when cultured in the conditioned medium derived from cancer cell lines, differentiate into cancer stem cells (CSCs. While differentiating into CSCs, they do retain the potential to develop endothelial progenitor cells. Several questions arise here: 1.Are these miPS derived CSCs really pluripotent, even if the terminal differentiation destined to specific phenotypes? 2.Shouldn’t the Cancer Stem Cells be termed as cancer progenitor cells, as till date they are considered to be producing only cancer cells but not pluripotent to yield other types of normal tissues? The spin-offs could be infinite as the process of differentiation and de-differentiation happening due to trillions of signals and pathways, most still remaining not-so-well understood. A special mention should be made to Prof. Shinya Yamanaka as he has several sterling qualities to be a role-model for budding scientists. Apart from his passion for science, which made him shift his career from orthopedics to a cell biologist, his

  15. 49 CFR 238.447 - Train operator's controls and power car cab layout.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Train operator's controls and power car cab layout. 238.447 Section 238.447 Transportation Other Regulations Relating to Transportation (Continued... layout. (a) Train operator controls in the power car cab shall be arranged so as to minimize the chance...

  16. Field Assessment of Enclosed Cab Filtration System Performance Using Particle Counting Measurements

    Science.gov (United States)

    Organiscak, John A.; Cecala, Andrew B.; Noll, James D.

    2015-01-01

    Enclosed cab filtration systems are typically used on mobile mining equipment to reduce miners’ exposure to airborne dust generated during mining operations. The National Institute for Occupational Safety and Health (NIOSH) Office of Mine Safety and Health Research (OMSHR) has recently worked with a mining equipment manufacturer to examine a new cab filtration system design for underground industrial minerals equipment. This cab filtration system uses a combination of three particulate filters to reduce equipment operators’ exposure to dust and diesel particulates present in underground industrial mineral mines. NIOSH initially examined this cab filtration system using a two-instrument particle counting method at the equipment company’s manufacturing shop facility to assess several alternative filters. This cab filtration system design was further studied on several pieces of equipment during a two- to seven-month period at two underground limestone mines. The two-instrument particle counting method was used outside the underground mine at the end of the production shifts to regularly test the cabs’ long-term protection factor performance with particulates present in the ambient air. This particle counting method showed that three of the four cabs achieved protection factors greater than 1,000 during the field studies. The fourth cab did not perform at this level because it had a damaged filter in the system. The particle counting measurements of submicron particles present in the ambient air were shown to be a timely and useful quantification method in assessing cab performance during these field studies. PMID:23915268

  17. 30 CFR 75.1710 - Canopies or cabs; diesel-powered and electric face equipment.

    Science.gov (United States)

    2010-07-01

    ...-powered and electric face equipment, including shuttle cars, be provided with substantially constructed... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Canopies or cabs; diesel-powered and electric... Miscellaneous § 75.1710 Canopies or cabs; diesel-powered and electric face equipment. In any coal mine where the...

  18. 49 CFR 236.566 - Locomotive of each train operating in train stop, train control or cab signal territory; equipped.

    Science.gov (United States)

    2010-10-01

    ..., train control or cab signal territory; equipped. 236.566 Section 236.566 Transportation Other... train stop, train control or cab signal territory; equipped. The locomotive from which brakes are controlled, of each train operating in automatic train stop, train control, or cab signal territory shall be...

  19. 78 FR 13754 - Notice of Receipt of Petition for Decision That Nonconforming 2004 Ford F-150 Crew Cab Trucks...

    Science.gov (United States)

    2013-02-28

    ... Nonconforming 2004 Ford F-150 Crew Cab Trucks Manufactured for Sale in the Mexican Market Are Eligible for... a petition for a decision that 2004 Ford F-150 Crew Cab trucks manufactured for sale in the Mexican... 2004 Ford F-150 Crew Cab truck) and they are capable of being readily altered to conform to the...

  20. Center for Advanced Biofuel Systems (CABS) Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Kutchan, Toni M. [Donald Danforth Plant Science Center, St. Louis, MO (United States)

    2015-12-02

    One of the great challenges facing current and future generations is how to meet growing energy demands in an environmentally sustainable manner. Renewable energy sources, including wind, geothermal, solar, hydroelectric, and biofuel energy systems, are rapidly being developed as sustainable alternatives to fossil fuels. Biofuels are particularly attractive to the U.S., given its vast agricultural resources. The first generation of biofuel systems was based on fermentation of sugars to produce ethanol, typically from food crops. Subsequent generations of biofuel systems, including those included in the CABS project, will build upon the experiences learned from those early research results and will have improved production efficiencies, reduced environmental impacts and decreased reliance on food crops. Thermodynamic models predict that the next generations of biofuel systems will yield three- to five-fold more recoverable energy products. To address the technological challenges necessary to develop enhanced biofuel systems, greater understanding of the non-equilibrium processes involved in solar energy conversion and the channeling of reduced carbon into biofuel products must be developed. The objective of the proposed Center for Advanced Biofuel Systems (CABS) was to increase the thermodynamic and kinetic efficiency of select plant- and algal-based fuel production systems using rational metabolic engineering approaches grounded in modern systems biology. The overall strategy was to increase the efficiency of solar energy conversion into oils and other specialty biofuel components by channeling metabolic flux toward products using advanced catalysts and sensible design:1) employing novel protein catalysts that increase the thermodynamic and kinetic efficiencies of photosynthesis and oil biosynthesis; 2) engineering metabolic networks to enhance acetyl-CoA production and its channeling towards lipid synthesis; and 3) engineering new metabolic networks for the

  1. SPS and PS Experiments Committee

    CERN Multimedia

    CERN. Geneva

    2004-01-01

    OPEN SESSION: 09:00 Status report of NA58 / COMPASS: A. Magnon 09:40 Status report of PS212 / DIRAC: L. Tausher 10:10 PS212 / DIRAC Addendum: L. Nemenov CLOSED SESSION on Tuesday, 27 April 2004 after the open session, Main Building, 6th floor conference room

  2. The Libera as a PS orbit measurement system building block

    CERN Document Server

    Belleman, J M; CERN. Geneva. AB Department

    2005-01-01

    During the year 2004, extensive tests using a Libera data processor have been made in order to study its suitability as a building block for a complete PS trajectory and orbit measurement system. The Libera consists of four fast 12-bits ADCs, a Virtex II Pro FPGA and a large memory. This note presents some of the results of the analysis of acquisitions made on a position pick-up in the CERN PS.

  3. Role of extracellular matrix protein CabA in resistance of Vibrio vulnificus biofilms to decontamination strategies.

    Science.gov (United States)

    Park, Jin Hwan; Lee, Byungho; Jo, Youmi; Choi, Sang Ho

    2016-11-07

    Biofilms are recalcitrant and raise safety problems in the food industry. In this study, the role of CabA, an extracellular matrix protein, in the resistance of the biofilms of Vibrio vulnificus, a foodborne pathogen, to decontamination strategies was investigated. Biofilms of the cabA mutant revealed reduced resistance to detachment by vibration and disinfection by sodium hypochlorite compared to the biofilms of the parental wild type in vitro. The reduced resistance of the cabA mutant biofilms was complemented by introducing a recombinant cabA, indicating that the reduced resistance of the cabA mutant biofilms is caused by the inactivation of cabA. The expression of cabA was induced in cells bound to oyster, the primary vehicle of the pathogen. The cabA mutant biofilms on oyster are defective in biomass and resistance to detachment and disinfection. The bacterial cells in the wild-type biofilms are clustered by filaments which are not apparent in the cabA mutant biofilms. The combined results indicated that CabA contributes to the structural integrity of V. vulnificus biofilms possibly by forming filaments in the matrix and thus rendering the biofilms robust, suggesting that CabA could be a target to control V. vulnificus biofilms on oyster. Copyright © 2016 Elsevier B.V. All rights reserved.

  4. Prototype design and test of a collision protection system for cab car engineers.

    Science.gov (United States)

    2014-12-01

    Advancements in the design of rail cars can : potentially prevent the structural collapse of : space occupied by a cab car engineer : during a train collision. With adequate : survival space maintained, the next : crashworthiness objective is to mini...

  5. Prototype design of a collision protection system for cab car engineers - fabrication and test.

    Science.gov (United States)

    2015-06-01

    Advancements in the structural crashworthiness of passenger rail cars now make it possible to preserve the compartmentalized : space occupied by a cab car engineer during a train collision. In order to translate this additional protection into improv...

  6. 49 CFR 236.512 - Cab signal indication when locomotive enters block where restrictive conditions obtain.

    Science.gov (United States)

    2010-10-01

    ... where restrictive conditions obtain. 236.512 Section 236.512 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RULES... Systems Standards § 236.512 Cab signal indication when locomotive enters block where restrictive...

  7. Biological Control of White Rot in Garlic Using Burkholderia pyrrocinia CAB08106-4

    Directory of Open Access Journals (Sweden)

    Kwang Seop Han

    2013-03-01

    Full Text Available White rot caused by Sclerotium cepivorum was reported to be severe soil-born disease on garlic. Disease progress of white rot of garlic (Allium sativum L. was investigated during the growing season of 2009 to 2011 at Taean and Seosan areas. The white rot disease on bulb began to occur from late April and peaked in late May. The antifungal bacteria, Burkholderia pyrrocinia CAB08106-4 was tested in field bioassay for suppression of white rot disease. As a result of the nucleotide sequence of the gene 16S rRNA, CAB008106-4 strain used in this study has been identified as B. pyrrocinia. B. pyrrocinia CAB080106-4 isolate suppressed the white rot with 69.6% control efficacy in field test. These results suggested that B. pyrrocinia CAB08106-4 isolate could be an effective biological control agent against white rot of garlic.

  8. Experimental investigation and performance analysis of inertia properties measurement for heavy truck cab

    Directory of Open Access Journals (Sweden)

    Tianjun Zhu

    2015-11-01

    Full Text Available An experimental investigation and performance analysis of inertia properties measurement for heavy truck cab is presented. This method is specifically intended for measuring the inertia properties of irregular rigid bodies, and it has the potential to be applied to the measurement of the inertia properties of vehicle bodies, such as the cab, engine, and gearbox. This article, based on CATARC moment of inertia measurement system test rig, develops an accurate measuring method to identify inertia parameters of heavy truck cab. First, corresponding tests are carried out, and the lever principle and moments of inertia parallel theorem are employed to calculate and analyse the test results, which leads to the accurate value of inertia parameters. Second, the performance analysis of the proposed method is verified through the measurement error analysis. As a result, the proposed method shows high accuracy, which provides an experimental basis for accurate inertia parameter measurement of heavy truck cab.

  9. Towards a covariance matrix of CAB model parameters for H(H2O

    Directory of Open Access Journals (Sweden)

    Scotta Juan Pablo

    2017-01-01

    Full Text Available Preliminary results on the uncertainties of hydrogen into light water thermal scattering law of the CAB model are presented. It was done through a coupling between the nuclear data code CONRAD and the molecular dynamic simulations code GROMACS. The Generalized Least Square method was used to adjust the model parameters on evaluated data and generate covariance matrices between the CAB model parameters.

  10. Potential air toxics hot spots in truck terminals and cabs.

    Science.gov (United States)

    Smith, Thomas J; Davis, Mary E; Hart, Jaime E; Blicharz, Andrew; Laden, Francine; Garshick, Eric

    2012-12-01

    Hot spots are areas where concentrations of one or more air toxics--organic vapors or particulate matter (PM)--are expected to be elevated. The U.S. Environmental Protection Agency's (EPA*) screening values for air toxics were used in our definition of hot spots. According to the EPA, a screening value "is used to indicate a concentration of a chemical in the air to which a person could be continually exposed for a lifetime ... and which would be unlikely to result in a deleterious effect (either cancer or noncancer health effects)" (U.S. EPA 2006). Our characterization of volatile organic compounds (VOCs; namely 18 hydrocarbons, methyl tert-butyl ether [MTBE], acetone, and aldehydes) was added onto our ongoing National Cancer Institute-funded study of lung cancer and particulate pollutant concentrations (PM with an aerodynamic diameter parks; downwind areas affected by upwind and terminal sources; and the loading docks and mechanic shops within terminal as well as the interior of cabs of trucks being driven on city, suburban, and rural streets and on highways. In Phase 1 of our study, 15 truck terminals across the United States were each visited for five consecutive days. During these site visits, sorbent tubes were used to collect 12-hour integrated samples of hydrocarbons and aldehydes from upwind and downwind fence-line locations as well as inside truck cabs. Meteorologic data and extensive site information were collected with each sample. In Phase 2, repeat visits to six terminals were conducted to test the stability of concentrations across time and judge the representativeness of our previous measurements. During the repeat site visits, the sampling procedure was expanded to include real-time sampling for total hydrocarbon (HC) and PM2.5 at the terminal upwind and downwind sites and inside the truck cabs, two additional monitors in the yard for four-quadrant sampling to better characterize the influence of wind, and indoor sampling in the loading dock and

  11. A simple turbidimetric method for monitoring the inhibition of tRNA-dependent amidotransferase GatCAB.

    Science.gov (United States)

    Chatani, Miho; Tanaka, Michiko; Nakamura, Akiyoshi; Takesue, Nobuchika; Tanaka, Isao; Asano, Kozo

    2010-02-01

    In eubacteria that lack glutaminyl-tRNA synthetase (GlnRS), a tRNA-dependent amidotransferase (GatCAB) recognizes mischarged Glu-tRNA(Gln) and converts it into Gln-tRNA(Gln). An inhibitor specific for GatCAB could therefore act as an antibiotic with a novel mode of action against multidrug-resistant bacteria such as Staphylococcus strains. However, there is no rapid, simple and efficient screening method for specifically monitoring the inhibition of GatCAB activity. We have focused on developing a simple system for monitoring the inhibition of GatCAB activity using Escherichia coli Top10 co-expressing the ndGluRS and GatCAB genes from Staphylococcus aureus Mu50. First, growth repression was confirmed by introducing ndgluRS from S. aureus Mu50 into E. coli. Then, we verified that co-expression of the gatCAB operon alleviated growth repression in the host E. coli. The screening system consisted of these two transformants and non-expressing E. coli Top10. The transformant harbors both ndGluRS gene and GatCAB operon could be co-expressed in the presence and in the absence of chemical compound of interest. Since there is no inhibitor that inactivates GatCAB activity, we expressed two inactive GatCAB deletion variants, GatCAB(Delta10) and GatCAB(DeltaCHD) together with ndGluRS in E. coli Top10. The expressed E. coli showed repressed growth as well as ndGluRS expressed. These results indicate that if GatCAB activity is inhibited in this co-expressed E. coli, the inhibition can be monitored by the decrease in O.D. of the co-expressed E. coli. Copyright 2009 Elsevier B.V. All rights reserved.

  12. The PS locomotive runs again

    CERN Multimedia

    2001-01-01

    Over forty years ago, the PS train entered service to steer the magnets of the accelerator into place... ... a service that was resumed last Tuesday. Left to right: Raymond Brown (CERN), Claude Tholomier (D.B.S.), Marcel Genolin (CERN), Gérard Saumade (D.B.S.), Ingo Ruehl (CERN), Olivier Carlier (D.B.S.), Patrick Poisot (D.B.S.), Christian Recour (D.B.S.). It is more than ten years since people at CERN heard the rumbling of the old PS train's steel wheels. Last Tuesday, the locomotive came back into service to be tested. It is nothing like the monstrous steel engines still running on conventional railways -just a small electric battery-driven vehicle employed on installing the magnets for the PS accelerator more than 40 years ago. To do so, it used the tracks that run round the accelerator. In fact, it is the grandfather of the LEP monorail. After PS was commissioned in 1959, the little train was used more and more rarely. This is because magnets never break down, or hardly ever! In fact, the loc...

  13. The PS Booster hits 40

    CERN Multimedia

    Joannah Caborn Wengler

    2012-01-01

    Many accelerators’ "round" birthdays are being celebrated at CERN these days – the PS turned 50 in 2009, the SPS was 35 in 2011, and this year it's the turn of the PS Booster to mark its 40th anniversary. Originally designed to accelerate 1013 protons to 800 MeV, it has far exceeded its initial design performance over the years.   The PS Booster in the 1970s. Imagine the scene: a group of accelerator physicists staring expectantly at a monitor, when suddenly a shout of joy goes up as a signal flickers across the screen. Does that sound familiar? Well, turn the clock back 40 years (longer hair, wider trouser legs) and you have the situation at the PS Booster on 26 May 1972. On that day, beam was injected into the Booster for the first time. “It was a real buzz,” says Heribert Koziol, then Chairman of the Running-in Committee. “We were very happy – and also a little relieved – when the beam finally...

  14. Mapping Chinese Agricultural and Allied Sciences Journals Indexed in CAB Abstracts Database

    Directory of Open Access Journals (Sweden)

    Arundhati Kaushik

    2013-06-01

    Full Text Available CAB Abstracts published by CABI (Centre for Agriculture and Biosciences International is the premier database for agricultural and allied sciences literature. The purpose of this study is to determine the extent of index coverage in CAB Abstracts and to identify the core journals in the field of agricultural and allied sciences published in China. The study depicts the trend of Chinese agricultural and allied sciences journals, which is successfully proving a gateway of the agricultural research in China to merge into the main stream of the world.

  15. STRATEGI BRI SYARIAH CAB. KENDARI UNTUK MENGATASI GAGAL BAYAR PADA PROGRAM PEMBIAYAAN USAHA MIKRO

    Directory of Open Access Journals (Sweden)

    Turmudi Turmudi

    2016-05-01

      Abstrak Penelitian ini merupakan penelitian kualitatif deskriftif yang bertujuan mengetahui strategi yang dilakukan BRI Syariah Cab. Kendari untuk mencegah serta mengatasi gagal bayar nasabah pembiayaan usaha mikro. Data yang diperoleh pada penelitian ini melalui observasi, wawancara serta studi dokumen. BRI Syariah Cab. Kendari memiliki program pembiayaan bagi pengusaha mikro yang diberi nama Mikro 25iB, Mikro 75iB serta Mikro 500iB. Penerapan prinsip kehati-hatian pada pembiayaan usaha mikro dimulai ketika calon debitur mengajukan permohonan pembiayaan yakni dengan mengikuti persyaratan administratif yang sudah ditentukan BRI Syaraiah Cab. Kendari kemudian dianalisa mengenai character, capacity, capital, collateral, kondisi dan Syariah untuk mencegah risiko adanya nasabah yang mengalami masalah dalam pembayaran pembiayaan (wanprestatie. Upaya penyelamatan pembiayaan BRI Syariah Cab. Kendari yaitu 1 melalui program rescheduling, reconditioning, ataupun restructuring 2 Penyelesaian pembiayaan bermasalah melalui proses pengadilan dilakukan apabila pihak debitur sengaja tidak mau membayar sehingga tidak ada keinginan untuk melunasi kewajibannya, atau apabila proses penyelesaian di luar pengadilan tidak membawa hasil seperti yang diharapkan. Kata kunci: Pembiayaan Usaha Mikro, Pembiayaan Bermasalah, Prinsip Kehati-hatian Bank.

  16. U.S. truck driver anthropometric study and multivariate anthropometric models for cab designs.

    Science.gov (United States)

    Guan, Jinhua; Hsiao, Hongwei; Bradtmiller, Bruce; Kau, Tsui-Ying; Reed, Matthew R; Jahns, Steven K; Loczi, Josef; Hardee, H Lenora; Piamonte, Dominic Paul T

    2012-10-01

    This study presents data from a large-scale anthropometric study of U.S. truck drivers and the multivariate anthropometric models developed for the design of next-generation truck cabs. Up-to-date anthropometric information of the U.S. truck driver population is needed for the design of safe and ergonomically efficient truck cabs. We collected 35 anthropometric dimensions for 1,950 truck drivers (1,779 males and 171 females) across the continental United States using a sampling plan designed to capture the appropriate ethnic, gender, and age distributions of the truck driver population. Truck drivers are heavier than the U.S.general population, with a difference in mean body weight of 13.5 kg for males and 15.4 kg for females. They are also different in physique from the U.S. general population. In addition, the current truck drivers are heavier and different in physique compared to their counterparts of 25 to 30 years ago. The data obtained in this study provide more accurate anthropometric information for cab designs than do the current U.S. general population data or truck driver data collected 25 to 30 years ago. Multivariate anthropometric models, spanning 95% of the current truck driver population on the basis of a set of 12 anthropometric measurements, have been developed to facilitate future cab designs. The up-to-date truck driver anthropometric data and multivariate anthropometric models will benefit the design of future truck cabs which, in turn, will help promote the safety and health of the U.S. truck drivers.

  17. Modeling of protein-peptide interactions using the CABS-dock web server for binding site search and flexible docking.

    Science.gov (United States)

    Blaszczyk, Maciej; Kurcinski, Mateusz; Kouza, Maksim; Wieteska, Lukasz; Debinski, Aleksander; Kolinski, Andrzej; Kmiecik, Sebastian

    2016-01-15

    Protein-peptide interactions play essential functional roles in living organisms and their structural characterization is a hot subject of current experimental and theoretical research. Computational modeling of the structure of protein-peptide interactions is usually divided into two stages: prediction of the binding site at a protein receptor surface, and then docking (and modeling) the peptide structure into the known binding site. This paper presents a comprehensive CABS-dock method for the simultaneous search of binding sites and flexible protein-peptide docking, available as a user's friendly web server. We present example CABS-dock results obtained in the default CABS-dock mode and using its advanced options that enable the user to increase the range of flexibility for chosen receptor fragments or to exclude user-selected binding modes from docking search. Furthermore, we demonstrate a strategy to improve CABS-dock performance by assessing the quality of models with classical molecular dynamics. Finally, we discuss the promising extensions and applications of the CABS-dock method and provide a tutorial appendix for the convenient analysis and visualization of CABS-dock results. The CABS-dock web server is freely available at http://biocomp.chem.uw.edu.pl/CABSdock/. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.

  18. EDH 'Millionaire' in PS Division

    CERN Document Server

    2001-01-01

    Christmas cheer! Left to right: Gerard Lobeau receives a bottle of Champagne from Derek Mathieson and Jurgen De Jonghe in recognition of EDH's millionth document. At 14:33 on Monday 3 December a technician in PS division, Gerard Lobeau, unwittingly became part of an important event in the life of CERN's Electronic Document Handling system (EDH). While ordering some pieces of aluminum for one of the PS's 10Mhz RF cavities, he created EDH document number 1,000,000. To celebrate the event Derek Mathieson (EDH Project Leader) and Jurgen De Jonghe (Original EDH Project Leader) presented Mr Lobeau with a bottle of champagne. As with 93% of material requests, Mr Lobeau's order was delivered within 24 hours. 'I usually never win anything' said Mr Lobeau as he accepted his prize, 'I initially though there may have been a problem with EDH when the document number had so many zeros in it, and was then surprised to get a phone call from you a few minutes later.' The EDH team had been monitoring the EDH document number ...

  19. A simple turbidimetric method for monitoring the inhibition of tRNA-dependent amidotransferase GatCAB

    OpenAIRE

    Chatani, Miho; Tanaka, Michiko; Nakamura, Akiyoshi; Takesue, Nobuchika; Tanaka, Isao; ASANO, Kozo

    2010-01-01

    In eubacteria that lack glutaminyl-tRNA synthetase (GlnRS), a tRNA-dependent amidotransferase (GatCAB) recognizes mischarged Glu-tRNA^[Gln] and converts it into Gln-tRNA^[Gln]. An inhibitor specific for GatCAB could therefore act as an antibiotic with a novel mode of action against multidrug-resistant bacteria such as Staphylococcus strains. However, there is no rapid, simple and efficient screening method for specifically monitoring the inhibition of GatCAB activity. We have focused on devel...

  20. Modal analysis of a truck cab using the least squares complex exponent test method

    Directory of Open Access Journals (Sweden)

    Pingqing Fan

    2015-03-01

    Full Text Available This article introduces the basic theory of modal analysis. The modal testing system is established for a developing truck body. Using a pseudo-random excitation signal along the x, y, and z directions, the modal test is carried out to obtain the dynamic performance by multi-point excitations. The transfer function set is obtained by averaging all transfer functions, and the set is processed by order selection to get 28 order modes. Fitting modal parameters and normalizing modal mass can gain natural frequencies and vibration modes of cab. Then, the modal analysis of truck cab is calculated based on the finite element method, and the results are compared with the test results. The improved measures are put forward to enhance the local stiffness, avoid modal coupling, and reduce vibration noise. So, this article supplies a reference for the dynamic test for the large body.

  1. Low frequency sound reproduction in irregular rooms using CABS (Control Acoustic Bass System)

    DEFF Research Database (Denmark)

    Celestinos, Adrian; Nielsen, Sofus Birkedal

    2011-01-01

    loudspeakers well positioned at the end of the room a virtual array is formed propagating plane waves along the length of the room in one direction. This will correct the sound field distribution in the room. When plane wave arrives to the end wall two more loudspeakers have to be placed connected......Early investigations on low frequency sound reproduction in rectangular rooms using CABS (Controlled Acoustic Bass System) have shown good results on simulations and measurements in real rooms. CABS takes the advantage of having a rectangular room with parallel walls. By using two low frequency...... with the same signal in counter phase and with a delay corresponding to approximately the length of the room. This is to cancel the reflection and maintain the plane wave propagating along the room. Real life rooms are not necessary rectangular and can be of different shapes. In this paper simulations...

  2. Low frequency sound field control for loudspeakers in rectangular rooms using CABS (Controlled Acoustical Bass System)

    DEFF Research Database (Denmark)

    Nielsen, Sofus Birkedal; Celestinos, Adrian

    2010-01-01

    Rectangular rooms are the most common shape for sound reproduction, but at low frequencies the reflections from the boundaries of the room cause large spatial variations in the sound pressure level.  Variations up to 30 dB are normal, not only at the room modes, but basically at all frequencies....... As sound propagates in time, it seems natural that the problems can best be analyzed and solved in the time domain. A time based room correction system named CABS (Controlled Acoustical Bass System) has been developed for sound reproduction in rectangular listening rooms. It can control the sound...... distribution in the room at low frequencies by using multiple loudspeakers together with an optimal placement of the loudspeakers.  At low frequencies CABS will create a plane wave from the front wall loudspeakers which will be absorbed by additional loudspeakers at the rear wall giving an almost homogeneous...

  3. Electro-deposition painting process improvement of cab truck by Six Sigma concept

    Science.gov (United States)

    Kawitu, Kitiya; Chutima, Parames

    2017-06-01

    The case study company is a manufacturer of trucks and currently facing a high rework cost due to the thickness of the electro-deposited paint (EDP) of the truck cab is lower than standard. In addition, the process capability is very low. The Six Sigma concept consisting of 5 phases (DMAIC) is applied to determine new parameter settings for each significant controllable factor. After the improvement, EDP thickness of the truck cab increases from 17.88μ to 20μ (i.e. standard = 20 ± 3μ). Moreover, the process capability indexes (Cp and Cpk) are increased from 0.9 to 1.43, and from 0.27 to 1.43, respectively. This improvement could save the rework cost about 1.6M THB per year.

  4. CAB-DWTM for 5 μm trace-width deposition of solar cell metallization top-contacts

    Energy Technology Data Exchange (ETDEWEB)

    Justin Hoey; Drew Thompson; Matt Robinson; Zakaria Mahmud; Orven F. Swenson; Iskander S. Akhatov; Douglas L. Schulz

    2009-06-08

    This paper reviews methods for creating solar cell grid contacts and explores how cell efficiency can be increased using CAB-DW{trademark}. Specifically, the efficiency of p-i-n structure solar cells built in-house with 90 {micro}m sputtered lines and 5 {micro}m CAB-DW lines were compared. Preliminary results of the comparison show a marked improvement in solar cell efficiency using CAB-DW. In addition to this, a theoretical and experimental analysis of the dynamics of particle impaction on a substrate (i.e. whether particle stick or bounce) will be discussed including how this analysis may lead to further improvement of CAB-DW.

  5. Sleeper Cab Climate Control Load Reduction for Long-Haul Truck Rest Period Idling

    Energy Technology Data Exchange (ETDEWEB)

    Lustbader, J. A.; Kreutzer, C.; Adelman, S.; Yeakel, S.; Zehme, J.

    2015-04-29

    Annual fuel use for long-haul truck rest period idling is estimated at 667 million gallons in the United States. The U.S. Department of Energy’s National Renewable Energy Laboratory’s CoolCab project aims to reduce heating, ventilating, and air conditioning (HVAC) loads and resulting fuel use from rest period idling by working closely with industry to design efficient long-haul truck climate control systems while maintaining occupant comfort. Enhancing the thermal performance of cab/sleepers will enable smaller, lighter, and more cost-effective idle reduction solutions. In order for candidate idle reduction technologies to be implemented at the original equipment manufacturer and fleet level, their effectiveness must be quantified. To address this need, a number of promising candidate technologies were evaluated through experimentation and modeling to determine their effectiveness in reducing rest period HVAC loads. For this study, load reduction strategies were grouped into the focus areas of solar envelope, occupant environment, and conductive pathways. The technologies selected for a complete-cab package of technologies were “ultra-white” paint, advanced insulation, and advanced curtains. To measure the impact of these technologies, a nationally-averaged solar-weighted reflectivity long-haul truck paint color was determined and applied to the baseline test vehicle. Using the complete-cab package of technologies, electrical energy consumption for long-haul truck daytime rest period air conditioning was reduced by at least 35% for summer weather conditions in Colorado. The National Renewable Energy Laboratory's CoolCalc model was then used to extrapolate the performance of the thermal load reduction technologies nationally for 161 major U.S. cities using typical weather conditions for each location over an entire year.

  6. Pesticide aerosol characteristics in the vicinity of an agricultural vehicle cab during application.

    Science.gov (United States)

    Bémer, Denis; Fismes, Joelle; Subra, Isabelle; Blachère, Veronique; Protois, Jean-Claude

    2007-07-01

    Pesticide spraying for crop protection leads to the formation of a mist of droplets, part of which is dispersed into the atmosphere. The characteristics of this aerosol, namely its particle size distribution and concentration, were measured during five campaigns involving cereal crop growing, wine grape culture, and orcharding. The measurement method incorporated a tracer product (fluorescein) with the treatment product; the pesticide aerosol concentration was then deduced from the tracer concentration. This method was validated by comparing the pesticide concentration determined by tracing with the concentration determined by direct measurement of the active substance of the pesticide. Concentration was measured using sampling filters, and particle size distribution was measured using cascade impactors. Instruments were mounted on an agricultural vehicle cab to optimize aerosol characterization, and then the cab's confinement efficiency was determined. Aerosols analyzed were fine, featuring mass median diameters between 4 microm and 15 microm; they are therefore highly dispersive. Their concentration is sufficiently high to justify operator protection by an efficient, filtered-air, pressurized cab, especially in wine grape culture and orcharding, which are the sectors where the highest pesticide transfers have been observed.

  7. Conceptual design study for an advanced cab and visual system, volume 1

    Science.gov (United States)

    Rue, R. J.; Cyrus, M. L.; Garnett, T. A.; Nachbor, J. W.; Seery, J. A.; Starr, R. L.

    1980-01-01

    A conceptual design study was conducted to define requirements for an advanced cab and visual system. The rotorcraft system integration simulator is for engineering studies in the area of mission associated vehicle handling qualities. Principally a technology survey and assessment of existing and proposed simulator visual display systems, image generation systems, modular cab designs, and simulator control station designs were performed and are discussed. State of the art survey data were used to synthesize a set of preliminary visual display system concepts of which five candidate display configurations were selected for further evaluation. Basic display concepts incorporated in these configurations included: real image projection, using either periscopes, fiber optic bundles, or scanned laser optics; and virtual imaging with helmet mounted displays. These display concepts were integrated in the study with a simulator cab concept employing a modular base for aircraft controls, crew seating, and instrumentation (or other) displays. A simple concept to induce vibration in the various modules was developed and is described. Results of evaluations and trade offs related to the candidate system concepts are given, along with a suggested weighting scheme for numerically comparing visual system performance characteristics.

  8. Vehicle design influences whole body vibration exposures: effect of the location of the front axle relative to the cab.

    Science.gov (United States)

    Blood, Ryan P; Rynell, Patrik W; Johnson, Peter W

    2011-06-01

    Using a repeated measure design, this study compared differences in whole body vibration (WBV) exposures among 13 drivers who drove a truck with the cab over the front axle (cab-over design) and a truck with the cab situated behind the front axle (non-cab-over design). The drivers drove both trucks over a standardized route that comprised three distinct segments: a freeway segment, a city street segment with stop-and-go driving (traffic lights), and a city street segment without traffic lights. A portable WBV data acquisition system collected tri-axial time-weighted and raw WBV data per ISO 2631-1 and 2631-5 standards. Simultaneous global positioning system (GPS) data were also collected to compare vehicle speeds. The GPS data indicated that there were no speed differences between the two vehicles. However, average and impulsive z-axis vibration levels were significantly higher for the cab-over design than for the non-cab-over design. In addition, significant WBV exposure differences between road types were found, with the freeway segments having the lowest exposures and the city street segments without traffic lights having the highest exposures. Vehicle type and the associated WBV exposures should be considered when purchasing vehicles to be used by full-time professional vehicle operators.

  9. Determinants of tobacco use and prevalence of oral precancerous lesions in cab drivers in Bengaluru City, India

    Directory of Open Access Journals (Sweden)

    Punith Shetty

    2017-01-01

    Full Text Available Background: Tobacco is a most important risk factor for various types of cancer as well as some noncommunicable disease. Around 34.6% of Indian population consume tobacco. The tobacco consumption is higher in some vulnerable population such as drivers, daily wage laborers, and policemen. Tobacco consumption is known to cause oral cancers, and screening for oral cancer in these individuals is known to reduce mortality from cancer. The study was designed to assess the determinants of tobacco use and the prevalence of oral precancerous lesions in cab drivers. Methods: This is a cross-sectional study among cab drivers at prepaid taxi counters in Bengaluru city. A total of 450 cab drivers were enrolled in the study, of which 225 cab drivers were interviewed during morning hours and remaining half at night time using a semi-structured questionnaire. All were screened for oral cancer/precancerous lesions. Results: Nearly 70.88% of cab drivers were consuming tobacco in any form. Long working hours, working at night, and family members consuming tobacco were significant risk factors for tobacco use among cab drivers. Forty-eight drivers were detected to have oral precancerous lesions. Conclusions: It was very evident that long hours of driving and infrequent shifts played a greater role in acquiring the habit. Behavioral counseling and new laws need to be formed to limit the working hours in drivers to have an effective tobacco control.

  10. Synthesis and Crystal Structure of Hexakis(imidazole nickel (II O,O′-diphenyldithiophosphate [Ni(Im6](Ph2O2PS22

    Directory of Open Access Journals (Sweden)

    Kui Jiao

    2003-12-01

    Full Text Available The crystal and molecular structures of [Ni(Im6](dtp2 (Im = imidazole, dtp = O,O′-diphenyldithiophosphate have been determined by X-ray crystallography. It crystallizes in the triclinic system, space group Pī, with cell parameters a = 9.375 (2, b = 12.324(3, c = 13.285(3 Å, α = 107.86(3, β = 102.28(3, γ = 109.24(3, and Z = 1. The crystal structure of the title compound is built up of discrete monomeric molecules of [Ni(Im6](dtp2. The nickel (II ion is hexacoordinated by six imidazole molecules and the coordination environment of Ni (II is of octahedral geometry. In the solid state, a network of N-H···S intermolecular hydrogen bonds connect the Ni(Im6 moieties and O,O′-diphenyldithiophosphate molecules, forming a three-dimensional structure.

  11. psRNATarget: a plant small RNA target analysis server.

    Science.gov (United States)

    Dai, Xinbin; Zhao, Patrick Xuechun

    2011-07-01

    Plant endogenous non-coding short small RNAs (20-24 nt), including microRNAs (miRNAs) and a subset of small interfering RNAs (ta-siRNAs), play important role in gene expression regulatory networks (GRNs). For example, many transcription factors and development-related genes have been reported as targets of these regulatory small RNAs. Although a number of miRNA target prediction algorithms and programs have been developed, most of them were designed for animal miRNAs which are significantly different from plant miRNAs in the target recognition process. These differences demand the development of separate plant miRNA (and ta-siRNA) target analysis tool(s). We present psRNATarget, a plant small RNA target analysis server, which features two important analysis functions: (i) reverse complementary matching between small RNA and target transcript using a proven scoring schema, and (ii) target-site accessibility evaluation by calculating unpaired energy (UPE) required to 'open' secondary structure around small RNA's target site on mRNA. The psRNATarget incorporates recent discoveries in plant miRNA target recognition, e.g. it distinguishes translational and post-transcriptional inhibition, and it reports the number of small RNA/target site pairs that may affect small RNA binding activity to target transcript. The psRNATarget server is designed for high-throughput analysis of next-generation data with an efficient distributed computing back-end pipeline that runs on a Linux cluster. The server front-end integrates three simplified user-friendly interfaces to accept user-submitted or preloaded small RNAs and transcript sequences; and outputs a comprehensive list of small RNA/target pairs along with the online tools for batch downloading, key word searching and results sorting. The psRNATarget server is freely available at http://plantgrn.noble.org/psRNATarget/.

  12. The directed differentiation of human iPS cells into kidney podocytes.

    Directory of Open Access Journals (Sweden)

    Bi Song

    Full Text Available The loss of glomerular podocytes is a key event in the progression of chronic kidney disease resulting in proteinuria and declining function. Podocytes are slow cycling cells that are considered terminally differentiated. Here we provide the first report of the directed differentiation of induced pluripotent stem (iPS cells to generate kidney cells with podocyte features. The iPS-derived podocytes share a morphological phenotype analogous with cultured human podocytes. Following 10 days of directed differentiation, iPS podocytes had an up-regulated expression of mRNA and protein localization for podocyte markers including synaptopodin, nephrin and Wilm's tumour protein (WT1, combined with a down-regulation of the stem cell marker OCT3/4. In contrast to human podocytes that become quiescent in culture, iPS-derived cells maintain a proliferative capacity suggestive of a more immature phenotype. The transduction of iPS podocytes with fluorescent labeled-talin that were immunostained with podocin showed a cytoplasmic contractile response to angiotensin II (AII. A permeability assay provided functional evidence of albumin uptake in the cytoplasm of iPS podocytes comparable to human podocytes. Moreover, labeled iPS-derived podocytes were found to integrate into reaggregated metanephric kidney explants where they incorporated into developing glomeruli and co-expressed WT1. This study establishes the differentiation of iPS cells to kidney podocytes that will be useful for screening new treatments, understanding podocyte pathogenesis, and offering possibilities for regenerative medicine.

  13. Ps-atom scattering at low energies

    CERN Document Server

    Fabrikant, I I

    2015-01-01

    A pseudopotential for positronium-atom interaction, based on electron-atom and positron-atom phase shifts, is constructed, and the phase shifts for Ps-Kr and Ps-Ar scattering are calculated. This approach allows us to extend the Ps-atom cross sections, obtained previously in the impulse approximation [Phys. Rev. Lett. 112, 243201 (2014)], to energies below the Ps ionization threshold. Although experimental data are not available in this low-energy region, our results describe well the tendency of the measured cross sections to drop with decreasing velocity at $v<1$ a.u. Our results show that the effect of the Ps-atom van der Waals interaction is weak compared to the polarization interaction in electron-atom and positron-atom scattering. As a result, the Ps scattering length for both Ar and Kr is positive, and the Ramsauer-Townsend minimum is not observed for Ps scattering from these targets. This makes Ps scattering quite different from electron scattering in the low-energy region, in contrast to the inter...

  14. Enhanced personal protection at the PS

    CERN Multimedia

    Samuel Morier Genoud

    2013-01-01

    Pictures 03, 06, 07 08 : Pierre Ninin, deputy group leader of GS-ASE and responsible for the installation of the new PS complex safety system, in front of a new access control system.Pictures 10, 12 ,13 : View of Building 271, the future control centre of the new PS complex safety system.

  15. PS, SL and LHC Auditoria change names

    CERN Document Server

    2003-01-01

    Following the replacement of the PS, SL and LHC Divisions by the AB and AT Divisions, the Auditoria are also changing their names. PS Auditorium is renamed AB Meyrin SL Auditorium is renamed AB Prévessin LHC Auditorium is renamed AT

  16. A novel biomarker associated with distress in humans: calcium-binding protein, spermatid-specific 1 (CABS1).

    Science.gov (United States)

    Ritz, Thomas; Rosenfield, David; St Laurent, Chris D; Trueba, Ana F; Werchan, Chelsey A; Vogel, Pia D; Auchus, Richard J; Reyes-Serratos, Eduardo; Befus, A Dean

    2017-06-01

    Calcium-binding protein spermatid-specific 1 (CABS1) is expressed in the human submandibular gland and has an anti-inflammatory motif similar to that in submandibular rat 1 in rats. Here, we investigate CABS1 in human saliva and its association with psychological and physiological distress and inflammation in humans. Volunteers participated across three studies: 1) weekly baseline measures; 2) a psychosocial speech and mental arithmetic stressor under evaluative threat; and 3) during academic exam stress. Salivary samples were analyzed for CABS1 and cortisol. Additional measures included questionnaires of perceived stress and negative affect; exhaled nitric oxide; respiration and cardiac activity; lung function; and salivary and nasal inflammatory markers. We identified a CABS1 immunoreactive band at 27 kDa in all participants and additional molecular mass forms in some participants. One week temporal stability of the 27-kDa band was satisfactory (test-retest reliability estimate = 0.62-0.86). Acute stress increased intensity of 18, 27, and 55 kDa bands; 27-kDa increases were associated with more negative affect and lower heart rate, sympathetic activity, respiration rate, and minute ventilation. In both acute and academic stress, changes in 27 kDa were positively associated with salivary cortisol. The 27-kDa band was also positively associated with VEGF and salivary leukotriene B4 levels. Participants with low molecular weight CABS1 bands showed reduced habitual stress and negative affect in response to acute stress. CABS1 is readily detected in human saliva and is associated with psychological and physiological indicators of stress. The role of CABS1 in inflammatory processes, stress, and stress resilience requires careful study. Copyright © 2017 the American Physiological Society.

  17. On the crystallization behavior of syndiotactic-b-atactic polystyrene stereodiblock copolymers, atactic/syndiotactic polystyrene blends, and aPS/sPS blends modified with sPS-b-aPS

    Energy Technology Data Exchange (ETDEWEB)

    Annunziata, Liana, E-mail: liana.annunziatta@univ-rennes1.fr [Organométalliques et Catalyse, UMR 6226 Sciences Chimiques CNRS, Université de Rennes 1, Campus de Beaulieu, F-35042 Rennes Cedex (France); Monasse, Bernard, E-mail: bernard.monasse@mines-paristech.fr [Mines-ParisTech, CEMEF, Centre de Mise en Forme des Matériaux, UMR CNRS 7635, Sophia Antipolis (France); Rizzo, Paola; Guerra, Gaetano [Dipartimento di Chimica e Biologia, Università degli studi di Salerno, Via Ponte don Melillo, I-84084 Fisciano, SA (Italy); Duc, Michel [Total Petrochemicals Research Feluy, Zone Industrielle Feluy C, B-7181 Seneffe (Belgium); Carpentier, Jean-François, E-mail: jean-francois.carpentier@univ-rennes1.fr [Organométalliques et Catalyse, UMR 6226 Sciences Chimiques CNRS, Université de Rennes 1, Campus de Beaulieu, F-35042 Rennes Cedex (France)

    2013-09-16

    Crystallization and morphological features of syndiotactic-b-atactic polystyrene stereodiblock copolymers (sPS-b-aPS), atactic/syndiotactic polystyrene blends (aPS/sPS), and aPS/sPS blends modified with sPS-b-aPS, with different compositions in aPS and sPS, have been investigated using differential scanning calorimetry (DSC), polarized light optical microscopy (POM) and wide angle X-ray diffraction (WAXRD) techniques. For comparative purposes, the properties of parent pristine sPS samples were also studied. WAXRD analyses revealed for all the samples, independently from their composition (aPS/sPS ratio) and structure (blends, block copolymers, blends modified with block copolymers), the same polymorphic β form of sPS. The molecular weight of aPS and sPS showed opposite effects on the crystallization of 50:50 aPS/sPS blends: the lower the molecular weight of aPS, the slower the crystallization while the lower the molecular weight of sPS, the faster the crystallization. DSC studies performed under both isothermal and non-isothermal conditions, independently confirmed by POM studies, led to a clear trend for the crystallization rate at a given sPS/aPS ratio (ca. 50:50 and 20:80): sPS homopolymers > sPS-b-aPS block copolymers ∼sPS/aPS blends modified with sPS-b-aPS copolymers > sPS/aPS blends. Interestingly, sPS-b-aPS block copolymers not only crystallized faster than blends, but also affected positively the crystallization behavior of blends. At 50:50 sPS/aPS ratio, blends (Blend-2), block copolymers (Cop-1) and blends modified with block copolymers (Blend-2-mod) crystallized via spherulitic crystalline growth controlled by an interfacial process. In all cases, an instantaneous nucleation was observed. The density of nuclei in block copolymers (160,000−190,000 nuclei mm{sup −3}) was always higher than that in blends and modified blends (30,000−60,000 nuclei mm{sup −3}), even for quite different sPS/aPS ratio. At 20:80 sPS/aPS ratio, the block copolymers

  18. CABS-dock web server for the flexible docking of peptides to proteins without prior knowledge of the binding site.

    Science.gov (United States)

    Kurcinski, Mateusz; Jamroz, Michal; Blaszczyk, Maciej; Kolinski, Andrzej; Kmiecik, Sebastian

    2015-07-01

    Protein-peptide interactions play a key role in cell functions. Their structural characterization, though challenging, is important for the discovery of new drugs. The CABS-dock web server provides an interface for modeling protein-peptide interactions using a highly efficient protocol for the flexible docking of peptides to proteins. While other docking algorithms require pre-defined localization of the binding site, CABS-dock does not require such knowledge. Given a protein receptor structure and a peptide sequence (and starting from random conformations and positions of the peptide), CABS-dock performs simulation search for the binding site allowing for full flexibility of the peptide and small fluctuations of the receptor backbone. This protocol was extensively tested over the largest dataset of non-redundant protein-peptide interactions available to date (including bound and unbound docking cases). For over 80% of bound and unbound dataset cases, we obtained models with high or medium accuracy (sufficient for practical applications). Additionally, as optional features, CABS-dock can exclude user-selected binding modes from docking search or to increase the level of flexibility for chosen receptor fragments. CABS-dock is freely available as a web server at http://biocomp.chem.uw.edu.pl/CABSdock. © The Author(s) 2015. Published by Oxford University Press on behalf of Nucleic Acids Research.

  19. Ps 22 in Gospels’ interpretation of Passion

    Directory of Open Access Journals (Sweden)

    Sylwester Jędrzejewski

    2012-09-01

    Full Text Available Ps 22 is a piece of artistically high poetry, clear images and metaphors, historical and prophetic references. The conviction of biblical scholars that the New Testament writers has recognized in Ps 22 prophetic witness of passion, accompanies the Church from its beginnings. The words of Jesus on the cross, taken from Ps 22: 2, have a character of lamentable re-symbolization of the prayer of Israel. These words establish a theological answer in the form of suitable credo as well. Dramatic question “why?” is connected with a proclamation and identification “My God”. The personal experience of oppression and death is included by Jesus in the history of his nation and in the experience of God. Ps 22 in the Gospels’ passion context becomes a proclamation form of prayer and a very personal, expressed in such dramatic circumstances confession of the faith.

  20. Yasp for LEIR to PS injection

    CERN Document Server

    Kain, V; Bartosik, H; Huschauer, A; Jacquet, D; Nicosia, D; Pasinelli, S; Wenninger, J

    2017-01-01

    The steering program YASP was introduced in the LEIRinjection as well as the extraction lines in 2016 to correctthe trajectories with well-known model based correctionalgorithms such as MICADO or SVD. In addition a YASPconfiguration was prepared to correct the extraction linetogether with the first turn of the PS. In this way the injectionoscillations can be corrected while keeping the trajectoryreasonable in the PS injection line.

  1. PS overcomes two serious magnet failures

    CERN Multimedia

    Maximilien Brice

    2003-01-01

    Two magnets and a bus bar connection in the PS were found to be faulty during high-voltage tests at the end of the accelerator shutdown. A five-week repair schedule was quickly devised. A team of mechanics, technicians and engineers worked at full speed to replace the faulty magnets, succeeding in limiting the delay of the accelerators' spring start-up to two weeks. Here we see the PS magnet string awaiting the replacement no. 6 magnet.

  2. A New Universal Second-Order Filter using Configurable Analog Building Blocks (CABs for Filed-Programmable Analogue Arrays

    Directory of Open Access Journals (Sweden)

    M. T. Abuelma'atti

    2011-06-01

    Full Text Available In this paper, the design of a universal second-order filter using configurable analog blocks (CABs for field programmable analog arrays is presented. The configurable blocks are capable of performing integration, differentiation, amplification, log, anti-log, add and negate functions. To maintain high frequency operation, the programmability and configurability of the blocks are achieved by digitally modifying the block's biasing conditions. Using at most four CABs, this article shows that it is possible to design a versatile second-order filter realizing all the standard five filter functions; lowpass, highpass, bandpass, notch and allpass. SPICE simulation results using practical bipolar junction transistor (BJT parameters confirm the feasibility of using the CABs in designing second-order filters.

  3. Ergonomics in drivers' cabs on open-cast mining machines; Ergonomie bei Fuehrerstaenden auf Tagebaugeraeten

    Energy Technology Data Exchange (ETDEWEB)

    Vater, L. [Ergonomie/Gefahrstoffe, Vattenfall Europe Mining AG, Senftenberg (Germany)

    2004-08-12

    Ergonomically designed driver's cabs also contribute directly to the increase in safety at work. In the course of the electrical re-design of the open-cast mining machines new drivers' cabs, which eliminate ergonomic deficits, were used. Other important aspects in addition to the improvements in the environmental factors noise, vibration and dust, are in particular the visibility conditions, visualisation of process data and monitoring as well as operating concepts. Taking into account the different types of machine drivers' cabs with a modified basic design and bearing design are used. Optimisation of the installation of the monitors and the basic structuring of the control panels was carried out. In addition to the increase in the effectiveness of control another aim is to minimise faulty operation by the driver when changing machines frequently. (orig.)

  4. Low energy o-Ps-o-Ps elastic scattering using a simple model

    Energy Technology Data Exchange (ETDEWEB)

    Himanshu, Sharma [Veer Kunwar Singh Univ., Dept. of Physics, Bihar (India); Kiran, Kumari [R N College, P. G. Dept. of Physics, Bihar (India); Sumana, Chakraborty [Indian Association for the Cultivation of Science, Dept. of Theoretical Physics (India)

    2009-06-15

    A simple model is employed to investigate o-Ps-o-Ps (positronium-positronium) scattering at low energies. This model contains the effect of exchange explicitly and a model long range potential in the framework of static-exchange model. These two physical features are of key importance in Ps-Ps (atom-atom) scattering system. S-wave triplet-triplet and singlet-singlet scattering lengths and corresponding phase shifts up to the incident momentum k = 0.5 a.u. are in excellent agreement with those yielded by most elaborate and theoretically sound predictions. (authors)

  5. Photosystem II electron flow as a measure for phytoplankton gross primary production = [Fotosysteem II elektronentransport als een maat voor de bruto primaire produktie van fytoplankton

    NARCIS (Netherlands)

    Geel, C.

    1997-01-01

    Saturating pulse fluorescence measurements, well known from studies of higher plants for determination of photosystem II (PS II) characteristics, were applied to cultures of the green alga Dunaliella teitiolecta (Chapter 2). The actual efficiency of PS IIPS

  6. LS1 Report: PS beams are back!

    CERN Multimedia

    Katarina Anthony & Anaïs Schaeffer

    2014-01-01

    For the first time in over 15 months, there are beams back in the PS. Making their first tour of the accelerator today, 20 June, their injection marks the end of weeks of cold checkouts and hardware commissioning in the PS.   The CERN Control Centre (CCC) is back in business: people gather to restart the LHC injectors, today the PS. Since hardware commissioning was wrapped up on 23 May, the Operations Group (BE-OP) has been conducting cold checkouts on the PS. This involves switching on all of the machine's systems, verifying that they respond to commands by OP and ensuring they are calibrated to beam timings. "These verifications were done, in part, during the hardware commissioning dry runs," says Rende Steerenberg, PS section leader. "But the cold checkouts are on a much larger scale, as we act as if there is beam in the whole machine. We placed a full load on the controls system, cooling, networks, etc. in order to setup the accelerator in the most realis...

  7. Assessment of cognitive function in patients with stress-related exhaustion using the Cognitive Assessment Battery (CAB).

    Science.gov (United States)

    Ellbin, Susanne; Engen, Nina; Jonsdottir, Ingibjörg H; Nordlund, Arto I K

    2017-11-05

    The health care system is facing an increased number of patients seeking care for burnout/stress-related exhaustion. One of the core features of this condition is cognitive impairment-effective and easy tools are needed to assess cognition in this patient group. Our objective was to determine whether the Cognitive Assessment Battery (CAB) could be used for this purpose. Ninety-three patients diagnosed with exhaustion disorder (ED) and 111 controls were included in the study and tested with CAB. CAB consists of six short tests covering the cognitive domains speed and attention, episodic memory, visuospatial, language, and executive functions. The patients also completed questionnaires on subjective memory problems, degree of burnout, anxiety, and depression. The patients performed worse than the controls on four tests of speed and attention, language, and executive function. Subjective memory problems, degree of burnout, and anxiety did not influence cognitive performance, only degree of depression influenced performance negatively on an executive test. CAB is a useful instrument for rapid, comprehensive screening of cognitive status in patients with stress-related exhaustion. Using it, we confirmed the most replicated findings regarding cognitive impairments in patients with stress-related exhaustion.

  8. ORF Alignment: NC_000868 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available abyssi (strain Orsay) ... sp|Q9UZC9|MRE11_PYRAB DNA double-strand break re... NC_000868 gi|14521424 >1ii7A 1 329 11 340 4e-97 ... emb|CAB50130.1| Rad32/mre11 DNA r...pair ... protein mre11 ... Length = 330 ... Query: 11 ... IKFAHLADVHLGYEQFNRSQRAEEFAKAFEDAIKICVDEKVD

  9. PS overcomes two serious magnet failures

    CERN Multimedia

    Maximilien Brice

    2003-01-01

    Two magnets and a bus bar connection in the PS were found to be faulty during high-voltage tests at the end of the accelerator shutdown. A five-week repair schedule was quickly devised. A team of mechanics, technicians and engineers worked at full speed to replace the faulty magnets, succeeding in limiting the delay of the accelerators' spring start-up to two weeks. These pictures show one of the magnets (no. 19) on the PS locomotive brought back into service for the removal and replacement operations.

  10. CAB Contribution to HARMONI: The first light spectrograph of the E-ELT

    Science.gov (United States)

    Piqueras López, J.; Arribas, S.; Calcines, A.

    2017-03-01

    HARMONI (High Angular Resolution Monolithic Optical and Near-infrared Integral field spectrograph) is a visible and near-infrared (0.47 to 2.45 μm) integral field spectrograph selected as a first-light instrument for the European Extremely Large Telescope (E-ELT). With four spatial scales (60, 20, 10 and 4 mas) and a wide range of spectral resolving powers (R=3500, 7500, 20000), HARMONI will allow scientists to address many of the E-ELT science cases. The HARMONI Consortium is led by the University of Oxford, and is also formed by the UK Astronomy Technology Centre (UKATC, Edinburgh, UK), Centre de Recherche Astrophysique de Lyon (CRAL), Laboratoire d'Astrophysique de Marseille (LAM), Instituto de Astrofísica de Canarias (IAC, Spain) and the Centro de Astrobiología (CAB INTA-CSIC, Spain). We summarize here the current status of the project, and describe the participation of CAB to design and manufacture two of the instrument sub-systems: the calibration unit and the secondary guiding module. The calibration unit will simulate the optical output of the telescope, and provide the functionality needed to illuminate the focal plane in such a way that the following type of data can be obtained: data aimed at removing the instrumental signature from the raw data and to convert the data into a data product that uses physical units, data required for monitoring the status of the instrument, and data required for calibrating the secondary guiding subsystem. The secondary guiding subsystem basic requirement is to provide knowledge (relative or absolute) of the location of the science focal plane on timescales of a few seconds and longer (up to months), with an accuracy of 2mas or 0.1x the input FWHM (at H/K bands), whichever is greater. The subsystem should achieve this level performance for different observation modes, e.g. no- AO, GLAO and LTAO modes.

  11. Comparison of MERV 16 and HEPA filters for cab filtration of underground mining equipment.

    Science.gov (United States)

    Cecala, A B; Organiscak, J A; Noll, J D; Zimmer, J A

    2016-08-01

    Significant strides have been made in optimizing the design of filtration and pressurization systems used on the enclosed cabs of mobile mining equipment to reduce respirable dust and provide the best air quality to the equipment operators. Considering all of the advances made in this area, one aspect that still needed to be evaluated was a comparison of the efficiencies of the different filters used in these systems. As high-efficiency particulate arrestance (HEPA) filters provide the highest filtering efficiency, the general assumption would be that they would also provide the greatest level of protection to workers. Researchers for the U.S. National Institute for Occupational Safety and Health (NIOSH) speculated, based upon a previous laboratory study, that filters with minimum efficiency reporting value, or MERV rating, of 16 may be a more appropriate choice than HEPA filters in most cases for the mining industry. A study was therefore performed comparing HEPA and MERV 16 filters on two kinds of underground limestone mining equipment, a roof bolter and a face drill, to evaluate this theory. Testing showed that, at the 95-percent confidence level, there was no statistical difference between the efficiencies of the two types of filters on the two kinds of mining equipment. As the MERV 16 filters were less restrictive, provided greater airflow and cab pressurization, cost less and required less-frequent replacement than the HEPA filters, the MERV 16 filters were concluded to be the optimal choice for both the roof bolter and the face drill in this comparative-analysis case study. Another key finding of this study is the substantial improvement in the effectiveness of filtration and pressurization systems when using a final filter design.

  12. CART treatment improves memory and synaptic structure in APP/PS1 mice.

    Science.gov (United States)

    Jin, Jia-li; Liou, Anthony K F; Shi, Yejie; Yin, Kai-lin; Chen, Ling; Li, Ling-ling; Zhu, Xiao-lei; Qian, Lai; Yang, Rong; Chen, Jun; Xu, Yun

    2015-05-11

    Major characteristics of Alzheimer's disease (AD) include deposits of β-amyloid (Aβ) peptide in the brain, loss of synapses, and cognitive dysfunction. Cocaine- and amphetamine-regulated transcript (CART) has recently been reported to attenuate Aβ-induced toxicity. In this study, CART localization in APP/PS1 mice was characterized and the protective effects of exogenous CART treatment were examined. Compared to age-matched wild type mice, 8-month-old APP/PS1 mice had significantly greater CART immunoreactivity in the hippocampus and cortex. A strikingly similar pattern of Aβ plaque-associated CART immunoreactivity was observed in the cortex of AD cases. Treatment of APP/PS1 mice with exogenous CART ameliorated memory deficits; this effect was associated with improvements in synaptic ultrastructure and long-term potentiation, but not a reduction of the Aβ plaques. Exogenous CART treatment in APP/PS1 mice prevented depolarization of the mitochondrial membrane and stimulated mitochondrial complex I and II activities, resulting in an increase in ATP levels. CART treatment of APP/PS1 mice also reduced reactive oxygen species and 4-hydroxynonenal, and mitigated oxidative DNA damage. In summary, CART treatment reduced multiple neuropathological measures and improved memory in APP/PS1 mice, and may therefore be a promising and novel therapy for AD.

  13. Positron Annihilation in the Bipositronium Ps2

    Energy Technology Data Exchange (ETDEWEB)

    Bailey, David H.; Frolov, Alexei M.

    2005-07-01

    The electron-positron-pair annihilation in the bipositronium PS2 is considered. In particular, the two-, three-, one- and zero-photon annihilation rates are determined to high accuracy. The corresponding analytical expressions are also presented. Also, a large number of bound state properties have been determined for this system.

  14. The 4 Ps as a Guiding Perspective

    Science.gov (United States)

    Kalsbeek, David H.

    2013-01-01

    A 4 Ps perspective addresses immediate needs: to help institutions gain traction in their retention strategies by framing and reframing the challenges and the possible responses, by challenging some of the traditional mental models about retention that can distract or dilute those strategies, and by offering focus and coherence to institutional…

  15. 10th Anniversary P.S.

    CERN Multimedia

    Adams,J

    1969-01-01

    John Adams parle de la préhistoire du P.S. avec présentation des dias. Le DG B.Gregory prend la parole. Les organisateurs présentent sous la direction du "Prof.Ocktette"(?) un sketch très humoristique (p.e.existence de Quark etc.....)

  16. Back to work for the PS

    CERN Multimedia

    2006-01-01

    On 22 June, the PS's rotating machine started turning again for the first time since its enforced shutdown one month ago (see Bulletin No. 23-24/2006) - and the PS was back in operation the very next day! A team from Siemens worked their socks off, 6 days a week for one month (including public holidays), to repair the electrical power supply in collaboration with the AB/PO Group's Main Power Converters (MPC) Section. The generator's faulty rotor was dismantled and replaced by the renovated spare rotor. The multitude of electrical and mechanical connections together with the sheer weight of the rotor (80 tonnes) made this an extremely complex job. The AB/PO Group used the shutdown to test a back-up solution for the PS power supply. The accelerator was directly wired up to the 18 kV electrical network via a 13 MVA transformer, installed at the end of the 1970s but never used. This solution succeeded in bringing the PS back into operation but at limited energy and frequency. Just 14 GeV could be achieved, whic...

  17. STUDY OF TRANSMISSION LINES EFFECT ON THE SYSTEM OPERATIONON OF CONTINUOUS AUTOMATIC CAB SIGNALLING

    Directory of Open Access Journals (Sweden)

    O. O. Hololobova

    2014-10-01

    Full Text Available Purpose. To conduct an effect research of the electromagnetic field of high-voltage transmission lines (HVTL (750 kV, 50 Hz on the track circuits and continuous automatic cab signalling (CACS with a signal current of 50 Hz in the areas of convergence and intersection with the transmission lines and to propose possible methods to improve noise immunity of CACS. Methodology. The measurements were performed both by means of car-laboratory and directly on rail lines. During the study the electric field strength in the range of industrial frequency directly under the transmission lines and at the distance from it to the railway lines was measured, as well as the time dependence of CACS codes with signal current frequency of 50 Hz directly under the transmission lines and at a distance from it in the absence of the train and its passing. Findings. The root causes analysis of CACS faults and failures was carried out. The effect of the electromagnetic field of high-voltage transmission lines (750 kV, 50 Hz on the track circuit and CACS with signal current of 50 Hz in the areas of convergence and intersection with the transmission line was investigated. Possible methods to improve noise immunity of CACS were considered. Originality. The effect research of transmission lines (750 kV on the operation of the automatic cab signalling on spans Prishib-Burchatsk and Privolnoye-Yelizarovo, Pridneprovsk railway in places of oblique railroads crossing and transmission lines (750 kV, 50 Hz was conducted. Electric field strength in the range of industrial frequency directly under the transmission lines and at a distance from it to the railway line, as well as the time dependences of ALSN codes with signal current frequency of 50 Hz directly under the transmission lines and at a distance from it in the absence of the train and as its passing were measured. It was found that CACS codes in track circuits under transmission lines are strongly distorted, as strength

  18. PS overcomes two serious magnet failures

    CERN Multimedia

    Maximilien Brice

    2003-01-01

    Two magnets (no.'s 6 and 19)and a bus bar connection in the PS were found to be faulty during high-voltage tests at the end of the accelerator shutdown. A five-week repair schedule was quickly devised. A team of mechanics, technicians and engineers worked at full speed to replace the faulty magnets, succeeding in limiting the delay of the accelerators' spring start-up to two weeks. Pictured here are members of the PS team with the replacement no. 6 magnet. From left to right: In the back row, Frédéric Roussel (Transport DBS), Yves Bernard (Transport DBS), Luc Moreno (Cegelec), Thierry Battimanza (Transport DBS), Raymond Brown (AB/ABP), Thomas Zickler (AT/MEL); at the front, Steven Southern (AT/VAC), Thierry Gaidon (Brun & Sorensen), Philippe Vidales (Cegelec), Daniel Aubert (Cegelec), Jerome Cachet (Transport DBS), Jose Manual Gomes de Faria (AT/MEL), Eric Page (AT/VAC).

  19. PS overcomes two serious magnet failures

    CERN Multimedia

    Maximilien Brice

    2003-01-01

    Two magnets and a bus bar connection in the PS were found to be faulty during high-voltage tests at the end of the accelerator shutdown. A five-week repair schedule was quickly devised. A team of mechanics, technicians and engineers worked at full speed to replace the faulty magnets, succeeding in limiting the delay of the accelerators´ spring start-up to two weeks. Here we see one of the replacement magnets (no. 19) being prepared.

  20. The PS overcomes two serious magnet failures

    CERN Multimedia

    2003-01-01

    Two magnets and a bus bar connection in the PS were found to be faulty during high-voltage tests at the end of the accelerator shutdown. A five-week repair schedule was quickly devised. A team of mechanics, technicians and engineers worked at full speed to replace the faulty magnets, succeeding in limiting the delay of the accelerators' spring start-up to two weeks.

  1. Motor-Generator Set, PS Main Supply

    CERN Multimedia

    CERN PhotoLab

    1983-01-01

    This is the "new" motor-generator set. It replaced the previous, original, one which had served from the PS start-up in 1959. Ordered in 1965, installed in 1967, it was brought into operation at the beginning of 1968. Regularly serviced and fitted with modern regulation and controls, it still serves at the time of writing (2006) and promises to serve for several more years, as a very much alive museum-piece. See also 6803016 and 0201010.

  2. Measuring target for the PS Booster

    CERN Multimedia

    1971-01-01

    The measuring target for the PS Booster (originally 800 MeV, now 1.4 GeV). It measures the size of the beam by destroying all particles with amplitudes greater than the size of the fork, the position and width of which are adjustable. The plunging time is only 20 ms and the acceleration at the tip of the fork reaches 90 g. The servo-controlled linear motor is shown detached from the mechanism. See also 7602008.

  3. Memories of the PS and of LEP

    CERN Document Server

    Steinberger, Jack

    2012-01-01

    The CERN PS, which started in 1959, and the Brookhaven AGS in 1960, represented an advance by a factor of more than five in the energy of proton accelerators, from the 5 GeV of the Berkeley Bevatron to about 30 GeV. These accelerators made possible the large progress in our understanding of particles and their interactions over the next two decades, culminating in the electroweak and QCD gauge theories.

  4. PS overcomes two serious magnet failures

    CERN Multimedia

    Maximilien Brice

    2003-01-01

    Two magnets and a bus bar connection in the PS were found to be faulty during high-voltage tests at the end of the accelerator shutdown. A five-week repair schedule was quickly devised. A team of mechanics, technicians and engineers worked at full speed to replace the faulty magnets, succeeding in limiting the delay of the accelerators' spring start-up to two weeks. Here we see one of the replacement magnets (no. 6) being prepared.

  5. Enhanced personal protection system for the PS

    CERN Multimedia

    Caroline Duc

    2013-01-01

    During the first long shutdown (LS1) a new safety system will be installed in the primary beam areas of the PS complex in order to bring the standard of personnel radiation protection at the PS into line with that of the LHC.   Pierre Ninin, deputy group leader of GS-ASE and responsible for the installation of the new PS complex safety system, in front of a new access control system. The LHC access control systems are state-of-the-art, whereas those of the injection chain accelerators were running the risk of becoming obsolete. For the past two years a project to upgrade the access and safety systems of the first links in the LHC accelerator chain has been underway to bring them into compliance with nuclear safety standards. These systems provide the personnel with automatic protection by limiting access to hazardous areas and by ensuring that nobody is present in the areas when the accelerator is in operation. By the end of 2013, the project teams will ha...

  6. Rediseño de la unidad de tracción para el iCab2

    OpenAIRE

    Asís González, José

    2011-01-01

    Este proyecto tenía como objetivo el rediseño de la unidad de tracción para la plataforma iCab2. Para ello se plantearon y se consiguieron los siguientes objetivos: • Introducción de mejoras al diseño de la unidad de tracción, que añaden funcionalidades y evitan errores de diseño de la versión anterior. • Fabricación de varias placas del módulo de potencia, con la idea de integrarlas en la versión del iCab1 y como repuestos para el futuro. • Fabricación de un cableado que hiciera más accesibl...

  7. Biochemical indicators of nutritional status and dietary intake in Costa Rican Cabécar Indian adolescents.

    Science.gov (United States)

    Monge-Rojas, Rafael; Barrantes, Mauro; Holst, Ileana; Nuñez-Rivas, Hilda; Alfaro, Thelma; Rodríguez, Sara; Cunningham, Lowella; Cambronero, Priscilla; Salazar, Lisbeth; Herrmann, F H

    2005-03-01

    The purpose of this study was to determine the blood levels of selected nutritional status indicators and the dietary intake of Costa Rican Cabécar Indians aged 10 to 16 years. The results showed that 65% of the adolescents had an adequate body mass index (BMI) for their age, and 32% had a BMI 10 micromol/L (29%), and homozygous mutation of methylenetetrahydrofolate reductase (MTHFR) (49%). The diet was poor, being high in saturated fat and low in polyunsaturated fat, fiber, and several micronutrients. The dietary intakes of more than 55% of the adolescents did not meet 50% of the estimated average requirements (EAR) for zinc, vitamin A, vitamin C, vitamin B12, vitamin B2, and folate. Furthermore, a high prevalence of parasitosis was found (68%). Our results show an adolescent Cabécar population with a mosaic of nutritional deficiencies and cardiovascular risk factors.

  8. PS16dtm: A Tidal Disruption Event in a Narrow-line Seyfert 1 Galaxy

    Science.gov (United States)

    Blanchard, P. K.; Nicholl, M.; Berger, E.; Guillochon, J.; Margutti, R.; Chornock, R.; Alexander, K. D.; Leja, J.; Drout, M. R.

    2017-07-01

    We present observations of PS16dtm (also known as SN 2016ezh), a luminous transient that occurred at the nucleus of a narrow-line Seyfert 1 galaxy hosting a 106 M ⊙ black hole. The light curve shows that PS16dtm exhibited a plateau phase for ˜100 days, during which it showed no color evolution, maintained a blackbody temperature of ˜ 1.7× {10}4 K, and radiated at approximately the Eddington luminosity of the supermassive black hole (SMBH). The spectra exhibit multicomponent hydrogen emission lines and strong Fe II emission, show little time evolution, and closely resemble the spectra of NLS1s while being distinct from those of Type IIn supernovae (SNe IIn). Moreover, PS16dtm is undetected in the X-rays to a limit an order of magnitude below an archival X-ray detection of its host galaxy. These observations strongly link PS16dtm to activity associated with the SMBH and are difficult to reconcile with an SN origin or known forms of active galactic nucleus (AGN) variability. Therefore, we argue that PS16dtm is a tidal disruption event (TDE) in which the accretion of the stellar debris powers the rise in the continuum and excitation of the preexisting broad-line region, while obscuring the X-ray-emitting region of the preexisting AGN disk. We predict that PS16dtm will remain bright for years and that the X-ray emission will reappear on a similar timescale as the accretion rate declines. Placing PS16dtm in the context of other TDEs, we find that TDEs in AGN galaxies are more efficient and reach Eddington luminosities, likely due to interaction of the stellar debris with the preexisting accretion disk.

  9. "Dammed Taxi Cab"--How Silent Communication in Questionnaires Can Be Understood and Used to Give Voice to Children's Experiences

    Science.gov (United States)

    Alerby, E.; Kostenius, C.

    2011-01-01

    "Dammed taxi cab"--a 12-year-old boy wrote these words in the margins of a questionnaire, and within this paper they will serve as a point of departure for the discussion of the use of questionnaires as a way to voice children's experiences. The overall aim of this paper is to enable understanding of and discuss the use of questionnaires as a way…

  10. Impacts of Luminosity in the Cab at Night on the Dynamic Distance of Visual Cognition

    Directory of Open Access Journals (Sweden)

    Weihua Zhao

    2014-02-01

    Full Text Available Suddenly encountering light sources at night will reduce drivers' dynamic distance of visual cognition. In order to investigate the law of quantitative changes of the visual recognition distance under the conditions of different speeds and different environmental luminosity around drivers, calibration experiments were conducted on an actual road. And on the basis of the data set from the experiments, using the method of curved surface regression analysis, the function models describing the rule of the visual recognition distance changing with the environmental luminosity around drivers and running speeds were established. The models were effective via statistical tests. Furthermore, combined with the automobile braking distance, the reaction time allowed for drivers and the critical speeds were analyzed then. Verification tests were also designed to test the established function model. Results showed that as the environmental luminosity around drivers increases, vision recognition distance decreases; as vehicle speed increases, vision recognition distance decreases. Therefore, the sudden showing-up light sources will affect the environmental luminosity in the cab and lead to the reduction in the visual recognition distance as well as the reaction time for drivers. In this circumstance, drivers must control the speed lower than the critical speed to avoid collision.

  11. Computational analysis of ammonia transfer along two intramolecular tunnels in Staphylococcus aureus glutamine-dependent amidotransferase (GatCAB).

    Science.gov (United States)

    Dewage, Sajeewa Walimuni; Cisneros, G Andrés

    2015-03-05

    Most bacteria and all archaea misacylate the tRNAs corresponding to Asn and Gln with Asp and Glu (Asp-tRNA(Asn) and Glu-tRNA(Gln)).The GatCAB enzyme of most bacteria converts misacylated Glu-tRNA(Gln) to Gln-tRNA(Gln) in order to enable the incorporation of glutamine during protein synthesis. The conversion process involves the intramolecular transfer of ammonia between two spatially separated active sites. This study presents a computational analysis of the two putative intramolecular tunnels that have been suggested to describe the ammonia transfer between the two active sites. Molecular dynamics simulations have been performed for wild-type GatCAB of S. aureus and its mutants: T175(A)V, K88(B)R, E125(B)D, and E125(B)Q. The two tunnels have been analyzed in terms of free energy of ammonia transfer along them. The probability of occurrence of each type of tunnel and the variation of the probability for wild-type GatCAB and its mutants is also discussed.

  12. A protocol for CABS-dock protein-peptide docking driven by side-chain contact information.

    Science.gov (United States)

    Kurcinski, Mateusz; Blaszczyk, Maciej; Ciemny, Maciej Pawel; Kolinski, Andrzej; Kmiecik, Sebastian

    2017-08-18

    The characterization of protein-peptide interactions is a challenge for computational molecular docking. Protein-peptide docking tools face at least two major difficulties: (1) efficient sampling of large-scale conformational changes induced by binding and (2) selection of the best models from a large set of predicted structures. In this paper, we merge an efficient sampling technique with external information about side-chain contacts to sample and select the best possible models. In this paper we test a new protocol that uses information about side-chain contacts in CABS-dock protein-peptide docking. As shown in our recent studies, CABS-dock enables efficient modeling of large-scale conformational changes without knowledge about the binding site. However, the resulting set of binding sites and poses is in many cases highly diverse and difficult to score. As we demonstrate here, information about a single side-chain contact can significantly improve the prediction accuracy. Importantly, the imposed constraints for side-chain contacts are quite soft. Therefore, the developed protocol does not require precise contact information and ensures large-scale peptide flexibility in the broad contact area. The demonstrated protocol provides the extension of the CABS-dock method that can be practically used in the structure prediction of protein-peptide complexes guided by the knowledge of the binding interface.

  13. Psühhodramaatikud annavad Pärnus eksami

    Index Scriptorium Estoniae

    2008-01-01

    29. maist kuni 1. juunini kestab Pärnus psühhodraama konverents "Geeniuste kohtumine", kus rahvusvahelise koolituse läbinud annavad eksami. Ruuda Palmquist on psühhodraama kui teadusharu rajajaid Eestis. Pärnus on kohal Rootsi Moreno Instituudi juhataja, psühhodraama lavastaja Marc Treadwell

  14. Psychometric properties of the French translation of the reduced KOOS and HOOS (KOOS-PS and HOOS-PS)

    DEFF Research Database (Denmark)

    Ornetti, P; Perruccio, A V; Roos, E M

    2009-01-01

    OBJECTIVE: To evaluate the psychometric properties of the French KOOS physical function (KOOS-PS) and HOOS physical function (HOOS-PS), specifically its feasibility, reliability, construct validity, and responsiveness. METHODS: Consecutive outpatients consulting for primary knee or hip osteoarthr......OBJECTIVE: To evaluate the psychometric properties of the French KOOS physical function (KOOS-PS) and HOOS physical function (HOOS-PS), specifically its feasibility, reliability, construct validity, and responsiveness. METHODS: Consecutive outpatients consulting for primary knee or hip...

  15. Evolving science enhanced with iPS

    Directory of Open Access Journals (Sweden)

    Editor

    2007-11-01

    Full Text Available Dear friends, Greetings from all in the team. With the stage set for online submissions and the review-response-revision-resubmission process standardized, we have come with the first regular issue and from now there will be quarterly issues of the journal. Since the starting of the JSRM in a short span there have been a lot of developments, which we would rather say as "evolutions" keeping in mind, the recent iPS! This evolution we would like you to see from a background of the various developments in the art and science of medicine throughout in the past three centuries. We have come across the era of investigative tools such as bamboo made laryngoscopes to era of vaccines and antibiotics followed by the era of revolutionary non-invasive procedures and recently the nano technology based drugs and now the iPS! Macro to Micro, but still more to go. All through the influence of the society, religions, philosophies have been playing a very important role in every step the science of biology moves ahead. Starting with the contraception, assisted reproduction then the gene modified plants....and now the embryonic stem cells! With the advent of the iPS, though the issues of oncogenes, teratoma yet to be ruled out, we have found there is a way which can bypass the ES cells! Hats off to those scientists who have burnt their midnight oil to have found this way out! The lesson we learn is to explore things with an open mind and continue to proceed further without spending much time fingers crossed. Yours sincerely,The Editorial team.

  16. Position pickup of the PS Booster

    CERN Multimedia

    CERN PhotoLab

    1975-01-01

    The beam position around the 4 rings of the PS Booster (originally 800 MeV, now 1.4 GeV), is measured with electrostatic pickups (PU). They consist of a ceramic cylinder forming part of the vacuum chamber, and, in order to save space, they are located inside the multipole lenses. The inside of the ceramic is coated with a metallic layer, into which the form of the electrodes was cut by computer-controlled micro-sandblasting. Each PU has a pair of horizontal and a pair of vertical electrodes, as well as a separate intensity-sensing circular electrode.

  17. Space charge studies in the PS

    CERN Document Server

    Asvesta, F; Damerau, H; Huschauer, A; Papaphilippou, Y; Serluca, M; Sterbini, G; Zisopoulos, P

    2017-01-01

    In this paper the results of Machine Development (MD)studies conducted at the CERN Proton Sychrotron (PS) arepresented. The main focus was the investigation of newworking points in an effort to characterize and potentiallyimprove the brightness for LHC-type beams in view of theLHC Injectors Upgrade (LIU). Various working points werecompared in terms of losses and emittance evolution. Sincespace charge and the resonances it excites are the main causefor emittance blow-up and losses, tunes close to excitedresonances were carefully studied. Mitigation techniques,such as bunch flattening using a double harmonic RF system,were also tested.

  18. PAN/PS elctrospun fibers for oil spill cleanup

    Science.gov (United States)

    Ying, Qiao; Lili, Zhao; Haixiang, Sun; Peng, Li

    2014-08-01

    A high-capacity oil sorbent was fabricated by electrospinning using PS/PAN blend. Morphology, contact angle and oil adsorption of PAN/PS fiber and PP nonwoven fabric were studied. It was found that the PAN/PS fiber had a smaller diameter than PP, and the maximum sorption capacities of the PAN/PS sorbent for pump oil, peanut oil, diesel, and gasoline were 194.85, 131.7, 66.75, and 43.38 g/g, which were far higher than those of PP. The sorbent PS/PAN fiber showed a contact angle of water144.32° and diesel oil 0°. The sorption kinetics of PAN/PS and PP sorbent were also investigated. Compared with the commercial PP fabric, the PAN/PS fiber seems to have the ability to be used in oil-spill cleanup application.

  19. Chemotherapy and quality of life in NSCLC PS 2 patients

    DEFF Research Database (Denmark)

    Helbekkmo, Nina; Strøm, Hans H; Sundstrøm, Stein H

    2009-01-01

    INTRODUCTION: Nearly 40% of patients with advanced NSCLC are in performance status (PS) 2. These patients have a shorter life expectancy than PS 0/1 patients and they are underrepresented in clinical trials. Data on how platinum-based combination chemotherapy affects Health Related Quality of Life...... (HRQOL) of patients with PS 2 are scarce and the treatment of this important group of patients is controversial. METHODS: A national multicenter phase III study on platinum based chemotherapy to 432 advanced NSCLC patients included 123 patients with PS 2. To explore the treatment impact on HRQOL......: Whereas the demographic data at baseline were well balanced between the groups, the PS 2 patients had significantly worse function and more severe symptoms than the PS 0/1 patients. In response to combination chemotherapy, the PS 2 patients had a more profound improvement of global QOL, cognitive function...

  20. The PS Booster Fast Wire Scanner

    CERN Document Server

    Burger, S; Priestnall, K; Raich, U

    2003-01-01

    The very tight emittance budget for LHC type beams makes precise emittance measurements in the injector complex a necessity. The PS machine uses 2 fast wire scanners per transverse plane for emittance measurement of the circulating beams. In order to ease comparison the same type of wire scanners have been newly installed in the upstream machine, the PS Booster, where each of the 4 rings is equipped with 2 wire scanners measuring the horizontal and vertical profiles. Those wire scanners use new and more modern control and readout electronics featuring dedicated intelligent motor movement controllers, which relieves the very stringent real time constraints due to the very high speed of 20m/s. In order to be able to measure primary beams at the very low injection energy of the Booster (50MeV) secondary emission currents from the wire can be measured as well as secondary particle flows at higher primary particle energies during and after acceleration. The solution adopted for the control of the devices is descri...

  1. Sofrimento psíquico e trabalho

    Directory of Open Access Journals (Sweden)

    Sarah Rosa Salles Vieira

    2014-03-01

    Full Text Available O presente artigo aprofunda questões clínico-téoricas relacionadas especificamente ao trabalho docente e ao sofrimento psíquico a ele relacionado a partir da observação clínica e vivência grupal nos atendimentos terapêuticos ocupacionais realizados no Hospital do Servidor Público Estadual de São Paulo "Francisco Morato de Oliveira" (HSPE-FMO. Partindo dos estudos acerca da Psicopatologia do Trabalho de Christophe Dejours, do trabalho docente e do relato de um caso clínico, caracteriza a problemática do sofrimento no trabalho, os sistemas de defesa contra este sofrimento, a ameaça à subjetividade do próprio trabalhador, as representações e conflitos vivenciados no trabalho docente, bem como a relação aditiva estabelecida como uma estratégia inconsciente de sobrevivência psíquica.

  2. KAJIAN INDUCED PLURIPOTENT STEMCELL (iPS (HARAPAN DAN TANTANGAN

    Directory of Open Access Journals (Sweden)

    Masagus Zainuri

    2014-05-01

    Full Text Available AbstractInduced Pluripotent Stemcell (iPS are adult cells which the genetic information in the nucleus of those cells being reprogrammed (reprogram by inserting exogenous pluripotential genes. The exogenous gene transduction is using vectors, such as lentivirus, retrovirus, or adenovirus, which suppressed the gene expression of the original cells, so they will express the transduced exogenous gene. Viral vectors are then used to reprogramming and producing iPS clones that are pluripotent. iPS derived from adult cells of patient with certain diseases will be used as a tool to study the mechanisms of those specific diseases and the effects of selected drugs against the diseases. Several previous studies have shown that iPS clones developed from specific genetic disease have its original genotype and retain the character of the response to the drug that similar as the original adult cells. Opportunities for the utilization of autologous iPS cell therapy in the future is wide open as expected iPS transplant will not be rejected when transplanted back to the patient. Behind all its potential, iPS production is still facing some problems to be applicable clinically. The use of viruses as vectors may cause problems due to virus gene sequences may be integrated into the genome of the DNA donor cell, thereby causing mutations of the iPS clones. Several subsequent studies have succeeded in replacing the use of viruses as vectors, but the level of efficiency obtained is still very low. Another problem that arises is that epigenetic changes may occur in iPS cultures. Many advanced research related to iPS may be developed in Indonesia and is necessary to improve the production efficiency of iPS and solve iPS clones epigenetic changes problems in the future.Keywords: iPS, pluripotency, transduction, transfection.AbstrakInduced Pluripotent Stemcell (iPS adalah sel somatic dewasa yang informasi genetika dalam inti selnyadiprogram ulang (reprogram dengan cara

  3. Complete genome sequence of the biocontrol strain Pseudomonas protegens Cab57 discovered in Japan reveals strain-specific diversity of this species.

    Science.gov (United States)

    Takeuchi, Kasumi; Noda, Naomi; Someya, Nobutaka

    2014-01-01

    The biocontrol strain Pseudomonas sp. Cab57 was isolated from the rhizosphere of shepherd's purse growing in a field in Hokkaido by screening the antibiotic producers. The whole genome sequence of this strain was obtained by paired-end and whole-genome shotgun sequencing, and the gaps between the contigs were closed using gap-spanning PCR products. The P. sp. Cab57 genome is organized into a single circular chromosome with 6,827,892 bp, 63.3% G+C content, and 6,186 predicted protein-coding sequences. Based on 16S rRNA gene analysis and whole genome analysis, strain Cab57 was identified as P. protegens. As reported in P. protegens CHA0 and Pf-5, four gene clusters (phl, prn, plt, and hcn) encoding the typical antibiotic metabolites and the reported genes associated with Gac/Rsm signal transduction pathway of these strains are fully conserved in the Cab57 genome. Actually strain Cab57 exhibited typical Gac/Rsm activities and antibiotic production, and these activities were enhanced by knocking out the retS gene (for a sensor kinase acting as an antagonist of GacS). Two large segments (79 and 115 kb) lacking in the Cab57 genome, as compared with the Pf-5 genome, accounted for the majority of the difference (247 kb) between these genomes. One of these segments was the complete rhizoxin analog biosynthesis gene cluster (ca. 79 kb) and another one was the 115-kb mobile genomic island. A whole genome comparison of those relative strains revealed that each strain has unique gene clusters involved in metabolism such as nitrite/nitrate assimilation, which was identified in the Cab57 genome. These findings suggest that P. protegens is a ubiquitous bacterium that controls its biocontrol traits while building up strain-specific genomic repertoires for the biosynthesis of secondary metabolites and niche adaptation.

  4. Comparison of molecular species of various transphosphatidylated phosphatidylserine (PS) with bovine cortex PS by mass spectrometry

    NARCIS (Netherlands)

    Chen, S.; Li, K.W.

    2008-01-01

    The exogenous introduction of a molecular species mixture of bovine cortex phosphatidylserine (BC-PS) has been claimed to improve memory function in subjects suffering from age-associated memory impairment and dementia. However, it has been also reported that oral administration of another molecular

  5. Dinaciclib potently suppresses MCL-1 and selectively induces the cell death in human iPS cells without affecting the viability of cardiac tissue.

    Science.gov (United States)

    Alsayegh, Khaled; Matsuura, Katsuhisa; Sekine, Hidekazu; Shimizu, Tatsuya

    2017-03-31

    Induced pluripotent stem (iPS) cells hold great potential for being a major source of cells for regenerative medicine. One major issue that hinders their advancement to clinic is the persistence of undifferentiated iPS cells in iPS-derived tissue. In this report, we show that the CDKs inhibitor, Dinaciclib, selectively eliminates iPS cells without affecting the viability of cardiac cells. We found that low nanomolar concentration of dinaciclib increased DNA damage and p53 protein levels in iPSCs. This was accompanied by negative regulation of the anti-apoptotic protein MCL-1. Gene knockdown experiments revealed that p53 downregulation only increased the threshold of dinaciclib induced apoptosis in iPS cells. Dinaciclib also inhibited the phosphorylation of Serine 2 of the C-terminal domain of RNA Polyemrase II through CDK9 inhibition. This resulted in the inhibition of transcription of MCL-1 and the pluripotency genes, NANOG and c-MYC. Even though dinaciclib caused a slight downregulation of MCL-1 in iPS-derived cardiac cells, the viability of the cells was not significantly affected, and beating iPS-derived cardiac cell sheet could still be fabricated. These findings suggest a difference in tolerance of MCL-1 downregulation between iPSCs and iPS-derived cardiac cells which could be exploited to eliminate remaining iPS cells in bioengineered cell sheet tissues.

  6. PS main supply: motor-generator set.

    CERN Multimedia

    Maximilien Brice

    2002-01-01

    In picture 04 the motor is on the right in the background and the main view is of the generator. The peak power in each PS cycle drawn from the generator, up to 96 MW, is taken from the rotational kinetic energy of the rotor (a heavy-weight of 80 tons), which makes the rotational speed drop by only a few percent. The motor replenishes the average power of 2 to 4 MW. Photo 05: The motor-generator set is serviced every year and, in particular, bearings and slip-rings are carefully checked. To the left is the motor with its slip-rings visible. It has been detached from the axle and moved to the side, so that the rotor can be removed from the huge generator, looming at the right.

  7. Controlled Acoustic Bass System (CABS) A Method to Achieve Uniform Sound Field Distribution at Low Frequencies in Rectangular Rooms

    DEFF Research Database (Denmark)

    Celestinos, Adrian; Nielsen, Sofus Birkedal

    2008-01-01

    ), is introduced. The system utilizes front loudspeakers and extra loudspeakers on the opposite wall of the room processed to cancel out the rear-wall reflections, which effectively conveys a more uniform sound field. The system works in the time domain and presents good performance over the loudspeaker low......The sound field produced by loudspeakers at low frequencies in small- and medium-size rectangular listening rooms is highly nonuniform due to the multiple reflections and diffractions of sound on the walls and different objects in the room. A new method, called controlled acoustic bass system (CABS...

  8. Responses of photosystems I and II of Acutodesmus obliquus to chemical stress caused by the use of recycled nutrients.

    Science.gov (United States)

    Patzelt, Dominik J; Hindersin, Stefan; Kerner, Martin; Hanelt, Dieter

    2016-01-01

    Nutrients derived from hydrothermal gasification of Acutodesmus obliquus were tested on its biological compatibility to support growth of the same microalgae. Photosynthetic parameters of photosystems I and II (PS I and PS II) were investigated to study physiological effects on the microalgal cell. The nutrients were collected as liquid residues. Dilutions of 1:500 showed no effect on both photosystems. Lower dilutions affected PS II initially and later also PS I. Cyclic electron flow around PS I compensated for loss of electrons due to partially inhibited PS II. The highest tested concentration of liquid residue erased any photosynthetic activity of PS II after 28 min and onwards. In contrast, PS I remained active. The results suggest that PS I is less susceptible than PS II and that the mixture of chemicals in the liquid residue did not directly affect PS I but PS II. The toxicants in the residues seemed to interfere with linear electron flow of PS II even though light-driven formation of radicals and subsequent damage to one of the photosystems can be excluded as demonstrated in darkness. Lowered photosynthetic activity of PS I during actinic irradiation was caused due to lack of supply of electrons from PS II. The cyclic electron flow might play a key role in delivering the energy needed to restore PS II activity and to biodegrade the toxicants when linear electron flow failed. These negative effects of liquid residue towards microalgal cells require a remediation step for direct application of the liquid residue to substitute commercial fertilizers in microalgal mass cultures.

  9. RMS Pictorial Scale (RMS-PS: An innovative scale for the assessment of child′s dental anxiety

    Directory of Open Access Journals (Sweden)

    R M Shetty

    2015-01-01

    Full Text Available Background: Dental anxiety assessment for young children is as important as performing their treatment. Appropriate knowledge of patient′s anxiety boosts confidence and will help us to review potential management options specific to every child. Aim: This study aimed to validate (RMS Pictorial Scale (RMS-PS and to compare it with Venham Picture Test (VPT and Facial image scale (FIS in measuring dental anxiety for young children during their first dental visit. Materials and Methods: A total of 102 healthy children aged between 4 and 14 years during their first dental visit were randomly selected for the study. Childs anxiety level was measured using three different scales namely (i RMS-PS (ii VPT, and (iii FIS. Statistical Analysis: Student t test was used to compare the scores obtained from all the three scales. Pearson correlation test was used to obtain correlation among the scales used in the study. Results: A strong correlation (0·76 was found between the VPT and RMS-PS, and a moderate correlation (0.5 was found between RMS-PS and FIS, indicating good validity for the RMS-PS. Conclusions: The findings of this study suggest that the RMS-PS can be a newer and easiest means for the assessment of dental anxiety for young children in a clinical context.

  10. PS: A nonprocedural language with data types and modules

    Science.gov (United States)

    Gokhale, M. B.

    1986-01-01

    The Problem Specification (PS) nonprocedural language is a very high level language for algorithm specification. PS is suitable for nonprogrammers, who can specify a problem using mathematically-oriented equations; for expert programmers, who can prototype different versions of a software system for evaluation; and for those who wish to use specifications for portions (if not all) of a program. PS has data types and modules similar to Modula-2. The compiler generates C code. PS is first shown by example, and then efficiency issues in scheduling and code generation are discussed.

  11. Distinct iPS Cells Show Different Cardiac Differentiation Efficiency.

    Science.gov (United States)

    Ohno, Yohei; Yuasa, Shinsuke; Egashira, Toru; Seki, Tomohisa; Hashimoto, Hisayuki; Tohyama, Shugo; Saito, Yuki; Kunitomi, Akira; Shimoji, Kenichiro; Onizuka, Takeshi; Kageyama, Toshimi; Yae, Kojiro; Tanaka, Tomofumi; Kaneda, Ruri; Hattori, Fumiyuki; Murata, Mitsushige; Kimura, Kensuke; Fukuda, Keiichi

    2013-01-01

    Patient-specific induced pluripotent stem (iPS) cells can be generated by introducing transcription factors that are highly expressed in embryonic stem (ES) cells into somatic cells. This opens up new possibilities for cell transplantation-based regenerative medicine by overcoming the ethical issues and immunological problems associated with ES cells. Despite the development of various methods for the generation of iPS cells that have resulted in increased efficiency, safety, and general versatility, it remains unknown which types of iPS cells are suitable for clinical use. Therefore, the aims of the present study were to assess (1) the differentiation potential, time course, and efficiency of different types of iPS cell lines to differentiate into cardiomyocytes in vitro and (2) the properties of the iPS cell-derived cardiomyocytes. We found that high-quality iPS cells exhibited better cardiomyocyte differentiation in terms of the time course and efficiency of differentiation than low-quality iPS cells, which hardly ever differentiated into cardiomyocytes. Because of the different properties of the various iPS cell lines such as cardiac differentiation efficiency and potential safety hazards, newly established iPS cell lines must be characterized prior to their use in cardiac regenerative medicine.

  12. (ABA)-simulating photosystem II

    African Journals Online (AJOL)

    ajl yemi

    2011-11-14

    Nov 14, 2011 ... Leaf photosynthetic activity limited by summer heat stress represents large constraint to production process of fruit trees. To cope with this problem, we tested photosystem II (PS II) thermostability in clonal apple tree rootstocks with different growth intensity - semi-vigorous-MM106 and dwarfing-J-TE-F.

  13. LEADIR-PS: providing unprecedented SMR safety and economics

    Energy Technology Data Exchange (ETDEWEB)

    Hart, R.S., E-mail: N2i2@xplornet.ca [Northern Nuclear Industries Incorporated, Cambridge, ON (Canada)

    2015-07-01

    Northern Nuclear Industries Incorporated (N{sup 2} I{sup 2}) is developing Small Modular Reactors (SMRs) called LEADIR-PS, an acronym for LEAD-cooled Integral Reactor-Passively Safe. LEADIR-PS integrates proven technologies including TRISO fuel, Pebble Bed core and graphite moderator, with molten lead coolant in an integral pool type reactor configuration to achieve unprecedented safety and economics. Plants under development are LEADIR-PS30, producing 30 MWth, LEADIR-PS100 producing 100 MWth and LEADIR-PS300 producing 300 MWth that are focused on serving the energy demands of areas with a small electrical grid and/or process heat applications. A plant consisting of six LEADIR-PS300 reactor modules serving a common turbine-generator, called the LEADIR-PS Six-Pack, is focused on serving areas with higher energy demands and a robust electricity grid. The Gen{sup +} I LEADIR-PS plants are inherently/passively safe. There is no potential for a Loss Of Coolant Accident, a reactivity transient without shutdown, a loss of heat sink, or hydrogen generation. No active systems or operator actions are required to assure safety. The unprecedented safety of LEADIR-PS reactors avoids large exclusion radius and demanding evacuation plan requirements. LEADIR-PS, with steam conditions of 370 {sup o}C and 12 MPa can serve over 85% of the world's non-transportation process heat demands. In Canada, the electricity and process heat demands, ranging from those of remote communities and the oil sands to densely populated areas can be served by LEADIR-PS. (author)

  14. The HARP detector at the CERN PS

    CERN Document Server

    Catanesi, M G; Radicioni, E; Simone, S; Edgecock, R; Ellis, M; Robbins, S; Soler, F J P; Gößling, C; Mass, M; Bunyatov, S; Chukanov, A; Klimov, O; Krasin, I; Krasnoperov, A; Kustov, D; Popov, B; Serdiouk, V; Tereshchenko, V; Carassiti, V; Di Capua, E; Evangelisti, F; Vidal-Sitjes, G; Artamonov, A; Arce, P; Brocard, R; Decreuse, G; Friend, B; Giani, S; Gilardoni, S; Gorbunov, p; Grant, A; Grossheim, A; Gruber, P; Ivanchenko, V; Legrand, J C; Kayis-Topaksu,A; Panman, P; Papadopoulos, I; Pasternak, J; Chernyaev, E; Tsukerman, I; van der Vlugt, R; Veenhof, R; Wiebusch, C; Zucchelli, P; Blondel, A; Borghi, S; Campanelli, M; Cervera-Villanueva, A; Morone, M C; Prior, G; Schroeter, R; Kato, I; Gastaldi, Ugo; Mills, G B; Graulich, J S; Grégoire, G; Bonesini, M; Chignoli, F; Ferri, F; Paleari, F; Kirsanov, M; Postoev, V; Bagulya A; Grichine, V; Polukhina, N; Palladino, V; Coney, L; Schmitz, D; Barr, G; De Santo, A; Pattison, C; Zuber, K; Barichello, G; Bobisut, F; Gibin, D; Guglielmi, A; Laveder, M; Menegolli, A; Mezzetto M; Pepato, Adriano; Dumarchez, J; Troquereau, S; Vannucci, F; Dore, U; Iaciofano, A; Lobello, M; Marinilli, F; Orestano, D; Panayotov, D; Pasquali, M; Pastore, F; Tonazzo, A; Tortora, L; Booth, C; Buttar, C; Hodgson, P; Howlett, L; Nicholson, R; Bogomilovw, M; Burin, K; Chizhov, M; Kolev, D; Petev, P; Rusinov, I; Tsenov, R; Piperov, S; Temnikov, P; Apollonio, M; Chimenti, P; Giannini, G; Santin, G; Burguet-Castell, J; Gómez-Cadenas, J J; Novella, P; Sorel, M; Tornero, A

    2007-01-01

    HARP is a high-statistics, large solid angle experiment to measure hadron production using proton and pion beams with momenta between 1.5 and 15 GeV/c impinging on many different solid and liquid targets from low to high Z. The experiment, located in the T9 beam of the CERN PS, took data in 2001 and 2002. For the measurement of momenta of produced particles and for the identification of particle types, the experiment includes a large-angle spectrometer, based on a Time Projection Chamber and a system of Resistive Plate Chambers, and a forward spectrometer equipped with a set of large drift chambers, a threshold Cherenkov detector, a time-of-flight wall and an electromagnetic calorimeter. The large angle system uses a solenoidal magnet, while the forward spectrometer is based on a dipole magnet. Redundancy in particle identification has been sought, to enable the cross-calibration of efficiencies and to obtain a few percent overall accuracy in the cross-section measurements. Detector construction, operation an...

  15. Modelling IRF8 Deficient Human Hematopoiesis and Dendritic Cell Development with Engineered iPS Cells.

    Science.gov (United States)

    Sontag, Stephanie; Förster, Malrun; Qin, Jie; Wanek, Paul; Mitzka, Saskia; Schüler, Herdit M; Koschmieder, Steffen; Rose-John, Stefan; Seré, Kristin; Zenke, Martin

    2017-04-01

    Human induced pluripotent stem (iPS) cells can differentiate into cells of all three germ layers, including hematopoietic stem cells and their progeny. Interferon regulatory factor 8 (IRF8) is a transcription factor, which acts in hematopoiesis as lineage determining factor for myeloid cells, including dendritic cells (DC). Autosomal recessive or dominant IRF8 mutations occurring in patients cause severe monocytic and DC immunodeficiency. To study IRF8 in human hematopoiesis we generated human IRF8-/- iPS cells and IRF8-/- embryonic stem (ES) cells using RNA guided CRISPR/Cas9n genome editing. Upon induction of hematopoietic differentiation, we demonstrate that IRF8 is dispensable for iPS cell and ES cell differentiation into hemogenic endothelium and for endothelial-to-hematopoietic transition, and thus development of hematopoietic progenitors. We differentiated iPS cell and ES cell derived progenitors into CD141+ cross-presenting cDC1 and CD1c+ classical cDC2 and CD303+ plasmacytoid DC (pDC). We found that IRF8 deficiency compromised cDC1 and pDC development, while cDC2 development was largely unaffected. Additionally, in an unrestricted differentiation regimen, IRF8-/- iPS cells and ES cells exhibited a clear bias toward granulocytes at the expense of monocytes. IRF8-/- DC showed reduced MHC class II expression and were impaired in cytokine responses, migration, and antigen presentation. Taken together, we engineered a human IRF8 knockout model that allows studying molecular mechanisms of human immunodeficiencies in vitro, including the pathophysiology of IRF8 deficient DC. Stem Cells 2017;35:898-908. © 2017 The Authors Stem Cells published by Wiley Periodicals, Inc. on behalf of AlphaMed Press.

  16. Interleaving of beam lines inside the PS tunnel

    CERN Multimedia

    1983-01-01

    View against the direction of the proton beams. The PS ring (section 26) is on the left. The injection tunnel for LEAR leaving from here has increased the trafic in this already busy area where the two Linacs and the transfer tunnel leading to the SPS, ISR and AA join the PS ring (cf. photo 7802260, 7802261, Annual Report 1981, p. 89, fig. 12).

  17. Modulation of enzymatic PS synthesis by liposome membrane composition.

    Science.gov (United States)

    Pinsolle, Alexandre; Roy, Philippe; Cansell, Maud

    2014-03-01

    Phosphatidylserine (PS) is a phospholipid known to exert important physiological roles in humans. However, this phospholipid (PL) is poorly available as a natural source and hardly produced by the chemical route. In this work, PS was obtained by transphosphatidylation using phospholipase D (PLD) and PL self-assembled into liposomes as the substrates. The aim was to better understand how the liposome membrane composition could modulate PS yield. Three lecithins were used as PL substrates, one originated from a marine source providing a high amount of n-3 polyunsaturated fatty acids, and two issued from soya differing in their phosphatidylcholine (PC) content. Different parameters such as Ca(2+) content, enzyme and L-serine concentrations modulated PS synthesis. The presence of Ca(2+) increased PS conversion yield. The alcohol acceptor (L-serine) concentration positively acted on PL conversion, by governing the equilibrium between transphosphatidylation and hydrolysis. Beside these specific reaction conditions, it was demonstrated that the membrane composition of the liposomes modulated PS synthesis. A direct correlation between PS accumulation and the amount of cholesterol or α-tocopherol incorporated into the soya lecithins was observed. This result was interpreted in terms of "head" spacers promoting PLD transphosphatidylation. On the whole, this work provided key parameters for the formulation of liposomes using enzymatic PLD technology, to produce lecithins enriched in different proportions of PS and esterified with various types of fatty acids depending on the initial lecithin source. Copyright © 2013 Elsevier B.V. All rights reserved.

  18. Spectroscopic Classification of PS16chs with SOAR/Goodman

    Science.gov (United States)

    Miller, J. A.; Hounsell, R. A.; Pan, Y.-C.; Foley, R. J.; Jha, S. W.; Rest, A.; Scolnic, D.

    2016-05-01

    We report the classification of PS16chs from spectroscopic observation with the Goodman spectrograph on the SOAR telescope. The observation was made on 2016 May 08 UT. We classify PS16chs as a SN Ia near maximum light at z = 0.19.

  19. Motor-Generator powering the PS (Proton Synchrotron) main magnets

    CERN Multimedia

    1983-01-01

    This motor-generator,30 MW peak, 1500 r.p.m.,pulsed power supply for the PS main magnet replaced in 1968 the initial 3000 r.p.m. motor-generator-flywheel set which had served from the PS start-up in 1959 until end 1967. See also photo 8302337 and its abstract.

  20. Transfer line TT70 (electrons from PS to SPS)

    CERN Multimedia

    CERN PhotoLab

    1981-01-01

    As injectors for LEP, PS and SPS had to be converted to the acceleration of electrons and positrons. So far, only positively charged particles had been transferred from the PS to the SPS, for the negatively charged electrons a new transfer line, TT70, had to be built. Due to the difference in level of the two machines, the transfer line slopes and tilts.

  1. Psühhodraama - spontaansuse kool / Taimi Elenurm

    Index Scriptorium Estoniae

    Elenurm, Taimi

    2010-01-01

    Viinis ja New Yorgis tegutsenud psühhiaatri Jakob Levy Moreno loodud psühhodraamast, mis võimaldab rollimängu kaudu näha ennast läbi teiste silmade, aga ka vabaneda pingetest andes võimaluse käituda teisiti kui tavaelus

  2. Successful online learning – the five Ps

    Directory of Open Access Journals (Sweden)

    Jim FLOOD

    2004-04-01

    Full Text Available Successful online learning – the five Ps Jim FLOOD E-learning Consultant-UK jimflood@btinternet.com Key learning points • An important aspect of design for online learning is visual ergonomics. • Learning theories offer poor predictive power in terms of how learners work and learn. • Success at learning is closely related to emotional engagement–and learning designers tend to ignore this aspect. • Online learning poses a challenging experience for learners–and they need support to cope with it. • A key goal to achieve Praxis – being able to put learning into practice. Many of you will be familiar with the three (or more Ps of marketing and even if not, as trainers or teachers you are likely to have used mnemonics as an aid to retention and recall. Mnemonics are especially useful when you need to get the key points to ‘stick’ in the minds of your audience. With this in mind I offer you the 5 Ps of online learning: Presentation, Pedagogy, Promotion, Preparation and Props. What I offer is not new; in fact much of it results from the eleven years of online teaching and learning at The Open University, the £22 million it has spent on research and evaluation 1, and the worldwide community that have been sharing experience in recent years. You can therefore consider these 5 Ps to be a convenient re-packing of the information and experience that can be found in abundance on the Internet. Presentation Good graphic design appeals to the subtle process by which the brain processes information and, as a result, we decide if we like the ‘look and feel’ of a visual environment. Part of liking this ‘look and feel’ is the way the text and pictorial layout can appear inviting and encouraging–a vital aspect of any online learning environment. Another aspect of presentation is how the text reads in terms of engaging the learner and introducing the story to be told–as well as being written in clear and concise English When browsing through books

  3. Telomere reprogramming and maintenance in porcine iPS cells.

    Directory of Open Access Journals (Sweden)

    Guangzhen Ji

    Full Text Available Telomere reprogramming and silencing of exogenous genes have been demonstrated in mouse and human induced pluripotent stem cells (iPS cells. Pigs have the potential to provide xenotransplant for humans, and to model and test human diseases. We investigated the telomere length and maintenance in porcine iPS cells generated and cultured under various conditions. Telomere lengths vary among different porcine iPS cell lines, some with telomere elongation and maintenance, and others telomere shortening. Porcine iPS cells with sufficient telomere length maintenance show the ability to differentiate in vivo by teratoma formation test. IPS cells with short or dysfunctional telomeres exhibit reduced ability to form teratomas. Moreover, insufficient telomerase and incomplete telomere reprogramming and/or maintenance link to sustained activation of exogenous genes in porcine iPS cells. In contrast, porcine iPS cells with reduced expression of exogenous genes or partial exogene silencing exhibit insufficient activation of endogenous pluripotent genes and telomerase genes, accompanied by telomere shortening with increasing passages. Moreover, telomere doublets, telomere sister chromatid exchanges and t-circles that presumably are involved in telomere lengthening by recombination also are found in porcine iPS cells. These data suggest that both telomerase-dependent and telomerase-independent mechanisms are involved in telomere reprogramming during induction and passages of porcine iPS cells, but these are insufficient, resulting in increased telomere damage and shortening, and chromosomal instability. Active exogenes might compensate for insufficient activation of endogenous genes and incomplete telomere reprogramming and maintenance of porcine iPS cells. Further understanding of telomere reprogramming and maintenance may help improve the quality of porcine iPS cells.

  4. Telomere reprogramming and maintenance in porcine iPS cells.

    Science.gov (United States)

    Ji, Guangzhen; Ruan, Weimin; Liu, Kai; Wang, Fang; Sakellariou, Despoina; Chen, Jijun; Yang, Yang; Okuka, Maja; Han, Jianyong; Liu, Zhonghua; Lai, Liangxue; Gagos, Sarantis; Xiao, Lei; Deng, Hongkui; Li, Ning; Liu, Lin

    2013-01-01

    Telomere reprogramming and silencing of exogenous genes have been demonstrated in mouse and human induced pluripotent stem cells (iPS cells). Pigs have the potential to provide xenotransplant for humans, and to model and test human diseases. We investigated the telomere length and maintenance in porcine iPS cells generated and cultured under various conditions. Telomere lengths vary among different porcine iPS cell lines, some with telomere elongation and maintenance, and others telomere shortening. Porcine iPS cells with sufficient telomere length maintenance show the ability to differentiate in vivo by teratoma formation test. IPS cells with short or dysfunctional telomeres exhibit reduced ability to form teratomas. Moreover, insufficient telomerase and incomplete telomere reprogramming and/or maintenance link to sustained activation of exogenous genes in porcine iPS cells. In contrast, porcine iPS cells with reduced expression of exogenous genes or partial exogene silencing exhibit insufficient activation of endogenous pluripotent genes and telomerase genes, accompanied by telomere shortening with increasing passages. Moreover, telomere doublets, telomere sister chromatid exchanges and t-circles that presumably are involved in telomere lengthening by recombination also are found in porcine iPS cells. These data suggest that both telomerase-dependent and telomerase-independent mechanisms are involved in telomere reprogramming during induction and passages of porcine iPS cells, but these are insufficient, resulting in increased telomere damage and shortening, and chromosomal instability. Active exogenes might compensate for insufficient activation of endogenous genes and incomplete telomere reprogramming and maintenance of porcine iPS cells. Further understanding of telomere reprogramming and maintenance may help improve the quality of porcine iPS cells.

  5. Crash simulation of the new MAN truck cab family; Crashsimulation der neuen Fahrerhausbaureihe der MAN Nutzfahrzeuge AG

    Energy Technology Data Exchange (ETDEWEB)

    Riebeck, L. [MAN Nutzfahrzeuge AG, Muenchen (Germany)

    2000-07-01

    Attainment of a high level of safety for the occupants of trucks entails first and foremost the prevention of accidents by technical and other means. Because of the vehicle masses involved and the associated energy conversions collisions between trucks and massive obstrucles or collisions between one truck and another constitute a particular challenge. Data on real accidents shows that most of the collisions with serious consequences for the occupants are rear-end collisions. The basis for minimising the consequences of accidents is that the cab ensures an adequate survival space. The measures necessary for this can be ascertained in advance by crash simulation. The simulations performed show that beside an adequate basic rigidity the design of the cab mounts is of great importance. Comparison of the results of simulation with the tests performed reveals a high degree of correlation. Elaborate and cost-intensive test series and unsuccessful tests were therefore avoided. Not only must the cab structure be optimised, but also the retention system consisting of the seat with integrated belt tightener and airbag. Here the design of the seat pushes calculation to its limits. As a result of the high structural acceleration rates (>100 g), for example, vibrations may arise in the detent systems which consequently fail because teeth break off. (orig.) [German] Die Realisierung eines hohen Sicherheitsniveaus fuer die Insassen von Nutzfahrzeugen bedeutet zunaechst die Vermeidung von Unfaellen durch technische und andere Massnahmen. Kollisionen von Nutzfahrzeugen mit massiven Hindernissen oder Kollisionen untereinander stellen aufgrund der Fahrzeugmassen mit den damit verbundenen grossen Energieumsaetze eine besondere Herausforderung dar. Das reale Unfallgeschehen zeigt, dass es sich beim ueberwiegenden Teil der fuer die Lkw-Insassen folgenschweren Kollisionen um Auffahrunfaelle handelt. Grundlage fuer die Unfallfolgenminimierung ist, dass das Fahrerhaus einen ausreichenden

  6. 49 CFR Appendix F to Part 238 - Alternative Dynamic Performance Requirements for Front End Structures of Cab Cars and MU Locomotives

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Alternative Dynamic Performance Requirements for... TRANSPORTATION PASSENGER EQUIPMENT SAFETY STANDARDS Pt. 238, App. F Appendix F to Part 238—Alternative Dynamic... and allow for the application of dynamic performance criteria to cab cars and MU locomotives as an...

  7. Shallow PS-logging by high frequency wave; Koshuha wo mochiita senbu PS kenso

    Energy Technology Data Exchange (ETDEWEB)

    Nakajima, A.; Miyazawa, M.; Azuma, H. [OYO Corp., Tokyo (Japan)

    1996-05-01

    This paper describes the following matters on down-hole PS logging in shallow subsurface. Determining an elastic wave velocity structure in shallow subsurface with high accuracy by using down-hole PS logging requires reduction of errors in reading travel time. Therefore, a high-frequency vibration source was fabricated with an objective to raise frequencies of waves used for the measurement. Measurements were made on two holes, A and B, at a measurement interval of 0.5 m, whereas at the hole A a measurement was performed simultaneously by using a normal type (low-frequency) vibration source. A spectral analysis on the waveform record revealed that the frequencies with each vibration source were 127 Hz and 27 Hz for the hole A, 115 Hz for the hole B, and the S/N ratio was all the same for both holes. When the high-frequency vibration source was used, the velocity was determined at accuracy of 5% over the whole length of the shallow section. When the low-frequency vibration source was used, sections with the velocity determining error greater than 5% were found, and it was not possible to derive the velocity structure in the shallow subsurface in fine segments. 3 refs., 8 figs., 2 tabs.

  8. The Gravita 10BB. A modular locomotive with a central cab; Modulare Mittelfuehrerhaus-Lokomotive Gravita 10BB

    Energy Technology Data Exchange (ETDEWEB)

    Klaua, Ulf; Brunkert, Daniel; Wolfgram, Dieter [Voith Turbo Lokomotivtechnik GmbH und Co. KG, Kiel (Germany)

    2009-05-15

    The consistent development of the Gravita family of locomotives has made it possible for the first time for train operating companies to benefit from the advantage of a high degree of modularity in the market segment of locomotives with central cabs. They can choose from a broad range of specifications offered to select the locomotive that best suits their transport needs and thereby provide the optimum economic response to competitors using the roads. The authors take the example of the Gravita 10BB to illustrate the family's various modules. The unfaltering aim of the development from the very beginning has been to reduce complexity. Particular importance has been attached to achieving the benefits customers want in terms of ease of operation and maintainability. (orig.)

  9. Overview of the Moral Status of iPS Cells.

    Science.gov (United States)

    Martinho, Andreia Martins

    2016-07-01

    The production of induced pluripotent stem (iPS) cells in 2006 by Takahashi and Yamanaka was a major breakthrough in stem cell research. IPS cells technology holds great promise for cell therapy, disease modelling, and drug testing, but it poses ethical questions concerning the moral status of somatic cells, which can re-gain pluripotency (iPS cells). This article provides an overview of the arguments that substantiate the debate on the moral assessment of iPS cells: potentiality argument; relational properties/standard view; and genetic basis for moral status.

  10. Simulation of Air Entrapment and Resin Curing During Manufacturing of Composite Cab Front by Resin Transfer Moulding Process

    Directory of Open Access Journals (Sweden)

    Kuppusamy Raghu Raja Pandiyan

    2017-09-01

    Full Text Available Mould filling and subsequent curing are the significant processing stages involved in the production of a composite component through Resin Transfer Moulding (RTM fabrication technique. Dry spot formation and air entrapment during filling stage caused by improper design of filling conditions and locations that lead to undesired filling patterns resulting in defective RTM parts. Proper placement of inlet ports and exit vents as well as by adjustment of filling conditions can alleviate the problems during the mould filling stage. The temperature profile used to polymerize the resin must be carefully chosen to reduce the cure time. Instead of trial and error methods that are expensive, time consuming, and non-optimal, we propose a simulation-based optimization strategy for a composite cab front component to reduce the air entrapment and cure stage optimization. In order to be effective, the optimization strategy requires an accurate simulation of the process utilizing submodels to describe the raw material characteristics. Cure reaction kinetics and chemo-rheology were the submodels developed empirically for an unsaturated polyester resin using experimental data. The simulations were performed using commercial software PAM RTM 2008, developed by ESI Technologies. Simulation results show that the use of increase in injection pressure at the inlet filling conditions greatly reduce the air entrapped. For the cab front, the alteration of injection pressure with proper timing of vent opening reduced the air entrapped during mould filling stage. Similarly, the curing simulation results show that the use of higher mould temperatures effectively decreases the cure time as expected.

  11. Measuring the performance of attention networks with the Dalhousie Computerized Attention Battery (DalCAB: Methodology and reliability in healthy adults

    Directory of Open Access Journals (Sweden)

    Stephanie Anne Holland Jones

    2016-06-01

    Full Text Available Attention is an important, multifaceted cognitive domain that has been linked to three distinct, yet interacting, networks: alerting, orienting, and executive control. The measurement of attention and deficits of attention within these networks is critical to the assessment of many neurological and psychiatric conditions in both research and clinical settings. The Dalhousie Computerized Attention Battery (DalCAB was created to assess attentional functions related to the three attention networks using a range of tasks including: simple reaction time, go/no-go, choice reaction time, dual task, flanker, item and location working memory and visual search. The current study provides preliminary normative data, test-retest reliability (intraclass correlations and practice effects in DalCAB performance 24-hours after baseline for healthy young adults (n = 96, 18-31 years. Performance on the DalCAB tasks demonstrated Good to Excellent test-retest reliability for mean reaction time, while accuracy and difference measures (e.g., switch costs, interference effects and working memory load effects were most reliable for tasks that require more extensive cognitive processing (e.g., choice reaction time, flanker, dual task, and conjunction search. Practice effects were common and pronounced at the 24-hour interval. In addition, performance related to specific within-task parameters of the DalCAB sub-tests provides preliminary support for future formal assessment of the convergent validity of our interpretation of the DalCAB as a potential clinical and research assessment tool for measuring aspects of attention related to the alerting, orienting and executive control networks.Keywords: computerized assessment; attention; orienting; alerting; executive function

  12. PS buildings : reinforced concrete structure for shielding "bridge" pillar

    CERN Multimedia

    CERN PhotoLab

    1956-01-01

    The PS ring traverses the region between the experimental halls South and North (buildings Nos 150 and 151) under massive bridge-shaped concrete beams. This pillar stands at the S-W end of the structure.

  13. New safety training for access to the PS complex areas

    CERN Multimedia

    2012-01-01

    Since 10/08/2012, a new course dedicated to the specific radiological risks in the accelerators of the PS complex has been available on SIR (https://sir.cern.ch/). This course complements the general classroom-based Radiation Safety training. Successful completion of the course will be obligatory and verified by the access system as from 01/11/2012 for access to the following accelerator areas: LINAC2, BOOSTER, PS and TT2. Information and reminder e-mails will be sent to all persons currently authorized to access the accelerators of the PS complex. For questions please contact the HSE unit and in particular, the Radiation Protection Group (+41227672504 or safety-rp-ps-complex@cern.ch).

  14. Study of Value Co-Creation in CoPS

    OpenAIRE

    Mingli Zhang; Jianhua Ye

    2013-01-01

    Value co-creation is associated with specific investment in the context of CoPS. The feature of CoPS decides that the study of co-creation cannot execute without regarding asset specificity. This study considers that value co-creation will be associated with specific value, which is outcome of relationship value and asset specificity. Supplier and customer have a close relation, which conducts to specific investment and then it turns to obstacle for competitors. Trust, commitment and satisfac...

  15. Motor-generator set of the PS main supply

    CERN Multimedia

    Photographic Service; CERN PhotoLab

    1968-01-01

    Already in 1964, the PS improvement programme included a new main magnet supply with more power for the longer cycles needed for slow extraction at the full energy of 26 GeV. This motor-generator set was installed in 1967 and took up service at the beginning of 1968. Regularly serviced and fitted with modern electronic regulation, it pulses the PS to this day.

  16. DiPS: A Unifying Approach for developing System Software

    OpenAIRE

    Michiels, Sam; Matthijs, Frank; Walravens, Dirk; Verbaeten, Pierre

    2002-01-01

    In this paper we unify three essential features for flexible system software: a component oriented approach, self-adaptation and separation of concerns.We propose DiPS (Distrinet Protocol Stack), a component framework, which offers components, an anonymous interaction model and connectors to handle non-functional aspects such as concurrency. DiPS has effectively been used in industrial protocol stacks and device drivers.

  17. The new heart of the PS is beating strongly

    CERN Document Server

    Corinne Pralavorio

    2011-01-01

    The PS has resumed operation with a brand new electrical power system called POPS; this enormous system comprising power electronics and capacitors is crucial because if it broke down practically no particles would be able to circulate at CERN. As soon as it started, POPS passed all the tests with flying colours and is now pulsing at full power.   The new PS power system is made up of 6 containers, each with 60 tonnes of capacitors and 8 power converters. The date 11/02/11 will always be remembered with affection by the engineers in the Electrical Power Converters Group. At 11:11 in the morning (no joke), the first beams powered by the new system began to circulate in the PS. The cutely-named POPS (POwer for PS) took over from the old rotating machine that had been working since 1968. From now on it will be POPS that supplies the PS main magnets with the electrical pulses needed to accelerate the beams for the LHC and all CERN's other facilities. The system is crucial as the PS is one of the lyn...

  18. The PS will soon be back in operation

    CERN Multimedia

    2006-01-01

    The PS's power supply system is undergoing repairs for the accelerator to restart on 26 June. The AB Department's Power Converter Group is working flat out with Siemens to return the PS's power supply system to working order. A problem appeared on the insulation of the power cables of the rotor of the rotating machine (photo) which supplies power to the PS magnets. To prevent more significant damage to the rotating machine, the AB Department, with the approval of the CERN Management, decided to shut down the PS which had started running on 15 May. Everything is being done to restart the accelerator on 26 June. The PS's rotating machine comprises a motor coupled to a generator. The generator's rotor acts like a flywheel, supplying high-power pulses of 40 to 50 megawatts to the PS magnets. The 6 megawatt motor drives the installation at 1000 revolutions per minute and compensates only for variations in speed. It is an essential interface since it would be hard to imagine connecting such an electrical charge, p...

  19. Cross-reconstitution of the extrinsic proteins and photosystem II complexes from Chlamydomonas reinhardtii and Spinacia oleracea.

    Science.gov (United States)

    Suzuki, T; Ohta, H; Enami, I

    2005-06-01

    Cross-reconstitution of the extrinsic proteins and Photosystem II (PS II) from a green alga, Chlamydomonas reinhardtii, and a higher plant,Spinacia oleracea, was performed to clarify the differences of binding properties of the extrinsic proteins between these two species of organisms. (1) Chlamydomonas PsbP and PsbQ directly bound to Chlamydomonas PS II independent of the other extrinsic proteins but not to spinach PS II. (2) Chlamydomonas PsbP and PsbQ directly bound to the functional sites of Chlamydomonas PS II independent of the origins of PsbO, while spinach PsbP and PsbQ only bound to non-functional sites on Chlamydomonas PS II. (3) Both Chlamydomonas PsbP and spinach PsbP functionally bound to spinach PS II in the presence of spinach PsbO. (4) While Chlamydomonas PsbP functionally bound to spinach PS II in the presence of Chlamydomonas PsbO, spinach PsbP bound loosely to spinach PS II in the presence of Chlamydomonas PsbO with no concomitant restoration of oxygen evolution. (5) Chlamydomonas PsbQ bound to spinach PS II in the presence of Chlamydomonas PsbP and PsbO or spinach PsbO but not to spinach PS II in the presence of spinach PsbP and Chlamydomonas PsbO or spinach PsbO. (6) Spinach PsbQ did not bind to spinach PS II in the presence of Chlamydomonas PsbO and PsbP. On the basis of these results, we showed a simplified scheme for binding patterns of the green algal and higher plant extrinsic proteins with respective PS II.

  20. Burkholderia phytofirmans PsJN reduces damages to freezing temperature in Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Fan eSU

    2015-10-01

    Full Text Available Several plant growth-promoting rhizobacteria (PGPR are known to improve plant tolerance to multiple stresses, including low temperatures. However, mechanisms underlying this protection are still poorly understood. The aim of this study was to evaluate the role of the endophytic PGPR, Burkholderia phytofirmans strain PsJN (Bp PsJN, on Arabidopsis thaliana cold tolerance using photosynthesis parameters as physiological markers.Under standard conditions, our results indicated that Bp PsJN inoculation led to growth promotion of Arabidopsis plants without significant modification on photosynthesis parameters and chloroplast organization. However, bacterial colonization induced a cell wall strengthening in the mesophyllImpact of inoculation modes (either on seeds or by soil irrigation and their effects overnight at 0, -1 or -3°C, were investigated by following photosystem II (PSII activity and gas exchanges. Following low temperatures stress, a decrease of photosynthesis parameters was observed. In addition, during three consecutive nights or days at -1°C, PSII activity was monitored. Pigment contents, RuBisCO protein abundance, expression of several genes including RbcS, RbcL, CBF1, CBF2, CBF3, ICE1, COR15a, and COR78 were evaluated at the end of exposure. To assess the impact of the bacteria on cell ultrastructure under low temperatures, microscopic observations were achieved. Results indicated that freezing treatment induced significant changes in PSII activity as early as the first cold day, whereas the same impact on PSII activity was observed only during the third cold night. The significant effects conferred by PsJN were differential accumulation of pigments, and reduced expression of RbcL and COR78. Microscopical observations showed an alteration/disorganization in A. thaliana leaf mesophyll cells independently of the freezing treatments. The presence of bacteria during the three successive nights or days did not significantly improved A

  1. iPS-Cinderella Story in Cell Biology

    Directory of Open Access Journals (Sweden)

    Editorial

    2010-01-01

    Full Text Available As we step through the frontiers of modern Science, we are all witnesses to the Cinderella story repeating itself in the form of the iPS. The process of re-programming adult somatic cells to derive Induced Pluripotent stem cells (iPS with the wand of transcription factors and then differentiating them back to adult somatic cells resembles the transformation of Cinderella from a Cinder girl to princess and back to a Cinder girl after the ball; but the iPS-Cinderella is the most fascinating thing ever in cell biology!From the day iPS first made its headlines when it was first produced by Shinya Yamanaka at Kyoto University in Japan, Stem Cell scientists all over the world are re- doing their experiments so far done using other sources like embryonic and adult Stem cells with the iPS cells exploring their potential to the fullest. A Stem Cell science news page without this magic word of iPS is difficult to imagine these days and Scientists have been successful in growing most of the adult Cell types from iPS cells.iPS cells was the key to solve the problems of Immune rejection and Immunosupression required when using other allogeneic Stem cell types which had baffled scientists previously. But the issues raised by scientists about the use of viruses and Oncogenes in producing iPS cells were made groundless when scientists in February 2008 published the discovery of a technique that could remove oncogenes after the induction of pluripotency and now it is possible to induce pluripotency using plasmid transfection, piggyback transposon system and piggyback transposon system combined with a non viral vector system. The word of the day is pIPS which are protein-induced Pluripotent stem cells which are iPS cells that were generated without any genetic alteration of the adult cell. This research by the group of Sheng Ding in La Jolla, California made public in April 2009 showed that the generation of poly-arginine anchors was sufficient to induce

  2. Simulation of a wide area survey for NEOs with Pan-STARRS PS1 & PS2 Telescopes

    Science.gov (United States)

    Chambers, Kenneth C.; Lilly (Schunova), Eva; Dukes, Martin Todd; Wainscoat, Richard J.

    2017-10-01

    We have performed a new survey simulation for a wide area survey with PS1 & PS2 as part of our quest to optimize the discovery rate of Near Earth Objects with the full Pan-STARRS system. The survey is intended to be as unbiased and as complete as possible given the available sky visibility and the anticipated performance of the PS1 and PS2 telescopes working together. The simulation includes a complete model of both telescopes, camera and slew overhead, sky visibility, moon phase, galactic plane exclusion, and weather. The performance of the resulting survey strategy is then evaluated using the method of Lilly et. al. 2017. This uses the Greenstreet et al. 2012 model with 50 million NEOs with absolute magnitudes 13 < H < 29 and the Moving Object Processing System (MOPS, Denneau et al. 2013) for linkages. The results are compared with other possible strategies.

  3. Profiling the microRNA Expression in Human iPS and iPS-derived Retinal Pigment Epithelium.

    Science.gov (United States)

    Wang, Heuy-Ching; Greene, Whitney A; Kaini, Ramesh R; Shen-Gunther, Jane; Chen, Hung-I H; Cai, Hong; Wang, Yufeng

    2014-01-01

    The purpose of this study is to characterize the microRNA (miRNA) expression profiles of induced pluripotent stem (iPS) cells and retinal pigment epithelium (RPE) derived from induced pluripotent stem cells (iPS-RPE). MiRNAs have been demonstrated to play critical roles in both maintaining pluripotency and facilitating differentiation. Gene expression networks accountable for maintenance and induction of pluripotency are linked and share components with those networks implicated in oncogenesis. Therefore, we hypothesize that miRNA expression profiling will distinguish iPS cells from their iPS-RPE progeny. To identify and analyze differentially expressed miRNAs, RPE was derived from iPS using a spontaneous differentiation method. MiRNA microarray analysis identified 155 probes that were statistically differentially expressed between iPS and iPS-RPE cells. Up-regulated miRNAs including miR-181c and miR-129-5p may play a role in promoting differentiation, while down-regulated miRNAs such as miR-367, miR-18b, and miR-20b are implicated in cell proliferation. Subsequent miRNA-target and network analysis revealed that these miRNAs are involved in cellular development, cell cycle progression, cell death, and survival. A systematic interrogation of temporal and spatial expression of iPS-RPE miRNAs and their associated target mRNAs will provide new insights into the molecular mechanisms of carcinogenesis, eye differentiation and development.

  4. Long-term safety and efficacy of human-induced pluripotent stem cell (iPS) grafts in a preclinical model of retinitis pigmentosa.

    Science.gov (United States)

    Li, Yao; Tsai, Yi-Ting; Hsu, Chun-Wei; Erol, Deniz; Yang, Jin; Wu, Wen-Hsuan; Davis, Richard J; Egli, Dieter; Tsang, Stephen H

    2012-12-06

    The U.S. Food and Drug Administration recently approved phase I/II clinical trials for embryonic stem (ES) cell-based retinal pigmented epithelium (RPE) transplantation, but this allograft transplantation requires lifelong immunosuppressive therapy. Autografts from patient-specific induced pluripotent stem (iPS) cells offer an alternative solution to this problem. However, more data are required to establish the safety and efficacy of iPS transplantation in animal models before moving iPS therapy into clinical trials. This study examines the efficacy of iPS transplantation in restoring functional vision in Rpe65(rd12)/Rpe65(rd12) mice, a clinically relevant model of retinitis pigmentosa (RP). Human iPS cells were differentiated into morphologically and functionally RPE-like tissue. Quantitative real-time polymerase chain reaction (RT-PCR) and immunoblots confirmed RPE fate. The iPS-derived RPE cells were injected into the subretinal space of Rpe65(rd12)/Rpe65(rd12) mice at 2 d postnatally. After transplantation, the long-term surviving iPS-derived RPE graft colocalized with the host native RPE cells and assimilated into the host retina without disruption. None of the mice receiving transplants developed tumors over their lifetimes. Furthermore, electroretinogram, a standard method for measuring efficacy in human trials, demonstrated improved visual function in recipients over the lifetime of this RP mouse model. Our study provides the first direct evidence of functional recovery in a clinically relevant model of retinal degeneration using iPS transplantation and supports the feasibility of autologous iPS cell transplantation for retinal and macular degenerations featuring significant RPE loss.

  5. Synthesis and luminescence properties of polymeric complexes of Cu(II), Zn(II) and Al(III) with 8-hydroxyquinoline side group-containing polystyrene

    Science.gov (United States)

    Gao, Baojiao; Wei, Xiaopeng; Zhang, Yanyan

    2013-01-01

    Three kinds of metalloquinolate-containing polystyrene were prepared via a polymer reaction and a coordination reaction. 5-Chloromethyl-8-hydroxyquinoline (CHQ) was first prepared through the chloromethylation reaction of 8-hydroxyquinoline (HQ) with 1,4-bichloromethoxy-butane as chloromethylation reagent. A polymer reaction, Friedel-Crafts alkylation reaction, was carried out between polystyrene (PS) and CHQ in the presence of Lewis catalyst, and HQ was bonded onto the side chains of PS, obtaining 8-hydroxyquinoline-functionalized Polystyrene, HQ-PS. And then, by using one-pot method with two-stage procedures, the coordination reaction of HQ-PS and small molecule HQ with metal ions including Al(III), Zn(II) and Cu(II) ions, was allowed to be carried out, and three polymeric metalloquinolates, AlQ3-PS, ZnQ2-PS and CuQ2-PS, were successfully prepared, respectively. In the chemical structures of these polymeric metalloquinolates, metalloquinolates were chemically attached onto the side chains of PS. HQ-PS and three polymeric metalloquinolates were fully characterized by FTIR, 1H NMR and TGA. The luminescence properties of the three polymeric metalloquinolates were mainly investigated by UV/Vis absorption spectra and fluorescence emission spectra in solutions and in solid film states. When excited by the ray at about 365 nm, the three polymeric metalloquinolates have blue-green luminescence, and the main emission peaks in the DMF solutions are located at 490, 482 and 502 nm for AlQ3-PS, ZnQ2-PS and CuQ2-PS, respectively. As compared with their emissions in solutions, the emissions in solid film states are red-shifted to some extent, and the main emission peaks are located at 500, 488 and 510 nm for AlQ3-PS, ZnQ2-PS and CuQ2-PS, respectively. Besides, these polymeric metalloquinolates have higher thermal stability than PS as polymeric skeleton.

  6. Characterization of crosslinked polystyrene(PS) beads in SBR matrix

    Energy Technology Data Exchange (ETDEWEB)

    Cha, Yoon-Jong; Choe, Soonja [Inha Univ. (Korea, Republic of)

    1995-12-01

    Monodisperse sized crosslinked polystyrene(PS) beads were prepared by a reaction of semibatch emulsion polymerization with styrene monomer, divinylbenzene(DVB) crosslinking agent and potassium persulfate(K{sub 2}S{sub 2}O{sub 9}) initiator in the absence of emulsifier. The glass transition temperature(T{sub g}) and the mean diameter of the beads were increased from 100{degrees}C to 135{degrees}C and from 402 nm to 532 nm, respectively, for an incorporation of 2 to 10 mol% DVB. Crosslinking density was also linearly increased with DVB content. SEM microphotographs of SBR composite filled with various contents of PS beads revealed that PS beads are relatively well dispersed without changing the spherical shape of the beads in all range of compositions. In stress-strain analysis, elongation at break and tensile strength of SBR composite were increased with the bead content. Applicability of the PS beads as a filler in SBR matrix is tested by plotting Mooney-Rivlin or Guth-Smallwood equations. However, mechanical properties of the composite with the beads were not so excellent as those of the composite with carbon black. Crosslinked PS beads are still tentative as a white color reinforcing filler on SBR matrix.

  7. The PS complex produces the nominal LHC beam

    CERN Document Server

    Benedikt, Michael; Borburgh, J; Cappi, R; Chanel, M; Chohan, V; Cyvoct, G; Garoby, R; Grier, D G; Gruber, J; Hancock, S; Hill, C E; Jensen, E; Krusche, A; Lindroos, M; Métral, Elias; Métral, G; Metzmacher, K D; Olsfors, J; Pedersen, F; Raich, U; Riunaud, J P; Royer, J P; Sassowsky, M; Schindl, Karlheinz; Schönauer, Horst Otto; Thivent, M; Ullrich, H M; Völker, F V; Vretenar, Maurizio; Barnes, M; Blackmore, E W; Cifarelli, F; Clark, G; Jones, F; Koscielniak, Shane Rupert; Mammarella, F; Mitra, A; Poirier, R; Reiniger, K W; Ries, T C

    2000-01-01

    The LHC [1] will be supplied, via the SPS, with protons from the pre-injector chain comprising Linac2, PS Booster (PSB) and PS. These accelerators have under-gone a major upgrading programme [2] during the last five years so as to meet the stringent requirements of the LHC. These imply that many high-intensity bunches of small emittance and tight spacing (25 ns) be available at the PS extraction energy (25 GeV). The upgrading project involved an increase of Linac2 current, new RF systems in the PSB and the PS, raising the PSB energy from 1 to 1.4 GeV, two-batch filling of the PS and the installation of high-resolution beam profile measurement devices. With the project entering its final phase and most of the newly installed hardware now being operational, the emphasis switches to producing the nominal LHC beam and tackling the associated beam physics problems. While a beam with transverse characteristics better than nominal has been obtained, the longitudinal density still needs to be increased. An alternativ...

  8. Pressure Monitoring Using Hybrid fs/ps Rotational CARS

    Science.gov (United States)

    Kearney, Sean P.; Danehy, Paul M.

    2015-01-01

    We investigate the feasibility of gas-phase pressure measurements at kHz-rates using fs/ps rotational CARS. Femtosecond pump and Stokes pulses impulsively prepare a rotational Raman coherence, which is then probed by a high-energy 6-ps pulse introduced at a time delay from the Raman preparation. Rotational CARS spectra were recorded in N2 contained in a room-temperature gas cell for pressures from 0.1 to 3 atm and probe delays ranging from 10-330 ps. Using published self-broadened collisional linewidth data for N2, both the spectrally integrated coherence decay rate and the spectrally resolved decay were investigated as means for detecting pressure. Shot-averaged and single-laser-shot spectra were interrogated for pressure and the accuracy and precision as a function of probe delay and cell pressure are discussed. Single-shot measurement accuracies were within 0.1 to 6.5% when compared to a transducer values, while the precision was generally between 1% and 6% of measured pressure for probe delays of 200 ps or more, and better than 2% as the delay approached 300 ps. A byproduct of the pressure measurement is an independent but simultaneous measurement of the gas temperature.

  9. Polysaccharides PS-G and protein LZ-8 from Reishi (Ganoderma lucidum) exhibit diverse functions in regulating murine macrophages and T lymphocytes.

    Science.gov (United States)

    Yeh, Chen-Hao; Chen, Hsiao-Chin; Yang, Jeng-Je; Chuang, Wen-I; Sheu, Fuu

    2010-08-11

    Bioactive components in Ganoderma lucidum mainly include polysaccharides (PS-G) and immunomodulatory protein Ling Zhi-8 (LZ-8). These components may have diverse regulatory functions in the immune system. However, the PS-G preparations from different procedures still contained partial LZ-8 residue, indicating that the specific target and regulating function of PS-G and LZ-8 were not fully understood. In the present study, PS-G was subjected to 15% TCA for removing proteins and the LZ-8 detection using anti-LZ-8 monoclonal antibodies showed a remarkable 89.7% protein reduction of the deproteinized PS-G (dpPS-G). The Saccharomyces cerevisiae which expressed recombinant LZ-8 protein (rLZ-8) without glycosylation was generated and then compared with dpPS-G in the induction toward murine primary macrophage and T lymphocytic cells. The peritoneal macrophages from TLR4-deficient and wild type mice revealed that TLR4 was a putative receptor of dpPS-G, mediating the TNF-alpha, IL-1beta and IL-12p70 cytokine production and CD86, MHC II expression on macrophages, while rLZ-8 enhanced the production of IL-1beta, IL-12p70, CD86, and MHC II expression by another obscure route. rLZ-8-treated macrophages enhanced the release of IFN-gamma and IL-2 by murine CD4(+) and CD8(+) T cells, whereas dpPS-G treatment did not enhance the release of IFN-gamma and IL-2. Furthermore, although the direct rLZ-8-treatment conduced dramatic CD154, CD44 expression on CD3(+) T cells and increased IL-2, IFN-gamma secretion on CD4(+) and CD8(+) T cells, the dpPS-G was incapable of priming CD3(+), CD4(+) or CD8(+) T cells unitarily. Taken together, these results demonstrated that LZ-8 could activate murine macrophages and T lymphocytes but PS-G was merely the activator for macrophages, suggesting their diverse roles in activating the innate and adaptive immunity.

  10. Active low frequency sound field control in a listening room using CABS (Controlled Acoustic Bass System) will also reduce the sound transmitted to neighbour rooms

    DEFF Research Database (Denmark)

    Nielsen, Sofus Birkedal; Celestinos, Adrian

    2012-01-01

    is possible at modal frequencies. For that reason the modal frequencies in the source room will also have big impact on the transmission to neighbour rooms. These low frequency resonance frequencies are very audible in the source room but also in neighbour rooms as a booming bass. CABS (Controlled Acoustic......Sound in rooms and transmission of sound between rooms gives the biggest problems at low frequencies. Rooms with rectangular boundaries have strong resonance frequencies and will give big spatial variations in sound pressure level (SPL) in the source room, and an increase in SPL of 20 dB at a wall...... Bass System) is a time based room correction system for reproduced sound using loudspeakers. The system can remove room modes at low frequencies, by active cancelling the reflection from at the rear wall to a normal stereo setup. Measurements in a source room using CABS and in two neighbour rooms have...

  11. Final Results on the CERN PS Electrostatic Septa Consolidation Program

    CERN Document Server

    Borburgh, Jan; Bobbio, Piero; Carlier, Etienne; Hourican, Michael; Masson, Thierry; Müller, Tania; Prost, Antoine; Crescenti, Massimo

    2003-01-01

    The CERN PS electrostatic septum consolidation program is coming to completion after almost 4 years of development. The program was started to fulfil the increased requirements on vacuum performance and the need to reduce the time necessary for maintenance interventions. The new design of septum 31, used for the so-called 'continuous transfer' 5-turn extraction, and the related construction issues will be presented together with the operational experience gained during the PS 2002 run. In addition, the experience of two years of operation with the new generation septum 23, used for a resonant slow extraction, will be briefly discussed. The continued development undertaken since its installation in the PS ring in 2001 will also be described.

  12. A&T Sector Note on the PS transverse feedback

    CERN Document Server

    Coly, Marcel; Blas, Alfred; Sterbini, Guido; CERN. Geneva. ATS Department

    2017-01-01

    In a particle accelerator, several contributions can degrade the beam quality and particularly the beam transverse emittance. In this document we will describe a system used in the CERN Proton Synchrotron (PS) to cope with the injection steering errors and the transverse instabilities: the PS transverse feedback (PS TFB). As time progresses, this system is also being used for other purpose, to increase in a controlled way the beam transverse emittance and to excite the beam for the Multi-Turn-Extraction (MTE). In 2016, it has been successfully used on some operational beams to damp injection oscillations. This allowed to test the reliability of the system for its operational deployment. A piquet service is available in case of problem.

  13. SAFETY: STRICTER CONTROLS IN CONTROLLED AREAS IN THE PS

    CERN Document Server

    G. Daems

    2001-01-01

    The PS accelerators will soon stop for several months. Work will take place in controlled areas in the PS and will involve many people who are not always aware of the risks associated with the work sites. To guarentee the safety of these workers, the following two measures will be applied: everyone working in a controlled zone - Linacs, PSB, and PS machines tunnels, and transfer lines - must wear, visibly, his CERN access card and his film badge. the CERN access card and the film badge will only be issued after following a basic safety course. Regular checks will be carried out during the shutdown. Anyone without these two items on their person will be obliged to leave the area immediately.

  14. Electrophysical properties of PMN-PT-PS-PFN:Li ceramics

    Directory of Open Access Journals (Sweden)

    R. Skulski

    2013-01-01

    Full Text Available We present the technology of obtaining and the electrophysical properties of a multicomponent material 0.61PMN-0.20PT-0.09PS-0.1PFN:Li (PMN-PT-PS-PFN:Li. The addition of PFN into PMN-PT decreases the temperature of final sintering which is very important during technological process (addition of Li decreases electric conductivity of PFN. Addition of PS i.e., PbSnO3 (which is unstable in ceramic form permits to shift the temperature of the maximum of dielectric permittivity. One-step method of obtaining ceramic samples from oxides and carbonates has been used. XRD, microstructure, scanning calorimetry measurements and the main dielectric, ferroelectric and electromechanical properties have been investigated for the obtained samples.

  15. Effect of interfaces on the melting of PEO confined in triblock PS-b-PEO-b-PS copolymers.

    Science.gov (United States)

    Beaudoin, E; Phan, T N T; Robinet, M; Denoyel, R; Davidson, P; Bertin, D; Bouchet, R

    2013-08-27

    Block copolymers form nanostructures that have interesting physical properties because they combine, for a single compound, the complementary features brought by each block. However, in order to fully exploit these properties, the physical state of each kind of domain must be precisely controlled. In this work, triblock PS-b-PEO-b-PS copolymers consisting of a central poly(ethylene oxide) (PEO) block covalently bonded to polystyrene (PS) blocks were synthesized by Atom Transfer Radical Polymerization. Their morphology was investigated by X-ray scattering and TEM experiments whereas their thermodynamic behavior was characterized by DSC. A strong decrease of both the melting temperature and the degree of crystallinity of PEO, due to its confinement between the PS domains, was observed and analyzed with a modified Gibbs-Thomson equation, following the approaches used for fluids confined in porous media. The existence of an amorphous bound layer, a few nanometers thick, at the PEO/PS interface, that does not undergo any phase transition in the temperature range investigated, accounts for both the melting temperature depression and the decrease of crystallinity upon confinement. This interfacial layer may significantly affect the mechanical and transport properties of these block copolymers that find applications as solid polymer electrolytes in batteries for example. Moreover, the value obtained for the solid PEO/liquid PEO surface tension is lower than those previously published but is thermodynamically consistent with the surface tensions of polymers at the solid/vapor and liquid/vapor interfaces.

  16. Inauguration of POPS: the new power system of the PS

    CERN Multimedia

    Maximilien Brice

    2010-01-01

    Pictures 03 and 04 : The team from the Electrical Power Converters Group (TE/EPC) is joined by the Director of Accelerators, the heads of the BE, TE and FI departments, CERN managers and Converteam representatives in a group portrait in front of three of the containers that house the capacitor banks of the PS's new power supply system, POPS. Pictures 01, 06 and 07 : Magid-Michel Saikaly, energy and infrastructure director at Converteam, receives a prize from Steve Myers, Director of Accelerators at CERN, for the development and fabrication of the new electrical power system for the PS, called POPS.

  17. The Septa for LEIR Extraction and PS Injection

    CERN Document Server

    Borburgh, J; Masson, T; Prost, A

    2006-01-01

    The Low Energy Ion Ring (LEIR) is part of the CERN LHC injector chain for ions. The LEIR extraction uses a pulsed magnetic septum, clamped around a metallic vacuum chamber. Apart from separating the ultra high vacuum in the LEIR ring from the less good vacuum in the transfer line to the PS this chamber also serves as magnetic screen and retains the septum conductor in place. The PS ion injection septum consists of a pulsed laminated magnet under vacuum, featuring a single-turn water cooled coil and a remote positioning system. The design, the construction and the commissioning of both septa are described.

  18. The OMERACT psoriatic arthritis magnetic resonance imaging scoring system (PsAMRIS): definitions of key pathologies, suggested MRI sequences, and preliminary scoring system for PsA Hands

    DEFF Research Database (Denmark)

    Østergaard, Mikkel; McQueen, Fiona; Wiell, Charlotte

    2009-01-01

    This article describes a preliminary OMERACT psoriatic arthritis magnetic resonance image scoring system (PsAMRIS) for evaluation of inflammatory and destructive changes in PsA hands, which was developed by the international OMERACT MRI in inflammatory arthritis group. MRI definitions of important...... pathologies in peripheral PsA and suggestions concerning appropriate MRI sequences for use in PsA hands are also provided....

  19. Antigen processing of glycoconjugate vaccines; the polysaccharide portion of the pneumococcal CRM(197) conjugate vaccine co-localizes with MHC II on the antigen processing cell surface.

    Science.gov (United States)

    Lai, Zengzu; Schreiber, John R

    2009-05-21

    Pneumococcal (Pn) polysaccharides (PS) are T-independent (TI) antigens and do not induce immunological memory or antibodies in infants. Conjugation of PnPS to the carrier protein CRM(197) induces PS-specific antibody in infants, and memory similar to T-dependent (Td) antigens. Conjugates have improved immunogenicity via antigen processing and presentation of carrier protein with MHC II and recruitment of T cell help, but the fate of the PS attached to the carrier is unknown. To determine the location of the PS component of PnPS-CRM(197) in the APC, we separately labeled PS and protein and tracked their location. The PS of types 14-CRM(197) and 19F-CRM(197) was specifically labeled by Alexa Fluor 594 hydrazide (red). The CRM(197) was separately labeled red in a reaction that did not label PS. Labeled antigens were incubated with APC which were fixed, permeabilized and incubated with anti-MHC II antibody labeled green by Alexa Fluor 488, followed by confocal microscopy. Labeled CRM(197) was presented on APC surface and co-localized with MHC II (yellow). Labeled unconjugated 14 or 19F PS did not go to the APC surface, but PS labeled 14-CRM(197) and 19F-CRM(197) was internalized and co-localized with MHC II. Monoclonal antibody to type 14 PS bound to intracellular type 14 PS and PS-CRM(197). Brefeldin A and chloroquine blocked both CRM(197) and PS labeled 14-CRM(197) and 19F-CRM(197) from co-localizing with MHC II. These data suggest that the PS component of the CRM(197) glycoconjugate enters the endosome, travels with CRM(197) peptides to the APC surface and co-localizes with MHC II.

  20. Optimization of protease production by an actinomycete Strain, PS ...

    African Journals Online (AJOL)

    Actinomycetes were isolated from the sediment samples of an estuarine shrimp pond located along the south east coast of India. During the investigation, a total of 28 strains of actinomycetes were isolated and examined for their protease activity. Among them, one strain PS-18A which was tentatively identified as ...

  1. Seismic receiver function interpretation: Ps splitting or anisotropic underplating?

    Science.gov (United States)

    Liu, Zhen; Park, Jeffrey

    2017-03-01

    Crustal anisotropy is crucial to understanding the evolutionary history of Earth's lithosphere. Shear wave splitting of Moho P-to-S converted phases in receiver functions (RFs) have been often used to study crustal anisotropy. Harmonic variation of Moho Ps phases in delay times are used to infer splitting parameters of averaged anisotropy in the crust. However, crustal anisotropy may distribute at various levels within the crust due to complex deformational processes. Layered anisotropy requires careful investigation of the distribution of anisotropy before interpreting Moho Ps splitting. In this study, we show results from stations ARU in Russia, KIP in the Hawaiian Islands and LSA in Tibetan Plateau, where layered anisotropy is constrained well by intracrust Ps conversions at high frequencies using a harmonic-decomposition technique. Anisotropic velocity models are inferred by forward-modeling decomposed RF waveforms. We suggest that the harmonic variation of Moho Ps phases should always be investigated to check for anisotropic layering using RFs with frequency content above 1 Hz, rather than simply reporting averaged anisotropy of the whole crust.

  2. Optimization of protease production by an actinomycete Strain, PS ...

    African Journals Online (AJOL)

    STORAGESEVER

    Isolation Agar Medium in duplicate Petri plates. To minimize ... on the Petri plates were counted from 5th day onwards, up to 28th .... After the dialysis, the volume was measured and analyzed for proteins and stored in deep freezer. Taxonomic investigation. The genus level identification was made for the strain PS-18A using ...

  3. Framing Retention for Institutional Improvement: A 4 Ps Framework

    Science.gov (United States)

    Kalsbeek, David H.

    2013-01-01

    A 4 Ps framework for student retention strategy is a construct for reframing the retention discussion in a way that enables institutional improvement by challenging some conventional wisdom and prevailing perspectives that have characterized retention strategy for years. It opens new possibilities for action and improvement by suggesting that…

  4. Multipole stack for the 4 rings of the PS Booster

    CERN Multimedia

    CERN PhotoLab

    1976-01-01

    The PS Booster (originally 800 MeV, now 1.4 GeV) saw first beam in 1972, routine operation began in 1973. The strive for ever higher intensities required the addition of multipoles. Manufacture of 8 stacks of multipoles was launched in 1974, for installation in 1976. For details, see 7511120X.

  5. The Swelling Behaviour of Polystyrene (PS)/ Polyvinylacetate (Pvac ...

    African Journals Online (AJOL)

    The effect of the variation of the type of solvent responsible for the differences in the swelling kinetics of Polystyrene (PS) and Polyvinyl acetate (PVAc) blends was studied. The results showed that the nature of solvent control or affects the degree of swelling. Also, 1-V characteristics at temperature range of 323-363K shows ...

  6. Boiling treatment of ABS and PS plastics for flotation separation.

    Science.gov (United States)

    Wang, Chong-qing; Wang, Hui; Wu, Bao-xin; Liu, Qun

    2014-07-01

    A new physical method, namely boiling treatment, was developed to aid flotation separation of acrylonitrile-butadiene-styrene (ABS) and polystyrene (PS) plastics. Boiling treatment was shown to be effective in producing a hydrophilic surface on ABS plastic. Fourier Transform Infrared analysis was conducted to investigate the mechanism of boiling treatment of ABS. Surface rearrangement of polymer may be responsible for surface change of boiling treated ABS, and the selective influence of boiling treatment on the floatability of boiling treated plastics may be attributed to the difference in the molecular mobility of polymer chains. The effects of flotation time, frother concentration and particle size on flotation behavior of simple plastic were investigated. Based on flotation behavior of simple plastic, flotation separation of boiling treatment ABS and PS with different particle sizes was achieved efficiently. The purity of ABS and PS was up to 99.78% and 95.80%, respectively; the recovery of ABS and PS was up to 95.81% and 99.82%, respectively. Boiling treatment promotes the industrial application of plastics flotation and facilitates plastic recycling. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. Mid-infrared Flare of TDE Candidate PS16dtm: Dust Echo and Implications for the Spectral Evolution

    Science.gov (United States)

    Jiang, Ning; Wang, Tinggui; Yan, Lin; Xiao, Ting; Yang, Chenwei; Dou, Liming; Wang, Huiyuan; Cutri, Roc; Mainzer, Amy

    2017-11-01

    PS16dtm was classified as a candidate tidal disruption event in a dwarf Seyfert 1 galaxy with a low-mass black hole (∼ {10}6 {M}ȯ ) and has presented various intriguing photometric and spectra characteristics. Using the archival Wide-field Infrared Survey Explorer and the newly released NEOWISE data, we found that PS16dtm is experiencing a mid-infrared (MIR) flare that started ∼11 days before the first optical detection. Interpreting the MIR flare as a dust echo requires close pre-existing dust with a high covering factor and suggests that the optical flare may have brightened slowly for some time before it became bright detectable from the ground. More evidence is given at the later epochs. At the peak of the optical light curve, the new inner radius of the dust torus has grown to a much larger size (i.e., a factor of seven of the initial radius) due to the strong radiation field. At ∼150 days after the first optical detection, the dust temperature has dropped well below the sublimation temperature. Other peculiar spectral features shown by PS16dtm are the transient, prominent Fe ii emission lines and outflows indicated by broad absorption lines detected during the optical flare. Our model explains the enhanced Fe ii emission from iron that is newly released from the evaporated dust. The observed broad absorption line outflow could be explained by accelerated gas in the dust torus due to the radiation pressure.

  8. The role of a conserved membrane proximal cysteine in altering αPS2CβPS integrin diffusion

    Science.gov (United States)

    Syed, Aleem; Arora, Neha; Bunch, Thomas A.; Smith, Emily A.

    2016-12-01

    Cysteine residues (Cys) in the membrane proximal region are common post-translational modification (PTM) sites in transmembrane proteins. Herein, the effects of a highly conserved membrane proximal α-subunit Cys1368 on the diffusion properties of αPS2CβPS integrins are reported. Sequence alignment shows that this cysteine is palmitoylated in human α3 and α6 integrin subunits. Replacing Cys1368 in wild-type integrins with valine (Val1368) putatively blocks a PTM site and alters integrins’ ligand binding and diffusion characteristics. Both fluorescence recovery after photobleaching (FRAP) and single particle tracking (SPT) diffusion measurements show Val1368 integrins are more mobile compared to wild-type integrins. Approximately 33% and 8% more Val1368 integrins are mobile as measured by FRAP and SPT, respectively. The mobile Val1368 integrins also exhibit less time-dependent diffusion, as measured by FRAP. Tandem mass spectrometry data suggest that Cys1368 contains a redox or palmitoylation PTM in αPS2CβPS integrins. This membrane proximal Cys may play an important role in the diffusion of other alpha subunits that contain this conserved residue.

  9. psíquico de um caps em florianópolis

    Directory of Open Access Journals (Sweden)

    Dorotéa Loes Ribas

    2007-01-01

    Full Text Available En el presente estudio se realizó una investigación cualitativa cuyo objetivo fue reflexionar, con el individuo en sufrimiento psíquico, sus experiencias vividas en el cotidiano, identificando los significados de estas experiencias. El estudio fue realizado con dos clientes de un Centro de Atención Psicosocial (CAPS II, en la ciudad de Florianópolis. La recolección de los datos fue hecha a partir de la implantación del proceso de cuidado, según la Teoría de Rosemarie Rizzo Parse. En el análisis de los datos fueron identificados los siguientes significados: conviviendo con los recuerdos de la infancia; la co-constitución de la enfermedad psiquiátrica; el trabajo penetrando el proceso salud-enfermedad; transcendiendo en salud, ciudadanía y calidad de vida; iluminados por la Reforma de la Asistencia Psiquiátrica. De esa forma, la teoría “Volverse Humano”, con sus conceptos, principios y presupuestos le permitió al individuo en sufrimiento psíquico vislumbrar una nueva manera de vivir, relacionada con la propuesta de la Reforma Psiquiátrica Brasileña.

  10. [Retinal Cell Therapy Using iPS Cells].

    Science.gov (United States)

    Takahashi, Masayo

    2016-03-01

    Progress in basic research, starting with the work on neural stem cells in the middle 1990's to embryonic stem (ES) cells and induced pluripotent stem (iPS) cells at present, will lead the cell therapy (regenerative medicine) of various organs, including the central nervous system to a big medical field in the future. The author's group transplanted iPS cell-derived retinal pigment epithelial (RPE) cell sheets to the eye of a patient with exudative age-related macular degeneration (AMD) in 2014 as a clinical research. Replacement of the RPE with the patient's own iPS cell-derived young healthy cell sheet will be one new radical treatment of AMD that is caused by cellular senescence of RPE cells. Since it was the first clinical study using iPS cell-derived cells, the primary endpoint was safety judged by the outcome one year after surgery. The safety of the cell sheet has been confirmed by repeated tumorigenisity tests using immunodeficient mice, as well as purity of the cells, karyotype and genetic analysis. It is, however, also necessary to prove the safety by clinical studies. Following this start, a good strategy considering cost and benefit is needed to make regenerative medicine a standard treatment in the future. Scientifically, the best choice is the autologous RPE cell sheet, but autologous cell are expensive and sheet transplantation involves a risky part of surgical procedure. We should consider human leukocyte antigen (HLA) matched allogeneic transplantation using the HLA 6 loci homozyous iPS cell stock that Prof. Yamanaka of Kyoto University is working on. As the required forms of donor cells will be different depending on types and stages of the target diseases, regenerative medicine will be accomplished in a totally different manner from the present small molecule drugs. Proof of concept (POC) of photoreceptor transplantation in mouse is close to being accomplished using iPS cell-derived photoreceptor cells. The shortest possible course for treatment

  11. A transmissão psíquica geracional

    Directory of Open Access Journals (Sweden)

    Vinícius Oliveira dos Santos

    Full Text Available O artigo seguinte refere-se a um estudo sobre como ocorre a transmissão psíquica entre as gerações e qual sua importância na constituição psíquica do sujeito. É também objetivo deste artigo explicar o que são as transmissões intergeracional e transgeracional. Para buscar respostas para essas questões, fez-se uma pesquisa bibliográfica sobre a transmissão psíquica, pelo viés psicanalítico, principalmente a partir da teoria lacaniana e com conceitos oriundos da linguística saussuriana. Será a partir de uma determinada ordem simbólica, constituída pela linguagem que precede o sujeito, nomeado por Lacan como o Outro, que a transmissão psíquica entre gerações ganhará o seu caráter unívoco, sempre se tendo em mente a importância fundamental do recalcamento e de seus efeitos, bem como do retorno do recalcado nas diferentes gerações. A transmissão psíquica é necessária e concomitante à constituição do sujeito, e ocorre através da linguagem, dos significantes que irão determinar uma ordem simbólica para o ser que nasce através dos diferentes discursos que perpassam as gerações nas figuras dos pais desse novo ser. Essa ordem simbólica continuará a se fazer presente nesse novo sujeito pelo restante de sua existência. Este artigo busca dar nova luz ao aspecto da transmissão psíquica transgeracional, diferenciando-se da recalque s abordagens psicanalíticas contemporâneas por ser uma leitura lacaniana. Serão usados dois exemplos: um de como a transmissão aparece na cultura, outro, na subjetividade do sujeito através da arte.

  12. Transfer line from the PSB to the PS (recombination)

    CERN Multimedia

    CERN PhotoLab

    1976-01-01

    After sequential ejection of 5 bunches from each of the 4 rings of the Booster (originally 800 MeV, now 1.4 GeV), the 4 batches are brought to the same vertical level, so as to form a string of 20 bunches, filling the circumference of the PS. This vertical "recombination" is performed in the transfer line, using vertical bending magnets, septa and kickers. Here we see the section where the beam from ring 4 (the top one) is brought down to the level of ring 3, and the beam from ring 1 up to the level of ring 2. Further downstream (to the right, outside this picture), level 2 is brought up to level 3, identical to that of the PS. After this original recombination scheme, other ways of combining the 4 beams, vertically and/or longitudinally, were developed and used in operation.

  13. O Trabalho Psíquico da Intersubjetividade

    Directory of Open Access Journals (Sweden)

    Maria Inês Assumpção Fernandes

    2003-01-01

    Full Text Available O presente trabalho procura refletir sobre o trabalho psíquico da intersubjetividade nos grupos. Trata-se de pensá-lo na relação com a ruptura de investimentos durante o processo de Transformação x Criação, em primeiro lugar. A partir desse ponto, discutiremos a relação entre Transformação, Trabalho e Dispositivo. Neste caso pensamos nas possibilidades de intervenção, refletindo sobre a intervenção inpidual e a intervenção grupal. A questão da Transmissão Psíquica entre gerações será focalizada, fundamentalmente, no que se refere aos tempos lógicos do recalque.

  14. Images of Christ's Saving Work in Ps.-Epiphanius' Homilies

    Directory of Open Access Journals (Sweden)

    H. F. Stander

    1997-12-01

    Full Text Available Images of Christ's Saving Work in Ps.-Epiphanius' Homilies. One cannot really speak of a systematic theology on the subject of atone-ment in the patristic writers. Frances Young once said that 'it is in fact impossible to categorize neatly the thought of the major patristic writers on the subject of atonement'. She adds that one cannot do justice to the range of motifs and images that are found in describing the saving and atoning work of Christ if we merely dismember 'systematic theologies' to illustrate common soteriological themes. One can only appreciate patristic views of atonement if one begins by recognizing the multifaceted unity of imagery that pervades the literature. This then is the goal of this article: to discuss the rich images which Ps: -Epiphanius uses to describe the atoning work of Christ.

  15. Magnetoelectric MnPS3 as a candidate for ferrotoroidicity

    Science.gov (United States)

    Ressouche, E.; Loire, M.; Simonet, V.; Ballou, R.; Stunault, A.; Wildes, A.

    2010-09-01

    We have revisited the magnetic structure of manganese phosphorus trisulfide MnPS3 using neutron diffraction and polarimetry. MnPS3 undergoes a transition toward a collinear antiferromagnetic order at 78 K. The resulting magnetic point-group breaks both the time reversal and the space inversion thus allowing a linear magnetoelectric coupling. Neutron polarimetry was subsequently used to prove that this coupling provides a way to manipulate the antiferromagnetic domains simply by cooling the sample under crossed magnetic and electrical fields, in agreement with the nondiagonal form of the magnetoelectric tensor. In addition, this tensor has, in principle, an antisymmetric part that results in a toroidic moment and provides with a pure ferrotoroidic compound.

  16. PS Dreyer: Bakens op die pad van die wetenskap

    Directory of Open Access Journals (Sweden)

    A. J. Antonites

    1986-01-01

    Full Text Available PS Dreyer: Beacons on the path of science Professor PS Dreyer is an academic who has shown insight and vision into several problems of the human sciences since 1951. He has identified problems, but also contributed solutions to them. In this respect his philosophy on causality and freedom is of utmost importance. The same applies to his investigations into the relationship history-Christianity as well as the unity of sciences and how the concepts scientific, unscientic and nonscientific are related to one another. His contribution to the understanding of Greek philosophy should be of significance for time to come. Two milestones could be distinguished: Dreyer's particular solution to the problem of the criterion on truth, viz meaningfulness and his notion of the knowledge of values in ethics by valuation in contradistinction to knowledge through feeling, reason and will.

  17. Images of Christ's Saving Work in Ps.-Epiphanius' Homilies

    Directory of Open Access Journals (Sweden)

    H. F. Stander

    1997-01-01

    Full Text Available Images of Christ's Saving Work in Ps.-Epiphanius' Homilies. One cannot really speak of a systematic theology on the subject of atone-ment in the patristic writers. Frances Young once said that 'it is in fact impossible to categorize neatly the thought of the major patristic writers on the subject of atonement'. She adds that one cannot do justice to the range of motifs and images that are found in describing the saving and atoning work of Christ if we merely dismember 'systematic theologies' to illustrate common soteriological themes. One can only appreciate patristic views of atonement if one begins by recognizing the multifaceted unity of imagery that pervades the literature. This then is the goal of this article: to discuss the rich images which Ps: -Epiphanius uses to describe the atoning work of Christ.

  18. Longitudinal coupled-bunch instability studies in the PS

    CERN Document Server

    Damerau, H

    2017-01-01

    The main longitudinal limitation for LHC-type beams inthe PS are coupled-bunch instabilities. A dedicated proto-typefeedbacksystemusingaFinemetcavityasalongitudinalkicker has been installed. Extensive tests with beam havebeen performed to explore the intensity reach with this feed-back. The maximum intensity with nominal longitudinalemittance at PS extraction has been measured, as well as theemittance required to keep the beam longitudinally stableat the design intensity for the High-Luminosity LHC (HL-LHC). A higher-harmonic cavity is a complementary op-tion to extend the intensity reach beyond the capabilities ofthe coupled-bunch feedback. Preliminary machine develop-ment (MD) studies operating one20MHzor one40MHzRF system as a higher harmonic at the flat-top indicate thebeneficial effect on longitudinal beam stability

  19. Functional characterization of calcineurin homologs PsCNA1/PsCNB1 in Puccinia striiformis f. sp. tritici using a host-induced RNAi system.

    Directory of Open Access Journals (Sweden)

    Hong Zhang

    Full Text Available Calcineurin plays a key role in morphogenesis, pathogenesis and drug resistance in most fungi. However, the function of calcineurin genes in Puccinia striiformis f. sp. tritici (Pst is unclear. We identified and characterized the calcineurin genes PsCNA1 and PsCNB1 in Pst. Phylogenetic analyses indicate that PsCNA1 and PsCNB1 form a calcium/calmodulin regulated protein phosphatase belonging to the calcineurin heterodimers composed of subunits A and B. Quantitative RT-PCR analyses revealed that both PsCNA1 and PsCNB1 expression reached their maximum in the stage of haustorium formation, which is one day after inoculation. Using barely stripe mosaic virus (BSMV as a transient expression vector in wheat, the expression of PsCNA1 and PsCNB1 in Pst was suppressed, leading to slower extension of fungal hyphae and reduced production of urediospores. The immune-suppressive drugs cyclosporin A and FK506 markedly reduced the germination rates of urediospores, and when germination did occur, more than two germtubes were produced. These results suggest that the calcineurin signaling pathway participates in stripe rust morphogenetic differentiation, especially the formation of haustoria during the early stage of infection and during the production of urediospores. Therefore PsCNA1 and PsCNB1 can be considered important pathogenicity genes involved in the wheat-Pst interaction.

  20. Consolidation of the 45-Year Old PS Main Magnet System

    CERN Document Server

    Zickler, Thomas; Kalbreier, Wilhelm; Mess, Karl Hubert; Newborough, Antony

    2006-01-01

    After a major coil insulation breakdown on two of the 47-year-old CERN PS main magnets in 2003, an extensive magnet consolidation program has been launched. This article reviews the analysis of the magnet state be-fore the repair and the applied major improvements. An overview is given of the production of the new compo-nents, the actual refurbishment and the commissioning of the main magnet system after 18 months shutdown.

  1. Specification of the Beam Position Measurement in the PS Machine

    CERN Document Server

    Bravin, Enrico; Chanel, M; Ludwig, M; Métral, Elias; Métral, G; Potier, J P; Raich, U; Scrivens, R; Steerenberg, R; CERN. Geneva. AB Department

    2003-01-01

    This specification, drawn up by the instrumentation specification board 2, describes the requirements concerning orbit and trajectory measurements in the PS machine. The orbit measurement and the trajectory measurement are both indispensable in order to be able to guarantee the correct beam quality for beams like LHC, the future Grand Sasso beam, the nTOF beam and surely the combined operation of the nTOF beam and the East Area beam.

  2. Science spin: iPS cell research in the news.

    Science.gov (United States)

    Caulfield, T; Rachul, C

    2011-05-01

    Big scientific developments have always been spun to meet particular social agendas. We have seen it in the context of global warming, nuclear power, and genetically modified organisms. But few stories illustrate the phenomenon of spin as well as the reaction, and concomitant media coverage, that surrounded the November 2007 announcement regarding the reprogramming of skin cells to produce cells with qualities comparable to those of human embryonic stem cells (hESCs) known as induced pluripotent stem (iPS) cells.

  3. Physics at the AD/PS/SPS (1/4)

    CERN Multimedia

    CERN. Geneva

    2012-01-01

    Lecture 1: The CERN injector complex and beams for non-LHC physics. The various machines and beam lines in the CERN injector complex are presented, from the linacs to the SPS. Special emphasis is given to the beam lines at the PS and SPS machines: AD, North and East Areas, nTOF and CNGS and HiRadMad as well as the ion beams. A short outlook is given to possible future upgrades and projects.

  4. Ps18.pdf | sep2002 | jess | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; jess; sep2002; Ps18.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. Associates – 2017. Posted on 17 July 2017. Click here to see the list · 28th Mid Year Meeting. Posted on 26 May ...

  5. New Electron Cloud Detectors for the PS Main Magnets

    CERN Document Server

    Yin Vallgren, Ch; Gilardoni, S; Taborelli, M; Neupert, H; Ferreira Somoza, J

    2014-01-01

    Electron cloud (EC) has already been observed during normal operation of the PS, therefore it is necessary to study its in fluence on any beam instability for the future LHC Injector Upgrade (LIU). Two new electron cloud detectors have been discussed, developed and installed during the Long Shutdown (LS1) in one of the PS main magnets. The first measurement method is based on current measurement by using a shielded button-type pick-up. Due to the geometry and space limitation in the PS magnet, the button-type pick-up made of a 96%Al2O3 block coated with a thin layer of solvent-based Ag painting, placed 30 degrees to the bottom part of the vacuum chamber was installed in the horizontal direction where the only opening of the magnet coil is. The other newly developed measurement method is based on detection of photons emitted by the electrons from the electron cloud impinging on the vacuum chamber walls. The emitted photons are reected to a quartz window. A MCP-PMT (Micro-Channel Plate Photomultiplier Tube) wit...

  6. LS1 Report: PS Booster prepares for beam

    CERN Multimedia

    Katarina Anthony

    2014-01-01

    With Linac2 already up and running, the countdown to beam in the LHC has begun! The next in line is the PS Booster, which will close up shop to engineers early next week. The injector will be handed over to the Operations Group who are tasked with getting it ready for active duty.   Taken as we approach the end of LS1 activities, this image shows where protons will soon be injected from Linac2 into the four PS Booster rings. Over the coming two months, the Operations Group will be putting the Booster's new elements through their paces. "Because of the wide range of upgrades and repairs carried out in the Booster, we have a very full schedule of tests planned for the machine," says Bettina Mikulec, PS Booster Engineer in Charge. "We will begin with cold checks; these are a wide range of tests carried out without beam, including system tests with power on/off and with varying settings, as well as verification of the controls system and timings." Amon...

  7. In-vivo identification of direct electron transfer from Shewanella oneidensis MR-1 to electrodes via outer-membrane OmcA-MtrCAB protein complexes

    Energy Technology Data Exchange (ETDEWEB)

    Okamoto, Akihiro [Department of Applied Chemistry, School of Engineering, University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-8656 (Japan); Nakamura, Ryuhei, E-mail: nakamura@light.t.u-tokyo.ac.jp [Department of Applied Chemistry, School of Engineering, University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-8656 (Japan); Hashimoto, Kazuhito, E-mail: hashimoto@light.t.u-tokyo.ac.jp [Department of Applied Chemistry, School of Engineering, University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-8656 (Japan); ERATO/JST, HASHIMOTO Light Energy Conversion Project (Japan)

    2011-06-30

    Graphical abstract: . Display Omitted Highlights: > Monolayer biofilm of Shewanella cells was prepared on an ITO electrode. > Extracellular electron transfer (EET) process was examined with series of mutants. > Direct ET was confirmed with outer-membrane-bound OmcA-MtrCAB complex. > The EET process was not prominently influenced by capsular polysaccharide. - Abstract: The direct electron-transfer (DET) property of Shewanella bacteria has not been resolved in detail due to the complexity of in vivo electrochemistry in whole-cell systems. Here, we report the in vivo assignment of the redox signal indicative of the DET property in biofilms of Shewanella oneidensis MR-1 by cyclic voltammetry (CV) with a series of mutants and a chemical marking technique. The CV measurements of monolayer biofilms formed by deletion mutants of c-type cytochromes ({Delta}mtrA, {Delta}mtrB, {Delta}mtrC/{Delta}omcA, and {Delta}cymA), and pilin ({Delta}pilD), capsular polysaccharide ({Delta}SO3177) and menaquinone ({Delta}menD) biosynthetic proteins demonstrated that the electrochemical redox signal with a midpoint potential at 50 mV (vs. SHE) was due to an outer-membrane-bound OmcA-MtrCAB protein complex of decaheme cytochromes, and did not involve either inner-membrane-bound CymA protein or secreted menaquinone. Using the specific binding affinity of nitric monoxide for the heme groups of c-type cytochromes, we further confirmed this conclusion. The heterogeneous standard rate constant for the DET process was estimated to be 300 {+-} 10 s{sup -1}, which was two orders of magnitude higher than that previously reported for the electron shuttling process via riboflavin. Experiments using a mutant unable to produce capsular polysaccharide ({Delta}SO3177) revealed that the DET property of the OmcA-MtrCAB complex was not influenced by insulating and hydrophilic extracellular polysaccharide. Accordingly, under physiological conditions, S. oneidensis MR-1 utilizes a high density of outer

  8. The time course of photoinactivation of photosystem II in leaves revisited.

    Science.gov (United States)

    Kou, Jiancun; Oguchi, Riichi; Fan, Da-Yong; Chow, Wah Soon

    2012-09-01

    Since photosystem II (PS II) performs the demanding function of water oxidation using light energy, it is susceptible to photoinactivation during photosynthesis. The time course of photoinactivation of PS II yields useful information about the process. Depending on how PS II function is assayed, however, the time course seems to differ. Here, we revisit this problem by using two additional assays: (1) the quantum yield of oxygen evolution in limiting, continuous light and (2) the flash-induced cumulative delivery of PS II electrons to the oxidized primary donor (P700(+)) in PS I measured as a 'P700 kinetics area'. The P700 kinetics area is based on the fact that the two photosystems function in series: when P700 is completely photo-oxidized by a flash added to continuous far-red light, electrons delivered from PS II to PS I by the flash tend to re-reduce P700(+) transiently to an extent depending on the PS II functionality, while the far-red light photo-oxidizes P700 back to the steady-state concentration. The quantum yield of oxygen evolution in limiting, continuous light indeed decreased in a way that deviated from a single-negative exponential. However, measurement of the quantum yield of oxygen in limiting light may be complicated by changes in mitochondrial respiration between darkness and limiting light. Similarly, an assay based on chlorophyll fluorescence may be complicated by the varying depth in leaf tissue from which the signal is detected after progressive photoinactivation of PS II. On the other hand, the P700 kinetics area appears to be a reasonable assay, which is a measure of functional PS II in the whole leaf tissue and independent of changes in mitochondrial respiration. The P700 kinetics area decreased in a single-negative exponential fashion during progressive photoinactivation of PS II in a number of plant species, at least at functional PS II contents ≥6 % of the initial value, in agreement with the conclusion of Sarvikas et al. (Photosynth

  9. Kultuur isiksuse psühholoogiat ei mõjuta / Tiit Kändler

    Index Scriptorium Estoniae

    Kändler, Tiit, 1948-

    2010-01-01

    Psühholoogia uuemate andmete kohaselt ei sõltu indiviidi seadumus kultuurist, soost, vanusest, haridusest. Eesti psühholoogide Jüri Alliku ja Ann Realo osalusel ajakirjas "Journal Personality and Social Psychology" ilmunud artiklist

  10. Kultuur isiksuse psühholoogiat ei mõjuta / Tiit Kändler

    Index Scriptorium Estoniae

    Kändler, Tiit, 1948-

    2005-01-01

    Psühholoogia uuemate andmete kohaselt ei sõltu indiviidi seadumus kultuurist, soost, vanusest, haridusest. Eesti psühholoogide Jüri Alliku ja Anu Realo osalusel ajakirjas "Journal Personality and Social Psychology" ilmunud artiklist

  11. Comparative, validity and responsiveness of the HOOS-PS and KOOS-PS to the WOMAC physical function subscale in total joint replacement for osteoarthritis

    DEFF Research Database (Denmark)

    Davis, A M; Perruccio, A V; Canizares, M

    2009-01-01

    OBJECTIVE: To evaluate the internal consistency of the Hip disability and Osteoarthritis Outcome Score-Physical Function Short-form (HOOS-PS) and the Knee injury and Osteoarthritis Outcome Score-Physical Function Short-form (KOOS-PS) in total hip replacement (THR) and total knee (TKR) replacement....... Construct validity and responsiveness were compared to the Western Ontario McMaster Universities' Osteoarthritis Index (WOMAC) Likert 3.0 physical function (PF) subscale and the PF excluding the items in the short measures (PF-exclusions). METHODS: Participants completed the full HOOS or KOOS, measures...... of fatigue, anxiety, depression and the Chronic Pain Grade (CPG) pre-surgery and the HOOS or KOOS 6 months post-surgery. Internal consistency for the HOOS-PS and KOOS-PS was calculated using Cronbach's alpha. For construct validity, it was hypothesized that correlations between the HOOS-PS or KOOS-PS and PF...

  12. Analüütilised voolud psühholoogias ja nende rakendamine pedagoogikas / Aleksander Elango

    Index Scriptorium Estoniae

    Elango, Aleksander, 1902-2004

    2001-01-01

    Analüütise psühholoogia kolm koolkonda - S.Freudì koolkond e. päris-psühhoanalüüs, A.Adlerì koolkond e. individuaalpsühholoogia ja C.G.Jungì psühhoanalüüsi ja individuaalpsühholoogia sünteesi luua püüdev koolkond. Analüütise psühholoogia koolkondade ja pedagoogika suhetest

  13. File list: His.PSC.05.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.05.AllAg.iPS_cells hg19 Histone Pluripotent stem cell iPS cells SRX317576,S...077,SRX317607 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.PSC.05.AllAg.iPS_cells.bed ...

  14. File list: His.PSC.50.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.50.AllAg.iPS_cells mm9 Histone Pluripotent stem cell iPS cells SRX977417,SR...RX127376,SRX146530,SRX146522,SRX146547,SRX333561,SRX035985,SRX1090869 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.50.AllAg.iPS_cells.bed ...

  15. File list: ALL.PSC.50.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.50.AllAg.iPS_cells hg19 All antigens Pluripotent stem cell iPS cells SRX088...16,SRX189400,SRX189399 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/ALL.PSC.50.AllAg.iPS_cells.bed ...

  16. File list: His.PSC.10.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.10.AllAg.iPS_cells hg19 Histone Pluripotent stem cell iPS cells SRX110016,S...315,SRX381309 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.PSC.10.AllAg.iPS_cells.bed ...

  17. File list: ALL.PSC.20.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.20.AllAg.iPS_cells hg19 All antigens Pluripotent stem cell iPS cells SRX088...27,SRX189400,SRX189399 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/ALL.PSC.20.AllAg.iPS_cells.bed ...

  18. File list: His.PSC.50.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.50.AllAg.iPS_cells hg19 Histone Pluripotent stem cell iPS cells SRX110015,S...079,SRX317585 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.PSC.50.AllAg.iPS_cells.bed ...

  19. File list: Pol.PSC.20.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.PSC.20.AllAg.iPS_cells mm9 RNA polymerase Pluripotent stem cell iPS cells SRX97...7435,SRX977434,SRX027462 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Pol.PSC.20.AllAg.iPS_cells.bed ...

  20. File list: ALL.PSC.05.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.05.AllAg.iPS_cells hg19 All antigens Pluripotent stem cell iPS cells SRX753...00,SRX189399,SRX317607 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/ALL.PSC.05.AllAg.iPS_cells.bed ...

  1. File list: Pol.PSC.10.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.PSC.10.AllAg.iPS_cells mm9 RNA polymerase Pluripotent stem cell iPS cells SRX97...7435,SRX977434,SRX027462 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Pol.PSC.10.AllAg.iPS_cells.bed ...

  2. File list: ALL.PSC.05.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.05.AllAg.iPS_cells mm9 All antigens Pluripotent stem cell iPS cells SRX9774...30,SRX146524,SRX146522,SRX146547 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.PSC.05.AllAg.iPS_cells.bed ...

  3. File list: Oth.PSC.50.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.PSC.50.AllAg.iPS_cells mm9 TFs and others Pluripotent stem cell iPS cells SRX97...RX146524 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.PSC.50.AllAg.iPS_cells.bed ...

  4. File list: Pol.PSC.50.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.PSC.50.AllAg.iPS_cells mm9 RNA polymerase Pluripotent stem cell iPS cells SRX97...7435,SRX977434,SRX027462 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Pol.PSC.50.AllAg.iPS_cells.bed ...

  5. File list: DNS.PSC.20.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available DNS.PSC.20.AllAg.iPS_cells hg19 DNase-seq Pluripotent stem cell iPS cells SRX040379...,SRX040378,SRX135563,SRX040377,SRX040376,SRX189427,SRX189400,SRX189399 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/DNS.PSC.20.AllAg.iPS_cells.bed ...

  6. File list: DNS.PSC.10.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available DNS.PSC.10.AllAg.iPS_cells hg19 DNase-seq Pluripotent stem cell iPS cells SRX040379...,SRX040378,SRX040377,SRX040376,SRX135563,SRX189427,SRX189400,SRX189399 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/DNS.PSC.10.AllAg.iPS_cells.bed ...

  7. File list: Pol.PSC.05.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.PSC.05.AllAg.iPS_cells mm9 RNA polymerase Pluripotent stem cell iPS cells SRX97...7435,SRX027462,SRX977434 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Pol.PSC.05.AllAg.iPS_cells.bed ...

  8. File list: ALL.PSC.10.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.10.AllAg.iPS_cells hg19 All antigens Pluripotent stem cell iPS cells SRX753...09,SRX189400,SRX189399 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/ALL.PSC.10.AllAg.iPS_cells.bed ...

  9. File list: His.PSC.10.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.10.AllAg.iPS_cells mm9 Histone Pluripotent stem cell iPS cells SRX977417,SR...RX127372,SRX1090869,SRX127376,SRX035977,SRX146530,SRX146547,SRX146522 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.10.AllAg.iPS_cells.bed ...

  10. File list: Oth.PSC.20.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.PSC.20.AllAg.iPS_cells mm9 TFs and others Pluripotent stem cell iPS cells SRX97...RX146524 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.PSC.20.AllAg.iPS_cells.bed ...

  11. File list: DNS.PSC.05.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available DNS.PSC.05.AllAg.iPS_cells hg19 DNase-seq Pluripotent stem cell iPS cells SRX040379...,SRX040378,SRX040377,SRX040376,SRX135563,SRX189427,SRX189400,SRX189399 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/DNS.PSC.05.AllAg.iPS_cells.bed ...

  12. File list: His.PSC.20.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.20.AllAg.iPS_cells mm9 Histone Pluripotent stem cell iPS cells SRX127389,SR...RX127372,SRX127373,SRX1090869,SRX127376,SRX146530,SRX146522,SRX146547 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.20.AllAg.iPS_cells.bed ...

  13. Genomic imprinting is variably lost during reprogramming of mouse iPS cells.

    Science.gov (United States)

    Takikawa, Sachiko; Ray, Chelsea; Wang, Xin; Shamis, Yulia; Wu, Tien-Yuan; Li, Xiajun

    2013-09-01

    Derivation of induced pluripotent stem (iPS) cells is mainly an epigenetic reprogramming process. It is still quite controversial how genomic imprinting is reprogrammed in iPS cells. Thus, we derived multiple iPS clones from genetically identical mouse somatic cells. We found that parentally inherited imprint was variably lost among these iPS clones. Concurrent with the loss of DNA methylation imprint at the corresponding Snrpn and Peg3 imprinted regions, parental origin-specific expression of the Snrpn and Zim1 imprinted genes was also lost in these iPS clones. This loss of parental genomic imprinting in iPS cells was likely caused by the reprogramming process during iPS cell derivation because extended culture of iPS cells did not lead to significant increase in the loss of genomic imprinting. Intriguingly, one to several paternal chromosomes appeared to have acquired de novo methylation at the Snrpn and Zac1 imprinted regions in a high percentage of iPS clones. These results might have some implications for future therapeutic applications of iPS cells. Since DNA methylation imprint can be completely erased in some iPS clones at multiple imprinted regions, iPS cell reprogramming may also be employed to dissect the underlying mechanisms of erasure, reacquisition and maintenance of genomic imprinting in mammals. Copyright © 2013. Published by Elsevier B.V.

  14. File list: Oth.PSC.10.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.PSC.10.AllAg.iPS_cells mm9 TFs and others Pluripotent stem cell iPS cells SRX65...RX146524 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.PSC.10.AllAg.iPS_cells.bed ...

  15. File list: His.PSC.05.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.05.AllAg.iPS_cells mm9 Histone Pluripotent stem cell iPS cells SRX977417,SR...RX127374,SRX127373,SRX1090869,SRX333561,SRX146530,SRX146522,SRX146547 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/His.PSC.05.AllAg.iPS_cells.bed ...

  16. File list: ALL.PSC.10.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.10.AllAg.iPS_cells mm9 All antigens Pluripotent stem cell iPS cells SRX9774...30,SRX146524,SRX146547,SRX146522 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.PSC.10.AllAg.iPS_cells.bed ...

  17. File list: ALL.PSC.50.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.50.AllAg.iPS_cells mm9 All antigens Pluripotent stem cell iPS cells SRX9773...1,SRX035985,SRX1090869 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.PSC.50.AllAg.iPS_cells.bed ...

  18. File list: ALL.PSC.20.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.20.AllAg.iPS_cells mm9 All antigens Pluripotent stem cell iPS cells SRX9773...30,SRX146522,SRX146547 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.PSC.20.AllAg.iPS_cells.bed ...

  19. File list: His.PSC.20.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.20.AllAg.iPS_cells hg19 Histone Pluripotent stem cell iPS cells SRX110015,S...315,SRX381309 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.PSC.20.AllAg.iPS_cells.bed ...

  20. File list: Oth.PSC.05.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.PSC.05.AllAg.iPS_cells mm9 TFs and others Pluripotent stem cell iPS cells SRX65...RX146524 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Oth.PSC.05.AllAg.iPS_cells.bed ...

  1. File list: DNS.PSC.50.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available DNS.PSC.50.AllAg.iPS_cells hg19 DNase-seq Pluripotent stem cell iPS cells SRX040379...,SRX040378,SRX135563,SRX040376,SRX040377,SRX189427,SRX189400,SRX189399 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/DNS.PSC.50.AllAg.iPS_cells.bed ...

  2. Ser-261 phospho-regulation is involved in pS256 and pS269-mediated aquaporin-2 apical translocation.

    Science.gov (United States)

    Yui, Naofumi; Ando, Fumiaki; Sasaki, Sei; Uchida, Shinichi

    2017-08-26

    Vasopressin catalyzes aquaporin-2 phosphorylation at several serine sites in the C-terminal region. Compared with Ser-256 and Ser-269 phosphorylation, the role of Ser-261 phospho-regulation on vasopressin-regulated AQP2 apical translocation is largely unknown. In addition, recent discovery of transcytotic apical delivery of AQP2 made the concept of its intracellular trafficking even more complicated. In this study, we evaluated how intact phospho-AQP2 signals fit with the transcytosis trafficking model in Madin-Darby canine kidney cells. PS256 and pS269 signals were intracellularly detectable in wild-type AQP2 at the beginning of forskolin stimulation (1 min). These phospho-signals were detectable in basolateral membranes even after 10 min of stimulation. AQP2 stably inserted in the apical membrane increased pS269 and decreased pS261 signals. In an NDI-causing mutant P262L-AQP2, in which Ser-261 phospho-regulation is impaired, the pS256 and pS269 signals were detectable in the basolateral membranes with increased pS261 signals after forskolin stimulation. These results suggest that Ser-261 phospho-regulation is involved in pS256- and pS269-mediated AQP2 apical translocation. Copyright © 2017 Elsevier Inc. All rights reserved.

  3. Effects of collagen-induced rheumatoid arthritis on amyloidosis and microvascular pathology in APP/PS1 mice

    Directory of Open Access Journals (Sweden)

    Moon Gyeong

    2011-10-01

    Full Text Available Abstract Background Evidence suggests that rheumatoid arthritis (RA may enhance or reduce the progression of Alzheimer's disease (AD. The present study was performed to directly explore the effects of collagen-induced rheumatoid arthritis (CIA on amyloid plaque formation, microglial activation, and microvascular pathology in the cortex and hippocampus of the double transgenic APP/PS1 mouse model for AD. Wild-type or APP/PS1 mice that received type II collagen (CII in complete Freund's adjuvant (CFA at 2 months of age revealed characteristics of RA, such as joint swelling, synovitis, and cartilage and bone degradation 4 months later. Joint pathology was accompanied by sustained induction of IL-1β and TNF-α in plasma over 4 weeks after administration of CII in CFA. Results CIA reduced levels of soluble and insoluble amyloid beta (Aβ peptides and amyloid plaque formation in the cortex and hippocampus of APP/PS1 mice, which correlated with increased blood brain barrier disruption, Iba-1-positive microglia, and CD45-positive microglia/macrophages. In contrast, CIA reduced vessel density and length with features of microvascular pathology, including vascular segments, thinner vessels, and atrophic string vessels. Conclusions The present findings suggest that RA may exert beneficial effects against Aβ burden and harmful effects on microvascular pathology in AD.

  4. The Four-Tier Continuum of Academic and Behavioral Support (4T-CABS) Model: An Integrated Model for Medical Student Success.

    Science.gov (United States)

    Stegers-Jager, Karen M; Cohen-Schotanus, Janke; Themmen, Axel P N

    2017-11-01

    Not all students cope successfully with the demands of medical school, and students' struggles may result in study delay or dropout. To prevent these outcomes, medical schools need to identify students who are experiencing academic difficul ties and provide them with timely interventions through access to support programs. Although the importance of early identification and intervention is well recognized, less is known about successful strategies for identifying and supporting struggling students.Building on the literature and their own empirical findings, the authors propose an integrated, school-wide model for medical student success comprising a continuum of academic and behavioral support. This Four-Tier Continuum of Academic and Behavioral Support (4T-CABS) model focuses on improving both academic and behavioral outcomes by offering support for students at four levels, which range from adequate instruction for all, to targeted small-group interventions, to individualized support, and also include exit support for students who might be better off in another degree program. Additionally, medical schools should provide both academic and behavioral support; set high, yet realistic expectations and clearly communicate these to students; and intervene early, which requires timely identification of at-risk students who would benefit from the different types and tiers of support. Finally, interventions should be evidence based and fit the needs of the identified groups of students. The authors argue that adopting the core principles of the 4T-CABS model will enable medical schools to maximize academic engagement and performance for all students.

  5. Low frequency sound field control in rectangular listening rooms using CABS (Controlled Acoustic Bass System) will also reduce sound transmission to neighbor rooms

    DEFF Research Database (Denmark)

    Nielsen, Sofus Birkedal; Celestinos, Adrian

    2011-01-01

    from the rear wall, and thereby leaving only the plane wave in the room. With a room size of (7.8 x 4.1 x 2.8) m. it is possible to prevent modal frequencies up to 100 Hz. An investigation has shown that the sound transmitted to a neighbour room also will be reduced if CABS is used. The principle......Sound reproduction is often taking place in small and medium sized rectangular rooms. As rectangular rooms have 3 pairs of parallel walls the reflections at especially low frequencies will cause up to 30 dB spatial variations of the sound pressure level in the room. This will take place not only...... at resonance frequencies, but more or less at all frequencies. A time based room correction system named CABS (Controlled Acoustic Bass System) has been developed and is able to create a homogeneous sound field in the whole room at low frequencies by proper placement of multiple loudspeakers. A normal setup...

  6. Three-axial evaluation of whole-body vibration in agricultural telehandlers: The effects of an active cab-suspension system.

    Science.gov (United States)

    Caffaro, Federica; Preti, Christian; Micheletti Cremasco, Margherita; Cavallo, Eugenio

    2017-10-01

    Agricultural and earth-moving machinery operators are particularly exposed to whole-body vibration (WBV), which has severe effects on health and affects comfort and performance. Few studies have investigated vibrational safety and comfort issues in telescopic handlers. These vehicles are widespread in many off-road applications-such as construction, agriculture, and mining-used to handle loads and to lift persons and equipment. This study investigated the effects of an active hydro-pneumatic cab-suspension system fitted to a telehandler on a driver's vibration exposure along the x-, y-, and z-axes, through both objective and subjective assessments. Sixteen healthy professional telehandler drivers took part in the study. Objective measurements were acquired at the operator's seat, and subjective ratings were taken while participants drove the telehandler with either a deactivated or activated suspension system at 12 kph on an ISO 5008 smooth track. The results showed that the activation of the cab-suspension system reduced the root-mean-square acceleration along the x- and z-axes (p =.038 and p =.000, respectively). Moreover, the frequency analysis showed a reduction in the acceleration along the z-axis in the range of 2-25 Hz (p suspension systems are discussed.

  7. Acercamiento al proceso de socialización de la población infantil cabécar de chirripó

    Directory of Open Access Journals (Sweden)

    Watson Soto, Hannia

    2015-05-01

    Full Text Available Este artículo es producto de la investigación “Acercamiento al proceso de socialización de la población infantil cabécar de Chirripó”, que se desarrolló desde el Instituto de Investigación en Educación (INIE. La Universidad de Costa Rica como institución pública de educación superior, ha venido asumiendo la responsabilidad de contribuir a través de sus diferentes ámbitos de trabajo, en la resolución de necesidades de la comunidad nacional para la búsqueda de mejores condiciones de vida de todas las personas que la habitan, es así como en los últimos años ha generado reflexiones sobre la urgencia de generar procesos educativos con pertinencia cultural en las comunidades cabécares de Chirripó, este trabajo pretende aportar en este sentido. Para ello se recurre al estudio de los procesos de socialización de este grupo étnico para identificar las prácticas de crianza propias que les permiten construir y resignificar su identidad cultural, las cuales se concluye deben ser consideradas en la educación inicial formal para generar procesos educativos pertinentes y significativos.

  8. Low frequency sound field control in rectangular listening rooms using CABS (Controlled Acoustic Bass System) will also reduce sound transmission to neighbor rooms

    DEFF Research Database (Denmark)

    Nielsen, Sofus Birkedal; Celestinos, Adrian

    2011-01-01

    at resonance frequencies, but more or less at all frequencies. A time based room correction system named CABS (Controlled Acoustic Bass System) has been developed and is able to create a homogeneous sound field in the whole room at low frequencies by proper placement of multiple loudspeakers. A normal setup......Sound reproduction is often taking place in small and medium sized rectangular rooms. As rectangular rooms have 3 pairs of parallel walls the reflections at especially low frequencies will cause up to 30 dB spatial variations of the sound pressure level in the room. This will take place not only...... from the rear wall, and thereby leaving only the plane wave in the room. With a room size of (7.8 x 4.1 x 2.8) m. it is possible to prevent modal frequencies up to 100 Hz. An investigation has shown that the sound transmitted to a neighbour room also will be reduced if CABS is used. The principle...

  9. The novel dopamine D3 receptor antagonists/partial agonists CAB2-015 and BAK4-54 inhibit oxycodone-taking and oxycodone-seeking behavior in rats.

    Science.gov (United States)

    You, Zhi-Bing; Gao, Jun-Tao; Bi, Guo-Hua; He, Yi; Boateng, Comfort; Cao, Jianjing; Gardner, Eliot L; Newman, Amy Hauck; Xi, Zheng-Xiong

    2017-11-01

    The use of prescription opioid analgesics, particularly oxycodone, has dramatically increased, and parallels escalated opioid abuse and drug-related deaths worldwide. Understanding the molecular mechanisms underlying the development of opioid dependence and expanding treatment options to counter prescription opioid abuse has become a critical public health matter. In the present study, we first evaluated the reinforcing effects of oxycodone in a rat model of self-administration and then explored the potential utility of two novel high affinity dopamine D3 receptor (D3R) antagonists/partial agonists, CAB2-015 and BAK4-54, for treatment of prescription opioid abuse and dependence. We found that rats acquired oxycodone self-administration rapidly within a range of unit doses that was similar to that for heroin, confirming that oxycodone has significant abuse potential. Strikingly, pretreatment with either CAB2-015 or BAK4-54 (0.4-10 mg/kg, i.p.) dose-dependently decreased oxycodone self-administration, and shifted the oxycodone dose-response curve downward. Repeated pretreatment with CAB2-015 or BAK4-54 (0.4-4 mg/kg) facilitated extinction and inhibited oxycodone-induced reinstatement of drug-seeking behavior. In addition, pretreatment with CAB2-015 or BAK4-54 (4-10 mg/kg) also dose-dependently decreased oxycodone-enhanced locomotor activity, but only CAB2-015 decreased oral sucrose self-administration. These data suggest that D3R antagonists may be suitable alternatives or adjunctive to opioid-based medications currently used clinically in treating opioid addiction and that the D3R-selective ligands (CAB2-015 or BAK4-54) provide new lead molecules for development. Published by Elsevier Ltd.

  10. Create and Publish a Hierarchical Progressive Survey (HiPS)

    Science.gov (United States)

    Fernique, P.; Boch, T.; Pineau, F.; Oberto, A.

    2014-05-01

    Since 2009, the CDS promotes a method for visualizing based on the HEALPix sky tessellation. This method, called “Hierarchical Progressive Survey" or HiPS, allows one to display a survey progressively. It is particularly suited for all-sky surveys or deep fields. This visualization method is now integrated in several applications, notably Aladin, the SiTools/MIZAR CNES framework, and the recent HTML5 “Aladin Lite". Also, more than one hundred surveys are already available in this view mode. In this article, we will present the progress concerning this method and its recent adaptation to the astronomical catalogs such as the GAIA simulation.

  11. Electrostatic septum for "Continuous Transfer" from PS to SPS

    CERN Multimedia

    CERN PhotoLab

    1982-01-01

    For "Continuous Transfer" to the SPS, the PS beam, after acceleration, is peeled off in 5 turns. To minimize losses, the magnetic septa are preceded by an electrostatic septum in straight section 31. We see the inner part of it, on a lab-bench. The first part consists of W-wires, the second part is a Mo-foil. The circulating beam passes through the opening, the ejected beam at the outside (above the wires, in this picture). This assembly is the anode-part, the cathode is not shown.

  12. Beam Quality Preservation in the CERN PS-SPS Complex

    CERN Multimedia

    Arduini, Gianluigi

    2004-01-01

    The LHC will require beams of unprecedented transverse and longitudinal brightness. Their production imposes tight constraints on the emittance growth in each element of the LHC injector chain, namely the PS-SPS Accelerator Complex. The problems encountered at the different stages of the acceleration in the complex span a wide range of topics, such as injection matching, RF gymnastics, space charge, transverse and longitudinal single- and coupled-bunch instabilities, and electron cloud effects. The measurement techniques developed and applied to identify and study the various sources of emittance dilution to the high precision required for the LHC beams and the solutions found to control such phenomena are illustrated.

  13. Lo irreductible social y lo irreductible psíquico

    Directory of Open Access Journals (Sweden)

    Vincent Gaulejac, de

    2017-06-01

    Full Text Available Con base en la reconstrucción de las polaridades explicativas -lo irreductible social y lo irreductible psíquico-que atraviesan a las ciencias sociales, este texto propone trascender los modelos antagónicos y excluyentes. El objetivo es instaurar en el centro de la reflexión la idea de la dialktica existencial que restituye al sujeto tanto el contexto socio-histórico en el cual está localizado como el deseo y la singularidad que lo constituyen en productor de la afirmación de su individualidad y su historicidad.

  14. PS potential performance with a higher injection energy

    CERN Document Server

    Gilardoni, S; Borburgh, J; Bodart, D; Chiggiato, P; Damerau, H; Hancock, S; Metral, G; Pittet, S; Rossi, C; Rumolo, G; Steerenberg, R; Widorski, M

    2011-01-01

    In the context of the LHC Injectors upgrade project, the PS has to be brought up to − and to operate reliably at − the level of performance required by the HL-LHC until the end of the LHC lifetime. The study has started on the potential benefits of increasing the injection energy. An overview of the impact of this upgrade will be presented, with a preliminary estimate of the beam characteristics at the SPS entrance and the remaining performance limitations. The necessary hardware modifications will be described, highlighting the critical systems and the risks. The program for the 2011 machine studies and hardware interventions for refining these plans will be presented.

  15. Injection and transfer lines of the PS Booster

    CERN Multimedia

    Photographic Service

    1972-01-01

    In the foreground is the vacuum chamber for the 50 MeV proton beam coming from the Linac. The tank held by white frames houses the "Vertical Distributor", which deflects the Linac beam to the levels of the Booster's 4 superposed rings. After acceleration in the Booster, originally to 800 MeV, today to 1.4 GeV, the beams from the 4 rings are combined in the vertical plane and transfered to the 26 GeV PS. The "Recombination Line", intersecting the injection line, crosses the picture from left to right.

  16. Search for Decays of Heavy Neutrinos with the PS Beam

    CERN Multimedia

    2002-01-01

    The experiment searches for neutrino decay, primarily into the e|+e|-@n^e and @g@g@n^e modes. Neutrino masses in the region between 1 and 400~MeV will be explored. The beam used is the neutrino PS beam used for the oscillation experiments. The apparatus consists of a decay volume @=30~m long and a calorimeter @=8~radiation lengths thick and @=20~m|2 in surface. The detectors are flash-tube modules of the type developed at Saclay for the proton-stability experiment. Scintillator hodoscopes give the timing information necessary for the trigger logic and background rejection.

  17. Reliability and maintenance analysis of the CERN PS booster

    CERN Document Server

    Staff, P S B

    1977-01-01

    The PS Booster Synchrotron being a complex accelerator with four superposed rings and substantial additional equipment for beam splitting and recombination, doubts were expressed at the time of project authorization as to its likely operational reliability. For 1975 and 1976, the average down time was 3.2% (at least one ring off) or 1.5% (all four rings off). The items analysed are: operational record, design features, maintenance, spare parts policy, operating temperature, effects of thunderstorms, fault diagnostics, role of operations staff and action by experts. (15 refs).

  18. Viscometric characterization of PS/POSS hybrid nanocomposites

    OpenAIRE

    Bianchi, Otávio; Repenning, Gustavo B.; Mauler, Raquel S.; Oliveira, Ricardo V. B.; Canto, Leonardo B.

    2012-01-01

    Nanocompósitos híbridos de poliestireno (PS) e poliedros oligoméricos silsesquioxanos (POSS) com diferentes composições e graus de hibridização foram obtidos por processamento reativo no estado fundido utilizando-se peróxido de dicumila (DCP) como iniciador, na presença ou não de estireno como agente de transferência de radical. Os materiais foram caracterizados viscosimetricamente por cromatografia de permeação em gel (GPC) usando detecção tripla por espalhamento de luz, viscosimetria e índi...

  19. A multiturn measurement system for the CERN PS

    CERN Document Server

    Angoletta, Maria Elena

    2002-01-01

    Multiturn beam position measurements on one or more pickups provide very important information needed to derive machine optics parameters. A variety of analyses is possible, such as determination of phase advance, detuning with amplitude, and most important, the exploration of phase space. In this paper we present a new multiturn acquisition system for the CERN proton synchrotron (CERN PS) based on a compact PCI fast digitiser and a new general object-oriented visualisation and analysis tool for the acquired multiturn data. (11 refs).

  20. TRPV-1-mediated elimination of residual iPS cells in bioengineered cardiac cell sheet tissues

    Science.gov (United States)

    Matsuura, Katsuhisa; Seta, Hiroyoshi; Haraguchi, Yuji; Alsayegh, Khaled; Sekine, Hidekazu; Shimizu, Tatsuya; Hagiwara, Nobuhisa; Yamazaki, Kenji; Okano, Teruo

    2016-01-01

    The development of a suitable strategy for eliminating remaining undifferentiated cells is indispensable for the use of human-induced pluripotent stem (iPS) cell-derived cells in regenerative medicine. Here, we show for the first time that TRPV-1 activation through transient culture at 42 °C in combination with agonists is a simple and useful strategy to eliminate iPS cells from bioengineered cardiac cell sheet tissues. When human iPS cells were cultured at 42 °C, almost all cells disappeared by 48 hours through apoptosis. However, iPS cell-derived cardiomyocytes and fibroblasts maintained transcriptional and protein expression levels, and cardiac cell sheets were fabricated after reducing the temperature. TRPV-1 expression in iPS cells was upregulated at 42 °C, and iPS cell death at 42 °C was TRPV-1-dependent. Furthermore, TRPV-1 activation through thermal or agonist treatment eliminated iPS cells in cardiac tissues for a final concentration of 0.4% iPS cell contamination. These findings suggest that the difference in tolerance to TRPV-1 activation between iPS cells and iPS cell-derived cardiac cells could be exploited to eliminate remaining iPS cells in bioengineered cell sheet tissues, which will further reduce the risk of tumour formation. PMID:26888607

  1. TRPV-1-mediated elimination of residual iPS cells in bioengineered cardiac cell sheet tissues.

    Science.gov (United States)

    Matsuura, Katsuhisa; Seta, Hiroyoshi; Haraguchi, Yuji; Alsayegh, Khaled; Sekine, Hidekazu; Shimizu, Tatsuya; Hagiwara, Nobuhisa; Yamazaki, Kenji; Okano, Teruo

    2016-02-18

    The development of a suitable strategy for eliminating remaining undifferentiated cells is indispensable for the use of human-induced pluripotent stem (iPS) cell-derived cells in regenerative medicine. Here, we show for the first time that TRPV-1 activation through transient culture at 42 °C in combination with agonists is a simple and useful strategy to eliminate iPS cells from bioengineered cardiac cell sheet tissues. When human iPS cells were cultured at 42 °C, almost all cells disappeared by 48 hours through apoptosis. However, iPS cell-derived cardiomyocytes and fibroblasts maintained transcriptional and protein expression levels, and cardiac cell sheets were fabricated after reducing the temperature. TRPV-1 expression in iPS cells was upregulated at 42 °C, and iPS cell death at 42 °C was TRPV-1-dependent. Furthermore, TRPV-1 activation through thermal or agonist treatment eliminated iPS cells in cardiac tissues for a final concentration of 0.4% iPS cell contamination. These findings suggest that the difference in tolerance to TRPV-1 activation between iPS cells and iPS cell-derived cardiac cells could be exploited to eliminate remaining iPS cells in bioengineered cell sheet tissues, which will further reduce the risk of tumour formation.

  2. [Induced pluripotent stem (iPS) cell - issues for clinical application - ].

    Science.gov (United States)

    Aoi, Takashi

    2013-01-01

    Induced pluripotent stem (iPS) cells are generated from somatic cells by introducing small sets of transcription factors. iPS cells demonstrate pluripotency and the ability to self-renew. In addition, iPS cells can be generated from donor individuals with particular characteristics. Based on these features, iPS cells are expected to be applicable in drug discovery, the study of disease mechanisms and cell therapy. From a technical point of view, "diversity" is the key word. At present, iPS cells can be derived using various techniques, resulting in diversity in the quality of iPS cells generated. Therefore, optimization of the derivation technology is one of the most important issues. Another "diversity" is in the propensities amongst iPS cell lines derived using similar techniques. Thus, strategies for selecting good quality lines remain to be established. Considering such technical hurdles, establishment of an iPS cell bank consisting of high quality and versatile iPS lines is a promising idea because of the merits of cost and quality control. Now, we are exploring relevant parameters for the quality control of banked cells. The challenges facing clinical application of iPS cells are new but not unprecedented. To realize clinical applications of iPS cells, we need to make these challenges clear and overcome them through partnership not only with industry, governments and universities, but also patients and society at large.

  3. Methods for iPS cell generation for basic research and clinical applications.

    Science.gov (United States)

    Mochiduki, Yuji; Okita, Keisuke

    2012-06-01

    The induction of pluripotency can be achieved by forced expression of defined factors in somatic cells. The established cells, termed induced pluripotent stem (iPS) cells, have pluripotency and an infinite capacity for self-renewal in common with embryonic stem (ES) cells. Patient-specific iPS cells could be a useful source for drug discovery and cell transplantation therapies; however, the original method for iPS cell generation had several issues that were obstacles to their clinical application. Recent studies have brought about various improvements for iPS cell generation and uncovered several characteristics of iPS cells. Here we summarize the current status of iPS cell studies, with a focus on the improved methods that can be used to generate iPS cells, and also refer to the future challenges. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  4. Properties of Extruded PS-212 Type Self-Lubricating Materials

    Science.gov (United States)

    Waters, W. J.; Sliney, H. E.; Soltis, R. F.

    1993-01-01

    Research has been underway at the NASA Lewis Research Center since the 1960's to develop high temperature, self-lubricating materials. The bulk of the research has been done in-house by a team of researchers from the Materials Division. A series of self-lubricating solid material systems has been developed over the years. One of the most promising is the composite material system referred to as PS-212 or PM-212. This material is a powder metallurgy product composed of metal bonded chromium carbide and two solid lubricating materials known to be self-lubricating over a wide temperature range. NASA feels this material has a wide potential in industrial applications. Simplified processing of this material would enhance its commercial potential. Processing changes have the potential to reduce processing costs, but tribological and physical properties must not be adversely affected. Extrusion processing has been employed in this investigation as a consolidation process for PM-212/PS-212. It has been successful in that high density bars of EX-212 (extruded PM-212) can readily be fabricated. Friction and strength data indicate these properties have been maintained or improved over the P.M. version. A range of extrusion temperatures have been investigated and tensile, friction, wear, and microstructural data have been obtained. Results indicate extrusion temperatures are not critical from a densification standpoint, but other properties are temperature dependent.

  5. Phase morphological study on SEBS compatibilized PS/LDPE blends

    Directory of Open Access Journals (Sweden)

    Chatchai Kunyawut

    2014-09-01

    Full Text Available The co-continuous phase morphology of polystyrene (PS/low density polyethylene (LDPE blends compatibilized with poly(styrene-block-ethylene/butylene-block-styrene triblock copolymers (SEBS with varying molecular weights has been investigated. The blend samples were prepared in a mini-twin screw extruder. The barrel length and diameter are 224 and 16 mm, respectively. The diameter of the capillary die is 1 mm. The concentration of the blends was 70/30 wt% of PS/LDPE while that of the SEBS used was 5 wt% of the blend. The mixing temperatures used were 180, 250, and 280o C, and a screw speed of 60 rpm. The morphology of the blends was investigated using an AFM technique. Average droplet diameters of the blend samples were determined using an OM technique. The co-continuous morphology has not been obtained in all the blends, although the mixing temperature used is as high as 280o C. The experimental results indicated that the model prediction of the co-continuous morphology proposed by Willemse and co-worker was not applicable to the blend systems studied. Only droplet-type dispersion was observed. This is considered to arise from the processing conditions and the mixing device used. The blend compatibilized with the high molecular weight SEBS had higher dispersed phase size than that of the blend compatibilized with the medium and low molecular weight SEBSs. This behaviour is likely to arise from coalescence during melt processing.

  6. Preparations for Upgrading the RF Systems of the PS Booster

    CERN Document Server

    Albright, Simon; Shaposhnikova, Elena

    2016-01-01

    The accelerators of the LHC injector chain need to be upgraded to provide the HL-LHC beams. The PS Booster, the first synchrotron in the LHC injection chain, uses three different RF systems (first, second and up to tenth harmonic) in each of its four rings. As part of the LHC Injector Upgrade the current ferrite RF systems will be replaced with broadband Finemet cavities, increasing the flexibility of the RF system. A Finemet test cavity has been installed in Ring 4 to investigate its effect on machine performance, especially beam stability, during extensive experimental studies. Due to large space charge impedance Landau damping is lost through most of the cycle in single harmonic operation, but is recovered when using the second harmonic and controlled longitudinal emittance blow-up. This paper compares beam parameters during acceleration with and without the Finemet test cavity. Comparisons were made using beam measurements and simulations with the BLonD code based on a full PS Booster impedance model. Thi...

  7. KSR-based medium improves the generation of high-quality mouse iPS cells.

    Science.gov (United States)

    Liu, Kai; Wang, Fang; Ye, Xiaoying; Wang, Lingling; Yang, Jiao; Zhang, Jingzhuo; Liu, Lin

    2014-01-01

    Induced pluripotent stem (iPS) cells from somatic cells have great potential for regenerative medicine. The efficiency in generation of iPS cells has been significantly improved in recent years. However, the generation of high-quality iPS cells remains of high interest. Consistently, we demonstrate that knockout serum replacement (KSR)-based medium accelerates iPS cell induction and improves the quality of iPS cells, as confirmed by generation of chimeras and all iPS cell-derived offspring with germline transmission competency. Both alkaline phosphatase (AP) activity assay and expression of Nanog have been used to evaluate the efficiency of iPS cell induction and formation of ES/iPS cell colonies; however, appropriate expression of Nanog frequently indicates the quality of ES/iPS cells. Interestingly, whereas foetal bovine serum (FBS)-based media increase iPS cell colony formation, as revealed by AP activity, KSR-based media increase the frequency of iPS cell colony formation with Nanog expression. Furthermore, inhibition of MAPK/ERK by a specific inhibitor, PD0325901, in KSR- but not in FBS-based media significantly increases Nanog-GFP+ iPS cells. In contrast, addition of bFGF in KSR-based media decreases proportion of Nanog-GFP+ iPS cells. Remarkably, PD can rescue Nanog-GFP+ deficiency caused by bFGF. These data suggest that MAPK/ERK pathway influences high quality mouse iPS cells and that KSR- and PD-based media could enrich homogeneous authentic pluripotent stem cells.

  8. Prognostic significance of tumour burden in Hodgkin's disease PS I and II

    DEFF Research Database (Denmark)

    Specht, L; Nissen, N I

    1986-01-01

    of infradiaphragmatic lymph nodes), while the other 47 had been treated with mantle field irradiation plus 6 cycles of combination chemotherapy (MOPP or an equivalent regimen). Of the patients treated with radiotherapy alone, 13 relapsed whereas only 1 of the patients treated with radiotherapy plus combination...... chemotherapy relapsed. The initial tumour burden of each patient was estimated, combining tumour size of each involved area and number of sites involved. For patients treated with radiotherapy alone, a large tumour burden singled out the patients destined to relapse more accurately than other prognostic...

  9. MicroRNA expression profiles of human iPS cells, retinal pigment epithelium derived from iPS, and fetal retinal pigment epithelium.

    Science.gov (United States)

    Greene, Whitney A; Muñiz, Alberto; Plamper, Mark L; Kaini, Ramesh R; Wang, Heuy-Ching

    2014-06-24

    The objective of this report is to describe the protocols for comparing the microRNA (miRNA) profiles of human induced-pluripotent stem (iPS) cells, retinal pigment epithelium (RPE) derived from human iPS cells (iPS-RPE), and fetal RPE. The protocols include collection of RNA for analysis by microarray, and the analysis of microarray data to identify miRNAs that are differentially expressed among three cell types. The methods for culture of iPS cells and fetal RPE are explained. The protocol used for differentiation of RPE from human iPS is also described. The RNA extraction technique we describe was selected to allow maximal recovery of very small RNA for use in a miRNA microarray. Finally, cellular pathway and network analysis of microarray data is explained. These techniques will facilitate the comparison of the miRNA profiles of three different cell types.

  10. Comparison of implosion core metrics: A 10 ps dilation X-ray imager vs a 100 ps gated microchannel plate

    Science.gov (United States)

    Nagel, S. R.; Benedetti, L. R.; Bradley, D. K.; Hilsabeck, T. J.; Izumi, N.; Khan, S.; Kyrala, G. A.; Ma, T.; Pak, A.

    2016-11-01

    The dilation x-ray imager (DIXI) [T. J. Hilsabeck et al., Rev. Sci. Instrum. 81, 10E317 (2010); S. R. Nagel et al., ibid. 83, 10E116 (2012); S. R. Nagel et al., ibid. 85, 11E504 (2014)] is a high-speed x-ray framing camera that uses the pulse-dilation technique to achieve a temporal resolution of less than 10 ps. This is a 10 × improvement over conventional framing cameras currently employed on the National Ignition Facility (NIF) (100 ps resolution), and otherwise only achievable with 1D streaked imaging. A side effect of the dramatically reduced gate width is the comparatively lower detected signal level. Therefore we implement a Poisson noise reduction with non-local principal component analysis method [J. Salmon et al., J. Math. Imaging Vision 48, 279294 (2014)] to improve the robustness of the DIXI data analysis. Here we present results on ignition-relevant experiments at the NIF using DIXI. In particular we focus on establishing that/when DIXI gives reliable shape metrics (P0, P2, and P4 Legendre modes, and their temporal evolution/swings).

  11. Role of insulin receptor and insulin signaling on αPS2CβPS integrins' lateral diffusion.

    Science.gov (United States)

    Mainali, Dipak; Syed, Aleem; Arora, Neha; Smith, Emily A

    2014-12-01

    Integrins are ubiquitous transmembrane receptors with adhesion and signaling properties. The influence of insulin receptor and insulin signaling on αPS2CβPS integrins' lateral diffusion was studied using single particle tracking in S2 cells before and after reducing the insulin receptor expression or insulin stimulation. Insulin signaling was monitored by Western blotting for phospho-Akt expression. The expression of the insulin receptor was reduced using RNA interference (RNAi). After insulin receptor RNAi, four significant changes were measured in integrin diffusion properties: (1) there was a 24% increase in the mobile integrin population, (2) 14% of the increase was represented by integrins with Brownian diffusion, (3) for integrins that reside in confined zones of diffusion, there was a 45% increase in the diameter of the confined zone, and (4) there was a 29% increase in the duration integrins spend in confined zones of diffusion. In contrast to reduced expression of the insulin receptor, which alters integrin diffusion properties, insulin stimulation alone or insulin stimulation under conditions of reduced insulin receptor expression have minimal effects on altering the measured integrin diffusion properties. The differences in integrin diffusion measured after insulin receptor RNAi in the presence or absence of insulin stimulation may be the result of other insulin signaling pathways that are activated at reduced insulin receptor conditions. No change in the average integrin diffusion coefficient was measured for any conditions included in this study.

  12. Characterization of Dye-decolorizing Peroxidase (DyP) from Thermomonospora curvata Reveals Unique Catalytic Properties of A-type DyPs.

    Science.gov (United States)

    Chen, Chao; Shrestha, Ruben; Jia, Kaimin; Gao, Philip F; Geisbrecht, Brian V; Bossmann, Stefan H; Shi, Jishu; Li, Ping

    2015-09-18

    Dye-decolorizing peroxidases (DyPs) comprise a new family of heme peroxidases, which has received much attention due to their potential applications in lignin degradation. A new DyP from Thermomonospora curvata (TcDyP) was identified and characterized. Unlike other A-type enzymes, TcDyP is highly active toward a wide range of substrates including model lignin compounds, in which the catalytic efficiency with ABTS (kcat(app)/Km(app) = (1.7 × 10(7)) m(-1) s(-1)) is close to that of fungal DyPs. Stopped-flow spectroscopy was employed to elucidate the transient intermediates as well as the catalytic cycle involving wild-type (wt) and mutant TcDyPs. Although residues Asp(220) and Arg(327) are found necessary for compound I formation, His(312) is proposed to play roles in compound II reduction. Transient kinetics of hydroquinone (HQ) oxidation by wt-TcDyP showed that conversion of the compound II to resting state is a rate-limiting step, which will explain the contradictory observation made with the aspartate mutants of A-type DyPs. Moreover, replacement of His(312) and Arg(327) has significant effects on the oligomerization and redox potential (E°') of the enzyme. Both mutants were found to promote the formation of dimeric state and to shift E°' to a more negative potential. Not only do these results reveal the unique catalytic property of the A-type DyPs, but they will also facilitate the development of these enzymes as lignin degraders. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.

  13. Characterization of Dye-decolorizing Peroxidase (DyP) from Thermomonospora curvata Reveals Unique Catalytic Properties of A-type DyPs*

    Science.gov (United States)

    Chen, Chao; Shrestha, Ruben; Jia, Kaimin; Gao, Philip F.; Geisbrecht, Brian V.; Bossmann, Stefan H.; Shi, Jishu; Li, Ping

    2015-01-01

    Dye-decolorizing peroxidases (DyPs) comprise a new family of heme peroxidases, which has received much attention due to their potential applications in lignin degradation. A new DyP from Thermomonospora curvata (TcDyP) was identified and characterized. Unlike other A-type enzymes, TcDyP is highly active toward a wide range of substrates including model lignin compounds, in which the catalytic efficiency with ABTS (kcatapp/Kmapp = (1.7 × 107) m−1 s−1) is close to that of fungal DyPs. Stopped-flow spectroscopy was employed to elucidate the transient intermediates as well as the catalytic cycle involving wild-type (wt) and mutant TcDyPs. Although residues Asp220 and Arg327 are found necessary for compound I formation, His312 is proposed to play roles in compound II reduction. Transient kinetics of hydroquinone (HQ) oxidation by wt-TcDyP showed that conversion of the compound II to resting state is a rate-limiting step, which will explain the contradictory observation made with the aspartate mutants of A-type DyPs. Moreover, replacement of His312 and Arg327 has significant effects on the oligomerization and redox potential (E°′) of the enzyme. Both mutants were found to promote the formation of dimeric state and to shift E°′ to a more negative potential. Not only do these results reveal the unique catalytic property of the A-type DyPs, but they will also facilitate the development of these enzymes as lignin degraders. PMID:26205819

  14. Hydrogen sulfide down-regulates BACE1 and PS1 via activating PI3K/Akt pathway in the brain of APP/PS1 transgenic mouse.

    Science.gov (United States)

    He, Xuan-Li; Yan, Ning; Chen, Xiao-Shan; Qi, Yun-Wen; Yan, Yong; Cai, Zhiyou

    2016-10-01

    Endogenous hydrogen sulfide (H2S) may have multiple physiological functions in brain. Our previous study showed that H2S improved spatial memory impairment and decreased the production of Aβ in APP/PS1 transgenic mice. However, many of the underlying mechanisms are not still being elucidated. The aim of the present study is to investigate the neuroprotective mechanisms of H2S involving in the activity of β-secretase (BACE1), γ-secretase (PS1) and α-secretase (ADAM17). Morris water maze was used to measure the behavior change. The levels of Aβ40 and Aβ42 were quantified using colorimetric ELISA kits and immunohistochemical analysis. The levels of BACE1, PS1, ADAM17, pAkt, pp38MAPK, pERK and pJNK were tested by Western blot analysis in normal mice, APP/PS1 transgenic mice and 50μmol/kg-NaHS-treated transgenic mice. On the basis of exogenous H2S treatment, LY294002 (inhibitors of PI3K/Akt) or PD98059 (inhibitors of MAPK/ERK) was injected into lateral cerebral ventricle. The levels of BACE1, PS1 and pp38MAPK were increased and ADAM17 were decreased in the APP/PS1 transgenic mice. After intraperitoneal administration of an H2S donor (NaHS) into APP/PS1 mice, the levels of BACE1, PS1 and pp38MAPK were reduced and ADAM17 increased. The level of pp38 MAPKs, pAkt and pERK1/2 was increased in APP/PS1 transgenic mice compared with normal mice (ptransgenic mice and normal mice (p>0.05). These results demonstrated that LY294002 inhibited the effect of H2S on decreasing the BACE1 and PS1, reducing the level of Aβ and improving memory impairment in APP/PS1 transgenic mice. PD98059 had no influence on the expression of BACE1 and PS1. H2S inhibits the expression of BACE1 and PS1 by activating PI3K/Akt pathway in AD. Copyright © 2016 Institute of Pharmacology, Polish Academy of Sciences. Published by Elsevier Urban & Partner Sp. z o.o. All rights reserved.

  15. Environmental pH and the requirement for the extrinsic proteins of Photosystem II in the function of cyanobacterial photosynthesis

    Directory of Open Access Journals (Sweden)

    Jaz N Morris

    2016-08-01

    Full Text Available In one of the final stages of cyanobacterial Photosystem II (PS II assembly, binding of up to four extrinsic proteins to PS II stabilizes the oxygen-evolving complex (OEC. Growth of cyanobacterial mutants deficient in certain combinations of these thylakoid-lumen-associated polypeptides is sensitive to changes in environmental pH, despite the physical separation of the membrane-embedded PS II complex from the external environment. In this perspective, we discuss the effect of environmental pH on OEC function and photoautotrophic growth in cyanobacteria, with reference to pH-sensitive PS II mutants lacking extrinsic proteins. We consider the possibilities that, compared to pH 10.0, pH 7.5 increases susceptibility to PS II-generated reactive oxygen species (ROS, causing photoinhibition and reducing PS II assembly in some mutants and that perturbations to channels in the lumenal regions of PS II might alter the accessibility of water to the active site, and egress of oxygen and protons to the thylakoid lumen. Reduced levels of PS II in these mutants and reduced OEC activity arising from the disruption of substrate/product channels could reduce the trans-thylakoid pH gradient (ΔpH, leading to the impairement of photosynthesis. Growth of some PS II mutants at pH 7.5 can be rescued by elevating CO2 levels, suggesting that the pH-sensitive phenotype might primarily be an indirect result of back-pressure in the electron transport chain that results in heightened production of ROS by the impaired photosystem.

  16. Development and characterization of sub-100 ps photomultiplier tubes.

    Science.gov (United States)

    Horsfield, C J; Rubery, M S; Mack, J M; Young, C S; Herrmann, H W; Caldwell, S E; Evans, S C; Sedilleo, T J; Kim, Y H; McEvoy, A; Milnes, J S; Howorth, J; Davis, B; O'Gara, P M; Garza, I; Miller, E K; Stoeffl, W; Ali, Z

    2010-10-01

    We describe the evaluation of a microchannel plate (MCP) photomultiplier tube (PMT), incorporating a 3 μm pore MCP and constant voltage anode and cathode gaps. The use of the small pore size results in PMTs with response functions of the order of 85 ps full-width-half-maximum, while the constant electric field across the anode and cathode gaps produces a uniform response function over the entire operating range of the device. The PMT was characterized on a number of facilities and employed on gas Cherenkov detectors fielded on various deuterium tritium fuel (DT) implosions on the Omega Laser Facility at the University of Rochester. The Cherenkov detectors are part of diagnostic development to measure Gamma ray reaction history for DT implosions on the National Ignition Facility.

  17. An Antiproton Decelerator in the CERN PS Complex

    CERN Document Server

    Riunaud, J P; Baird, S A; Boillot, J; Bosser, Jacques; Brouet, M; Caspers, Friedhelm; Chanel, M; Chohan, V; Eriksson, T; Garoby, R; Giannini, R; Giovannozzi, Massimo; Gruber, J; Hémery, J Y; Koziol, Heribert; MacCaferri, R; Maury, S; Metzmacher, K D; Möhl, D; Mulder, H; Pedersen, F; Perriollat, F; Poncet, Alain; Riunaud, J P; Serre, C; Simon, Daniel Jean; Tranquille, G; Tuyn, Jan Willem Nicolaas; Williams, B; Williams, D J

    1996-01-01

    The present CERN PS low-energy antiproton complex involves 4 machines to collect, cool, decelerate and supply experiments with up to 1010 antiprotons per pulse and per hour of momenta ranging from 0.1 to 2 GeV/c. In view of a possible future physics programme requiring low energy antiprotons, mainly to carry out studies on antihydrogen, a simplified scheme providing at low cost antiprotons at 100 MeV/c has been studied. It requires only one machine, the present Antiproton Collector (AC) converted into a cooler and decelerator (Antiproton Decelerator, AD) and delivering beam to experiments in the hall of the present Antiproton Accumulator Complex (AAC) [1]. This paper describes the feasibility study of such a scheme [2].

  18. MD on Head-Tail Instability in the PS Booster

    CERN Document Server

    Kornilov, V; Mikulec, B; Aumon, S; Rumolo, G

    2013-01-01

    Machine study experiments on the coherent instabilities appearing along the magnetic ramp have been performed at the CERN PS Booster synchrotron in the week of June 11-15, 2012. The space- and time structure of the head-tail instabilities was recorded by the triggered pick-up signals due to reproducibility of the occurrence time in the shot-by-shot sense. The intensity thresholds, the absolute growth rates and the mode structure have been compared for the bunches in the single-rf and in three types of the double-rf operation. The growth rates are compared to the instantaneous synchrotron frequencies, in the cases of the large corresponding ratio the head-tail mode structure is deformed by the driving impedance. Bunch parameters measurements indicate that the PSB bunches are in the regime of very strong transverse space-charge all along the magnetic ramp.

  19. Migrating the CERN PS control system to IBM workstations

    CERN Document Server

    De Metz-Noblat, N

    1995-01-01

    The workstations used within the control system of the CERN PS accelerator complex are not produced any more. We had therefore to review the software primary used as user interface and we achieved a port to IBM workstations. We are also preparing the maintenance of this code for the next ten years with minimal staff. This implies a clear separation between general computing facilities, control system developments, and operation. In order to share our experience, we will try to summarize various aspects of this migration: - system installation principles used to speed-up error recovery time and long-term maintenance costs, - problems correlated with the coexistence of two different platforms during migration, - software problems due to the platform and operating system changes, - hidden dependencies from a specific manufacturer.

  20. Multipole Stack for the 800 MeV PS Booster

    CERN Multimedia

    1975-01-01

    The 800 MeV PS Booster had seen first beam in its 4 superposed rings in 1972, routine operation began in 1973. In the strive for ever higher beam intensities, the need for additional multipole lenses became evident. After detailed studies, the manufacture of 8 stacks of multipoles was launched in 1974. Each stack consists of 4 superposed multipoles and each multipole has 4 concentric shells. From the innermost to the outermost shell, Type A contains octupole, skew-octupole, sextupole, skew-sextupole. Type B contains skew-octupole, skew-sextupole, vertical dipole, horizontal dipole. Completion of installation in 1976 opened the way to higher beam intensities. M. Battiaz is seen here with a multipole stack and its many electrical connections.

  1. First PS magnet unit, with members of the Magnet Group.

    CERN Multimedia

    CERN PhotoLab

    1956-01-01

    Members of the Magnet Group, sitting atop the first unit of the PS combined-function magnet. The picture was taken at the Institute of Physics of Geneva University, as CERN was still a muddy construction site at that time. All these people have now retired, but all of the magnets are still pulsing away. Front row (left to right): R.Tinguely, C.Germain, G.Plass, D.Neet, B.de Raad, M.Cavallaro, K.H.Reich, G.Kuhn, J.Nilsson, C.A.Ramm, Paillard. Second row: L.Resegotti, M.Niklaus, C.J.Zilverschoon, R.Bertolotto, Marcellin, G.Brianti, P.Collet. Standing behind: B.Kuiper.

  2. Surface morphology of PS-PDMS diblock copolymer films

    DEFF Research Database (Denmark)

    Andersen, T.H.; Tougaard, S.; Larsen, N.B.

    2001-01-01

    Spin coated thin films (∼400 Å) of poly(styrene)–poly(dimethylsiloxane) (PS–PDMS) diblock copolymers have been investigated using X-ray Photoelectron Spectroscopy and Atomic Force Microscopy. Surface segregation of the poly(dimethylsiloxane) blocks was studied for five diblock copolymers which...... by use of peak shape analysis of the X-ray Photoelectron Spectra via the Tougaard Method. The amount of dimethylsiloxane in the uppermost part of the films was quantified as a function of annealing time and temperature. For annealing above the PS glass transition temperature, surface segregation...... of the dimethylsiloxane chain-ends occurs for all the studied PS–PDMS diblock copolymers. At room temperature, surface segregation takes place only when the amount of dimethylsiloxane in the diblock copolymers is small....

  3. Sub-10ps monolithic and low-power photodetector readout

    Energy Technology Data Exchange (ETDEWEB)

    Varner, Gary S.; Ruckman, Larry L.

    2009-02-20

    Recent advances in photon detectors have resulted in high-density imaging arrays that offer many performance and cost advantages. In particular, the excellent transit time spread of certain devices show promise to provide tangible benefits in applications such as Positron Emission Tomography (PET). Meanwhile, high-density, high-performance readout techniques have not kept on pace for exploiting these developments. Photodetector readout for next generation high event rate particle identification and time-resolved PET requires a highly-integrated, low-power, and cost-effective readout technique. We propose fast waveform sampling as a method that meets these criteria and demonstrate that sub-10ps resolution can be obtained for an existing device.

  4. Small-size meshless 50 ps streak tube

    Science.gov (United States)

    Ageeva, N. V.; Andreev, S. V.; Belolipetski, V. S.; Bryukhnevich, G. I.; Greenfield, D. E.; Ivanova, S. R.; Kaverin, A. M.; Khohlova, A. N.; Kuz'menko, E. A.; Levina, G. P.; Makushina, V. A.; Monastyrskiy, M. A.; Schelev, M. Ya.; Semichastnova, Z. M.; Serdyuchenko, Yu. N.; Skaballanovich, T. A.; Sokolov, V. E.

    2008-11-01

    In contrast to the conventional image intensifier with large work area, a streak image tube should possess additional important feature - the comparatively small temporal distortion at the entire work area of the photocathode. With this additional engineering restriction taken into account, a novel small-size meshless streak image tube has been developed by means of numerical optimization. The tube with 25-mm wide work area contains a pair of deflection plates to sweep the electron image along the 25 mm output phosphor screen that is separated by 100 mm from the photocathode. The electron image can be shuttered with a 300 V blanking electric pulse. Electron-optical magnification of the tube is unit; spatial resolution reaches 30 lp/mm over the entire photocathode work area; temporal resolution lies in the 20 - 50 ps range, depending on the accelerating voltage (6 - 15 kV).

  5. Psödohipoparatiroidi Tip 1A: Olgu Sunumu

    Directory of Open Access Journals (Sweden)

    Mehmet Güven

    2017-06-01

    Full Text Available Psödohipoparatiroidizm (PHPT; hedef organın parathormona (PTH yanıt vermediği kalıtımsal bir bozukluktur. Biyokimyasal olarak; hipokalsemi, hiperfosfatemi ve PTH yüksekliği ile karakterizedir. PTH uygulamasına verilen yanıt belirgin derecede düşüktür. Tip 1A, biyokimyasal özelliklere ek olarak Albright herediter osteodistrofisi (AHO olarak bilinen karakteristik somatik bir fenotipe de sahiptir. Bu fenotipin, kısa boy, yuvarlak yüz, frontal bombelik, brakidaktili, obezite özelikleri bulunmaktadır. Burada biz, hipokalsemi ve Albright herediter osteodistrofisi tanısı koyduğumuz; kalsiyum, aktif D vitamini ile tedavi ettiğimiz olgumuzu sunduk.

  6. Color evaluation of seventeen European unifloral honey types by means of spectrophotometrically determined CIE L*Cab*h(ab)° chromaticity coordinates.

    Science.gov (United States)

    Tuberoso, Carlo Ignazio Giovanni; Jerković, Igor; Sarais, Giorgia; Congiu, Francesca; Marijanović, Zvonimir; Kuś, Piotr Marek

    2014-02-15

    CIE (Commission Internationale de l'Eclairage) L(*)Cab(*)h(ab)° color coordinates for 305 samples of 17 unifloral honeys types (asphodel, buckwheat, black locust, sweet chestnut, citrus, eucalyptus, Garland thorn, honeydew, heather, lime, mint, rapeseed, sage, strawberry tree, sulla flower, savory and thistle) from different geographic locations in Europe were spectrophotometrically assessed and statistically evaluated. Preliminary separation of unifloral honeys was obtained by means of L(*)-C(ab)(*) color coordination correlation. Hierarchical Cluster Analysis (HCA) revealed an expected segregation of the honeys types according to their chromatic characteristics. Principal Component Analysis (PCA) allowed to obtain a more defined distinction of the 17 unifloral honey types, particularly when using 3D graphics. CIE L(*)C(ab)(*)hab(*) color coordinates were useful for the identification of several honey types. The proposed method represents a simple and efficient procedure that can be used as a basis for the authentication of unifloral honeys worldwide. Copyright © 2013 Elsevier Ltd. All rights reserved.

  7. The Design and Implementation of Smart Monitoring System for Large-Scale Railway Maintenance Equipment Cab Based on ZigBee Wireless Sensor Network

    Directory of Open Access Journals (Sweden)

    Hairui Wang

    2014-06-01

    Full Text Available In recent years, organizations use IEEE 802.15.4 and ZigBee technology to deliver solution in variety areas including home environment monitoring. ZigBee technology has advantages on low-cost, low power consumption and self-forming. With the rapid expansion of the Internet, there is the requirement for remote monitoring large-scale railway maintenance equipment cab. This paper discusses the disadvantages of the existing smart monitoring system, and proposes a solution. A ZigBee wireless sensor network smart monitoring system and Wi-Fi network is integrated through a home gateway to increase the system flexibility. At the same time the home gateway cooperated with a pre- processing system provide a flexible user interface, and the security and safety of the smart monitoring system. To testify the efficiency of the proposed system, the temperature and humidity sensors and light sensors have developed and evaluated in the smart monitoring system.

  8. Updating the Psoriatic Arthritis (PsA) Core Domain Set: A Report from the PsA Workshop at OMERACT 2016.

    Science.gov (United States)

    Orbai, Ana-Maria; de Wit, Maarten; Mease, Philip J; Callis Duffin, Kristina; Elmamoun, Musaab; Tillett, William; Campbell, Willemina; FitzGerald, Oliver; Gladman, Dafna D; Goel, Niti; Gossec, Laure; Hoejgaard, Pil; Leung, Ying Ying; Lindsay, Chris; Strand, Vibeke; van der Heijde, Désirée M; Shea, Bev; Christensen, Robin; Coates, Laura; Eder, Lihi; McHugh, Neil; Kalyoncu, Umut; Steinkoenig, Ingrid; Ogdie, Alexis

    2017-10-01

    To include the patient perspective in accordance with the Outcome Measures in Rheumatology (OMERACT) Filter 2.0 in the updated Psoriatic Arthritis (PsA) Core Domain Set for randomized controlled trials (RCT) and longitudinal observational studies (LOS). At OMERACT 2016, research conducted to update the PsA Core Domain Set was presented and discussed in breakout groups. The updated PsA Core Domain Set was voted on and endorsed by OMERACT participants. We conducted a systematic literature review of domains measured in PsA RCT and LOS, and identified 24 domains. We conducted 24 focus groups with 130 patients from 7 countries representing 5 continents to identify patient domains. We achieved consensus through 2 rounds of separate surveys with 50 patients and 75 physicians, and a nominal group technique meeting with 12 patients and 12 physicians. We conducted a workshop and breakout groups at OMERACT 2016 in which findings were presented and discussed. The updated PsA Core Domain Set endorsed with 90% agreement by OMERACT 2016 participants included musculoskeletal disease activity, skin disease activity, fatigue, pain, patient's global assessment, physical function, health-related quality of life, and systemic inflammation, which were recommended for all RCT and LOS. These were important, but not required in all RCT and LOS: economic cost, emotional well-being, participation, and structural damage. Independence, sleep, stiffness, and treatment burden were on the research agenda. The updated PsA Core Domain Set was endorsed at OMERACT 2016. Next steps for the PsA working group include evaluation of PsA outcome measures and development of a PsA Core Outcome Measurement Set.

  9. First observation of o-Ps to p-Ps transition and first direct measurement of positronium hyperfine splitting with sub-THz light

    Energy Technology Data Exchange (ETDEWEB)

    Yamazaki, Takayuki, E-mail: yamazaki@icepp.s.u-tokyo.ac.jp; Miyazaki, Akira; Suehara, Taikan; Namba, Toshio; Asai, Shoji; Kobayashi, Tomio [University of Tokyo, Department of Physics, Graduate School of Science, and International Center for Elementary Particle Physics (Japan); Saito, Haruo [University of Tokyo, Graduate School of Arts and Sciences (Japan); Urushizaki, Yuichi; Ogawa, Isamu; Idehara, Toshitaka [University of Fukui, Research Center for Development of Far-Infrared Region (Japan); Sabchevski, Svilen [Bulgarian Academy of Sciences (Bulgaria)

    2012-12-15

    Positronium is an ideal system for the research of the bound state QED. The hyperfine splitting of positronium (Ps-HFS, about 203 GHz) is an important observable but all previous measurements of Ps-HFS had been measured indirectly using Zeeman splitting. There might be the unknown systematic errors on the uniformity of magnetic field. We are trying to measure Ps-HFS directly using sub-THz radiation. We developed an optical system to accumulate high power (about 10 kW) radiation in a Fabry-Perot resonant cavity and observed the positronium hyperfine transition for the first time.

  10. Recombination dynamics in coalesced a-plane GaN ELO structures investigated by high spatially and ps-time-resolved cathodoluminescence microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Bastek, B.; Bertram, F.; Christen, J. [Institute of Experimental Physics, Otto-von-Guericke-University Magdeburg (Germany); Wernicke, T.; Weyers, M. [Ferdinand-Braun-Institut fuer Hoechstfrequenztechnik, Berlin (Germany); Kneissl, M. [Institute of Solid State Physics, Technical University, Berlin (Germany)

    2008-07-01

    The characteristic epitaxial lateral overgrowth (ELO) domains of fully coalesced a-plane GaN layers were directly imaged by highly spatially and spectrally resolved cathodoluminescence microscopy (CL) at 5 K. The patterned layers were grown by MOVPE on r-plane sapphire substrate and stripe masks oriented in the [01 anti 10] direction. In the area of coherent growth (I) the broad basal plane stacking fault (BSF) emission centered at 3.41 eV dominates the spectra. Also in the region (II) of coalescence the BSF luminescence dominates, however, the intensity increases by one order of magnitude compared to area (I). In complete contrast, in the stripes associated with the laterally grown domains (III) in [0001] direction, exclusively an intense and sharp (D{sup 0},X) emission at 3.475 eV is observed. ps-time-resolved CL of the free excitons (FX) recorded from this domains (III) decays bi-exponentially. The initial lifetime of 180 ps is primarily given by the capture of FX by impurities to form bound excitons (BE). With rising temperature this capture time constant decreases as T{sup -1/4} and reaches a minimum of 104 ps at T=60 K. Above 60 K, i.e. when FX starts to dominate the BEs, the lifetime increases rapidly to a value of 240 ps for 300 K.

  11. Delay-line cables for the fast bumpers in the PS.

    CERN Multimedia

    CERN PhotoLab

    1976-01-01

    For 'continuous transfer' to the SPS, the beam accelerated in the PS is shaved off over several turns, so as to form a continuous sequence of bunches several times the length of the PS circumference. Fast bumpers, powered in a 'staircase' way, displace the PS beam stepwise towards the ejection septum. Each step lasts 2.1 microsec and the cable drums in this picture contain some of the bumper delay-lines of altogether 10 km.

  12. A DiPS+ case study: a self-healing RADIUS server

    OpenAIRE

    Michiels, Sam; Desmet, Lieven; Verbaeten, Pierre

    2004-01-01

    This report shows performance results of a RADIUS implementation using the DiPS+ software architecture. In addition it compares this implementation with a commercially available RADIUS implementation, and shows that the DiPS+ architecture differentiates between user types and request types. In fact, the DiPS+ prototype prioritizes incoming traffic based on application-specifc preferences, and allocates the available processing resources to the highest priority requests.

  13. Microfabricated device for co-culture of sympathetic neuron and iPS-derived cardiomyocytes.

    Science.gov (United States)

    Takeuchi, Akimasa; Shimba, Kenta; Takayama, Yuzo; Kotani, Kiyoshi; Lee, Jong-Kook; Noshiro, Makoto; Jimbo, Yasuhiko

    2013-01-01

    Induced pluripotent stem (iPS) cell-derived cardiomyocytes (iPS-CMs) has been expected as a cell source for therapy of serious heart failure. However, it is unclear whether the function of iPS-CMs is modulated by the host sympathetic nervous system. Here we developed a device for co-culture of sympathetic neurons and iPS-CMs using microfabrication technique. The device consisted of a culture chamber and a microelectrode-array (MEA) substrate. The superior cervical ganglion (SCG) neurons were co-cultured with iPS-CMs in a microfabricated device, which had multiple compartments. Several days after seeding, synapses were formed between SCG neurons and iPS-CMs, as confirmed by immunostaining. Spontaneous electrical activities of the SCG neurons and the iPS-CMs were observed from the electrode of the MEA substrate. The beat rate of iPS-CMs increased after electrical stimulation of the co-cultured SCG neurons. Such changes in the beat rate were prevented in the presence of propranolol, a β-adrenoreceptor antagonist. These results suggest that the microfabricated device will be utilized for studying the functional modulation of iPS-CMs by connected sympathetic neurons.

  14. Facile Synthesis of Mono-Dispersed Polystyrene (PS/Ag Composite Microspheres via Modified Chemical Reduction

    Directory of Open Access Journals (Sweden)

    Wen Zhu

    2013-12-01

    Full Text Available A modified method based on in situ chemical reduction was developed to prepare mono-dispersed polystyrene/silver (PS/Ag composite microspheres. In this approach; mono-dispersed PS microspheres were synthesized through dispersion polymerization using poly-vinylpyrrolidone (PVP as a dispersant at first. Then, poly-dopamine (PDA was fabricated to functionally modify the surfaces of PS microspheres. With the addition of [Ag(NH32]+ to the PS dispersion, [Ag(NH32]+ complex ions were absorbed and reduced to silver nanoparticles on the surfaces of PS-PDA microspheres to form PS/Ag composite microspheres. PVP acted both as a solvent of the metallic precursor and as a reducing agent. PDA also acted both as a chemical protocol to immobilize the silver nanoparticles at the PS surface and as a reducing agent. Therefore, no additional reducing agents were needed. The resulting composite microspheres were characterized by TEM, field emission scanning electron microscopy (FESEM, energy-dispersive X-ray spectroscopy (EDS, XRD, UV-Vis and surface-enhanced Raman spectroscopy (SERS. The results showed that Ag nanoparticles (NPs were homogeneously immobilized onto the PS microspheres’ surface in the presence of PDA and PVP. PS/Ag composite microspheres were well formed with a uniform and compact shell layer and were adjustable in terms of their optical property.

  15. Lehtmets : psühhiaatria ei ole piisavalt atraktiivne / Andres Lehtmets ; interv. Marika Kusnets

    Index Scriptorium Estoniae

    Lehtmets, Andres

    2004-01-01

    Vestlus Eesti Psühhiaatrite Seltsi aseesimehega rahva vaimsest tervisest. Samas ka sotsiaalministeeriumi rahvatervise osakonna peaspetsialisti Helja Eomoisi kommentaar: Mida teeb ministeerium rahva vaimse tervise parandamiseks?

  16. Molecular characterization of plasmids pS7a and pS7b from Lactococcus lactis subsp. lactis bv. diacetylactis S50 as a base for the construction of mobilizable cloning vectors.

    Science.gov (United States)

    Strahinic, I; Kojic, M; Tolinacki, M; Fira, D; Topisirovic, L

    2009-01-01

    Strain Lactococcus lactis subsp. lactis bv. diacetylactis S50 harbours five theta-replicating plasmids (pS6, pS7a, pS7b, pS80 and pS140). The aim of this study was to characterize domains involved in the replication and conjugative mobilization of the small plasmids pS7a and pS7b, which are structurally very similar. Complete nucleotide sequences of pS7a and pS7b were determined by cloning DNA fragments of different sizes into Escherichia coli vectors. Linearized plasmids and four EcoRI fragments of the pS7a and pS7b were cloned into an origin probe vector. Constructed plasmids (pSEV10, pSK10, pISE1a and pISE1b) were able to replicate in the strain L. lactis subsp. cremoris MG1363. In addition, experiments showed that plasmids pS7a and pS7b contained oriT sequences and their conjugative transfer directly depended on the presence of pS80 in donor cells. Plasmids pS7a and pS7b contained typical lactococcal theta replication origin and repB gene that enable them to replicate in the strain L. lactis subsp. cremoris MG1363. Plasmid pS80 plays a key role in the conjugative transfer of small plasmids. Plasmids pS7a and pS7b-based derivatives could be valuable tools for genetic manipulation, studying processes of plasmid maintenance and horizontal gene transfer in lactococci.

  17. ToPS: a framework to manipulate probabilistic models of sequence data.

    Directory of Open Access Journals (Sweden)

    André Yoshiaki Kashiwabara

    Full Text Available Discrete Markovian models can be used to characterize patterns in sequences of values and have many applications in biological sequence analysis, including gene prediction, CpG island detection, alignment, and protein profiling. We present ToPS, a computational framework that can be used to implement different applications in bioinformatics analysis by combining eight kinds of models: (i independent and identically distributed process; (ii variable-length Markov chain; (iii inhomogeneous Markov chain; (iv hidden Markov model; (v profile hidden Markov model; (vi pair hidden Markov model; (vii generalized hidden Markov model; and (viii similarity based sequence weighting. The framework includes functionality for training, simulation and decoding of the models. Additionally, it provides two methods to help parameter setting: Akaike and Bayesian information criteria (AIC and BIC. The models can be used stand-alone, combined in Bayesian classifiers, or included in more complex, multi-model, probabilistic architectures using GHMMs. In particular the framework provides a novel, flexible, implementation of decoding in GHMMs that detects when the architecture can be traversed efficiently.

  18. Neural stem cells differentiated from iPS cells spontaneously regain pluripotency.

    Science.gov (United States)

    Choi, Hyun Woo; Kim, Jong Soo; Choi, Sol; Hong, Yean Ju; Kim, Min Jung; Seo, Han Geuk; Do, Jeong Tae

    2014-10-01

    Differentiated somatic cells can be reprogrammed into pluripotent stem cells by transduction of exogenous reprogramming factors. After induced pluripotent stem (iPS) cells are established, exogenous genes are silenced. In the pluripotent state, retroviral genes integrated in the host genome are kept inactive through epigenetic transcriptional regulation. In this study, we tried to determine whether exogenous genes remain silenced or are reactivated upon loss of pluripotency or on differentiation using an in vitro system. We induced differentiation of iPS cells into neural stem cells (NSCs) in vitro; the NSCs appeared morphologically indistinguishable from brain-derived NSCs and stained positive for the NSC markers Nestin and Sox2. These iPS cell-derived NSCs (iPS-NSCs) were also capable of differentiating into all three neural subtypes. Interestingly, iPS-NSCs spontaneously formed aggregates on long-term culture and showed reactivation of the Oct4-GFP marker, which was followed by the formation of embryonic stem cell-like colonies. The spontaneously reverted green fluorescent protein (GFP)-positive (iPS-NSC-GFP(+) ) cells expressed high levels of pluripotency markers (Oct4 and Nanog) and formed germline chimeras, indicating that iPS-NSC-GFP(+) cells had the same pluripotency as the original iPS cells. The reactivation of silenced exogenous genes was tightly correlated with the downregulation of DNA methyltransferases (Dnmts) during differentiation of iPS cells. This phenomenon was not observed in doxycycline-inducible iPS cells, where the reactivation of exogenous genes could be induced only by doxycycline treatment. These results indicate that pluripotency can be regained through reactivation of exogenous genes, which is associated with dynamic change of Dnmt levels during differentiation of iPS cells. © 2014 AlphaMed Press.

  19. Phosphorene-directed self-assembly of asymmetric PS-b-PMMA block copolymer for perpendicularly-oriented sub-10 nm PS nanopore arrays

    Science.gov (United States)

    Zhang, Ziming; Zheng, Lu; Khurram, Muhammad; Yan, Qingfeng

    2017-10-01

    Few-layer black phosphorus, also known as phosphorene, is a new two-dimensional material which is of enormous interest for applications, mainly in electronics and optoelectronics. Herein, we for the first time employ phosphorene for directing the self-assembly of asymmetric polystyrene-block-polymethylmethacrylate (PS-b-PMMA) block copolymer (BCP) thin film to form the perpendicular orientation of sub-10 nm PS nanopore arrays in a hexagonal fashion normal to the interface. We experimentally demonstrate that none of the PS and PMMA blocks exhibit preferential affinity to the phosphorene-modified surface. Furthermore, the perpendicularly-oriented PS nanostructures almost stay unchanged with the variation of number of layers of few-layer phosphorene nanoflakes between 15-30 layers. Differing from the neutral polymer brushes which are widely used for chemical modification of the silicon substrate, phosphorene provides a novel physical way to control the interfacial interactions between the asymmetric PS-b-PMMA BCP thin film and the silicon substrate. Based on our results, it is possible to build a new scheme for producing sub-10 nm PS nanopore arrays oriented perpendicularly to the few-layer phosphorene nanoflakes. Furthermore, the nanostructural microdomains could serve as a promising nanolithography template for surface patterning of phosphorene nanoflakes.

  20. Selective loss of noradrenaline exacerbates early cognitive dysfunction and synaptic deficits in APP/PS1 mice

    Science.gov (United States)

    Hammerschmidt, Thea; Kummer, Markus P.; Terwel, Dick; Martinez, Ana; Gorji, Ali; Pape, Hans-Christian; Rommelfanger, Karen S.; Schroeder, Jason P.; Stoll, Monika; Schultze, Joachim; Weinshenker, David; Heneka, Michael T.

    2016-01-01

    Background Degeneration of the locus ceruleus (LC), the major noradrenergic nucleus in the brain, occurs early and is ubiquitous in Alzheimer’s disease. Experimental lesions to the LC exacerbate AD-like neuropathology and cognitive deficits in several transgenic mouse models of AD. Because the LC contains multiple neuromodulators known to affect Aβ toxicity and cognitive function, the specific role of noradrenaline (NA) in AD is not well understood. Methods To determine the consequences of selective NA deficiency in an AD mouse model, we crossed dopamine β-hydroxylase (DBH) knock-out mice with APP/PS1 mice, overexpressing mutant amyloid precursor protein and presenilin-1. DBH (−/−) mice are unable to synthesize NA but otherwise have normal LC neurons and co-transmitters. Spatial memory, hippocampal long-term potentiation (LTP), and synaptic protein levels were assessed. Results The modest impairments in spatial memory and hippocampal LTP displayed by young APP/PS1 or DBH(−/−) single mutant mice were augmented in DBH(−/−)/APP/PS1 double mutant mice. Deficits were associated with reduced levels of total Ca2+/calmodulin-dependent protein kinases II (CaMKII) and N-Methyl-D-aspartate receptor 2A (NR2A), increased N-Methyl-D-aspartate receptor 2B (NR2B) levels and were independent of Aβ accumulation. Spatial memory performance was partly improved by treatment with the NA precursor drug L-threo-DOPS. Conclusions These results indicate that early LC degeneration and subsequent NA deficiency in AD may contribute to cognitive deficits via altered levels of CaMKII and N-Methyl-D-aspartate receptors, and suggest that NA supplementation could be beneficial in early AD. PMID:22883210

  1. Beam lines from Linac 1 to PS and Booster

    CERN Multimedia

    CERN PhotoLab

    1978-01-01

    View against the direction of the proton beams. The 50 MeV Linac 1 is behind the concrete wall. Its beam emerges from the hole near the centre of the picture. A switching magnet directs the beam either to the PS (to the right in the sense of the beam; original injection line), or lets it go straight on to the Booster (originally 800 MeV, now 1.4 GeV). The huge drum in the line to the Booster is a "debuncher", driven by the 200 MHz RF of the linac. It reduces the beam's momentum spread. This was the last year of Linac 1 as provider of protons to the Booster. Linac 2, nearly completed at the time of this picture, took up trial delivery at the end of 1978, and routine delivery in 1979. The beam line from Linac 2, barely visible here, can be clearly seen on 7802260. Linac 1 had a second life as an ion accelerator.

  2. The (7,7) optics at CERN PS

    CERN Document Server

    Serluca, M; Efthymiopoulos, I; Sperati, F; Sterbini, G; Tecker, F; Zisopoulos, P

    2017-01-01

    The PS lattice is composed by one hundred combinedfunction magnets, which set the bare tune of the machineto (Qh,Qv) = (6.25, 6.28). Low energy quadrupoles areused at injection to move the tune in a limited working pointarea. In particular the vertical tune is moved below 6.25 toavoid the structural resonance 8Qv= 50 coupled with spacecharge, which leads to strong losses. In view of the highdemands in terms of beam brightness for LIU and HL-LHCprojects, the interest of exploring different integer tune work-ing area started during last years. During 2016, for the firsttime, it has been possible to explore the (7,7) tune workingarea at injection using the auxiliary circuits of the combinedfunction magnets. A finite-element magnetic model, underdevelopment, has been used to predict the required currentsin order to get the desired optical parameters. In this pa-per we present the results and issues encountered duringthe Machine Development (MD) studies about the injectionin the (7,7) area along with optics and be...

  3. Injection Bump Synchronization Study for the CERN PS

    CERN Document Server

    Serluca, Maurizio; Gilardoni, Simone; CERN. Geneva. ATS Department

    2016-01-01

    In the framework of the LHC Injector Upgrade (LIU) project the CERN PS injection kinetic energy will be upgraded from 1.4 to 2 GeV. The present injection bump is made by four bumpers in Straight Section (SS) 40, 42, 43, 44 and it will be converted in a five bumpers system to allow additional flexibility in the bump shape with a reduction of the proton losses during the bump closure. The injection section SS42 has being redesigned to accommodate a new eddy current septum which will host a new bumper magnet in the same vacuum vessel due to reduced longitudinal space availability. The synchronization and amplitude variation of the power converter of the in-vacuum bumper 42 with respect to the remaining outside vacuum bumpers 40, 41, 43, 44 can lead to orbit distortion and consequent losses during injection. In this note we present the experimental results from Machine Development (MD) studies along with simulations for the present system at 1.4 GeV to quantify the acceptable orbit distortion and the performance ...

  4. Scanning SQUID sampler with 40-ps time resolution

    Science.gov (United States)

    Cui, Zheng; Kirtley, John R.; Wang, Yihua; Kratz, Philip A.; Rosenberg, Aaron J.; Watson, Christopher A.; Gibson, Gerald W.; Ketchen, Mark B.; Moler, Kathryn. A.

    2017-08-01

    Scanning Superconducting QUantum Interference Device (SQUID) microscopy provides valuable information about magnetic properties of materials and devices. The magnetic flux response of the SQUID is often linearized with a flux-locked feedback loop, which limits the response time to microseconds or longer. In this work, we present the design, fabrication, and characterization of a novel scanning SQUID sampler with a 40-ps time resolution and linearized response to periodically triggered signals. Other design features include a micron-scale pickup loop for the detection of local magnetic flux, a field coil to apply a local magnetic field to the sample, and a modulation coil to operate the SQUID sampler in a flux-locked loop to linearize the flux response. The entire sampler device is fabricated on a 2 mm × 2 mm chip and can be scanned over macroscopic planar samples. The flux noise at 4.2 K with 100 kHz repetition rate and 1 s of averaging is of order 1 mΦ0. This SQUID sampler will be useful for imaging dynamics in magnetic and superconducting materials and devices.

  5. Fs-transient absorption and fluorescence upconversion after two- photon excitation of carotenoids in solution and in LHC II

    CERN Document Server

    Wall, P J; Fleming, G R

    2000-01-01

    With time resolved two-photon techniques we determined the lifetime and two-photon spectrum of the forbidden S/sub 1/ state of beta - carotene (9+or-0.2 ps), lutein (15+or-0.5 ps) and the energy transferring carotenoids in LHC II (250+or-50 fs). (7 refs).

  6. Emission properties of porphyrin compounds in new polymeric PS:CBP host

    Science.gov (United States)

    Jafari, Mohammad Reza; Bahrami, Bahram

    2015-06-01

    In this study, a device with fundamental structure of ITO/PEDOT:PSS (60 nm)/PS:CBP (70 nm)/Al (150 nm) was fabricated. The electroluminescence spectrum of device designated a red shift rather than PS:CBP photoluminescence spectra. It can be suggested that the electroplex emission occurs at PS:CBP interface. By following this step, red light-emitting devices using porphyrin compounds as a red dopant in a new host material PS:CBP with a configuration of ITO/PEDOT:PSS (60 nm)/PS:CBP:porphyrin compounds(70 nm)/Al (150 nm) have been fabricated and investigated. The electroluminescent spectra of the porphyrin compounds were red-shifted as compared with the PS:CBP blend. OLED devices based on doping 3,4PtTPP and TPPNO2 in PS:CBP showed purer red emission compared with ZnTPP and CoTPP doped devices. We believe that the electroluminescence performance of OLED devices based on porphyrin compounds depends on overlaps between the absorption of the porphyrin compounds and the emission of PS:CBP.

  7. Composite Si/PS membrane pressure sensors with micro and macro ...

    Indian Academy of Sciences (India)

    Porous Silicon (PS) is a versatile material with many unique features making it viable in the field of Microelectromechanical Systems (MEMS). In this paper, we discuss the optimization of formation parameters of micro and macro PS with different porosity and thickness for use in pressure sensors. The optimized material is ...

  8. Sonication-assisted synthesis of polystyrene (PS)/organoclay nanocomposites: influence of clay content

    Science.gov (United States)

    Suresh, Kelothu; Kumar, R. Vinoth; Kumar, Manish; Jeyapriya, M.; Anbarasan, R.; Pugazhenthi, G.

    2017-06-01

    This article presents the synthesis of a series of polystyrene (PS)/organoclay nanocomposite films consisting of different contents of clay (1-7 wt%) by sonication-coupled solvent-blending technique. The prepared PS nanocomposite films were characterized using various techniques, including X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR), transmission electron microscopy (TEM), and thermal gravimetric analysis (TGA). The XRD and TEM results revealed the formation of exfoliated nanocomposites at lower loading of organoclay (<5 wt%). The presence of various functional groups in the organoclay and PS/organoclay nanocomposite was verified by FTIR spectra. The thermal stability of PS nanocomposites was significantly improved as compared to pristine PS, which is evident from TGA analysis. When 10% mass loss was chosen as a point of reference, the thermal degradation temperature of PS nanocomposite holding 7 wt% of organoclay was found to be 30 °C more over pristine PS. The thermal kinetic parameters such as activation energy ( E a), pre-exponential factor ( A), and the order of reaction ( n) were determined by employing the Coats-Redfern model. Thermal degradation reaction mechanism of PS nanocomposites was also investigated.

  9. [Methionine metabolism regulates maintenance and differentiation of human ES/iPS cells].

    Science.gov (United States)

    Shiraki, Nobuaki; Kume, Shoen

    2015-05-01

    Embryonic stem (ES) and induced pluripotent stem (iPS) cells are pluripotent and can give rise to all cell types. ES/iPS cells have a unique transcriptional circuit that sustains the pluripotent state. These cells also possess a characteristically high rate of proliferation as well as an abbreviated G1 phase. These unique molecular properties distinguish ES and iPS cells from somatic cells. Mouse ES/iPS cells are in a high-flux metabolic state, with a high dependence on threonine catabolism. However, little is known about amino acid metabolism in human ES/iPS cells. Recently, we reported that human ES/iPS cells require high amounts of methionine (Met) and express high levels of Met metabolism enzymes (Shriaki N, et al: Cell Metabolism, 2014). Met deprivation results in a rapid decrease in intracellular S-adenosyl-methionine (SAM), triggering the activation of p53 signaling, reducing pluripotent marker gene NANOG expression, and poising human ES/iPS cells for differentiation, follow by potentiated differentiation into all three germ layers. However, when exposed to prolonged Met deprivation, the cells went to apoptosis. In this review, we explain the importance of SAM in Met metabolism and its relationship with pluripotency, cell survival, and differentiation of human ES/iPS cells.

  10. Effects of hypoxia on pluripotency in murine iPS cells.

    Science.gov (United States)

    Sugimoto, Kouji; Yoshizawa, Yuu; Yamada, Shizuka; Igawa, Kazunari; Hayashi, Yoshihiko; Ishizaki, Hidetaka

    2013-10-01

    Retroviral transduction of four transcription factors (Oct4, Sox2, Klf4 and c-Myc) or three factors, excluding c-Myc, has been shown to initiate a reprogramming process that results in the transformation of murine fibroblasts to induced pluripotent stem (iPS) cells, and there has been a rapid increase in the number of iPS cell-based preclinical trials. In this study, the effects of these transcription factors were evaluated regarding the growth and differentiation of murine iPS cells under hypoxia. Based on the results of RT-PCR and alizarin red S staining, there were no statistical differences in the growth and differentiation of iPS cells or the induction of iPS cells to osteoblasts under hypoxia between the transcription factor groups. Furthermore, the function of hypoxia inducible factors (HIFs) in murine iPS cells under hypoxia was investigated in relation to the morphology and expression of transcription factors using RT-PCR and Western blotting. The HIF-2α knockdown group exhibited a decrease in the colony size of the iPS cells. The HIF-2α or -3α knockdown group demonstrated a statistically significant decrease in the transcription factor expression compared to that observed in the control group. These results demonstrate that HIF-2α among HIFs is the most influential candidate for the maintenance of the pluripotency of murine iPS cells. Copyright © 2013 Wiley Periodicals, Inc.

  11. 7 CFR 1753.37 - Plans and specifications (P&S).

    Science.gov (United States)

    2010-01-01

    ....37 Agriculture Regulations of the Department of Agriculture (Continued) RURAL UTILITIES SERVICE... Installation of Central Office Equipment § 1753.37 Plans and specifications (P&S). (a) General. (1) Prior to... central office equipment. (2) The P&S shall specify the delivery and completion time required for each...

  12. Rahuoperatsioonide Keskuses alustab sotsiaalse ja psühholoogilise toetuse sektsioon / Merle Tihaste, Marge Sillaste

    Index Scriptorium Estoniae

    Parmak, Merle, 1968-

    2008-01-01

    Missioonidel osalevatele või pikaajalises lähetuses viibivatele kaitseväelastele ja nende peredele suunatud sotsiaalse ja psühholoogilise toetuse tagamiseks loodud sektsioonist Rahuoperatsioonide Keskuse koosseisus. Sektsiooni töömudelist, ülesannetest ja koostöövõrgustikust. Skeem: Sotsiaalse ja psühholoogilise toetuse sektsiooni töömudel ja partnerid

  13. PS Dreyer: Bakens op die pad van die wetenskap | Antonites | HTS ...

    African Journals Online (AJOL)

    PS Dreyer: Beacons on the path of science. Professor PS Dreyer is an academic who has shovsm insight and vision into several problems of the human sciences since 1951. He has identified problems, but also contributed solutions to them. In this respect his philosophy on causality and freedom is of utmost importance.

  14. Preliminary Evaluation of PS300: A New Self-Lubricating High Temperature Composite Coating for Use to 800 C

    Science.gov (United States)

    Dellacorte, C.; Edmonds, B. J.

    1995-01-01

    This paper introduces PS300, a plasma sprayed, self-lubricating composite coating for use in sliding contacts at temperatures to 800 C. PS300 is a metal bonded chrome oxide coating with silver and BaF2/CaF2 eutectic solid lubricant additives. PS300 is similar to PS200, a chromium carbide based coating, which is currently being investigated for a variety of tribological applications. In pin-on-disk testing up to 650 C, PS300 exhibited comparable friction and wear properties to PS200. The PS300 matrix, which is predominantly chromium oxide rather than chromium carbide, does not require diamond grinding and polishes readily with silicon carbide abrasives greatly reducing manufacturing costs compared to PS200. It is anticipated that PS300 has potential for sliding bearing and seal applications in both aerospace and general industry.

  15. A trajetória da família do portador de sofrimento psíquico La trayectoria da familia del portador de sufrimiento psíquico The path of the person's family in psychic suffering

    Directory of Open Access Journals (Sweden)

    Vânia Moreno

    2003-06-01

    Full Text Available Este artigo é uma reflexão teórica acerca de como os familiares estiveram incluídos na assistência ao portador de sofrimento psíquico. Iniciamos a partir da constituição da psiquiatria enquanto ciência médica e buscamos chegar até os nossos dias. Percebemos que a família foi excluída do cuidado ao doente mental e que só veio receber a atenção e ser investigada a partir da Segunda Guerra Mundial quando começou o processo de desospitalização. No Brasil as estratégias visando auxiliar a família no enfrentamento do sofrimento psíquico ainda se encontram incipientes.Este artículo es una reflexión teórica a cerca de cómo los familiares estuvieron incluidos en la asistencia a personas en sufrimiento psíquico. Iniciamos a partir de la constitución de la psiquiatría mientras ciencia médica y buscamos llegar hasta nuestros días. Nos percatamos que la familia que excluida del cuidado al enfermo mental y que sólo vino a recibir la atención y ser investigada a partir de la Segunda Guerra Mundial cuando empezó. Actualmente algunos países han ofrecido asistencia al núcleo familiar y, cuando ocurre rechazo, la opción es por mantener contactos esporádicos del paciente con las familias de manera de evitar reinternaciones. En Brasil las estrategias visando a auxiliar la familia en el enfrentamiento del sufrimiento psíquico aún se encuentra incipiente.This article is a theoretical thought concerning how relatives were included in the attendance the person in mental suffering. The onset was the constitution of Psychiatry as a medical science up to our days. We noticed that the family was excluded from the care to the mental patient and that attention and investigation of the matter only started after World War II along with the psychiatric outpatient treatment process. In Brazil, a strategy seeking to support families facing psychic suffering is still incipient.

  16. Retinoid Uptake, Processing, and Secretion in Human iPS-RPE Support the Visual Cycle

    Science.gov (United States)

    Muñiz, Alberto; Greene, Whitney A.; Plamper, Mark L.; Choi, Jae Hyek; Johnson, Anthony J.; Tsin, Andrew T.; Wang, Heuy-Ching

    2014-01-01

    Purpose. Retinal pigmented epithelium derived from human induced pluripotent stem (iPS) cells (iPS-RPE) may be a source of cells for transplantation. For this reason, it is essential to determine the functional competence of iPS-RPE. One key role of the RPE is uptake and processing of retinoids via the visual cycle. The purpose of this study is to investigate the expression of visual cycle proteins and the functional ability of the visual cycle in iPS-RPE. Methods. iPS-RPE was derived from human iPS cells. Immunocytochemistry, RT-PCR, and Western blot analysis were used to detect expression of RPE genes lecithin-retinol acyl transferase (LRAT), RPE65, cellular retinaldehyde-binding protein (CRALBP), and pigment epithelium–derived factor (PEDF). All-trans retinol was delivered to cultured cells or whole cell homogenate to assess the ability of the iPS-RPE to process retinoids. Results. Cultured iPS-RPE expresses visual cycle genes LRAT, CRALBP, and RPE65. After incubation with all-trans retinol, iPS-RPE synthesized up to 2942 ± 551 pmol/mg protein all-trans retinyl esters. Inhibition of LRAT with N-ethylmaleimide (NEM) prevented retinyl ester synthesis. Significantly, after incubation with all-trans retinol, iPS-RPE released 188 ± 88 pmol/mg protein 11-cis retinaldehyde into the culture media. Conclusions. iPS-RPE develops classic RPE characteristics and maintains expression of visual cycle proteins. The results of this study confirm that iPS-RPE possesses the machinery to process retinoids for support of visual pigment regeneration. Inhibition of all-trans retinyl ester accumulation by NEM confirms LRAT is active in iPS-RPE. Finally, the detection of 11-cis retinaldehyde in the culture medium demonstrates the cells' ability to process retinoids through the visual cycle. This study demonstrates expression of key visual cycle machinery and complete visual cycle activity in iPS-RPE. PMID:24255038

  17. Retinoid uptake, processing, and secretion in human iPS-RPE support the visual cycle.

    Science.gov (United States)

    Muñiz, Alberto; Greene, Whitney A; Plamper, Mark L; Choi, Jae Hyek; Johnson, Anthony J; Tsin, Andrew T; Wang, Heuy-Ching

    2014-01-09

    Retinal pigmented epithelium derived from human induced pluripotent stem (iPS) cells (iPS-RPE) may be a source of cells for transplantation. For this reason, it is essential to determine the functional competence of iPS-RPE. One key role of the RPE is uptake and processing of retinoids via the visual cycle. The purpose of this study is to investigate the expression of visual cycle proteins and the functional ability of the visual cycle in iPS-RPE. iPS-RPE was derived from human iPS cells. Immunocytochemistry, RT-PCR, and Western blot analysis were used to detect expression of RPE genes lecithin-retinol acyl transferase (LRAT), RPE65, cellular retinaldehyde-binding protein (CRALBP), and pigment epithelium-derived factor (PEDF). All-trans retinol was delivered to cultured cells or whole cell homogenate to assess the ability of the iPS-RPE to process retinoids. Cultured iPS-RPE expresses visual cycle genes LRAT, CRALBP, and RPE65. After incubation with all-trans retinol, iPS-RPE synthesized up to 2942 ± 551 pmol/mg protein all-trans retinyl esters. Inhibition of LRAT with N-ethylmaleimide (NEM) prevented retinyl ester synthesis. Significantly, after incubation with all-trans retinol, iPS-RPE released 188 ± 88 pmol/mg protein 11-cis retinaldehyde into the culture media. iPS-RPE develops classic RPE characteristics and maintains expression of visual cycle proteins. The results of this study confirm that iPS-RPE possesses the machinery to process retinoids for support of visual pigment regeneration. Inhibition of all-trans retinyl ester accumulation by NEM confirms LRAT is active in iPS-RPE. Finally, the detection of 11-cis retinaldehyde in the culture medium demonstrates the cells' ability to process retinoids through the visual cycle. This study demonstrates expression of key visual cycle machinery and complete visual cycle activity in iPS-RPE.

  18. Mutations in AtPS1 (Arabidopsis thaliana parallel spindle 1 lead to the production of diploid pollen grains.

    Directory of Open Access Journals (Sweden)

    Isabelle d'Erfurth

    2008-11-01

    Full Text Available Polyploidy has had a considerable impact on the evolution of many eukaryotes, especially angiosperms. Indeed, most--if not all-angiosperms have experienced at least one round of polyploidy during the course of their evolution, and many important crop plants are current polyploids. The occurrence of 2n gametes (diplogametes in diploid populations is widely recognised as the major source of polyploid formation. However, limited information is available on the genetic control of diplogamete production. Here, we describe the isolation and characterisation of the first gene, AtPS1 (Arabidopsis thaliana Parallel Spindle 1, implicated in the formation of a high frequency of diplogametes in plants. Atps1 mutants produce diploid male spores, diploid pollen grains, and spontaneous triploid plants in the next generation. Female meiosis is not affected in the mutant. We demonstrated that abnormal spindle orientation at male meiosis II leads to diplogamete formation. Most of the parent's heterozygosity is therefore conserved in the Atps1 diploid gametes, which is a key issue for plant breeding. The AtPS1 protein is conserved throughout the plant kingdom and carries domains suggestive of a regulatory function. The isolation of a gene involved in diplogamete production opens the way for new strategies in plant breeding programmes and progress in evolutionary studies.

  19. Inhibition of Ps Formation in Benzene and Cyclohexane by CH3CI and CH3Br

    DEFF Research Database (Denmark)

    Wikander, G.; Mogensen, O. E.; Pedersen, Niels Jørgen

    1983-01-01

    Positron-annihilation lifetime spectra have been measured for mixtures of CH3Cl and CH3Br in cyclohexane and of CH3Cl in benzene. The ortho-positronium (Ps) yield decreased monotonically from 38% and 43% in cyclohexane and benzene respectively to 11% in pure CH3Cl and 6% in pure CH3Br. The strength......− anions to form Ps. while it forms a bound state with the halides. X−. CH3Cl was a roughly three times weaker Ps inhibitor in benzene than in cyclohexane, which shows that CH3Cl− does not dechlorinate in times comparable to or shorter than 400–500 ps in benzene. An improved model for the explanation of Ps...

  20. Chemical resistance of core-shell particles (PS/PMMA polymerized by seeded suspension

    Directory of Open Access Journals (Sweden)

    Luiz Fernando Belchior Ribeiro

    2017-09-01

    Full Text Available Abstract Core-shell particles were produced on seeded suspension polymerization by using polystyrene (PS as polymer core, or seed, and methyl methacrylate (MMA as the shell forming monomer. Two synthesis routes were evaluated by varying the PS seed conversion before MMA addition. The main purpose of this work was to investigate the influence of synthesis routes on the morphology and chemical resistance of the resulting particles. 1H NMR spectroscopy showed that the use of PS seeds with lower conversion led to the formation of higher amount of poly(styrene-co-MMA. The copolymer acted as a compatibilizer, decreasing the interfacial energy between both homopolymers. As a consequence, a larger amount of reduced PMMA cluster were formed, as was revealed by TEM measurements. Samples in this system showed enhanced resistance to cyclohexane attack compared with pure PS, with a PS extraction of only 37% after 54 hours test.

  1. iPS cell technologies: significance and applications to CNS regeneration and disease

    Science.gov (United States)

    2014-01-01

    In 2006, we demonstrated that mature somatic cells can be reprogrammed to a pluripotent state by gene transfer, generating induced pluripotent stem (iPS) cells. Since that time, there has been an enormous increase in interest regarding the application of iPS cell technologies to medical science, in particular for regenerative medicine and human disease modeling. In this review article, we outline the current status of applications of iPS technology to cell therapies (particularly for spinal cord injury), as well as neurological disease-specific iPS cell research (particularly for Parkinson’s disease and Alzheimer’s disease). Finally, future directions of iPS cell research are discussed including a) development of an accurate assay system for disease-associated phenotypes, b) demonstration of causative relationships between genotypes and phenotypes by genome editing, c) application to sporadic and common diseases, and d) application to preemptive medicine. PMID:24685317

  2. Formation of positron-atom bound states in collisions between Rydberg Ps and neutral atoms

    CERN Document Server

    Swann, A R; Deller, A; Gribakin, G F

    2016-01-01

    Predicted twenty years ago, positron binding to neutral atoms has not yet been observed experimentally. A new scheme is proposed to detect positron-atom bound states by colliding Rydberg positronium (Ps) with neutral atoms. Estimates of the charge-transfer-reaction cross section are obtained using the first Born approximation for a selection of neutral atom targets and a wide range of incident Ps energies and principal quantum numbers. We also estimate the corresponding Ps ionization cross section. The accuracy of the calculations is tested by comparison with earlier predictions for Ps charge transfer in collisions with hydrogen and antihydrogen. We describe an existing Rydberg Ps beam suitable for producing positron-atom bound states and estimate signal rates based on the calculated cross sections and realistic experimental parameters. We conclude that the proposed methodology is capable of producing such states and of testing theoretical predictions of their binding energies.

  3. Tribology and Microstructure of PS212 with a Cr2O3 Seal Coat

    Science.gov (United States)

    Sliney, Harold E.; Benoy, Patricia A.; Korenyi-Both, Andras; Dellacorte, Christopher

    1994-01-01

    PS212 is a plasma sprayed metal bonding chrome carbide coating with solid lubricant additives which has lubricating properties at temperatures up to about 900 deg C. The coating is diamond ground to achieve an acceptable tribological surface. But, as with many plasma spray coatings, PS212 is not fully-dense. In this study, a chromium oxide base seal coating is used in an attempt to seal any porosity that is open to the surface of the PS212 coating, and to study the effect of the sealant on the tribological properties of PS212. The results indicate that the seal coating reduces friction and wear when it is applied and then diamond ground leaving a thin layer of seal coating which fills in the surface pits of the PS212 coating.

  4. Intron-exon organization of the active human protein S gene PS. alpha. and its pseudogene PS. beta. : Duplication and silencing during primate evolution

    Energy Technology Data Exchange (ETDEWEB)

    Ploos van Amstel, H.; Reitsma, P.H.; van der Logt, C.P.; Bertina, R.M. (University Hospital, Leiden (Netherlands))

    1990-08-28

    The human protein S locus on chromosome 3 consists of two protein S genes, PS{alpha} and PS{beta}. Here the authors report the cloning and characterization of both genes. Fifteen exons of the PS{alpha} gene were identified that together code for protein S mRNA as derived from the reported protein S cDNAs. Analysis by primer extension of liver protein S mRNA, however, reveals the presence of two mRNA forms that differ in the length of their 5{prime}-noncoding region. Both transcripts contain a 5{prime}-noncoding region longer than found in the protein S cDNAs. The two products may arise from alternative splicing of an additional intron in this region or from the usage of two start sites for transcription. The intron-exon organization of the PS{alpha} gene fully supports the hypothesis that the protein S gene is the product of an evolutional assembling process in which gene modules coding for structural/functional protein units also found in other coagulation proteins have been put upstream of the ancestral gene of a steroid hormone binding protein. The PS{beta} gene is identified as a pseudogene. It contains a large variety of detrimental aberrations, viz., the absence of exon I, a splice site mutation, three stop codons, and a frame shift mutation. Overall the two genes PS{alpha} and PS{beta} show between their exonic sequences 96.5% homology. Southern analysis of primate DNA showed that the duplication of the ancestral protein S gene has occurred after the branching of the orangutan from the African apes. A nonsense mutation that is present in the pseudogene of man also could be identified in one of the two protein S genes of both chimpanzee and gorilla. This implicates that silencing of one of the two protein S genes must have taken place before the divergence of the three African apes.

  5. Pesticide application practices, pest knowledge, and cost-benefits of plantain production in the Bribri-Cabécar Indigenous Territories, Costa Rica.

    Science.gov (United States)

    Polidoro, Beth A; Dahlquist, Ruth M; Castillo, Luisa E; Morra, Matthew J; Somarriba, Eduardo; Bosque-Pérez, Nilsa A

    2008-09-01

    The use of pesticides in the cultivation of cash crops such as banana and plantain is increasing, in Costa Rica and worldwide. Agrochemical use and occupational and environmental exposures in export banana production have been documented in some parts of Central America. However, the extent of agrochemical use, agricultural pest knowledge, and economic components in plantain production are largely unknown in Costa Rica, especially in remote, high-poverty areas such as the Bribri-Cabécar Indigenous Territories. Our objective was to integrate a rapid rural appraisal of indigenous farmer pesticide application practices and pest knowledge with a cost-benefit analysis of plantain production in the Bribri-Cabécar Indigenous Territories, for the development of better agricultural management practices and improved regulatory infrastructure. Interviews conducted with 75 households in 5 indigenous communities showed that over 60% of participants grew plantain with agrochemicals. Of these plantain farmers, over 97% used the insecticide chlorpyrifos, and 84% applied nematicides, 64% herbicides, and 22% fungicides, with only 31% of participants reporting the use of some type of protective clothing during application. The banana weevil (Cosmopolites sordidus Germar) was ranked as the most important agricultural pest by 85% of participants, yet only 28% could associate the adult and larval form. A cost-benefit analysis conducted with a separate group of 26 plantain farmers identified several national markets and one export market for plantain production in the Indigenous Territories. Yearly income averaged US$6200/ha and yearly expenses averaged US$1872/ha, with an average cost-benefit ratio of 3.67 for plantain farmers. Farmers applied an average of 9.7 kg a.i./ha/yr of pesticide products and 375 kg/ha/yr of fertilizer, but those who sold their fruit to the national markets applied more nematicides, herbicides, and fertilizers than those who sold primarily to export markets

  6. Biochemical characterization of recombinant β-carbonic anhydrase (PgiCAb) identified in the genome of the oral pathogenic bacterium Porphyromonas gingivalis.

    Science.gov (United States)

    Del Prete, Sonia; Vullo, Daniela; De Luca, Viviana; AlOthman, Zeid; Osman, Sameh M; Supuran, Claudiu T; Capasso, Clemente

    2015-06-01

    Carbonic anhydrases (CAs, EC 4.2.1.1) belonging to the α-, β-, γ-, δ- and ζ-CAs are ubiquitous metalloenzymes present in prokaryotes and eukaryotes. CAs started to be investigated in detail only recently in pathogenic bacteria, in the search for antibiotics with a novel mechanism of action, since it has been demonstrated that in many such organisms they are essential for the life cycle of the organism. CA inhibition leads to growth impairment or growth defects in several pathogenic bacteria. The microbiota of the human oral mucosa consists of a myriad of bacterial species, Porphyromonas gingivalis being one of them and the major pathogen responsible for the development of chronic periodontitis. The genome of P. gingivalis encodes for a β- and a γ-CAs. Recently, our group purified the recombinant γ-CA (named PgiCA) which was shown to possess a significant catalytic activity for the reaction that converts CO2 to bicarbonate and protons, with a kcat of 4.1 × 10(5 )s(-1) and a kcat/Km of 5.4 × 10(7 )M(-1 )× s(-1). We have also investigated its inhibition profile with a range of inorganic anions such as thiocyanate, cyanide, azide, hydrogen sulfide, sulfamate and trithiocarbonate. Here, we describe the cloning, purification and kinetic parameters of the other class of CA identified in the genome of P. gingivalis, the β-CA, named PgiCAb. This enzyme has a good catalytic activity, with a kcat of 2.8 × 10(5 )s(-1) and a kcat/Km of 1.5 × 10(7 )M(-1 )× s(-1). PgiCAb was also inhibited by the clinically used sulfonamide acetazolamide, with an inhibition constant of 214 nM. The role of CAs as possible virulence factors of P. gingivalis is poorly understood at the moment but their good catalytic activity and the fact that they might be inhibited by a large number of compounds, which may pave the way for finding inhibitors with antibacterial activity that may elucidate these phenomena and lead to novel antibiotics.

  7. PS2013 Satellite Workshop on Photosynthetic Light-Harvesting Systems

    Energy Technology Data Exchange (ETDEWEB)

    Niederman, Robert A. [Rutgers Univ., New Brunswick, NJ (United States); Blankenship, Robert E. [Washington Univ., St. Louis, MO (United States); Frank, Harry A. [Univ. of Connecticut, Storrs, CT (United States)

    2015-02-07

    These funds were used for partial support of the PS2013 Satellite Workshop on Photosynthetic Light-Harvesting Systems, that was held on 8-11 August, 2013, at Washington University, St. Louis, MO. This conference, held in conjunction with the 16th International Congress on Photosynthesis/St. Louis, continued a long tradition of light-harvesting satellite conferences that have been held prior to the previous six international photosynthesis congresses. In this Workshop, the basis was explored for the current interest in replacing fossil fuels with energy sources derived form direct solar radiation, coupled with light-driven electron transport in natural photosynthetic systems and how they offer a valuable blueprint for conversion of sunlight to useful energy forms. This was accomplished through sessions on the initial light-harvesting events in the biological conversion of solar energy to chemically stored energy forms, and how these natural photosynthetic processes serve as a guide to the development of robust bio-hybrid and artificial systems for solar energy conversion into both electricity or chemical fuels. Organized similar to a Gordon Research Conference, a lively, informal and collegial setting was established, highlighting the exchange of exciting new data and unpublished results from ongoing studies. A significant amount of time was set aside for open discussion and interactive poster sessions, with a special session devoted to oral presentations by talented students and postdoctoral fellows judged to have the best posters. This area of research has seen exceptionally rapid progress in recent years, with the availability of a number of antenna protein structures at atomic resolution, elucidation of the molecular surface architecture of native photosynthetic membranes by atomic force microscopy and the maturing of ultrafast spectroscopic and molecular biological techniques for the investigation and manipulation of photosynthetic systems. The conferees

  8. An HDAC2-TET1 switch at distinct chromatin regions significantly promotes the maturation of pre-iPS to iPS cells.

    Science.gov (United States)

    Wei, Tingyi; Chen, Wen; Wang, Xiukun; Zhang, Man; Chen, Jiayu; Zhu, Songcheng; Chen, Long; Yang, Dandan; Wang, Guiying; Jia, Wenwen; Yu, Yangyang; Duan, Tao; Wu, Minjuan; Liu, Houqi; Gao, Shaorong; Kang, Jiuhong

    2015-06-23

    The maturation of induced pluripotent stem cells (iPS) is one of the limiting steps of somatic cell reprogramming, but the underlying mechanism is largely unknown. Here, we reported that knockdown of histone deacetylase 2 (HDAC2) specifically promoted the maturation of iPS cells. Further studies showed that HDAC2 knockdown significantly increased histone acetylation, facilitated TET1 binding and DNA demethylation at the promoters of iPS cell maturation-related genes during the transition of pre-iPS cells to a fully reprogrammed state. We also found that HDAC2 competed with TET1 in the binding of the RbAp46 protein at the promoters of maturation genes and knockdown of TET1 markedly prevented the activation of these genes. Collectively, our data not only demonstrated a novel intrinsic mechanism that the HDAC2-TET1 switch critically regulates iPS cell maturation, but also revealed an underlying mechanism of the interplay between histone acetylation and DNA demethylation in gene regulation. © The Author(s) 2015. Published by Oxford University Press on behalf of Nucleic Acids Research.

  9. Sulfide and pH effects on variable fluorescence of photosystem II in two strains of the cyanobacterium Oscillatoria amphigranulata.

    Science.gov (United States)

    Dodds, W K; Castenholz, R W

    1990-06-01

    Changes in fluorescence of photosystem II (PS II) chlorophyll were used to monitor the in vivo effects of sulfide and pH on photosynthesis by the cyanobacterium Oscillatoria amphigranulata. O. amphigranulata is capable of both oxygenic photosynthesis and sulfide dependent anoxygenic photosynthesis. A genetic variant of O. amphigranulata which photosynthesizes oxygenically at normal rates, but is incapable of anoxygenic photosynthesis and cannot tolerate sulfide, was also used to explore the mode of action of sulfide. In vivo fluorescence responses of PS II chlorophyll in the first few seconds of exposure to light (Kautsky transients) reflected the electrochemical states of PS II and associated electron donors and acceptors. Kautsky transients showed a distinct difference between PS II of the wild type and the variant, but sulfide lowered fluorescence in both. Kautsky transients with sulfide were similar to transients with addition of NH2OH, NH4 (+) or HCN, indicating sulfide interacts with a protein on the donor side of PS II. The fluorescence steady-state (after 2 min) was measured in the presence of sulfide, cyanide and ammonium with pH ranging from 7.2-8.7. Sulfide and cyanide had the most impact at pH 7.2, ammonium at pH 8.7. This suggests that the uncharged forms (HCN, NH3 and H2S) had the strongest effect on PS II, possibly because of increased membrane permeability.

  10. Early temporal short-term memory deficits in double transgenic APP/PS1 mice.

    Science.gov (United States)

    Lagadec, Saioa; Rotureau, Lolita; Hémar, Agnès; Macrez, Nathalie; Delcasso, Sebastien; Jeantet, Yannick; Cho, Yoon H

    2012-01-01

    We tested single APP (Tg2576) transgenic, PS1 (PS1dE9) transgenic, and double APP/PS1 transgenic mice at 3 and 6 months of age on the acquisition of a hippocampal-dependent operant "differential reinforcement of low rate schedule" (DRL) paradigm. In this task mice are required to wait for at least 10 seconds (DRL-10s) between 2 consecutive nose poke responses. Our data showed that while single APP and PS1 transgene expression did not affect DRL learning and performance, mice expressing double APP/PS1 transgenes were impaired in the acquisition of DRL-10s at 6 months, but not at 3 months of age. The same impaired double transgenic mice, however, were perfectly capable of normal acquisition of signaled DRL-10s (SDRL-10s) task, a hippocampal-independent task, wherein mice were required to emit responses when the end of the 10-second delay was signaled by a lighting of the chamber. The age-dependent and early deficits of APP/PS1 mice suggest that the appetitive DRL paradigm is sensitive to the amyloid pathology present in double APP/PS1 mice, and that this mouse line represents a good model with which to study the efficacy of therapeutic strategies against Alzheimer's disease. Copyright © 2012 Elsevier Inc. All rights reserved.

  11. Reprogramming in vivo produces teratomas and iPS cells with totipotency features.

    Science.gov (United States)

    Abad, María; Mosteiro, Lluc; Pantoja, Cristina; Cañamero, Marta; Rayon, Teresa; Ors, Inmaculada; Graña, Osvaldo; Megías, Diego; Domínguez, Orlando; Martínez, Dolores; Manzanares, Miguel; Ortega, Sagrario; Serrano, Manuel

    2013-10-17

    Reprogramming of adult cells to generate induced pluripotent stem cells (iPS cells) has opened new therapeutic opportunities; however, little is known about the possibility of in vivo reprogramming within tissues. Here we show that transitory induction of the four factors Oct4, Sox2, Klf4 and c-Myc in mice results in teratomas emerging from multiple organs, implying that full reprogramming can occur in vivo. Analyses of the stomach, intestine, pancreas and kidney reveal groups of dedifferentiated cells that express the pluripotency marker NANOG, indicative of in situ reprogramming. By bone marrow transplantation, we demonstrate that haematopoietic cells can also be reprogrammed in vivo. Notably, reprogrammable mice present circulating iPS cells in the blood and, at the transcriptome level, these in vivo generated iPS cells are closer to embryonic stem cells (ES cells) than standard in vitro generated iPS cells. Moreover, in vivo iPS cells efficiently contribute to the trophectoderm lineage, suggesting that they achieve a more plastic or primitive state than ES cells. Finally, intraperitoneal injection of in vivo iPS cells generates embryo-like structures that express embryonic and extraembryonic markers. We conclude that reprogramming in vivo is feasible and confers totipotency features absent in standard iPS or ES cells. These discoveries could be relevant for future applications of reprogramming in regenerative medicine.

  12. Integration-Free iPS Cells Engineered Using Human Artificial Chromosome Vectors

    Science.gov (United States)

    Hiratsuka, Masaharu; Uno, Narumi; Ueda, Kana; Kurosaki, Hajime; Imaoka, Natsuko; Kazuki, Kanako; Ueno, Etsuya; Akakura, Yutaro; Katoh, Motonobu; Osaki, Mitsuhiko; Kazuki, Yasuhiro; Nakagawa, Masato; Yamanaka, Shinya; Oshimura, Mitsuo

    2011-01-01

    Human artificial chromosomes (HACs) have unique characteristics as gene-delivery vectors, including episomal transmission and transfer of multiple, large transgenes. Here, we demonstrate the advantages of HAC vectors for reprogramming mouse embryonic fibroblasts (MEFs) into induced pluripotent stem (iPS) cells. Two HAC vectors (iHAC1 and iHAC2) were constructed. Both carried four reprogramming factors, and iHAC2 also encoded a p53-knockdown cassette. iHAC1 partially reprogrammed MEFs, and iHAC2 efficiently reprogrammed MEFs. Global gene expression patterns showed that the iHACs, unlike other vectors, generated relatively uniform iPS cells. Under non-selecting conditions, we established iHAC-free iPS cells by isolating cells that spontaneously lost iHAC2. Analyses of pluripotent markers, teratomas and chimeras confirmed that these iHAC-free iPS cells were pluripotent. Moreover, iHAC-free iPS cells with a re-introduced HAC encoding Herpes Simplex virus thymidine kinase were eliminated by ganciclovir treatment, indicating that the HAC safeguard system functioned in iPS cells. Thus, the HAC vector could generate uniform, integration-free iPS cells with a built-in safeguard system. PMID:21998730

  13. Inhibition of the integrin signal constitutes a mouse iPS cell niche.

    Science.gov (United States)

    Higuchi, Sayaka; Yoshina, Sawako; Mitani, Shohei

    2016-09-01

    Stem cells are regulated by their surrounding microenvironments, called niche, such as cell-cell interaction and extracellular matrix. Classically, feeder cells as a niche have been used in the culture of iPS cells from both the mouse and the human. However, the regulation mechanism of stem cells by feeder cells as a niche still have been partially unclear. In this study, we used three murine iPS cell lines, iPS-MEF-Ng-20D-17, iPS-MEF-Ng-178B-5 and iPS-MEF-Fb/Ng-440A-3, which were generated by different reprogramming methods. In general, these cell lines commonly need the feeder cells as a niche to culture. Recently, the effect of substrate stiffness is known in stem cell study. First, we focused on the mechanical properties of feeder cells, and then we speculated that feeder-less culture might be made possible by using molecules in place of the mechanical properties of the niche. Finally, we found that the combination of disintegrin (echistatin) and 2i (GSK3 inhibitor and MEK inhibitor) is a sufficient condition for three murine iPS culture. This novel method of mimicking the murine iPS cell niche may be useful to understand signaling pathways to maintain the pluripotency of stem cells. © 2016 The Authors. Development, Growth & Differentiation published by John Wiley & Sons Australia, Ltd on behalf of Japanese Society of Developmental Biologists.

  14. [Effects of Different Culture Systems on the Hematopoietic Differentiation Ability of iPS Cells].

    Science.gov (United States)

    Fan, Di; He, Wen-Yin; Niu, Xiao-Hua; Ou, Zhan-Hui; Chen, Yu-Chang; Sun, Xiao-Fang

    2016-12-01

    To investigate the in vitro effects of different culture systems on hematopoietic differentiation ability of induced pluripotent stem (iPS) cells. Two culture systems including E8 and mTESR(freeder-free medium), and the classical ES culture medium were chosen for culture of iPS cells. The iPS cells maintaining in above mentioning culcure systems were co-cultured with OP9 cells(murine bone marrow stromal cells) in vitro to be induced to differentiate into hematopoietic stem/progenitor cells. Flow cytometry and real-time quantitative PCR were used to detect the expression of specific hematopoietic markers and the effects of different culture systems on the differentiation of iPS in vitro. iPS cultured in the 3 selected medium could be differentiated into hematopoietic stem cells. Efficiency of hematopoietic differentiation was up to 28.4% in classical ES culture system, which was significantly higher than that in E8 and mTESR system. Under the co-culture with OP9, iPS can differentiate into hematopoietic stem/progenitor cells, which shows higher efficiency when iPS maintained in the ES medium.

  15. A family of small cyclic amphipathic peptides (SCAmpPs) genes in citrus.

    Science.gov (United States)

    Belknap, William R; McCue, Kent F; Harden, Leslie A; Vensel, William H; Bausher, Michael G; Stover, Ed

    2015-04-16

    Citrus represents a crop of global importance both in economic impact and significance to nutrition. Citrus production worldwide is threatened by the disease Huanglongbing (HLB), caused by the phloem-limited pathogen Candidatus Liberibacter spp.. As a source of stable HLB-resistance has yet to be identified, there is considerable interest in characterization of novel disease-associated citrus genes. A gene family of Small Cyclic Amphipathic Peptides (SCAmpPs) in citrus is described. The citrus genomes contain 100-150 SCAmpPs genes, approximately 50 of which are represented in the citrus EST database. These genes encode small ~50 residue precursor proteins that are post-translationally processed, releasing 5-10 residue cyclic peptides. The structures of the SCAmpPs genes are highly conserved, with the small coding domains interrupted by a single intron and relatively extended untranslated regions. Some family members are very highly transcribed in specific citrus tissues, as determined by representation in tissue-specific cDNA libraries. Comparison of the ESTs of related SCAmpPs revealed an unexpected evolutionary profile, consistent with targeted mutagenesis of the predicted cyclic peptide domain. The SCAmpPs genes are displayed in clusters on the citrus chromosomes, with apparent association with receptor leucine-rich repeat protein arrays. This study focused on three SCAmpPs family members with high constitutive expression in citrus phloem. Unexpectedly high sequence conservation was observed in the promoter region of two phloem-expressed SCAmpPs that encode very distinct predicted cyclic products. The processed cyclic product of one of these phloem SCAmpPs was characterized by LC-MS-MS analysis of phloem tissue, revealing properties consistent with a K(+) ionophore. The SCAmpPs amino acid composition, protein structure, expression patterns, evolutionary profile and chromosomal distribution are consistent with designation as ribosomally synthesized defense

  16. Delayed amyloid plaque deposition and behavioral deficits in outcrossed AβPP/PS1 mice.

    Science.gov (United States)

    Couch, Brian A; Kerrisk, Meghan E; Kaufman, Adam C; Nygaard, Haakon B; Strittmatter, Stephen M; Koleske, Anthony J

    2013-04-15

    Alzheimer's disease (AD) is a progressive neurodegenerative dementia characterized by amyloid plaque accumulation, synapse/dendrite loss, and cognitive impairment. Transgenic mice expressing mutant forms of amyloid-β precursor protein (AβPP) and presenilin-1 (PS1) recapitulate several aspects of this disease and provide a useful model system for studying elements of AD progression. AβPP/PS1 mice have been previously shown to exhibit behavioral deficits and amyloid plaque deposition between 4-9 months of age. We crossed AβPP/PS1 animals with mice of a mixed genetic background (C57BL/6 × 129/SvJ) and investigated the development of AD-like features in the resulting outcrossed mice. The onset of memory-based behavioral impairment is delayed considerably in outcrossed AβPP/PS1 mice relative to inbred mice on a C57BL/6 background. While inbred AβPP/PS1 mice develop deficits in radial-arm water maze performance and novel object recognition as early as 8 months, outcrossed AβPP/PS1 mice do not display defects until 18 months. Within the forebrain, we find that inbred AβPP/PS1 mice have significantly higher amyloid plaque burden at 12 months than outcrossed AβPP/PS1 mice of the same age. Surprisingly, inbred AβPP/PS1 mice at 8 months have low plaque burden, suggesting that plaque burden alone cannot explain the accompanying behavioral deficits. Analysis of AβPP processing revealed that elevated levels of soluble Aβ correlate with the degree of behavioral impairment in both strains. Taken together, these findings suggest that animal behavior, amyloid plaque deposition, and AβPP processing are sensitive to genetic differences between mouse strains. Copyright © 2012 Wiley Periodicals, Inc.

  17. Psühholoog Parmak: missioonide vahel peaks sõdur aasta puhkama / Merle Parmak ; intervjueerinud Kadri Ibrus

    Index Scriptorium Estoniae

    Parmak, Merle, 1968-

    2009-01-01

    Intervjuu kaitseväe ühendatud õppeasutuste rakendusuuringute keskuse psühholoogiga sõdurite psühholoogilise nõustamise praegusest olukorrast, posttraumaatilisest stressist, missioonidevahelise puhkeperioodi vajalikkusest

  18. Investigation of the pathogenesis of autoimmune diseases by iPS cells.

    Science.gov (United States)

    Natsumoto, Bunki; Shoda, Hirofumi; Fujio, Keishi; Otsu, Makoto; Yamamoto, Kazuhiko

    2017-01-01

    The pluripotent stem cells have a self-renewal ability and can be differentiated into theoretically all of cell types. The induced pluripotent stem (iPS) cells overcame the ethical problems of the human embryonic stem (ES) cell, and enable pathologic analysis of intractable diseases and drug discovery. The in vitro disease model using disease-specific iPS cells enables repeated analyses of human cells without influence of environment factors. Even though autoimmune diseases are polygenic diseases, autoimmune disease-specific iPS cells are thought to be a promising tool for analyzing the pathogenesis of the diseases and drug discovery in future.

  19. High Performance Computing Application: Solar Dynamo Model Project II, Corona and Heliosphere Component Initialization, Integration and Validation

    Science.gov (United States)

    2015-06-24

    AFRL-RD-PS- TR-2015-0028 AFRL-RD-PS- TR-2015-0028 HIGH PERFORMANCE COMPUTING APPLICATION: SOLAR DYNAMO MODEL PROJECT II; CORONA AND HELIOSPHERE...Dynamo Model Project II, Corona and Heliosphere Component Initialization, Integration and Validation 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6...Approved for public release; distribution is unlimited. 13. SUPPLEMENTARY NOTES 14. ABSTRACT This report reviews the status of current day solar corona and

  20. Amplified degradation of photosystem II D1 and D2 proteins under a mixture of photosynthetically active radiation and UVB radiation : dependence on redox status of photosystem II

    NARCIS (Netherlands)

    Babu, T.S.; Jansen, M.A.K.; Greenberg, B.M.; Gaba, V.; Malkin, S.; Mattoo, A.K.; Edelman, M.

    1999-01-01

    Plants exposed to a mixture of photosynthetically active radiation (PAR) and UVB radiation exhibit a marked boost in degradation of the D1 and D2 photosystem II (PS II) reaction center proteins beyond that predicted by the sum of rates in PAR and UVB alone (amplified degradation). Becausee

  1. File list: DNS.PSC.10.AllAg.iPS_derived_fibroblasts [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available DNS.PSC.10.AllAg.iPS_derived_fibroblasts hg19 DNase-seq Pluripotent stem cell iPS derived... fibroblasts http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/DNS.PSC.10.AllAg.iPS_derived_fibroblasts.bed ...

  2. File list: NoD.PSC.05.AllAg.iPS_derived_fibroblasts [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available NoD.PSC.05.AllAg.iPS_derived_fibroblasts hg19 No description Pluripotent stem cell iPS derived... fibroblasts http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/NoD.PSC.05.AllAg.iPS_derived_fibroblasts.bed ...

  3. File list: InP.PSC.10.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available InP.PSC.10.AllAg.iPS_derived_neural_cells hg19 Input control Pluripotent stem cell iPS derived... neural cells SRX702550 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.PSC.10.AllAg.iPS_derived_neural_cells.bed ...

  4. File list: Pol.PSC.20.AllAg.iPS_derived_fibroblasts [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.PSC.20.AllAg.iPS_derived_fibroblasts hg19 RNA polymerase Pluripotent stem cell iPS derived... fibroblasts http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.PSC.20.AllAg.iPS_derived_fibroblasts.bed ...

  5. File list: NoD.PSC.50.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available NoD.PSC.50.AllAg.iPS_derived_neural_cells hg19 No description Pluripotent stem cell iPS derived... neural cells http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/NoD.PSC.50.AllAg.iPS_derived_neural_cells.bed ...

  6. File list: DNS.PSC.05.AllAg.iPS_derived_fibroblasts [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available DNS.PSC.05.AllAg.iPS_derived_fibroblasts hg19 DNase-seq Pluripotent stem cell iPS derived... fibroblasts http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/DNS.PSC.05.AllAg.iPS_derived_fibroblasts.bed ...

  7. File list: Pol.PSC.20.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.PSC.20.AllAg.iPS_derived_neural_cells hg19 RNA polymerase Pluripotent stem cell iPS derived... neural cells http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.PSC.20.AllAg.iPS_derived_neural_cells.bed ...

  8. File list: Pol.PSC.50.AllAg.iPS_derived_fibroblasts [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.PSC.50.AllAg.iPS_derived_fibroblasts hg19 RNA polymerase Pluripotent stem cell iPS derived... fibroblasts http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.PSC.50.AllAg.iPS_derived_fibroblasts.bed ...

  9. File list: InP.PSC.20.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available InP.PSC.20.AllAg.iPS_derived_neural_cells hg19 Input control Pluripotent stem cell iPS derived... neural cells SRX702550 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.PSC.20.AllAg.iPS_derived_neural_cells.bed ...

  10. File list: Oth.PSC.10.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.PSC.10.AllAg.iPS_derived_neural_cells hg19 TFs and others Pluripotent stem cell iPS derived...X968910 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.PSC.10.AllAg.iPS_derived_neural_cells.bed ...

  11. File list: ALL.PSC.10.AllAg.iPS_derived_fibroblasts [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.10.AllAg.iPS_derived_fibroblasts hg19 All antigens Pluripotent stem cell iPS derived...4,SRX1099982,SRX1099970,SRX1099965,SRX1099961,SRX1099958,SRX1099949 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/ALL.PSC.10.AllAg.iPS_derived_fibroblasts.bed ...

  12. File list: DNS.PSC.20.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available DNS.PSC.20.AllAg.iPS_derived_neural_cells hg19 DNase-seq Pluripotent stem cell iPS derived... neural cells http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/DNS.PSC.20.AllAg.iPS_derived_neural_cells.bed ...

  13. File list: NoD.PSC.05.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available NoD.PSC.05.AllAg.iPS_derived_neural_cells hg19 No description Pluripotent stem cell iPS derived neural... cells http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/NoD.PSC.05.AllAg.iPS_derived_neural_cells.bed ...

  14. File list: His.PSC.50.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.50.AllAg.iPS_derived_neural_cells hg19 Histone Pluripotent stem cell iPS derived neural...archive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.PSC.50.AllAg.iPS_derived_neural_cells.bed ...

  15. File list: DNS.PSC.10.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available DNS.PSC.10.AllAg.iPS_derived_neural_cells hg19 DNase-seq Pluripotent stem cell iPS derived neural... cells http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/DNS.PSC.10.AllAg.iPS_derived_neural_cells.bed ...

  16. File list: ALL.PSC.10.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.10.AllAg.iPS_derived_neural_cells hg19 All antigens Pluripotent stem cell iPS derived neural...hive.biosciencedbc.jp/kyushu-u/hg19/assembled/ALL.PSC.10.AllAg.iPS_derived_neural_cells.bed ...

  17. File list: Unc.PSC.10.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.PSC.10.AllAg.iPS_derived_neural_cells hg19 Unclassified Pluripotent stem cell iPS derived neural... cells http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Unc.PSC.10.AllAg.iPS_derived_neural_cells.bed ...

  18. File list: DNS.PSC.05.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available DNS.PSC.05.AllAg.iPS_derived_neural_cells hg19 DNase-seq Pluripotent stem cell iPS derived neural... cells http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/DNS.PSC.05.AllAg.iPS_derived_neural_cells.bed ...

  19. File list: Unc.PSC.20.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.PSC.20.AllAg.iPS_derived_neural_cells hg19 Unclassified Pluripotent stem cell iPS derived neural... cells http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Unc.PSC.20.AllAg.iPS_derived_neural_cells.bed ...

  20. File list: Oth.PSC.05.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.PSC.05.AllAg.iPS_derived_neural_cells hg19 TFs and others Pluripotent stem cell iPS derived neural...X968908 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.PSC.05.AllAg.iPS_derived_neural_cells.bed ...

  1. File list: His.PSC.20.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.20.AllAg.iPS_derived_neural_cells hg19 Histone Pluripotent stem cell iPS derived neural...archive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.PSC.20.AllAg.iPS_derived_neural_cells.bed ...

  2. File list: ALL.PSC.50.AllAg.iPS_derived_fibroblasts [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.50.AllAg.iPS_derived_fibroblasts hg19 All antigens Pluripotent stem cell iPS...8,SRX1099970,SRX1099949,SRX1099977,SRX1099965,SRX1099969,SRX1099955 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/ALL.PSC.50.AllAg.iPS_derived_fibroblasts.bed ...

  3. File list: His.PSC.10.AllAg.iPS_derived_fibroblasts [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.10.AllAg.iPS_derived_fibroblasts hg19 Histone Pluripotent stem cell iPS der...ived fibroblasts http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.PSC.10.AllAg.iPS_derived_fibroblasts.bed ...

  4. File list: InP.PSC.05.AllAg.iPS_derived_fibroblasts [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available InP.PSC.05.AllAg.iPS_derived_fibroblasts hg19 Input control Pluripotent stem cell iPS... derived fibroblasts http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.PSC.05.AllAg.iPS_derived_fibroblasts.bed ...

  5. File list: Unc.PSC.05.AllAg.iPS_derived_fibroblasts [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.PSC.05.AllAg.iPS_derived_fibroblasts hg19 Unclassified Pluripotent stem cell iPS...1,SRX1099989,SRX1099969,SRX1099949,SRX1099955,SRX1099970,SRX1099965 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Unc.PSC.05.AllAg.iPS_derived_fibroblasts.bed ...

  6. File list: ALL.PSC.20.AllAg.iPS_derived_fibroblasts [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.20.AllAg.iPS_derived_fibroblasts hg19 All antigens Pluripotent stem cell iPS...2,SRX1099961,SRX1099958,SRX1099970,SRX1099949,SRX1099977,SRX1099965 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/ALL.PSC.20.AllAg.iPS_derived_fibroblasts.bed ...

  7. File list: Pol.PSC.10.AllAg.iPS_derived_fibroblasts [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.PSC.10.AllAg.iPS_derived_fibroblasts hg19 RNA polymerase Pluripotent stem cell iPS... derived fibroblasts http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.PSC.10.AllAg.iPS_derived_fibroblasts.bed ...

  8. File list: Oth.PSC.20.AllAg.iPS_derived_fibroblasts [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.PSC.20.AllAg.iPS_derived_fibroblasts hg19 TFs and others Pluripotent stem cell iPS... derived fibroblasts http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.PSC.20.AllAg.iPS_derived_fibroblasts.bed ...

  9. File list: Unc.PSC.50.AllAg.iPS_derived_fibroblasts [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.PSC.50.AllAg.iPS_derived_fibroblasts hg19 Unclassified Pluripotent stem cell iPS...8,SRX1099970,SRX1099949,SRX1099977,SRX1099965,SRX1099969,SRX1099955 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Unc.PSC.50.AllAg.iPS_derived_fibroblasts.bed ...

  10. File list: Oth.PSC.10.AllAg.iPS_derived_fibroblasts [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.PSC.10.AllAg.iPS_derived_fibroblasts hg19 TFs and others Pluripotent stem cell iPS... derived fibroblasts http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.PSC.10.AllAg.iPS_derived_fibroblasts.bed ...

  11. File list: InP.PSC.10.AllAg.iPS_derived_fibroblasts [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available InP.PSC.10.AllAg.iPS_derived_fibroblasts hg19 Input control Pluripotent stem cell iPS... derived fibroblasts http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.PSC.10.AllAg.iPS_derived_fibroblasts.bed ...

  12. File list: His.PSC.05.AllAg.iPS_derived_fibroblasts [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.05.AllAg.iPS_derived_fibroblasts hg19 Histone Pluripotent stem cell iPS der...ived fibroblasts http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.PSC.05.AllAg.iPS_derived_fibroblasts.bed ...

  13. File list: His.PSC.20.AllAg.iPS_derived_fibroblasts [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available His.PSC.20.AllAg.iPS_derived_fibroblasts hg19 Histone Pluripotent stem cell iPS der...ived fibroblasts http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/His.PSC.20.AllAg.iPS_derived_fibroblasts.bed ...

  14. File list: ALL.PSC.20.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.20.AllAg.iPS_derived_neural_cells hg19 All antigens Pluripotent stem cell iPS derived neural...hive.biosciencedbc.jp/kyushu-u/hg19/assembled/ALL.PSC.20.AllAg.iPS_derived_neural_cells.bed ...

  15. File list: Unc.PSC.50.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.PSC.50.AllAg.iPS_derived_neural_cells hg19 Unclassified Pluripotent stem cell iPS derived neural... cells http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Unc.PSC.50.AllAg.iPS_derived_neural_cells.bed ...

  16. File list: Oth.PSC.50.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.PSC.50.AllAg.iPS_derived_neural_cells hg19 TFs and others Pluripotent stem cell iPS derived neural...X968908 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.PSC.50.AllAg.iPS_derived_neural_cells.bed ...

  17. File list: InP.PSC.05.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available InP.PSC.05.AllAg.iPS_derived_neural_cells hg19 Input control Pluripotent stem cell iPS derived neural... cells SRX702550 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/InP.PSC.05.AllAg.iPS_derived_neural_cells.bed ...

  18. File list: Pol.PSC.05.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.PSC.05.AllAg.iPS_derived_neural_cells hg19 RNA polymerase Pluripotent stem cell iPS derived neural... cells http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.PSC.05.AllAg.iPS_derived_neural_cells.bed ...

  19. File list: ALL.PSC.50.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.PSC.50.AllAg.iPS_derived_neural_cells hg19 All antigens Pluripotent stem cell iPS derived neural...hive.biosciencedbc.jp/kyushu-u/hg19/assembled/ALL.PSC.50.AllAg.iPS_derived_neural_cells.bed ...

  20. File list: NoD.PSC.10.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available NoD.PSC.10.AllAg.iPS_derived_neural_cells hg19 No description Pluripotent stem cell iPS derived neural... cells http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/NoD.PSC.10.AllAg.iPS_derived_neural_cells.bed ...

  1. File list: Unc.PSC.05.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.PSC.05.AllAg.iPS_derived_neural_cells hg19 Unclassified Pluripotent stem cell iPS derived neural... cells http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Unc.PSC.05.AllAg.iPS_derived_neural_cells.bed ...

  2. File list: Pol.PSC.10.AllAg.iPS_derived_neural_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.PSC.10.AllAg.iPS_derived_neural_cells hg19 RNA polymerase Pluripotent stem cell iPS derived neural... cells http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.PSC.10.AllAg.iPS_derived_neural_cells.bed ...

  3. Normal Amplitude of Electroretinography and Visual Evoked Potential Responses in AβPP/PS1 Mice.

    Science.gov (United States)

    Leinonen, Henri; Lipponen, Arto; Gurevicius, Kestutis; Tanila, Heikki

    2016-01-01

    Alzheimer's disease has been shown to affect vision in human patients and animal models. This may pose the risk of bias in behavior studies and therefore requires comprehensive investigation. We recorded electroretinography (ERG) under isoflurane anesthesia and visual evoked potentials (VEP) in awake amyloid expressing AβPPswe/PS1dE9 (AβPP/PS1) and wild-type littermate mice at a symptomatic age. The VEPs in response to patterned stimuli were normal in AβPP/PS1 mice. They also showed normal ERG amplitude but slightly shortened ERG latency in dark-adapted conditions. Our results indicate subtle changes in visual processing in aged male AβPP/PS1 mice specifically at a retinal level.

  4. Velocity-independent layer stripping of PP and PS reflection traveltimes

    Digital Repository Service at National Institute of Oceanography (India)

    Dewangan, P.; Tsvankin, I.

    Building accurate interval velocity models is critically important for seismic imaging and AVO (amplitude variation with offset) analysis. Here, we adapt the PP + PS = SS method to develop an exact technique for constructing the interval traveltime...

  5. 7 CFR 1753.26 - Plans and specifications (P&S).

    Science.gov (United States)

    2010-01-01

    ... Buildings § 1753.26 Plans and specifications (P&S). (a) For headquarters and commercial office buildings... workmanship. (3) A detailed building plan. Where the building is to house electronic apparatus, the detailed...

  6. Psühhofüsioloogilised mängud / Kaivo Thomson

    Index Scriptorium Estoniae

    Thomson, Kaivo, 1956-

    2002-01-01

    Rmt.: Thomson, Kaivo. Psühhofüsioloogilised mängud : teooria & värvitoonide, helikõrguste ja liikumiskiiruste eristamisvõime testimine ning arendamine meetodiga "WinPsycho 2000" (CD-1). Tartu : Atlex, 2001.

  7. Efectividad de la fisioterapia respiratoria en pacientes menores de 12 meses con bronquiolitis Estadio II en atención primaria.

    OpenAIRE

    Sainz Zelaia, Iñaki

    2015-01-01

    Pregunta clínica: ¿Es efectivo la fisioterapia respiratoria en lactantes menores de 12 meses con bronquiolitis estadio II? Objetivo: Verificar si la fisioterapia respiratoria en atención primaria reporta beneficioso en cuanto a los signos y síntomas de la bronquiolitis de estadio II a lactantes menores de un año. Metodología: El presente estudio es un ensayo clínico experimental comparativo, aleatorizado paralelo, simple ciego, prospectivo, longitudinal y multicéntrico. Se llevará a cab...

  8. 1000-V, 300-ps pulse-generation circuit using silicon avalanche devices

    Science.gov (United States)

    Benzel, D. M.; Pocha, M. D.

    1985-07-01

    A Marx configured avalanche transistor string and a pulse rise-time peaking diode are used to generate pulses of >1000 V into a 50-Ω load with rise times of less than 300 ps. The trigger delay of this circuit is about 7-10 ns, with jitter <100 ps. This circuit has been used to generate pulses at a repetition rate up to 5 kHz.

  9. Molecular Cloning and Expression Analysis of Cryptochrome Gene PsCRY2 in Tree Peony

    Directory of Open Access Journals (Sweden)

    Xiuxia REN

    2016-11-01

    Full Text Available Cryptochromes are blue/ultraviolet-A (UV-A light receptors involved in regulating various aspects of plant growth and development. Investigations of the structure and functions of cryptochromes in plants have largely focused on herbaceous plants. However, few data on the function of CRY2 are available in woody plants. In this study, a cryptochrome 2 (CRY2 gene was isolated from Paeonia suffruticosa by Reverse Transcription Polymerase Chain Reaction (RT-PCR. Sequence alignment and motif analysis showed that the deduced amino acids contained a PHR domain near the amino terminus and a CCT domain near the carboxy terminus. PsCRY2 showed high identity with AtCRY2 of Arabidopsis. Phylogenetic analysis indicated that it was closely related to Citrus sinensis. Gene expression analysis revealed that the highest expression levels of PsCRY2 occurred in the bud and seed embryo of P. suffruticosa, followed by the roots, stems, and leaves. PsCRY2 was upregulated during the entire process of bud differentiation, whereas this was downregulated during the early stage of bud development and upregulated in the middle and late stages. The highest level of PsCRY2 expression was observed in the big bell-like flower buds. These results suggested that PsCRY2 plays an important role in both bud differentiation and bud development. The expression patterns of PsCRY2 in the buds of ‘Luoyanghong’ and ‘Qiufa 1’ were similar, whereas that in the buds of ‘Qiufa 1’ was significantly higher than in the buds of ‘Luoyanghong’. The buds of plants subjected to different photoperiod treatments exhibited variations in PsCRY2 expression patterns. The expression of PsCRY2 decreased during bud sprouting and in the small bell-like flower buds that were subjected to short-day photoperiod compared to that observed under long-day photoperiod.

  10. APP/PS1 transgenic mice treated with aluminum: an update of Alzheimer's disease model.

    Science.gov (United States)

    Zhang, Q L; Jia, L; Jiao, X; Guo, W L; Ji, J W; Yang, H L; Niu, Q

    2012-01-01

    There is still no animal model available that can mimic all the cognitive, behavioral, biochemical, and histopathological abnormalities observed in patients with Alzheimer's disease (AD). We undertook to consider the interaction between genetic factors, including amyloid precursor protein (APP) and presenilin-1 (PS1), and environmental factors, such as Aluminum (Al) in determining susceptibility outcomes when studying the pathogenesis of AD. In this article, we provide an AD model in APP/PS1 transgenic mice triggered by Al. The animal model was established via intracerebral ventricular microinjection of aluminum chloride once a day for 5 days in APP/PS1 transgenic mice. Twenty wild type (WT) mice and 20 APP/PS1 transgenic (TG) mice were separately divided into 2 groups (control and Al group), and a stainless steel injector with stopper was used for microinjection into the left-lateral cerebral ventricle of each mouse. The Morris water maze task was used to evaluate behavioral function of learning and memory ability on the 20th day after the last injection. This AD model's brain was analyzed by: (1) amyloid beta immunohistochemical staining; (2) Tunnel staining; (3) apoptotic rates; (4) caspase-3 gene expression. Here, decrease of cognitive ability and neural cells loss were shown in APP/PS1 transgenic mice exposed to Al, which were more extensive than those in APP/PS1 TG alone and WT mice exposed to Al alone. These findings indicate that there is a close relationship between over-expression of APP and PS1 genes and Al overload. It is also suggested that APP/PS1 TG mice exposed to Al have potential value for improving AD models.

  11. Public Health Impact After the Introduction of PsA-TT: The First 4 Years.

    OpenAIRE

    Diomandé, FV; Djingarey, MH; Daugla, DM; Novak, RT; Kristiansen, PA; Collard, JM; Gamougam, K; Kandolo, D; Mbakuliyemo, N; Mayer, L.; Stuart, J; Clark , T.; Tevi-Benissan, C; Perea, WA; Preziosi, MP

    2015-01-01

    Background. ?During the first introduction of a group A meningococcal vaccine (PsA-TT) in 2010?2011 and its rollout from 2011 to 2013, >150 million eligible people, representing 12 hyperendemic meningitis countries, have been vaccinated. Methods. ?The new vaccine effectiveness evaluation framework was established by the World Health Organization and partners. Meningitis case-based surveillance was strengthened in PsA-TT first-introducer countries, and several evaluation studies were conducted...

  12. Psühholoogilise kriminoloogia arengujoooni. [1.-2. osa] / Jüri Saar

    Index Scriptorium Estoniae

    Saar, Jüri, 1956-

    1999-01-01

    C. Beccaria (1738-1794), J. Benthami (1748-1832), C. Lombroso (1835-1909), E. Durkheimi (1858-1917), A. Binet (1857-1911), H. H. Goddardi (1866-1957) ja S. Freudi (1856-1939) kriminoloogia-alastest teooriatest. Psühhopaatia ja kuritegeliku käitumise vahekorrast, H. J. Eysenck'i (1916-1997) teooriast, biheiviorismist jt. sotsioloogilise ja psühholoogilise kriminoloogia teooriatest

  13. Perceptions of Community Health Workers (CHWs/PS) in the U.S.-Mexico border HEART CVD study.

    Science.gov (United States)

    Balcazar, Hector G; Wise, Sherrie; Redelfs, Alisha; Rosenthal, E Lee; de Heer, Hendrik D; Burgos, Ximena; Duarte-Gardea, Maria

    2014-02-10

    Although prior research has shown that Community Health Workers/Promotores de Salud (CHW/PS) can facilitate access to care, little is known about how CHW/PS are perceived in their community. The current study reports the findings of a randomized telephone survey conducted in a high-risk urban community environment along the U.S.-Mexico border. In preparation for a community-based CHW/PS intervention called the HEART ecological study, the survey aimed to assess perceptions of CHW/PS, availability and utilization of community resources (recreational and nutrition related) and health behaviors and intentions. A total of 7,155 calls were placed to complete 444 surveys in three zip codes in El Paso, Texas. Results showed that participants felt that healthful community resources were available, but utilization was low and variable: 35% reported going to a park, 20% reported having taken a health class, few reported using a gym (12%), recreation center (8%), or YMCA/YWCA (0.9%). Awareness and utilization of CHW/PS services were low: 20% of respondents had heard of CHW/PS, with 8% reporting previous exposure to CHW/PS services. Upon review of a definition of CHW/PS, respondents expressed positive views of CHW/PS and their value in the healthcare system. Respondents who had previous contact with a CHW/PS reported a significantly more positive perception of the usefulness of CHW/PS (p = 0.006), were more likely to see CHW/PS as an important link between providers and patients (p = 0.008), and were more likely to ask a CHW/PS for help (p = 0.009). Participants who utilized CHW/PS services also had significantly healthier intentions to reduce fast food intake. Future research is needed to evaluate if CHW/PS can facilitate utilization of available community resources such as recreational facilities among Hispanic border residents at risk for CVD.

  14. Perceptions of Community Health Workers (CHWs/PS in the U.S.-Mexico Border HEART CVD Study

    Directory of Open Access Journals (Sweden)

    Hector G. Balcazar

    2014-02-01

    Full Text Available Although prior research has shown that Community Health Workers/Promotores de Salud (CHW/PS can facilitate access to care, little is known about how CHW/PS are perceived in their community. The current study reports the findings of a randomized telephone survey conducted in a high-risk urban community environment along the U.S.-Mexico border. In preparation for a community-based CHW/PS intervention called the HEART ecological study, the survey aimed to assess perceptions of CHW/PS, availability and utilization of community resources (recreational and nutrition related and health behaviors and intentions. A total of 7,155 calls were placed to complete 444 surveys in three zip codes in El Paso, Texas. Results showed that participants felt that healthful community resources were available, but utilization was low and variable: 35% reported going to a park, 20% reported having taken a health class, few reported using a gym (12%, recreation center (8%, or YMCA/YWCA (0.9%. Awareness and utilization of CHW/PS services were low: 20% of respondents had heard of CHW/PS, with 8% reporting previous exposure to CHW/PS services. Upon review of a definition of CHW/PS, respondents expressed positive views of CHW/PS and their value in the healthcare system. Respondents who had previous contact with a CHW/PS reported a significantly more positive perception of the usefulness of CHW/PS (p = 0.006, were more likely to see CHW/PS as an important link between providers and patients (p = 0.008, and were more likely to ask a CHW/PS for help (p = 0.009. Participants who utilized CHW/PS services also had significantly healthier intentions to reduce fast food intake. Future research is needed to evaluate if CHW/PS can facilitate utilization of available community resources such as recreational facilities among Hispanic border residents at risk for CVD.

  15. PS-wave Q estimation based on the P-wave Q values

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Y.; Lu, J.; Shi, Y.; Yang, C. [Chinese Academy of Sciences, Beijing (China). Inst. of Geology & Geophysics

    2009-12-15

    Through assumption of the equivalent velocity and equivalent quality factor of the PS-wave, in visco-elastic media, PS-wave Q estimation can be realized with the P-wave quality factor and P- to S-wave velocity ratio. For sedimentary rock, which has strong agglutination, the internal friction is mainly contributed by the shear friction along crevices or inter-granular crevices, so that a relationship between PS-wave Q values and P-wave Q values can be built up even when the S-wave Q values are unknown. In the estimation of the PS-wave quality factor, the P- to S-wave velocity ratio can be computed based on two-way traveltimes of PP and PS events respectively, in order to avoid the influence of the inaccuracy of P- and S-wave velocities. The method is demonstrated with a zero-offset VSP data in a coal-mining field. The results of P-wave and PS-wave Q values estimated show a consistency with lithology revealed from drilling.

  16. Reciprocal relationship between APP positioning relative to the membrane and PS1 conformation

    Directory of Open Access Journals (Sweden)

    Jones Phill

    2011-02-01

    Full Text Available Abstract Background Several familial Alzheimer disease (FAD mutations within the transmembrane region of the amyloid precursor protein (APP increase the Aβ42/40 ratio without increasing total Aβ production. In the present study, we analyzed the impact of FAD mutations and γ-secretase modulators (GSMs that alter the Aβ42/40 ratio on APP C-terminus (CT positioning relative to the membrane, reasoning that changes in the alignment of the APP intramembranous domain and presenilin 1 (PS1 may impact the PS1/γ-secretase cleavage site on APP. Results By using a Förster resonance energy transfer (FRET-based technique, fluorescent lifetime imaging microscopy (FLIM, we show that Aβ42/40 ratio-modulating factors which target either APP substrate or PS1/γ-secretase affect proximity of the APP-CT to the membrane and change PS1 conformation. Conclusions Thus, we propose that there is a reciprocal relationship between APP-CT positioning relative to the membrane and PS1 conformation, suggesting that factors that modulate either APP positioning in the membrane or PS1 conformation could be exploited therapeutically.

  17. Efficient genomic correction methods in human iPS cells using CRISPR-Cas9 system.

    Science.gov (United States)

    Li, Hongmei Lisa; Gee, Peter; Ishida, Kentaro; Hotta, Akitsu

    2016-05-15

    Precise gene correction using the CRISPR-Cas9 system in human iPS cells holds great promise for various applications, such as the study of gene functions, disease modeling, and gene therapy. In this review article, we summarize methods for effective editing of genomic sequences of iPS cells based on our experiences correcting dystrophin gene mutations with the CRISPR-Cas9 system. Designing specific sgRNAs as well as having efficient transfection methods and proper detection assays to assess genomic cleavage activities are critical for successful genome editing in iPS cells. In addition, because iPS cells are fragile by nature when dissociated into single cells, a step-by-step confirmation during the cell recovery process is recommended to obtain an adequate number of genome-edited iPS cell clones. We hope that the techniques described here will be useful for researchers from diverse backgrounds who would like to perform genome editing in iPS cells. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

  18. [Retinal regeneration with iPS cells ‒ Clinical trials for retinal degenerative disorders].

    Science.gov (United States)

    Sugita, Sunao

    2015-01-01

    Potential for re-programming cells has become widely accepted as a tool for obtaining transplantation materials. There has been great interest in cell-based therapies, including retinal transplants, because there is a reduced risk of immune rejection. Stem cells have the capacity for self-renewal plus the capacity to generate several differentiated cells. They are derived from many sources including human adult-derived induced pluripotent stem (iPS) cells and have found early application in the context of ocular disease. In results, our established iPS-retinal pigment epithelial (RPE) cells are high-quality RPE cells. iPS cells-derived RPE cells clearly showed polygonal morphology (mostly hexagonal) and contained melanin. Moreover, RPE cells derived from iPS cells had many characteristics of mature RPE cells in vivo, but no characteristics of pluripotent stem cells. Recently, we transplanted RPE cell sheets to treat a patient with wet age-related macular degeneration (September, 2014). In addition, we are now conducting experiments to determine whether allogeneic T cells can recognize iPS-RPE cells from HLA-A, B, DRB1 locus homozygote donors. iPS bank might be useful as allografts in retinal disorders, if the recipient T cells cannot respond to allogeneic RPE cells because of match to some of main HLA antigens.

  19. iPS cell-derived cardiogenicity is hindered by sustained integration of reprogramming transgenes.

    Science.gov (United States)

    Martinez-Fernandez, Almudena; Nelson, Timothy J; Reyes, Santiago; Alekseev, Alexey E; Secreto, Frank; Perez-Terzic, Carmen; Beraldi, Rosanna; Sung, Hoon-Ki; Nagy, Andras; Terzic, Andre

    2014-10-01

    Nuclear reprogramming inculcates pluripotent capacity by which de novo tissue differentiation is enabled. Yet, introduction of ectopic reprogramming factors may desynchronize natural developmental schedules. This study aims to evaluate the effect of imposed transgene load on the cardiogenic competency of induced pluripotent stem (iPS) cells. Targeted inclusion and exclusion of reprogramming transgenes (c-MYC, KLF4, OCT4, and SOX2) was achieved using a drug-inducible and removable cassette according to the piggyBac transposon/transposase system. Pulsed transgene overexpression, before iPS cell differentiation, hindered cardiogenic outcomes. Delayed in counterparts with maintained integrated transgenes, transgene removal enabled proficient differentiation of iPS cells into functional cardiac tissue. Transgene-free iPS cells generated reproducible beating activity with robust expression of cardiac α-actinin, connexin 43, myosin light chain 2a, α/β-myosin heavy chain, and troponin I. Although operational excitation-contraction coupling was demonstrable in the presence or absence of transgenes, factor-free derivatives exhibited an expedited maturing phenotype with canonical responsiveness to adrenergic stimulation. A disproportionate stemness load, caused by integrated transgenes, affects the cardiogenic competency of iPS cells. Offload of transgenes in engineered iPS cells ensures integrity of cardiac developmental programs, underscoring the value of nonintegrative nuclear reprogramming for derivation of competent cardiogenic regenerative biologics. © 2014 American Heart Association, Inc.

  20. Induced Pluripotent Stem (iPS) Cells in Dentistry: A Review.

    Science.gov (United States)

    Malhotra, Neeraj

    2016-11-30

    iPS cells are derived from somatic cells via transduction and expression of selective transcription factors. Both viral-integrating (like retroviral) and non-integrating (like, mRNA or protein-based) techniques are available for the production of iPS cells. In the field of dentistry, iPS cells have been derived from stem cells of apical papilla, dental pulp stem cells, and stem cells from exfoliated deciduous teeth, gingival and periodontal ligament fibroblasts, and buccal mucosa fibroblasts. iPS cells have the potential to differentiate into all derivatives of the 3 primary germ layers i.e. ectoderm, endoderm, and mesoderm. They are autogeneically accessible, and can produce patient-specific or disease-specific cell lines without the issue of ethical controversy. They have been successfully tested to produce mesenchymal stem cells-like cells, neural crest-like cells, ameloblasts-like cells, odontoblasts-like cells, and osteoprogenitor cells. These cells can aid in regeneration of periodontal ligament, alveolar bone, cementum, dentin-pulp complex, as well as possible Biotooth formation. However certain key issues like, epigenetic memory of iPS cells, viral-transduction, tumorgenesis and teratoma formation need to be overcome, before they can be successfully used in clinical practice. The article discusses the sources, pros and cons, and current applications of iPS cells in dentistry with an emphasis on encountered challenges and their solutions.

  1. 10th anniversary of iPS cells: the challenges that lie ahead.

    Science.gov (United States)

    Aoi, Takashi

    2016-09-01

    In 2006, induced pluripotent stem (iPS) cells were generated by Yamanaka and Takahashi for the first time from a mouse fibroblast culture by introducing four factors. In the 10 years since then, this breakthrough discovery has been making waves in the fields of biology and medical science. For example, various technologies for generating iPS cells have been developed, and we have cultivated a better understanding of the mechanisms involved in reprogramming. In addition, many researchers have explored the applications of iPS cells, such as drug discovery, the study of disease mechanisms and regenerative medicine, and the development of advanced technologies for the differentiation and qualification of the cells. Furthermore, the concept of iPS cell generation has inspired a number of studies that do not use iPS cells. We herein review and discuss the past, present and future of iPS cells and their related issues. © The Authors 2016. Published by Oxford University Press on behalf of the Japanese Biochemical Society. All rights reserved.

  2. PS-OCT of occlusal and interproximal caries lesions viewed from occlusal surfaces

    Science.gov (United States)

    Ngaotheppitak, Patara; Darling, Cynthia L.; Fried, Daniel; Bush, Jeff; Bell, Steve

    2006-02-01

    Previous studies have demonstrated that Polarization Sensitive Optical Coherence Tomography (PS-OCT) can be used to image early dental caries. The primary objective of this study was to compare the measured reflectivity of natural occlusal caries lesions with the relative mineral loss measured using digital microradiography. There was excellent agreement between the increase in the integrated reflectivity in the perpendicular polarization axis of the PS-OCT system and the increase in the integrated mineral loss or lesion severity for occlusal lesions. Therefore, PS-OCT is ideally suited to image natural caries lesions in the important occlusal surfaces for the assessment of the lesion severity and activity. A secondary objective was to compare the performance of a new autocorrelator-based PS-OCT system employing a novel polarization-switching probe with our polarization-maintaining fiber based PS-OCT system, both operating at 1310-nm. The new PS-OCT system produced clean images with no artifacts and achieved high penetration depth. Yet a third objective was to determine if interproximal lesions can be imaged from the occlusal surface (from above) since interproximal lesions may only be accessible in vivo from buccal or lingual surfaces or from the occlusal surface. Simulated and natural interproximal caries lesions were imaged from the occlusal surfaces as long as there was no intervening dentin.

  3. The S(1) split signal of photosystem II; a tyrosine-manganese coupled interaction.

    Science.gov (United States)

    Cox, Nicholas; Ho, Felix M; Pewnim, Naray; Steffen, Ronald; Smith, Paul J; Havelius, Kajsa G V; Hughes, Joseph L; Debono, Lesley; Styring, Stenbjörn; Krausz, Elmars; Pace, Ron J

    2009-07-01

    Detailed optical and EPR analyses of states induced in dark-adapted PS II membranes by cryogenic illumination permit characterization and quantification of all pigment derived donors and acceptors, as well as optically silent (in the visible, near infrared) species which are EPR active. Near complete turnover formation of Q(A)((-)) is seen in all centers, but with variable efficiency, depending on the donor species. In minimally detergent-exposed PS II membranes, negligible (ii) reduced cytochrome b(559) ( approximately 30-50% centers), and (iii) an organic donor, possibly an amino acid side chain, ( approximately 30% centers).

  4. A Myb transcription factor of Phytophthora sojae, regulated by MAP kinase PsSAK1, is required for zoospore development.

    Directory of Open Access Journals (Sweden)

    Meng Zhang

    Full Text Available PsSAK1, a mitogen-activated protein (MAP kinase from Phytophthora sojae, plays an important role in host infection and zoospore viability. However, the downstream mechanism of PsSAK1 remains unclear. In this study, the 3'-tag digital gene expression (DGE profiling method was applied to sequence the global transcriptional sequence of PsSAK1-silenced mutants during the cysts stage and 1.5 h after inoculation onto susceptible soybean leaf tissues. Compared with the gene expression levels of the recipient P. sojae strain, several candidates of Myb family were differentially expressed (up or down in response to the loss of PsSAK1, including of a R2R3-type Myb transcription factor, PsMYB1. qRT-PCR indicated that the transcriptional level of PsMYB1 decreased due to PsSAK1 silencing. The transcriptional level of PsMYB1 increased during sporulating hyphae, in germinated cysts, and early infection. Silencing of PsMYB1 results in three phenotypes: a no cleavage of the cytoplasm into uninucleate zoospores or release of normal zoospores, b direct germination of sporangia, and c afunction in zoospore-mediated plant infection. Our data indicate that the PsMYB1 transcription factor functions downstream of MAP kinase PsSAK1 and is required for zoospore development of P. sojae.

  5. Cartilage collagen type II seromarker patterns in axial spondyloarthritis and psoriatic arthritis

    DEFF Research Database (Denmark)

    Munk, Heidi Lausten; Gudmann, Natasja Staehr; Christensen, Anne Friesgaard

    2016-01-01

    The aim of the study was to assess the possible association between type II collagen turnover seromarkers and disease profile in patients with axial spondyloarthritis (SpA) and psoriatic arthritis (PsA). Outpatients with axial SpA (n = 110) or PsA (n = 101) underwent clinical examination including......-smokers, 0.43 ng/ml (p = 0.02), while PIIANP was higher in HLA-B27 positive, 2312 ng/ml versus negative patients, 2021 ng/ml (p = 0.03). In PsA, PIIANP and C2M did not differ between patients and controls, but PIIANP was elevated in patients not receiving DMARDs, 2726 ng/ml. In PsA, PIIANP and C2M did...... not differ according to smoking and HLA-B27. Cartilage degradation assessed by C2M is increased in SpA irrespective of treatment but not in PsA. Cartilage synthesis reflected by PIIANP is increased in untreated SpA and PsA. PIIANP correlates with CRP in SpA while not in PsA. In DMARD-naïve SpA but not in PsA...

  6. Validity and reliability of the Dutch adaptation of the Psoriatic Arthritis Quality of Life (PsAQoL Questionnaire.

    Directory of Open Access Journals (Sweden)

    Freke Wink

    Full Text Available OBJECTIVE: The Psoriatic Arthritis Quality of Life (PsAQoL questionnaire is a disease- specific instrument developed to measure quality of life (QoL in patients with psoriatic arthritis (PsA. The aim of this study was to translate the measure into Dutch and to determine its psychometric properties. METHOD: Translation of the original English PsAQoL into Dutch was performed by bilingual and lay panel. Ten field-test interviews with PsA patients were performed to assess face and content validity. In total, 211 PsA patients were included in a test-retest postal survey to investigate the reliability and construct validity of the Dutch adaptation of the PsAQoL. The PsAQoL, Health Assessment Questionnaire (HAQ and Skindex-17 were administered on two different occasions approximately two weeks apart. RESULTS: The Dutch version of the PsAQoL was found to be relevant, understandable and easy to complete in only a few minutes. It correlated as expected with the HAQ (Spearman's ρ = 0.72 and the 2 subscales of the Skindex-17 (ρ = 0.40 for the psychosocial and ρ = 0.46 for the symptom scale. Furthermore, the measure had good internal consistency (Cronbach's α = 0.92 and test-retest reliability (ρ = 0.89. The PsAQoL was able to define groups of patients based on self-reported general health status, self-reported severity of PsA and flare of arthritis. Duration of PsA did not influence PsAQoL scores. CONCLUSIONS: The Dutch version of the PsAQoL is a valid and reliable questionnaire suitable for use in clinical or research settings to asses PsA-specific QoL.

  7. Modeling Alzheimer's disease with human induced pluripotent stem (iPS) cells.

    Science.gov (United States)

    Mungenast, Alison E; Siegert, Sandra; Tsai, Li-Huei

    2016-06-01

    In the last decade, induced pluripotent stem (iPS) cells have revolutionized the utility of human in vitro models of neurological disease. The iPS-derived and differentiated cells allow researchers to study the impact of a distinct cell type in health and disease as well as performing therapeutic drug screens on a human genetic background. In particular, clinical trials for Alzheimer's disease (AD) have been failing. Two of the potential reasons are first, the species gap involved in proceeding from initial discoveries in rodent models to human studies, and second, an unsatisfying patient stratification, meaning subgrouping patients based on the disease severity due to the lack of phenotypic and genetic markers. iPS cells overcome this obstacles and will improve our understanding of disease subtypes in AD. They allow researchers conducting in depth characterization of neural cells from both familial and sporadic AD patients as well as preclinical screens on human cells. In this review, we briefly outline the status quo of iPS cell research in neurological diseases along with the general advantages and pitfalls of these models. We summarize how genome-editing techniques such as CRISPR/Cas9 will allow researchers to reduce the problem of genomic variability inherent to human studies, followed by recent iPS cell studies relevant to AD. We then focus on current techniques for the differentiation of iPS cells into neural cell types that are relevant to AD research. Finally, we discuss how the generation of three-dimensional cell culture systems will be important for understanding AD phenotypes in a complex cellular milieu, and how both two- and three-dimensional iPS cell models can provide platforms for drug discovery and translational studies into the treatment of AD. Copyright © 2015 Elsevier Inc. All rights reserved.

  8. Phenotypic correction of murine hemophilia A using an iPS cell-based therapy.

    Science.gov (United States)

    Xu, Dan; Alipio, Zaida; Fink, Louis M; Adcock, Dorothy M; Yang, Jianchang; Ward, David C; Ma, Yupo

    2009-01-20

    Hemophilia A is caused by mutations within the Factor VIII (FVIII) gene that lead to depleted protein production and inefficient blood clotting. Several attempts at gene therapy have failed for various reasons-including immune rejection. The recent generation of induced pluripotent stem (iPS) cells from somatic cells by the ectopic expression of 3 transcription factors, Oct4, Sox2, and Klf4, provides a means of circumventing the immune rejection barrier. To date, iPS cells appear to be indistinguishable from ES cells and thus provide tremendous therapeutic potential. Here we prepared murine iPS cells from tail-tip fibroblasts and differentiated them to both endothelial cells and endothelial progenitor cells by using the embryoid body differentiation method. These iPS cells express major ES cell markers such as Oct4, Nanog, SSEA-1, alkaline phosphatase, and SALL4. Endothelial/endothelial progenitor cells derived from iPS cells expressed cell-specific markers such as CD31, CD34, and Flk1 and secreted FVIII protein. These iPS-derived cells were injected directly into the liver of irradiated hemophilia A mice. At various times after transplantation (7-90 days) hemophilia A mice and their control mice counterparts were challenged by a tail-clip bleeding assay. Nontransplanted hemophilia A mice died within a few hours, whereas transplanted mice survived for more than 3 months. Plasma FVIII levels increased in transplanted hemophilia A mice during this period to 8% to 12% of wild type and corrected the hemophilia A phenotype. Our studies provide additional evidence that iPS cell therapy may be able to treat human monogenetic disorders in the future.

  9. Chronic Stress Contributes to Cognitive Dysfunction and Hippocampal Metabolic Abnormalities in APP/PS1 Mice

    Directory of Open Access Journals (Sweden)

    Bing Han

    2017-03-01

    Full Text Available Background/Aims: Stress response is determined by the brain, and the brain is a sensitive target for stress. Our previous experiments have confirmed that once the stress response is beyond the tolerable limit of the brain, particularly that of the hippocampus, it will have deleterious effects on hippocampal structure and function; however, the metabolic mechanisms for this are not well understood. Methods: Here, we used morris water maze, elisa and gas chromatography-time of flight/mass spectrometry to observe the changes in cognition, neuropathology and metabolomics in the hippocampus of APP/PS1 mice and wild-type (C57 mice caused by chronic unpredictable mild stress (CUMS, we also further explored the correlation between cognition and metabolomics. Results: We found that 4 weeks of CUMS aggravated cognitive impairment and increased amyloid-β deposition in APP/PS1 mice, but did not affect C57 mice. Under non-stress conditions, compared with C57 mice, there were 8 different metabolites in APP/PS1 mice. However, following CUMS, 3 different metabolites were changed compared with untreated C57 mice. Compared to APP/PS1 mice, there were 7 different metabolites in APP/PS1+CUMS mice. Among these alterations, 3-hydroxybutyric acid, valine, serine, beta-alanine and o-phosphorylethanolamine, which are involved in sphingolipid metabolism, synthesis and degradation of ketone bodies, and amino acid metabolism. Conclusion: The results indicate that APP/PS1 mice are more vulnerable to stress than C57 mice, and the metabolic mechanisms of stress-related cognitive impairment in APP/PS1 mice are related to multiple pathways and networks, including sphingolipid metabolism, synthesis and degradation of ketone bodies, and amino acid metabolism.

  10. Performance of a dual-process PVD/PS tungsten coating structure under deuterium ion irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hyunmyung; Lee, Ho Jung; Kim, Sung Hwan [Department of Nuclear and Quantum Engineering, KAIST, Daejeon (Korea, Republic of); Song, Jae-Min [Department of Nuclear Engineering, Seoul National University, Seoul (Korea, Republic of); Jang, Changheui, E-mail: chjang@kaist.ac.kr [Department of Nuclear and Quantum Engineering, KAIST, Daejeon (Korea, Republic of)

    2016-11-01

    Highlights: • D{sup +} irradiation performance of a dual-process PVD/PS W coating was evaluated. • Low-energy plasmas exposure of 100 eV D{sup +} with 1.17 × 10{sup 21} D/s{sup −1} m{sup 2} flux was applied. • After D ion irradiation, flakes were observed on the surface of the simple PS coating. • While, sub-μm size protrusions were observed for dual-process PVD/PS W coating. • Height of D spike in depth profile was lower for dual-process PVD/PS W coating. - Abstract: A dual-process coating structure was developed on a graphite substrate to improve the performance of the coating structure under anticipated operating condition of fusion devices. A thin multilayer W/Mo coating (6 μm) was deposited by physical vapor deposition (PVD) method with a variation of Mo interlayer thickness on plasma spray (PS) W coating (160 μm) of a graphite substrate panel. The dual-process PVD/PS W coatings then were exposed to 3.08 × 10{sup 24} D m{sup −2} of 100 eV D ions with a flux of 1.71 × 10{sup 21} D m{sup −2} s{sup −1} in an electron cyclotron resonance (ECR) chamber. After irradiation, surface morphology and D depth profiles of the dual-process coating were analyzed and compared to those of the simple PS W coating. Both changes in surface morphology and D retention were strongly dependent on the microstructure of surface coating. Meanwhile, the existence of Mo interlayer seemed to have no significant effect on the retention of deuterium.

  11. UVB-induced DNA and photosystem II damage in two intertidal green macroalgae: distinct survival strategies in UV-screening and non-screening Chlorophyta.

    Science.gov (United States)

    Pescheck, Frauke; Lohbeck, Kai T; Roleda, Michael Y; Bilger, Wolfgang

    2014-03-05

    Ultraviolet-B-induced (UVB, 280-315 nm) accumulation of cyclobutane pyrimidine dimers (CPDs) and deactivation of photosystem II (PS II) was quantified in two intertidal green macroalgae, Ulva clathrata and Rhizoclonium riparium. The species were chosen due to their shared habitats but contrasting UVB screening potentials. In the non-screening U. clathrata CPDs accumulated and PS II activity declined as a linear function of applied UVB irradiance. In R. riparium UVB-induced damage was significantly lower than in U. clathrata, demonstrating an efficient UVB protection of DNA and PS II by screening. Based on the UVB irradiance reaching the chloroplasts, both species showed an identical intrinsic sensitivity of PS II towards UVB, but DNA lesions accumulated slower in U. clathrata. While repair of CPDs was similar in both species, U. clathrata was capable of restoring its PS II function decidedly faster than R. riparium. In R. riparium efficient screening may represent an adaptation to its high light habitat, whereas in U. clathrata high repair rates of PS II appear to be important to survive natural UVB exposure. The role of shading of the nucleus by the large chloroplasts in U. clathrata is discussed. Copyright © 2014 Elsevier B.V. All rights reserved.

  12. (II) complexes

    African Journals Online (AJOL)

    activities of Schiff base tin (II) complexes. Neelofar1 ... Conclusion: All synthesized Schiff bases and their Tin (II) complexes showed high antimicrobial and ...... Singh HL. Synthesis and characterization of tin (II) complexes of fluorinated Schiff bases derived from amino acids. Spectrochim Acta Part A: Molec Biomolec.

  13. Application of dissolved air flotation on separation of waste plastics ABS and PS.

    Science.gov (United States)

    Wang, Hui; Chen, Xiao-Lei; Bai, Yang; Guo, Chao; Zhang, Li

    2012-07-01

    The aim of this research was to separate waste plastics acrylonitrile butadiene styrene (ABS) and polystyrene (PS) by dissolved air flotation in a self-designed dissolved air flotation apparatus. The effects of wetting agents, frother, conditioning time and flotation time on flotation behavior of waste plastics ABS (w-ABS) and PS (w-PS) were investigated and the optimized separation conditions were obtained. The results showed that when using 25 mgL(-1) tannic acid, 5 mgL(-1) terpineol, 15 min conditioning time and 15 min flotation time, mixtures of w-ABS and w-PS were separated successfully by dissolved air flotation in two stages, the results revealed that the purity and recovery rate of w-PS in the floated products were 90.12% and 97.45%, respectively, and the purity and recovery rate of w-ABS in the depressed products were 97.24% and 89.38%, respectively. Based on the studies of wetting mechanism of plastic flotation, it is found that the electrostatic force and hydrophobic attraction cannot be the main factor of the interaction between wetting agent molecules and plastic particles, which can be completed through water molecules as a mesophase, and a hydrogen bonding adsorption model with hydration shell as a mesophase was proposed. Copyright © 2012 Elsevier Ltd. All rights reserved.

  14. Regeneration of tumor antigen-specific CTLs utilizing iPS technology.

    Science.gov (United States)

    Maeda, Takuya; Masuda, Kyoko; Kawamoto, Hiroshi

    2016-08-01

    Tumor immunotherapy, especially tumor antigen specific T cell therapy, is currently attracting attention. However, a critical issue still awaits resolution; it is difficult to efficiently expand tumor antigen-specific T cells. To solve this problem, we are now utilizing iPS cell technology. When iPS cells are established from tumor antigen specific T cells, T cells regenerated from these iPS cells are expected to express the same TCRs as the original T cells. In line with this concept, we succeeded in regenerating tumor antigen specific cytotoxic T cells. The regenerated T cells exhibited TCR specific killing activity comparable to that of the original cells, and were able to kill leukemia cells in an antigen-specific manner. We are currently endeavoring to apply this method clinically. In the future, we intend to establish an allogeneic transfusion system, in which various tumor antigen specific T-iPS cells from a wide range of HLA haplotype homozygous donors will be lined up as a "T-iPS cell bank", with the aim of making off-the-shelf tumor immunotherapy a reality.

  15. Miniaturized iPS-Cell-Derived Cardiac Muscles for Physiologically Relevant Drug Response Analyses.

    Science.gov (United States)

    Huebsch, Nathaniel; Loskill, Peter; Deveshwar, Nikhil; Spencer, C Ian; Judge, Luke M; Mandegar, Mohammad A; Fox, Cade B; Mohamed, Tamer M A; Ma, Zhen; Mathur, Anurag; Sheehan, Alice M; Truong, Annie; Saxton, Mike; Yoo, Jennie; Srivastava, Deepak; Desai, Tejal A; So, Po-Lin; Healy, Kevin E; Conklin, Bruce R

    2016-04-20

    Tissue engineering approaches have the potential to increase the physiologic relevance of human iPS-derived cells, such as cardiomyocytes (iPS-CM). However, forming Engineered Heart Muscle (EHM) typically requires >1 million cells per tissue. Existing miniaturization strategies involve complex approaches not amenable to mass production, limiting the ability to use EHM for iPS-based disease modeling and drug screening. Micro-scale cardiospheres are easily produced, but do not facilitate assembly of elongated muscle or direct force measurements. Here we describe an approach that combines features of EHM and cardiospheres: Micro-Heart Muscle (μHM) arrays, in which elongated muscle fibers are formed in an easily fabricated template, with as few as 2,000 iPS-CM per individual tissue. Within μHM, iPS-CM exhibit uniaxial contractility and alignment, robust sarcomere assembly, and reduced variability and hypersensitivity in drug responsiveness, compared to monolayers with the same cellular composition. μHM mounted onto standard force measurement apparatus exhibited a robust Frank-Starling response to external stretch, and a dose-dependent inotropic response to the β-adrenergic agonist isoproterenol. Based on the ease of fabrication, the potential for mass production and the small number of cells required to form μHM, this system provides a potentially powerful tool to study cardiomyocyte maturation, disease and cardiotoxicology in vitro.

  16. Connexin expression and gap-junctional intercellular communication in ES cells and iPS cells.

    Science.gov (United States)

    Oyamada, Masahito; Takebe, Kumiko; Endo, Aya; Hara, Sachiko; Oyamada, Yumiko

    2013-01-01

    Pluripotent stem cells, i.e., embryonic stem (ES) and induced pluripotent stem (iPS) cells, can indefinitely proliferate without commitment and differentiate into all cell lineages. ES cells are derived from the inner cell mass of the preimplantation blastocyst, whereas iPS cells are generated from somatic cells by overexpression of a few transcription factors. Many studies have demonstrated that mouse and human iPS cells are highly similar but not identical to their respective ES cell counterparts. The potential to generate basically any differentiated cell types from these cells offers the possibility to establish new models of mammalian development and to create new sources of cells for regenerative medicine. ES cells and iPS cells also provide useful models to study connexin expression and gap-junctional intercellular communication (GJIC) during cell differentiation and reprogramming. In 1996, we reported connexin expression and GJIC in mouse ES cells. Because a substantial number of papers on these subjects have been published since our report, this Mini Review summarizes currently available data on connexin expression and GJIC in ES cells and iPS cells during undifferentiated state, differentiation, and reprogramming.

  17. Human iPS Cell-Derived Germ Cells: Current Status and Clinical Potential

    Directory of Open Access Journals (Sweden)

    Tetsuya Ishii

    2014-10-01

    Full Text Available Recently, fertile spermatozoa and oocytes were generated from mouse induced pluripotent (iPS cells using a combined in vitro and in vivo induction system. With regard to germ cell induction from human iPS cells, progress has been made particularly in the male germline, demonstrating in vitro generation of haploid, round spermatids. Although iPS-derived germ cells are expected to be developed to yield a form of assisted reproductive technology (ART that can address unmet reproductive needs, genetic and/or epigenetic instabilities abound in iPS cell generation and germ cell induction. In addition, there is still room to improve the induction protocol in the female germline. However, rapid advances in stem cell research are likely to make such obstacles surmountable, potentially translating induced germ cells into the clinical setting in the immediate future. This review examines the current status of the induction of germ cells from human iPS cells and discusses the clinical potential, as well as future directions.

  18. Structure-properties relationships of polyhedral oligomeric silsesquioxane (POSS filled PS nanocomposites

    Directory of Open Access Journals (Sweden)

    J. J. Schwab

    2012-07-01

    Full Text Available The polyhedral oligomeric silsesquioxane (POSS additivated polystyrene (PS based nanocomposites were prepared by melt processing and the structure-properties relationships of the POSS-PS systems were compared to those of the neat PS. In order to investigate the effect of these structural parameters on the final properties of the polymer nanocomposites, five different kinds of POSS samples were used, in particular, POSS with different inorganic cage and with different organic pendent groups. The rheological investigation suggests clearly that the POSS acts as a plasticizer and that the processability of the PS was positively modified. The affinity between the POSS samples and the PS matrix was estimated by the calculated theoretical solubility parameters, considering the Hoy’s method and by morphology analysis. Minor difference between the solubility parameter of POSS and the matrix means better compatibility and no aggregation tendency. Furthermore, the POSS loading leads to a decrease of the rigidity, of the glass transition temperature and of the damping factor of the nanocomposite systems. The loading of different POSS molecules with open cage leads to a more pronounced effect on all the investigated properties that the loading of the POSS molecules with closed cage. Moreover, the melt properties are significantly influenced by the type of inorganic framework, by the type of the pendent organic groups and by the interaction between the POSS organic groups and the host matrix, while, the solid state properties appears to be influenced more by the kind of cage.

  19. High-Resolution TomoSAR & PS-InSAR Analysis in Urban Areas

    Science.gov (United States)

    Wei, Lianhuan; Liao, Mingsheng; Balz, Timo; Liu, Kang; Jendryke, Michael

    2013-01-01

    The surveillance of urban infrastructures is of great importance. Urban infrastructure monitoring benefits from the launch of the new generation of high-resolution SAR satellites. With high-resolution SAR stacks, even deformation details of different building parts can be observed by PS-InSAR technique. However, high-rise building areas suffer severely from layover effects, which can cause serious phase unwrapping errors in PS-InSAR processing. SAR tomography (TomoSAR) provides a method of overcoming layover effects in urban areas. With tomographic techniques, the 3D distribution of multiple scatterers and their position can be reconstructed. In this poster, the PS-InSAR method is illustrated first, followed with PS-InSAR analysis results in Shanghai. Then, we will describe SAR tomography and why we need TomoSAR, especially in dense cities like Shanghai. Finally, preliminary tomographic results are presented. By combining PS-InSAR and TomoSAR, a 4D dynamic mapping of urban areas could be executed.

  20. Risk Management Capability Maturity and Performance of Complex Product and System (CoPS Projects with an Asian Perspective

    Directory of Open Access Journals (Sweden)

    Ren, Y.

    2014-07-01

    Full Text Available Complex Products and Systems (CoPS are high value, technology and engineering-intensive capital goods. The motivation of this study is the persistent high failure rate of CoPS projects, Asian CoPS provider’s weak capability and lack of specific research on CoPS risk management. This paper evaluates risk management maturity level of CoPS projects against a general CoPS risk management capability maturity model (RM-CMM developed by the authors. An Asian based survey was conducted to investigate the value of RM to project performance, and Asian (non-Japanese CoPS implementers’ perceived application of RM practices, their strengths and weaknesses. The survey result shows that higher RM maturity level leads to higher CoPS project performance. It also shows project complexity and uncertainty moderates the relationship between some RM practices and project performance, which implies that a contingency approach should be adopted to manage CoPS risks effectively. In addition, it shows that Asian CoPS implementers are weak in RM process and there are also rooms for improvement in the softer aspects of organizational capabilities and robustness.

  1. Assessment of myofascial trigger points (MTrPs): a new application of ultrasound imaging and vibration sonoelastography.

    Science.gov (United States)

    Sikdar, Siddhartha; Shah, Jay P; Gilliams, Elizabeth; Gebreab, Tadesse; Gerber, Lynn H

    2008-01-01

    Myofascial trigger points (MTrPs) are palpable hyperirritable nodules in skeletal muscle that are associated with chronic musculoskeletal pain. The goal of this study was to image MTrPs in the upper trapezius muscle using 2D gray scale ultrasound (US) and vibration sonoelastography (VSE) for differentiating the soft tissue characteristics of MTrPs compared to surrounding muscle. MTrPs appeared as hypoechoeic elliptically-shaped focal regions within the trapezius muscle on 2D US. Audio-frequency vibrations (100-250 Hz) were induced in the trapezius muscle of four volunteers with clinically identifiable MTrPs, and the induced vibration amplitudes were imaged using the color Doppler variance mode, and were further quantified using spectral Doppler analysis. Spectral Doppler analysis showed that vibration amplitudes were 27% lower on average within the MTrP compared to surrounding tissue (p0.05). Color variance imaging consistently detected a focal region of reduced vibration amplitude, which correlated with the hypoechoeic region identified as an MTrP (r =0.76 for area). Real-time 2D US identifies MTrPs, and VSE is feasible for differentiating MTrPs from surrounding tissue. Preliminary findings show that MTrPs are hypoechoeic on 2D US and the relative stiffness of MTrPs can be quantified using VSE. Ultrasound offers a convenient, accessible and low-risk approach for identifying MTrPs and for evaluating clinical observations of palpable, painful nodules.

  2. The Effect of Composition on the Surface Finish of PS400: A New High Temperature Solid Lubricant Coating

    Science.gov (United States)

    DellaCorte, Christopher; Stanford, malcolm K.; Thomas, Fransua; Edmonds, Brian J.

    2010-01-01

    A new composite, multi-constituent, solid lubricant coating, NASA PS400, developed for high temperature tribological applications, exhibits a smoother surface finish after grinding and polishing than its predecessors PS200 and PS300. In this paper, the baseline composition of PS400 is modified to investigate each individual constituent s role on the achievable surface finish through a series of coating deposition, grinding, and polishing experiments. Furthermore, to explore the limits of compositional tailoring for improved tribological performance, several PS400 coatings were doped with additional solid lubricants (graphite, MoS2 and BN) and tribologically tested. The test results clearly showed that, compared to PS300 coatings, PS400 achieves a smoother surface finish via a reduced lubricant content. Coatings prepared with higher than the baseline level (10 wt%) of lubricants exhibited higher final surface roughness than the earlier generation PS300 coatings. Reducing or eliminating the one or both lubricants (fluorides or silver) did not further improve the surface finish suggesting that the current composition of PS400 is near optimal with respect to surface finish. Lastly, attempts to improve the poor initial room temperature tribological behavior of PS400 via the addition of traditional solid lubricants were unsuccessful. Based upon this work and earlier results it is expected that future research will concentrate on developing methods to produce a lubricious glaze on the rubbing surface during break in to ensure that low friction and wear are rapidly achieved.

  3. Trace2PS and FSA2PS: two software toolkits for converting trace and fsa files to PostScript format

    Directory of Open Access Journals (Sweden)

    Werber Martin

    2009-07-01

    Full Text Available Abstract Background Due to the advanced techniques in sequencing and fragment analysis, DNA sequencers and analyzers produce vast amounts of data within short time. To administrate the large data volume conveniently, efficient data management systems are used in order to process and to store sequencers' or analyzers' data outcome. The inclusion of graphical reports in such systems is necessary to achieve a comprehensive view of the integrated data. However, the resulting data of sequencing and fragment analysis runs are stored in a proprietary format, the so-called trace or fsa format, which is only readable by programs provided by the instrument's vendor operating on the machine itself or by commercial tools designed for editing the respective data. To allow for a quick conversion of the proprietary data format into a commonly used one, toolkits are required that reach this aim and can be easily integrated into workflow systems. Results We have developed the software toolkits Trace2PS and Fsa2PS which allow to convert sequence and fragment analysis raw data files to PostScript images, respectively. The toolkits are implemented as Perl modules that can be used as standalone command line applications in conjunction with a script-based analysis pipeline, or integrated in software applications for displaying the data content of trace and fsa files. The converter modules support the commonly used file formats for storage of sequencing (ABI and SCF and fragment analysis data (FSA. Conclusion The software toolkits provide useful applications to convert sequencing and fragment analysis files from a proprietary into a more common, human-readable format. Trace2PS and FSA2PS are useful and capable in data management workflow systems like SAMS, or laboratory information systems that are used for displaying trace and fragment analysis results via web-based tools over an intranet or internet connection to users that can view their results directly on the

  4. Studies of Space Charge Effects in the Proposed CERN PS2

    Energy Technology Data Exchange (ETDEWEB)

    Qiang, Ji; /LBL, Berkeley; Ryne, Robert; /LBL, Berkeley; De Maria, Riccardo; /Brookhaven; Macridin, Alexandru; /Fermilab; Spentzouris, Panagiotis; /Fermilab; Papaphilippou, Yannis; /CERN; Wienands, Ulrich; /SLAC

    2012-06-22

    A new proton synchrotron, the PS2, is under design study to replace the current proton synchrotron at CERN for the LHC upgrade. Nonlinear space charge effects could cause significant beam emittance growth and particle losses and limit the performance of the PS2. In this paper, we report on studies of the potential space-charge effects at the PS2 using three-dimensional self-consistent macroparticle tracking codes, IMPACT, MaryLie/IMPACT, and Synergia. We will present initial benchmark results among these codes. Effects of space-charge on the emittance growth, especially due to synchrotron coupling, aperture sizes, initial painted distribution, and RF ramping scheme will also be discussed.

  5. Novel stable structure of Li3PS4 predicted by evolutionary algorithm under high-pressure

    Directory of Open Access Journals (Sweden)

    S. Iikubo

    2018-01-01

    Full Text Available By combining theoretical predictions and in-situ X-ray diffraction under high pressure, we found a novel stable crystal structure of Li3PS4 under high pressures. At ambient pressure, Li3PS4 shows successive structural transitions from γ-type to β-type and from β-type to α type with increasing temperature, as is well established. In this study, an evolutionary algorithm successfully predicted the γ-type crystal structure at ambient pressure and further predicted a possible stable δ-type crystal structures under high pressure. The stability of the obtained structures is examined in terms of both static and dynamic stability by first-principles calculations. In situ X-ray diffraction using a synchrotron radiation revealed that the high-pressure phase is the predicted δ-Li3PS4 phase.

  6. A 7.4 ps FPGA-Based TDC with a 1024-Unit Measurement Matrix.

    Science.gov (United States)

    Zhang, Min; Wang, Hai; Liu, Yan

    2017-04-14

    In this paper, a high-resolution time-to-digital converter (TDC) based on a field programmable gate array (FPGA) device is proposed and tested. During the implementation, a new architecture of TDC is proposed which consists of a measurement matrix with 1024 units. The utilization of routing resources as the delay elements distinguishes the proposed design from other existing designs, which contributes most to the device insensitivity to variations of temperature and voltage. Experimental results suggest that the measurement resolution is 7.4 ps, and the INL (integral nonlinearity) and DNL (differential nonlinearity) are 11.6 ps and 5.5 ps, which indicates that the proposed TDC offers high performance among the available TDCs. Benefitting from the FPGA platform, the proposed TDC has superiorities in easy implementation, low cost, and short development time.

  7. A density functional theory study of Raman modes of cadmium hexathiohypodiphosphate (CdPS3

    Directory of Open Access Journals (Sweden)

    Shakoor Abdul

    2015-06-01

    Full Text Available Raman scattering investigations based on density functional theory (DFT calculations were performed to explore the vibrational modes of a cadmium hexathiohypodiphosphate CdPS3 single crystal. The calculations were performed to obtain the Raman spectra for the cadmium hexathiohypodiphosphate atoms to study the size dependence. Several vibrational modes indicating stretching and bending features related to Cd, S and P atoms were observed. Modifications of the frequency and intensity of different Raman modes with an increase in the number of atoms in CdPS3 were discussed in detail. Hydrogen atoms were added in order to make the closed shell configuration and saturate the CdPS3 as per the requisite for calculating the Raman spectra. This produced some additional modes of vibration related to hydrogen atoms. Band gap and formation energy were also calculated. The results generated are found to be in close agreement with the experimental values.

  8. Injection Matching Studies using Turn by Turn Beam Profile Measurements in the CERN PS

    CERN Document Server

    Benedikt, Michael; Dutriat, C; Jansson, A; Giovannozzi, Massimo; Martini, M; Raich, U

    2001-01-01

    The very small emittance beam needed for the LHC requires that the emittance blow-up in its injector machines must be kept to a minimum. Mismatch upon the beam transfer from one machine to the next is a potential source of such blow-up. The CERN PS ring is equipped with 3 Secondary Emission Grids (SEM-Grids) which are used for emittance measurement at injection. One of these has been converted to a multi-turn mode, in which several tens of consecutive beam passages can be observed. This allows the study of mismatch between the PS-Booster and the PS. This paper describes the instrument and experimental results obtained during the last year.

  9. Land Subsidence Monitoring Using PS-InSAR Technique for L-Band SAR Data

    Science.gov (United States)

    Thapa, S.; Chatterjee, R. S.; Singh, K. B.; Kumar, D.

    2016-10-01

    Differential SAR-Interferometry (D-InSAR) is one of the potential source to measure land surface motion induced due to underground coal mining. However, this technique has many limitation such as atmospheric in homogeneities, spatial de-correlation, and temporal decorrelation. Persistent Scatterer Interferometry synthetic aperture radar (PS-InSAR) belongs to a family of time series InSAR technique, which utilizes the properties of some of the stable natural and anthropogenic targets which remain coherent over long time period. In this study PS-InSAR technique has been used to monitor land subsidence over selected location of Jharia Coal field which has been correlated with the ground levelling measurement. This time series deformation observed using PS InSAR helped us to understand the nature of the ground surface deformation due to underground mining activity.

  10. Emerging ps-TW CO{sub 2} laser technology for high energy physics applications

    Energy Technology Data Exchange (ETDEWEB)

    Pogorelsky, I.V.

    1998-02-01

    A brief overview of laser acceleration techniques and a comparative analysis of the picosecond terawatt (ps-TW) CO{sub 2} laser technology versus T{sup 3} solid state lasers for prospective HEP applications. Special attention is given to two laser accelerator schemes. The first one is the far-field staged laser accelerator, STELLA, which is under exploration at the ATF using a CO{sub 2} laser. The second is a laser wakefield accelerator where ps-TW CO{sub 2} lasers have a great potential. Inverse to the laser accelerator, a prospective monochromatic x-ray source feasible at the ATF will also utilize a 50 MeV subpicosecond electron beam and the first ps-TW CO{sub 2} laser, PITER I.

  11. Emittance control of the PS e ± beams using a robinson wiggler

    Science.gov (United States)

    Baconnier, Y.; Cappi, R.; Riunaud, J. P.; Umstätter, H. H.; Level, M. P.; Sommer, M.; Zyngier, H.

    1985-02-01

    In 1958 Robinson of the Cambridge electron accelerator (Massachusetts) proposed that a gradient wiggler magnet be used to stabilise naturally unstable electron and positron beams in combined function machines. In 1986 such a method is to be applied in the PS so that, besides its many other tasks, it may serve as an accelerator in the LEP injector chain. This paper describes a prototype of a gradient wiggler magnet designed and constructed at CERN. It reports the results of measurements obtained with proton beams in the PS to check the influence of the wiggler on beam optics and of measurements made with positron beams in DCI (LAL, Orsay, France) to check the damping variations produced by this wiggler. As predictions were confirmed by these measurements, three magnets of this type will be installed in the PS when it is part of the LEP injector chain.

  12. Compressed 6 ps pulse in nonlinear amplification of a Q-switched microchip laser

    Science.gov (United States)

    Diao, Ruxin; Liu, Zuosheng; Niu, Fuzeng; Wang, Aimin; Taira, Takunori; Zhang, Zhigang

    2017-02-01

    We present a passively Q-switched Nd:YVO4 crystal microchip laser with a 6 ps pulse width, which is based on SPM-induced spectral broadening and pulse compression. The passive Q-switching is obtained by a semiconductor saturable absorber mirror. The laser’s seed source centered at 1064 nm pulses with a duration of 80 ps, at a repetition rate of 600 kHz corresponding to an average output power of 10 mW. After amplification and compression, the pulses were compressed to 6 ps with a maximum pulse energy of 0.5 µJ.

  13. Situação de crise psíquica e desejo de saber

    OpenAIRE

    Helena Maria Melo Dias; Paulo Roberto Ceccarelli; Ana Cleide Guedes Moreira

    2016-01-01

    Este artigo, resultado de uma pesquisa de pós-doutorado, aborda a noção de crise psíquica em Pierre Fédida. Articula-se ao caso de uma paciente com HIV-AIDS, hospitalizada, cujos efeitos contratransferenciais da psicoterapia fazem pensar nos processos críticos da situação de crise psíquica e no desejo de “saber de si”. A escuta analítica possibilitou o saber de si. Considera-se que a noção de crise psíquica contribui com a investigação sobre a psicoterapia psicanalítica no hospital. This p...

  14. Situação de crise psíquica e desejo de saber

    Directory of Open Access Journals (Sweden)

    Helena Maria Melo Dias

    2016-03-01

    Full Text Available Este artigo, resultado de uma pesquisa de pós-doutorado, aborda a noção de crise psíquica em Pierre Fédida. Articula-se ao caso de uma paciente com HIV-AIDS, hospitalizada, cujos efeitos contratransferenciais da psicoterapia fazem pensar nos processos críticos da situação de crise psíquica e no desejo de “saber de si”. A escuta analítica possibilitou o saber de si. Considera-se que a noção de crise psíquica contribui com a investigação sobre a psicoterapia psicanalítica no hospital.

  15. PMMA/PS coaxial electrospinning: core-shell fiber morphology as a function of material parameters

    Science.gov (United States)

    Rahmani, Shahrzad; Arefazar, Ahmad; Latifi, Masoud

    2017-03-01

    Core-shell fibers of polymethyl methacrylate (PMMA) and polystyrene (PS) have been successfully electrospun by coaxial electrospinning. To evaluate the influence of the solvent on the final fiber morphology, four types of organic solvents were used in the shell solution while the core solvent was preserved. Morphological observations with scanning electron microscopy, transmission electron microscopy and optical microscopy revealed that both core and shell solvent properties were involved in the final fiber morphology. To explain this involvement, alongside a discussion of the Bagley solubility graph of PS and PMMA, a novel criterion based on solvent physical properties was introduced. A theoretical model based on the momentum conservation principle was developed and applied for describing the dependence of the core and shell diameters to their solvent combinations. Different concentrations of core and shell were also investigated in the coaxial electrospinning of PMMA/PS. The core-shell fiber morphologies with different core and shell concentrations were compared with their single electrospun fibers.

  16. PS-OCT of natural pigmented and nonpigmented interproximal caries lesions

    Science.gov (United States)

    Ngaotheppitak, Patara; Darling, Cynthia L.; Fried, Daniel

    2005-03-01

    Previous studies have demonstrated that Polarization Sensitive Optical Coherence Tomography (PS-OCT) can be used to image early dental caries. The purpose of this study was to compare the measured reflectivity of natural caries lesions with the mineral loss measured using digital microradiography. An all polarization-maintaining fiber based PS-OCT system operating at 1310-nm was used to acquire polarization resolved images of natural white spot lesions and pigmented lesions on the smooth surfaces of extracted teeth. There was a strong positive correlation between the increase in the integrated reflectivity in the perpendicular polarization axis of the PS-OCT system and the increase in the integrated mineral loss or lesion severity for both white-spot and pigmented lesions, P caries lesions and resolve the internal structure of early caries lesions for the potential assessment of the lesion activity.

  17. Synthesis of rGO/PS compound with sandwich structure on Ni foam as binder-free electrode for supercapacitor

    Science.gov (United States)

    Luo, Guangsheng; Huang, Haifu; Cheng, Zhenzhi; Lei, Chenglong; Wu, Xiaoshan; Tang, Shaolong; Du, Youwei

    Here, we demonstrate the design of a binder-free reduced graphene oxide (rGO) and polystyrene colloidal microsphere (PS) compound with rGO/PS/rGO sandwich structure and application for supercapacitors electrode. rGO and PS are alternately deposited into 3D Ni foam by a simple layer-by-layer assembly based on dip-coating. The interlayer space of rGO film expanded by PS microsphere and 3D structure of compound electrode can effectively shorten diffusion pathways of ions and accelerate the transport of ions into graphene sheets. The resulting rGO/PS compound electrode exhibits a high specific capacitance with 164.7F g-1, and outstanding rate capability. It is found that the specific capacitance is dependent on the number of rGO film layers in rGO/PS compound electrode.

  18. Simulation of Instability at Transition Energy with a New Impedance Model for CERN PS

    CERN Document Server

    Wang, Na; Biancacci, Nicolo; Migliorati, Mauro; Persichelli, Serena; Sterbini, Guido

    2016-01-01

    Instabilities driven by the transverse impedance are proven to be one of the limitations for the high intensity reach of the CERN PS. Since several years, fast single bunch vertical instability at transition energy has been observed with the high intensity bunch serving the neu-tron Time-of-Flight facility (n-ToF). In order to better understand the instability mechanism, a dedicated meas-urement campaign took place. The results were compared with macro-particle simulations with PyHEADTAIL based on the new impedance model developed for the PS. Instability threshold and growth rate for different longitu-dinal emittances and beam intensities were studied.

  19. Green feasible route preparation for PMMA vs PS: Its properties for photonic crystal application

    Science.gov (United States)

    Azman, Nursyafiqa; Kassim, Syara; Azwa, Rabiatul Addawiyah; Harun, Noor Aniza

    2017-09-01

    This paper discusses a novel way to make photonic crystal by using poly (methyl methacrylate) (PMMA) and polystyrene (PS) colloidal particle. Both synthesis were through surfactant free-emulsion polymerization. This synthesis is so-called "green process" by having water as a medium instead of using solvent. Conventional polymerization technique mostly uses surfactant as a stabilizer to complete the polymerization process. However, the presence of surfactant may contaminate to the end product and difficult to control the size of colloidal sphere. The detailed morphology of uniform size 386 nm PMMA vs 420 nm PS will be discussed for its further potential photonic application.

  20. A multichannel time-to-digital converter ASIC with better than 3 ps RMS time resolution

    Science.gov (United States)

    Perktold, L.; Christiansen, J.

    2014-01-01

    The development of a new multichannel, fine-time resolution time-to-digital converter (TDC) ASIC is currently under development at CERN. A prototype TDC has been designed, fabricated and successfully verified with demonstrated time resolutions of better than 3 ps-rms. Least-significant-bit (LSB) sizes as small as 5 ps with a differential-non-linearity (DNL) of better than ±0.9 LSB and integral-non-linearity (INL) of better than ±1.3 LSB respectively have been achieved. The contribution describes the implemented architecture and presents measurement results of a prototype ASIC implemented in a commercial 130 nm technology.

  1. Algunas secuelas psíquicas de la violencia política

    OpenAIRE

    Omar Guerrero

    2012-01-01

    Algunas secuelas psíquicas de la violencia política La violencia política y la tortura dejan huellas, a menudo físicas, pero siempre psíquicas. El trabajo de psicoterapia con personas que han pasado por esas experiencias extremas, muestra un cuadro clínico característico y nos enseña sobre la posibilidad de que alguien sea desalojado de su lugar subjetivo pero, también, sobre su capacidad para reanudar un juego social, cuyo eje es el discurso, es dec...

  2. Comparison of soft and hard tissue ablation with sub-ps and ns pulse lasers

    Energy Technology Data Exchange (ETDEWEB)

    Da Silva, L.B.; Stuart, B.C.; Celliers, P.M.; Feit, M.D.; Glinsky, M.E.; Heredia, N.J.; Herman, S.; Lane, S.M.; London, R.A.; Matthews, D.L.; Perry, M.D.; Rubenchik, A.M. [Lawrence Livermore National Lab., CA (United States); Chang, T.D. [Veterans Administration Hospital, Martinez, CA (United States); Neev, J. [Beckman Laser Inst. and Medical Clinic, Irvine, CA (United States)

    1996-05-01

    Tissue ablation with ultrashort laser pulses offers several unique advantages. The nonlinear energy deposition is insensitive to tissue type, allowing this tool to be used for soft and hard tissue ablation. The localized energy deposition lead to precise ablation depth and minimal collateral damage. This paper reports on efforts to study and demonstrate tissue ablation using an ultrashort pulse laser. Ablation efficiency and extent of collateral damage for 0.3 ps and 1000 ps duration laser pulses are compared. Temperature measurements of the rear surface of a tooth section is also presented.

  3. Kaitsevägi ei panusta psühholoogilisele abile / Kadri Ibrus

    Index Scriptorium Estoniae

    Ibrus, Kadri

    2010-01-01

    Kaitseväes pole tööd alustanud psühholoogiateenistus, veebel Jaune Engeli väitel ei toimu enne missioonile minekut mingit spetsiifilist ja tõhusat psühholoogilist ettevalmistust. Kaitseministeeriumi esindaja Peeter Kuimeti väitel ei ole siiani tuvastatud, et ükski endise kaitseväelase enesetapp oleks olnud põhjustatud nende teenistusest kaitseväes või missioonil käimisest. Kaitseväe teavitusosakonna vanemleitnandi Ingrid Mühlingu selgitusi

  4. A proposal for a trajectory measurement system for the PS Booster

    CERN Document Server

    Belleman, Jeroen

    2010-01-01

    This is a proposal to equip the CERN PS Booster with a trajectory measurement system along the same lines as was previously done for the PS. That is, high-speed ADCs convert all BPM signals directly into the digital domain at a high rate, and individual bunch positions as well as averaged orbits are calculated on the fly and stored into a large circular buffer memory. Multiple users may then read the data they are interested in. The system will make use of modern fast ADCs, large FPGAs and SDRAM.

  5. Poly(PS-b-DMA) Micelles for Reactive Oxygen Species Triggered Drug Release

    Science.gov (United States)

    Gupta, Mukesh K.; Meyer, Travis A.; Nelson, Christopher E.; Duvall, Craig L.

    2013-01-01

    A new micelle drug carrier that consists of a diblock polymer of propylene sulfide (PS) and N,N-dimethylacrylamide (poly(PS74−b-DMA310)) has been synthesized and characterized for site-specific release of hydrophobic drugs to sites of inflammation. Propylene sulfide was first polymerized using a thioacyl group transfer (TAGT) method with the RAFT chain transfer agent (CTA) 4-cyano-4-(ethylsulfanylthiocarbonylsulfanyl) pentanoic acid (CEP), and the resultant poly(PS74−CEP) macro-CTA was used to polymerize a second polymer block of DMA using reversible addition-fragmentation chain transfer (RAFT). The formation of the poly(PS74−b-DMA310) diblock polymer was confirmed by 1H NMR spectra and gel permeation chromatography (GPC). poly(PS74−b-DMA310) formed 100 nm micelles in aqueous media as confirmed by dynamic light scattering (DLS) and transmission electron microscopy (TEM). Micelles loaded with the model drugs Nile red and DiO were used to demonstrate the ROS-dependent drug release mechanism of these micelles following treatment with hydrogen peroxide (H2O2), 3-morpholinosydnonimine (SIN-1), and peroxynitrite. These oxidants were found to oxidize the micelle PPS core, making it more hydrophilic and triggering micelle disassembly and cargo release. Delivery of poly(PS74−b-DMA310) micelles dual-loaded with the Förster Resonance Energy Transfer (FRET) fluorophore pair DiI and DiO was used to prove that endogenous oxidants generated by lipopolysaccharide (LPS)-treated RAW 264.7 macrophages significantly increased release of nanocarrier contents relative to macrophages that were not activated. In vitro studies also demonstrated that the poly(PS74−b-DMA310) micelles were cytocompatible across a broad range of concentrations. These combined data suggest that the poly(PS74−b-DMA310) micelles synthesized using a combination of TAGT and RAFT have significant potential for site-specific drug delivery to tissues with high levels of oxidative stress. PMID:22889714

  6. DiPS: Filling the Gap between System Software and Testing

    OpenAIRE

    Michiels, Sam; Walravens, Dirk; Janssens, Nico; Verbaeten, Pierre

    2002-01-01

    Testing system software (such as protocol stacks or file systems) often is a tedious and error-prone process. The reason for this is that such software is very complex and often not designed to be tested. This paper presents DiPS, a component framework, which forces to develop testable software, and DiPSUnit, a JUnit extension, to test DiPS units in a uniform way. Although non-trivial test support is provided, using DiPSUnit keeps testing simple and intuitive thanks to...

  7. Interactive Web Based Visualization of PS-InSAR and TomoSAR Results

    Science.gov (United States)

    Li, Shanshan; Wei, Lianhuan; Balz, Timo; Liao, Mingsheng

    2013-01-01

    Interactive web based visualization has become an important trend for displaying information dynamically. Synthetic Aperture Radar (SAR) data can be used to measure height and deformation information using interferometric SAR (InSAR) and differential InSAR (D-InSAR). Precise deformation information can be acquired in urban areas using Persistent Scatterer Interferometry (PS-InSAR) and differential SAR tomography (D-TomoSAR). PS-InSAR and TomoSAR results are usually represented as point clouds. In order to visualize this data dynamically, we developed an interactive web-based visualization system.

  8. Interactive Web-Based Visualization of PS-InSAR and TomoSAR

    Science.gov (United States)

    Li, Shanshan; Wei, Lianhuan; Balz, Timo; Liao, Mingsheng

    2013-01-01

    Interactive web based visualization has become an important trend for displaying information dynamically. Synthetic Aperture Radar (SAR) data can be used to measure height and deformation information using interferometric SAR (InSAR) and differential InSAR (D-InSAR). Precise deformation information can be acquired in urban areas using Persistent Scatterer Interferometry (PS-InSAR) and differential SAR tomography (D-TomoSAR). PS-InSAR and TomoSAR results are usually represented as point clouds. In order to visualize this data dynamically, we developed an interactive web-based visualization system

  9. File list: InP.PSC.20.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available InP.PSC.20.AllAg.iPS_cells mm9 Input control Pluripotent stem cell iPS cells SRX977...146529,SRX127363,SRX127364,SRX146525,SRX127358,SRX127360,SRX657142,SRX657138,SRX657140 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.PSC.20.AllAg.iPS_cells.bed ...

  10. File list: InP.PSC.50.AllAg.iPS_cells [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available InP.PSC.50.AllAg.iPS_cells mm9 Input control Pluripotent stem cell iPS cells SRX977...204652,SRX146525,SRX657146,SRX127358,SRX127360,SRX204653,SRX657142,SRX657138,SRX657140 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/InP.PSC.50.AllAg.iPS_cells.bed ...

  11. Mõnede eesti sõnajärjemallide psühholingvistilisest reaalsusest / Annekatrin Kaivapalu

    Index Scriptorium Estoniae

    Kaivapalu, Annekatrin, 1963-

    2010-01-01

    Eesti vahekeele korpuse põhjal selgitatakse, milliseid sõnajärjemalle peetakse loomulikeks ja milliseid mitte, et tulemuste põhjal kirjeldada mõnede eesti keele sõnajärjemallide psühholingvistilist reaalsust ning määratleda sõnajärjevigade prioriteetsus

  12. Validation of the Participation Strategies Self-Efficacy Scale (PS-SES).

    Science.gov (United States)

    Lee, Danbi; Fogg, Louis; Baum, Carolyn M; Wolf, Timothy J; Hammel, Joy

    2018-01-01

    To develop and examine the psychometric properties of a newly developed Participation Strategies Self-Efficacy Scale (PS-SES) designed to assess self-efficacy in using participation strategies following a stroke. One hundred and sixty-six subjects with mild to moderate stroke were recruited and interviewed using the PS-SES. The principal axis factoring analysis was run to examine the factor structure, and internal consistency was assessed by computing Cronbach's alpha coefficient. The final measure is a 35-item scale with six subscales: (1) managing home participation, (2) staying organized, (3) planning and managing community participation, (4) managing work/productivity, (5) managing communication, and (6) advocating for resources. The instrument demonstrated high internal consistency. The PS-SES is a reliable measure offering unique information regarding self-efficacy in managing participation. Implications for Rehabilitation Post-stroke participation requires complex management of resources, information, and strategies. There is a gap in instruments that can assess self-efficacy in managing participation following a stroke. The PS-SES is a valid tool measuring self-efficacy in using participation strategies in home, work, and community contexts.

  13. Analysis of subthreshold anti-proton production at KEK-PS and anti-proton potential

    Energy Technology Data Exchange (ETDEWEB)

    Maruyama, T. [Nihon Univ., College of Bioresource Sciences, Fujisawa, Kanagawa (Japan)

    1999-08-01

    Using the RBUU approach we calculate the subthreshold production of antiprotons in the p- and d-nucleus reactions done by the KEK-ps collaboration. Then we attempt to determine the depth of the anti-proton potential at the normal nuclear density from experimental data of these reactions, by introducing the (author)

  14. Detectors and Concepts for sub-100 ps timing with gaseous detectors

    CERN Document Server

    Gonzalez-Diaz, D.

    2017-01-01

    We give a short compendium of the main ongoing detectors and concepts capable of performing accurate sub-100 ps timing at high particle fluxes and on large areas, through technologies based on gaseous media. We briefly discuss the state-of-the-art, technological limitations and prospects, and a new bizarre idea.

  15. Induced Pluripotent Stem (iPS) Cell Culture Methods and Induction of Differentiation into Endothelial Cells.

    Science.gov (United States)

    Chatterjee, Ishita; Li, Fei; Kohler, Erin E; Rehman, Jalees; Malik, Asrar B; Wary, Kishore K

    2016-01-01

    The study of stem cell behavior and differentiation in a developmental context is complex, time-consuming, and expensive, and for this reason, cell culture remains a method of choice for developmental and regenerative biology and mechanistic studies. Similar to ES cells, iPS cells have the ability to differentiate into endothelial cells (ECs), and the route for differentiation appears to mimic the developmental process that occurs during the formation of an embryo. Traditional EC induction methods from embryonic stem (ES) cells rely mostly on the formation of embryoid body (EB), which employs feeder or feeder-free conditions in the presence or absence of supporting cells. Similar to ES cells, iPS cells can be cultured in feeder layer or feeder-free conditions. Here, we describe the iPS cell culture methods and induction differentiation of these cells into ECs. We use anti-mouse Flk1 and anti-mouse VE-cadherin to isolate and characterize mouse ECs, because these antibodies are commercially available and their use has been described in the literature, including by our group. The ECs produced by this method have been used by our laboratory, and we have demonstrated their in vivo potential. We also discuss how iPS cells differ in their ability to differentiate into endothelial cells in culture.

  16. Collision between two ortho-positronium (Ps) atoms: A four-body ...

    Indian Academy of Sciences (India)

    10,11]. It is again useful for its applications in technology [18,19]. The Ps–Ps scattering problem is very difficult to treat theoretically as it is a four-body Coulomb problem. At lower energies, the particles are highly correlated. The proper symmetry ...

  17. Genomic differentiation among two strains of the PS1 clade isolated from geographically separated marine habitats

    KAUST Repository

    Jimenez Infante, Francy M.

    2014-05-22

    Using dilution-to-extinction cultivation, we isolated a strain affiliated with the PS1 clade from surface waters of the Red Sea. Strain RS24 represents the second isolate of this group of marine Alphaproteobacteria after IMCC14465 that was isolated from the East (Japan) Sea. The PS1 clade is a sister group to the OCS116 clade, together forming a putatively novel order closely related to Rhizobiales. While most genomic features and most of the genetic content are conserved between RS24 and IMCC14465, their average nucleotide identity (ANI) is < 81%, suggesting two distinct species of the PS1 clade. Next to encoding two different variants of proteorhodopsin genes, they also harbor several unique genomic islands that contain genes related to degradation of aromatic compounds in IMCC14465 and in polymer degradation in RS24, possibly reflecting the physicochemical differences in the environment they were isolated from. No clear differences in abundance of the genomic content of either strain could be found in fragment recruitment analyses using different metagenomic datasets, in which both genomes were detectable albeit as minor part of the communities. The comparative genomic analysis of both isolates of the PS1 clade and the fragment recruitment analysis provide first insights into the ecology of this group. © 2014 Federation of European Microbiological Societies.

  18. Upgrading fuzzy logic by GA-PS to determine asphaltene stability in crude oil

    Directory of Open Access Journals (Sweden)

    Saeid Ahmadi

    2017-06-01

    Full Text Available Precipitation and deposition of asphaltene are undesirable phenomena that arise during petroleum production which give rise to a pronounced rate of increase in operational cost and adversely affect production rates as well. Hence, it is imperative to develop a mathematical model for the assessment of asphaltene stability in crude oil. In the present study, delta RI which constitutes the difference between refractive index of crude oil (RI and refractive index of crude oil at the onset of asphaltene precipitation (PRI is employed as the principal factor for determining the asphaltene stability of the region. Fuzzy logic is a potent tool capable of extracting the underlying dependency between SARA fractions (saturate, aromatic, resin, and asphaltene data and delta RI for the inexpensive and rapid diagnosis of asphaltene stability. In this study a novel strategy known as hybrid genetic algorithm-pattern search (GA-PS is suggested for the development of an optimal fuzzy logic model as a reliable alternative for the widely-applied subtractive clustering (SC method. While SC solely optimizes mean of input Gaussian membership functions (GMFs, GA-PS tool optimizes both mean and variance of input GMFs. Comparison between GA-PS and SC methods confirmed the capability of GA-PS for developing an optimal fuzzy logic model.

  19. Beyond the Four Ps: A Theoretical Explication and Research Agenda for Social Marketing.

    Science.gov (United States)

    Sego, Trina

    Advocates of social marketing in the 1970s rarely went beyond discussion of the marketing 4Ps (product, place, promotion, and price) and their application to case studies. After two decades of research on social marketing, some misunderstanding of the approach persists, and a substantial theoretical base for social marketing has not been…

  20. Leaching of styrene and other aromatic compounds in drinking water from PS bottles.

    Science.gov (United States)

    Ahmad, Maqbool; Bajahlan, Ahmad S

    2007-01-01

    Bottled water may not be safer, or healthier, than tap water. The present studies have proved that styrene and some other aromatic compounds leach continuously from polystyrene (PS) bottles used locally for packaging. Water sapmles in contact with PS were extracted by a preconcentration technique called as "purge and trap" and analysed by gas chromatograph-mass spectrometer (GC/MS). Eleven aromatic compounds were identified in these studies. Maximum concentration of styrene in PS bottles was 29.5 microg/L. Apart from styrene, ethyl benzene, toluene and benzene were also quantified but their concentrations were much less than WHO guide line values. All other compounds were in traces. Quality of plastic and storage time were the major factor in leaching of styrene. Concentration of styrene was increased to 69.53 microg/L after one-year storage. In Styrofoam and PS cups studies, hot water was found to be contaminated with styrene and other aromatic compounds. It was observed that temperature played a major role in the leaching of styrene monomer from Styrofoam cups. Paper cups were found to be safe for hot drinks.

  1. The PS200 catching trap: A new tool for ultralow-energy antiproton physics

    Energy Technology Data Exchange (ETDEWEB)

    Holzscheiter, M.H.; Dyer, P.L.; King, N.S.P.; Lizon, D.C.; Morgan, G.L.; Schecker, J.A. (Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States)); Hoibraten, S. (University of Colorado, Boulder, Colorado 80309 (United States)); Lewis, R.A.; Otto, T. (Pennsylvania State University, Osmond Laboratory, University Park, Pennsylvania 16802 (United States)); Rochet, J. (CERN, Division PPE, CH 1211 Geneva (Switzerland)); Schauer, M.M. (Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States) Pennsylvania State University, Osmond Laboratory, University Park, Pennsylvania 16802 (United States))

    1994-10-01

    Approximately one million antiprotons have been trapped and electron cooled in the PS200 catching trap from a single fast extracted pulse from LEAR. The system is described in detail, different extraction schemes are discussed, and possible applications of this instrument to ultralow-energy atomic and nuclear physics with antiprotons are mentioned. [copyright] 1994 MAIK/Interperiodika

  2. The PS 200 catching trap: A new tool for ultra-low energy antiproton physics

    Energy Technology Data Exchange (ETDEWEB)

    Holzscheiter, M.H.; Dyer, P.L.; King, N.S.P.; Lizon, D.C.; Morgan, G.L.; Schauer, M.M.; Schecker, J.A. [Los Alamos National Lab., NM (United States); Hoibraten, S. [Colorado Univ., Boulder, CO (United States); Lewis, R.A.; Otto, T. [Pennsylvania State Univ., University Park, PA (United States). Noise Control Lab.; Rochet, J. [CERN, Div. PPE, Geneva (Switzerland)

    1994-04-01

    Approximately one million antiprotons have been trapped and electron cooled in the PS200 catching trap from a single fast extracted pulse from LEAR. The system is described in detail, different extraction schemes are discussed, and possible applications of this instrument to ultra-low energy atomic and nuclear physics with antiprotons are mentioned.

  3. The quinternary thiophosphate Cs0.5Ag0.5Nb2PS10

    Directory of Open Access Journals (Sweden)

    Sojeong Park

    2010-07-01

    Full Text Available The quinternary thiophosphate Cs0.5Ag0.5Nb2PS10, cesium silver tris(disulfido[tetrathiophosphato(V]diniobate(IV, has been prepared from the elements using a CsCl flux. The crystal structure is made up of ∞1[Nb2PS10] chains expanding along [010]. These chains are built up from bicapped trigonal-prismatic [Nb2S12] units and tetrahedral [PS4] groups and are linked through a linear S—Ag—S bridge, forming a two-dimensional layer. These layers then stack on top of each other, completing the three-dimensional structure with an undulating van der Waals gap. The disordered Cs+ ions reside on sites with half-occupation in the voids of this arrangement. Short [2.8843 (5 Å] and long [3.7316 (4 Å] Nb—Nb distances alternate along the chains, and anionic S22− and S2− species are observed. The charge balance of the compound can be represented by the formula [Cs+]0.5[Ag+]0.5[Nb4+]2[PS43−][S22−]3.

  4. Enhanced penetration of exogenous EPCs into brains of APP/PS1 transgenic mice

    Science.gov (United States)

    Yuan, Xiaoyang; Mei, Bin; Zhang, Le; Zhang, Cuntai; Zheng, Miao; Liang, Huifang; Wang, Wei; Zheng, Jie; Ding, Ling; Zheng, Kai

    2016-01-01

    The aim of this study was to investigate the repair function of exogenous Endothelial progenitor cells (EPCs) for brain microvascular damage of the APP/PS1 transgenic mouse model of Alzheimer’s disease (AD). This study used a density-gradient centrifugation method to isolate mononuclear cells (MNCs) from mouse bone marrow, which were subsequently seeded and cultured. Cells were characterized by morphology and detection of the surface markers CD34 and CD133 at different time points by immunofluorescence (IF) and flow cytometry (FCM). Then, EPCs were transfected with GFP adenoviral vectors (GFP-EPCs). Wild-type (WT) and APP/PS1 transgenic mice both received GFP-EPCs injection through the tail vein, and using a PBS buffer injection as the control. Seven days later, the animals’ brain tissue was isolated. Expression of GFP was detected by quantitative polymerase chain reaction (qPCR) and western-blot (WB), while the fluorescence of GFP within the brains of mice was observed under a fluorescence microscope. Higher mRNA and protein expression of GFP, accompanied with increased green fluorescence, were detected in the brain of GFP-EPCs-injected APP/PS1 mice, as compared with GFP-EPCs-injected WT mice. The results show that the APP/PS1 transgenic mouse model of AD exhibited enhanced penetration of exogenous EPCs into brains than the WT mice. PMID:27186272

  5. Human iPS cell-derived dopaminergic neurons function in a primate Parkinson's disease model.

    Science.gov (United States)

    Kikuchi, Tetsuhiro; Morizane, Asuka; Doi, Daisuke; Magotani, Hiroaki; Onoe, Hirotaka; Hayashi, Takuya; Mizuma, Hiroshi; Takara, Sayuki; Takahashi, Ryosuke; Inoue, Haruhisa; Morita, Satoshi; Yamamoto, Michio; Okita, Keisuke; Nakagawa, Masato; Parmar, Malin; Takahashi, Jun

    2017-08-30

    Induced pluripotent stem cells (iPS cells) are a promising source for a cell-based therapy to treat Parkinson's disease (PD), in which midbrain dopaminergic neurons progressively degenerate. However, long-term analysis of human iPS cell-derived dopaminergic neurons in primate PD models has never been performed to our knowledge. Here we show that human iPS cell-derived dopaminergic progenitor cells survived and functioned as midbrain dopaminergic neurons in a primate model of PD (Macaca fascicularis) treated with the neurotoxin MPTP. Score-based and video-recording analyses revealed an increase in spontaneous movement of the monkeys after transplantation. Histological studies showed that the mature dopaminergic neurons extended dense neurites into the host striatum; this effect was consistent regardless of whether the cells were derived from patients with PD or from healthy individuals. Cells sorted by the floor plate marker CORIN did not form any tumours in the brains for at least two years. Finally, magnetic resonance imaging and positron emission tomography were used to monitor the survival, expansion and function of the grafted cells as well as the immune response in the host brain. Thus, this preclinical study using a primate model indicates that human iPS cell-derived dopaminergic progenitors are clinically applicable for the treatment of patients with PD.

  6. Catalytic property of TiO2/PS complex nanoparticles prepared via a ...

    Indian Academy of Sciences (India)

    Abstract. With an average size of 7 nm and good catalytic property under the natural light, TiO2/PS complex nanoparticles were successfully prepared through a novel two-step method (TSM) from TiCl4, used as both the catalyst for polymerization of styrene and Ti source, and styrene monomer and characterized by TG-DTA ...

  7. Local thermomechanical analysis of a microphase-separated thin lamellar PS-b-PEO film.

    Science.gov (United States)

    Rice, Reginald H; Mokarian-Tabari, Parvaneh; King, William P; Szoszkiewicz, Robert

    2012-09-18

    We use atomic force microscopy (AFM) and hot tip AFM (HT-AFM) to thermophysically characterize a 30 nm thick film of poly(styrene-block-ethylene oxide), PS-b-PEO, and to modify its lamellar patterns having spacing of 39 ± 3 nm. AFM tip scans of the polymer film induce either abrasive surface patterns or nanoscale ripples, which depend upon the tip force, temperature, and number of scans. The evolution of the lamellar patterns is explained by the polymer film molecular structure and mode I crack propagation in the polymer combined with the stick-and-slip behavior of the AFM tip. The HT-AFM measurements at various tip-sample temperatures and scanning speeds yield several thermophysical quantities: the PEO melting temperature of 54 ± 12 °C, the PS glass transition temperature of 54 ± 12 °C, the PS-b-PEO specific heat of 3.6 ± 2.7 J g(-1) K(-1), the PEO melting enthalpy of 111 ± 88 J g(-1), and the free energy of Helmholtz for PEO unfolding (and melting) of 10(-20) J nm(-2). These quantities are obtained for PS-b-PEO volumes of 30,000 nm(3), which correspond to 30 ag of the polymer.

  8. Beam test results of a 16 ps timing system based on ultra-fast silicon detectors

    Science.gov (United States)

    Cartiglia, N.; Staiano, A.; Sola, V.; Arcidiacono, R.; Cirio, R.; Cenna, F.; Ferrero, M.; Monaco, V.; Mulargia, R.; Obertino, M.; Ravera, F.; Sacchi, R.; Bellora, A.; Durando, S.; Mandurrino, M.; Minafra, N.; Fadeyev, V.; Freeman, P.; Galloway, Z.; Gkougkousis, E.; Grabas, H.; Gruey, B.; Labitan, C. A.; Losakul, R.; Luce, Z.; McKinney-Martinez, F.; Sadrozinski, H. F.-W.; Seiden, A.; Spencer, E.; Wilder, M.; Woods, N.; Zatserklyaniy, A.; Pellegrini, G.; Hidalgo, S.; Carulla, M.; Flores, D.; Merlos, A.; Quirion, D.; Cindro, V.; Kramberger, G.; Mandić, I.; Mikuž, M.; Zavrtanik, M.

    2017-04-01

    In this paper we report on the timing resolution obtained in a beam test with pions of 180 GeV/c momentum at CERN for the first production of 45 μm thick Ultra-Fast Silicon Detectors (UFSD). UFSD are based on the Low-Gain Avalanche Detector (LGAD) design, employing n-on-p silicon sensors with internal charge multiplication due to the presence of a thin, low-resistivity diffusion layer below the junction. The UFSD used in this test had a pad area of 1.7 mm2. The gain was measured to vary between 5 and 70 depending on the sensor bias voltage. The experimental setup included three UFSD and a fast trigger consisting of a quartz bar readout by a SiPM. The timing resolution was determined by doing Gaussian fits to the time-of-flight of the particles between one or more UFSD and the trigger counter. For a single UFSD the resolution was measured to be 34 ps for a bias voltage of 200 V, and 27 ps for a bias voltage of 230 V. For the combination of 3 UFSD the timing resolution was 20 ps for a bias voltage of 200 V, and 16 ps for a bias voltage of 230 V.

  9. Beam test results of a 16 ps timing system based on ultra-fast silicon detectors

    Energy Technology Data Exchange (ETDEWEB)

    Cartiglia, N., E-mail: cartiglia@to.infn.it [INFN, Torino (Italy); Staiano, A.; Sola, V. [INFN, Torino (Italy); Arcidiacono, R. [INFN, Torino (Italy); Università del Piemonte Orientale (Italy); Cirio, R.; Cenna, F.; Ferrero, M.; Monaco, V.; Mulargia, R.; Obertino, M.; Ravera, F.; Sacchi, R. [INFN, Torino (Italy); Università di Torino, Torino (Italy); Bellora, A.; Durando, S. [Università di Torino, Torino (Italy); Mandurrino, M. [Politecnico di Torino, Torino (Italy); Minafra, N. [University of Kansas, KS (United States); Fadeyev, V.; Freeman, P.; Galloway, Z.; Gkougkousis, E. [SCIPP, University of California Santa Cruz, CA 95064 (United States); and others

    2017-04-01

    In this paper we report on the timing resolution obtained in a beam test with pions of 180 GeV/c momentum at CERN for the first production of 45 µm thick Ultra-Fast Silicon Detectors (UFSD). UFSD are based on the Low-Gain Avalanche Detector (LGAD) design, employing n-on-p silicon sensors with internal charge multiplication due to the presence of a thin, low-resistivity diffusion layer below the junction. The UFSD used in this test had a pad area of 1.7 mm{sup 2}. The gain was measured to vary between 5 and 70 depending on the sensor bias voltage. The experimental setup included three UFSD and a fast trigger consisting of a quartz bar readout by a SiPM. The timing resolution was determined by doing Gaussian fits to the time-of-flight of the particles between one or more UFSD and the trigger counter. For a single UFSD the resolution was measured to be 34 ps for a bias voltage of 200 V, and 27 ps for a bias voltage of 230 V. For the combination of 3 UFSD the timing resolution was 20 ps for a bias voltage of 200 V, and 16 ps for a bias voltage of 230 V.

  10. PS-InSAR Monitoring of Landslide Activity in the Black Sea Coast of the Caucasus

    NARCIS (Netherlands)

    Kiseleva, E.; Mikhailov, V.; Smolyaninova, E.; Dmitriev, P.; Golubev, V.; Timoshkina, E.; Hooper, A.; Samiei-Esfahany, S.; Hanssen, R.F.

    2014-01-01

    The landslide activity in the area of Bolshoy Sochi (Big Sochi) situated at the Black Sea coast of the Great Caucasus has been studied using the StaMPS PS-InSAR method. We incorporated three sets of radar images from the satellites with different wavelengths ALOS, Envisat and Terra-SAR-X from both

  11. [Research and Application of iPS Cells in Blood System].

    Science.gov (United States)

    Zhou, Li-Xia; Ye, Jie-Yu; Lian, Qi-Zhou; Yang, Mo

    2015-04-01

    Induced pluripotent stem cells (iPS cells) were first constructed by Takahshi and et al in 2006. They converted the mouse fibroblasts into ES-like cells via viral transduction with four transcription factors (Oct4, Sox2, Klf4 and c-Myc). Since, the significant progress has been made and many researchers have succeeded in inducing iPS cells from other human somatic cells by some novel approaches, such as combining transcriptional factors and small chemicals. IPS cells have significant prospect in clinical application. IPS cells derived from patient somatic cells can be used as a model in studying the pathogenesis of genetic hematological disease and applied in therapeutic screenings. Recent studies suggested that iPS cells can differentiate into red blood cells and platelets in vitro, which may make up a big blood bank for transfusion in future. In this review, current understanding of both recombinant technology of iPS cells and the research progress in hematology are summarized.

  12. Generation of iPS-derived model cells for analyses of hair shaft differentiation.

    Science.gov (United States)

    Kido, Takumi; Horigome, Tomoatsu; Uda, Minori; Adachi, Naoki; Hirai, Yohei

    2017-09-01

    Biological evaluation of hair growth/differentiation activity in vitro has been a formidable challenge, primarily due to the lack of relevant model cell systems. To solve this problem, we generated a stable model cell line in which successive differentiation via epidermal progenitors to hair components is easily inducible and traceable. Mouse induced pluripotent stem (iPS) cell-derived cells were selected to stably express a tetracycline (Tet)-inducible bone morphogenic protein-4 (BMP4) expression cassette and a luciferase reporter driven by a hair-specific keratin 31 gene (krt31) promoter (Tet-BMP4-KRT31-Luc iPS). While Tet- BMP4-KRT31-Luc iPS cells could be maintained as stable iPS cells, the cells differentiated to produce luciferase luminescence in the presence of all-trans retinoic acid (RA) and doxycycline (Dox), and addition of a hair differentiation factor significantly increased luciferase fluorescence. Thus, this cell line may provide a reliable cell-based screening system to evaluate drug candidates for hair differentiation activity.

  13. Physics at the AD/PS/SPS - PLEASE NOTE CHANGE OF ROOM!(2/4)

    CERN Multimedia

    CERN. Geneva

    2012-01-01

    Lecture 2: QCD and hadron physics: COMPASS, NA61, DIRAC The lecture will discuss the research done at the COMPASS, SHINE and DIRAC experiments at the SPS and PS. COMPASS studies nucleon structure and hadron spectroscopy, SHINE searches for the critical point and onset of deconfinement in heavy ion collisions while DIRAC studies the pi-pi scattering length in pionic atoms.

  14. Space Charge measurements in the PS at 2GeV.

    CERN Document Server

    Benedetto, E

    2012-01-01

    This note summarizes the 2011 Space-Charge studies in the PS on the $2$~GeV plateau and in particular it reports the results of the systematic measurements made on 9-10th November'11 with a low-emittance (LHC-type) beam.

  15. A recoil detector for the Internal Target Facility of AmPS (NIKHEF).

    NARCIS (Netherlands)

    van Sambeek, M.J.M.; Blok, H.P.

    1997-01-01

    A recoil detector has been built for internal target experiments with the Amsterdam Pulse Stretcher and storage ring, AmPS, of NIKHEF. The detector was designed to detect low-energy (1-20 MeV/nucleon) and low-mass (A ≤ 4) recoiling nuclei emerging from electron-induced reactions. The detector

  16. A recoil detector for the internal target facility of AmPS (NIKHEF).

    NARCIS (Netherlands)

    van Sambeek, M.J.M.; Blok, H.P.; Dodge, G.E.; Heimberg, P.C.; Steenbakkers, M.F.M.

    1998-01-01

    A recoil detector has been built for internal target experiments with the Amsterdam Pulse Stretcher and storage ring, AmPS, of NIKHEF. The detector was designed to detect low-energy (1-20 MeV/nucleon) and low-mass (A ≤ 4) recoiling nuclei emerging from electron-induced reactions. The detector

  17. Masin, organism või psüühiline vangla? / Mikk Salu

    Index Scriptorium Estoniae

    Salu, Mikk, 1975-

    2008-01-01

    Juhtimisteoreetik Gareth Morgan õpetab oma raamatus "Organisatsiooni metafoorid" firmade toimimist ja juhtimist kaheksat eri tüüpi metafooride kaudu: organisatsioon kui masin, organism, aju, kultuur, poliitiline süsteem, psüühiline vangla, muutuste protsess, valitsemisvahend. Lisa: Praktiline õppevahend

  18. Preparation of the beam for PS-MTE at the PSB

    CERN Document Server

    Chanel, M; CERN. Geneva. BE Department

    2009-01-01

    The Multi-Turn Extraction(MTE)1 at the PS requires, from the PSB, a beam(up to 6.5 1012 protons/ring) with a large horizontal emittance to better produce the five beamlets and a vertical emittance as small as possible. The ways to produce this beam and adjust the parameters are described in this note.

  19. RePS: a sequence assembler that masks exact repeats identified from the shotgun data

    DEFF Research Database (Denmark)

    Wang, Jun; Wong, Gane Ka-Shu; Ni, Peixiang

    2002-01-01

    We describe a sequence assembler, RePS (repeat-masked Phrap with scaffolding), that explicitly identifies exact 20mer repeats from the shotgun data and removes them prior to the assembly. The established software is used to compute meaningful error probabilities for each base. Clone-end-pairing i...

  20. Synthesis and Characterization of SPIO-loaded PEG-b-PS Micelles ...

    Indian Academy of Sciences (India)

    66

    Synthesis and Characterization of SPIO-loaded PEG-b-PS Micelles as Contrast Agent for Long-term Nanoparticle-based MRI phantom. Man Theerasilp1,2, Witaya Sungkarat3 and Norased Nasongkla1,2,*. 1Department of Biomedical Engineering, Faculty of Engineering, Mahidol University,. Puttamonthon Nakorn Pathom ...

  1. Au coated PS nanopillars as a highly ordered and reproducible SERS substrate

    Science.gov (United States)

    Kim, Yong-Tae; Schilling, Joerg; Schweizer, Stefan L.; Sauer, Guido; Wehrspohn, Ralf B.

    2017-07-01

    Noble metal nanostructures with nanometer gap size provide strong surface-enhanced Raman scattering (SERS) which can be used to detect trace amounts of chemical and biological molecules. Although several approaches were reported to obtain active SERS substrates, it still remains a challenge to fabricate SERS substrates with high sensitivity and reproducibility using low-cost techniques. In this article, we report on the fabrication of Au sputtered PS nanopillars based on a template synthetic method as highly ordered and reproducible SERS substrates. The SERS substrates are fabricated by anodic aluminum oxide (AAO) template-assisted infiltration of polystyrene (PS) resulting in hemispherical structures, and a following Au sputtering process. The optimum gap size between adjacent PS nanopillars and thickness of the Au layers for high SERS sensitivity are investigated. Using the Au sputtered PS nanopillars as an active SERS substrate, the Raman signal of 4-methylbenzenethiol (4-MBT) with a concentration down to 10-9 M is identified with good signal reproducibility, showing great potential as promising tool for SERS-based detection.

  2. Sulfide response analysis for sulfide control using a pS electrode in sulfate reducing bioreactors.

    Science.gov (United States)

    Villa-Gomez, D K; Cassidy, J; Keesman, K J; Sampaio, R; Lens, P N L

    2014-03-01

    Step changes in the organic loading rate (OLR) through variations in the influent chemical oxygen demand (CODin) concentration or in the hydraulic retention time (HRT) at constant COD/SO4(2-) ratio (0.67) were applied to create sulfide responses for the design of a sulfide control in sulfate reducing bioreactors. The sulfide was measured using a sulfide ion selective electrode (pS) and the values obtained were used to calculate proportional-integral-derivative (PID) controller parameters. The experiments were performed in an inverse fluidized bed bioreactor with automated operation using the LabVIEW software version 2009(®). A rapid response and high sulfide increment was obtained through a stepwise increase in the CODin concentration, while a stepwise decrease to the HRT exhibited a slower response with smaller sulfide increment. Irrespective of the way the OLR was decreased, the pS response showed a time-varying behavior due to sulfide accumulation (HRT change) or utilization of substrate sources that were not accounted for (CODin change). The pS electrode response, however, showed to be informative for applications in sulfate reducing bioreactors. Nevertheless, the recorded pS values need to be corrected for pH variations and high sulfide concentrations (>200 mg/L). Copyright © 2013 Elsevier Ltd. All rights reserved.

  3. Orbit, optics and chromaticity correction for PS2 negative momentum compaction lattices

    Energy Technology Data Exchange (ETDEWEB)

    Papaphilippou,Y.; Barranco, J.; Bartmann, W.; Benedikt, M.; Carli, C.; de Maria, R.; Peggs, S.; Trbojevic, D.

    2009-05-04

    The effect of magnet misalignments in the beam orbit and linear optics functions are reviewed and correction schemes are applied to the negative momentum compaction lattice of PS2. Chromaticity correction schemes are also proposed and tested with respect to off-momentum optics properties. The impact of the correction schemes in the dynamic aperture of the lattice is finally evaluated.

  4. High Resolution TomoSAR & PS-InSAR Analysis in Urban Areas

    Science.gov (United States)

    Wei, Lianhuan; Liao, Mingsheng; Balz, Timo; Liu, Kang; Jendryke, Michael

    2013-01-01

    The surveillance of urban infrastructures is of great importance. Urban infrastructure monitoring benefits from the launch of the new generation of high-resolution SAR satellites. With high-resolution SAR stacks, even deformation details of different building parts can be observed. The PS-InSAR technique has become a favorable tool for urban area subsidence monitoring, and it has been demonstrated that millimeter accuracy can be achieved. However, high-rise building areas suffer severely from layover effects, which can cause serious phase unwrapping errors. SAR tomography provides a method of overcoming layover effects in urban areas. With tomographic techniques, the 3D distribution of multiple scatterers and their position can be reconstructed. In this paper, the PS-InSAR method is briefly described first, followed by PS-InSAR analysis results in Shanghai. Then, we will describe SAR tomography and why we need TomoSAR, especially in dense cities like Shanghai. Finally, preliminary tomographic results about Shanghai are presented. By combining PS-InSAR and TomoSAR, a 4D dynamic mapping of urban areas could be executed.

  5. Looking beyond PsTOL1: marker development for two novel rice ...

    Indian Academy of Sciences (India)

    2014-08-19

    Aug 19, 2014 ... School of Crop Improvement, College of PostGraduate Studies, Central Agricultural University,. Umroi Road, Umiam 793103, India. [Dkhar F., Rai M. and Tyagi W. 2014 Looking beyond PsTOL1: marker development for two rice genes showing differential expression in P deficient conditions. J. Genet.

  6. Morphology and properties of SEBS block copolymer compatibilized PS/HDPE blends

    Czech Academy of Sciences Publication Activity Database

    Rek, V.; Vranješ, N.; Šlouf, Miroslav; Fortelný, Ivan; Jelčic, Ž.

    2008-01-01

    Roč. 40, č. 3 (2008), s. 237-251 ISSN 0095-2443 Grant - others:Ministry of Science, Education and Sport(HR) 0125059 Institutional research plan: CEZ:AV0Z40500505 Keywords : aPS/HDPE/SEBS blends * morphology * processing * rheological Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.658, year: 2008

  7. The coat protein complex II, COPII, protein Sec13 directly interacts with presenilin-1

    Energy Technology Data Exchange (ETDEWEB)

    Nielsen, Anders Lade, E-mail: aln@humgen.au.dk [Department of Human Genetics, The Bartholin Building, University of Aarhus, DK-8000 Aarhus C (Denmark)

    2009-10-23

    Mutations in the human gene encoding presenilin-1, PS1, account for most cases of early-onset familial Alzheimer's disease. PS1 has nine transmembrane domains and a large loop orientated towards the cytoplasm. PS1 locates to cellular compartments as endoplasmic reticulum (ER), Golgi apparatus, vesicular structures, and plasma membrane, and is an integral member of {gamma}-secretase, a protein protease complex with specificity for intra-membranous cleavage of substrates such as {beta}-amyloid precursor protein. Here, an interaction between PS1 and the Sec13 protein is described. Sec13 takes part in coat protein complex II, COPII, vesicular trafficking, nuclear pore function, and ER directed protein sequestering and degradation control. The interaction maps to the N-terminal part of the large hydrophilic PS1 loop and the first of the six WD40-repeats present in Sec13. The identified Sec13 interaction to PS1 is a new candidate interaction for linking PS1 to secretory and protein degrading vesicular circuits.

  8. ANATOMICAL PROPERTIES OF Shorea mujongensis P.S. Ashton, A CRITICALLY ENDANGERED SPECIES OF DIPTEROCARPS FROM KALIMANTAN

    Directory of Open Access Journals (Sweden)

    Listya Mustika Dewi

    2011-12-01

    Full Text Available Wood anatomy of Shorea mujongensis P.S. Ashton was investigated in order to ensure this species belongs to yellow meranti group. Such study is very important since this species is already listed in the red list of IUCN and classified as critically endangered species. The microscopic slides were prepared according to the Johansen's method, while the anatomical features observed according to the IAWA  List. The results show that S. mujongensis wood exhibit brown heartwood, light brown sapwood, rough texture, straight grain sometimes interlocked and somewhat rough. The main microscopic characters are growth rings indistinct; vessel diffuse, mostly solitary, rounded to oval; simple perforation plate and alternate intervessel pits; parenchyma scanty paratracheal to thin vasicentric; axial intercellular canals in long tangential line, radial intercellular canal and vasicentric tracheids present; rays uniseriate and multiseriate, prismatic crystal in procumbent cells; fiber length 1,294 µm, diameter 26 µm and wall thickness 4µm. Macroscopic and microscopic observation of S. mujongensis wood confirms the species belongs to yellow meranti group. The assesment on fiber dimensions and derived values of the wood fibers classified the wood into class quality II. It indicates that this species is moderately favorable as raw material for pulp and paper manufacture.

  9. Opto-electronic properties of a TiO{sub 2}/PS/mc-Si heterojunction based solar cell

    Energy Technology Data Exchange (ETDEWEB)

    Janene, N.; Ghrairi, N. [Laboratoire de Photovoltaïque, Centre de Recherches et des Technologies de l’Energie, Technopole de Borj-Cédria, BP 95, 2050 Hammam-Lif (Tunisia); Allagui, A. [Center for Advanced Materials Research, University of Sharjah, PO Box 27272, Sharjah (United Arab Emirates); Dept. of Sustainable and Renewable Energy Engineering, University of Sharjah, PO Box 27272, Sharjah (United Arab Emirates); Alawadhi, H. [Center for Advanced Materials Research, University of Sharjah, PO Box 27272, Sharjah (United Arab Emirates); Khakani, M. A. El [Institut National de la Recherche Scientifique, INRS-Énergie, Matériaux et Télécommunications, 1650, Blvd. Lionel-Boulet, Varennes, QC, Canada J3X-1S2 (Canada); Bessais, B. [Laboratoire de Photovoltaïque, Centre de Recherches et des Technologies de l’Energie, Technopole de Borj-Cédria, BP 95, 2050 Hammam-Lif (Tunisia); Gaidi, M., E-mail: mkaidi@sharjah.ac.ae [Center for Advanced Materials Research, University of Sharjah, PO Box 27272, Sharjah (United Arab Emirates)

    2016-04-15

    Graphical abstract: - Highlights: • In this work solar cells based on Au/PS/mc-Si/Al and Au/TiO{sub 2}/PS/mc-Si/Al structures have prepared. • A novel double treatment passivation based on TiO2/Porous Si has been used. • An enhancement of the electrical properties of TiO{sub 2}/PS/mc-Si heterojunction was observed after TiO{sub 2} coating. • The solar cells efficiencies past from 1.4% for uncoated PS/mc-Si structure to 5% for TiO{sub 2} coated one. - Abstract: In this work, we show the results of our investigation on the photoelectric properties of heterojunction solar cells based on Au/PS/mc-Si/Al and Au/TiO{sub 2}/PS/mc-Si/Al structures. Porous silicon (PS) were prepared by an electrochemical etching process with different values of current density. The surface porosity was found to increase with the increase of current density. Pulsed laser deposition was used to deposit 80 nm TiO{sub 2} thin films. Surface morphology and structural properties of TiO{sub 2}/PS were characterized by using scanning electron microscopy (SEM) and atomic force microscopy (AFM). An enhancement of the electrical properties of the TiO{sub 2}/PS/mc-Si heterojunction was observed after coating with TiO{sub 2}. As a consequence, the solar cell efficiencies increased from 1.4% for the uncoated PS/mc-Si structure to 5% for the TiO{sub 2} coated one. Impedance spectroscopy confirmed the passivation effect of TiO{sub 2} through the improvement of the elaborated cells’ electron lifetime and the formation of a TiO{sub 2}/PS/Au heterojunction with the appearance of a second semi-circle in the Nyquist plot.

  10. Copper (II)

    African Journals Online (AJOL)

    CLEMENT O BEWAJI

    ABSTRACT: A Schiff base was prepared from the reaction of 2 - amino - 3 – methylbutanoic acid and 2, 4 - pentanedione. The reaction of the prepared Schiff base with ethanolic solution of copper (II) chloride formed diaquo bis( N – 2 – amino – 3 - methylbutyl - 2, 4 - pentanedionato) copper (II) complex. The Schiff base is ...

  11. Induced pluripotent stem (iPS cells offer a powerful new tool for the life sciences

    Directory of Open Access Journals (Sweden)

    Yukio Nakamura

    2010-01-01

    Full Text Available Stem cell biology started with the analysis of somatic stem cells that function to maintain the adult body. We now know that the body is maintained by regeneration of a wide range of cell types, such as skin cells, blood cells and gastrointestinal mucous cells, from somatic stem cells. This regenerative activity is essential for survival. Regenerative medicine was initiated to identify therapies that support and/or accelerate this natural regenerative ability. For example, bone marrow transplantation is a therapy for reconstituting hematopoiesis from the hematopoietic stem cells present in the donor bone marrow. The successful development of a protocol for obtaining human embryonic stem (ES cells prompted medical scientists to utilize human ES cells for regenerative medicine. However, use of these cells raises ethical issues as they are derived from human embryos. An alternative approach using ES-like pluripotent stem cells has the considerable advantage that it does not necessitate use of human embryos. Pluripotent stem cells can be induced from terminally differentiated somatic cells by the introduction of only four defined factors. The products of this method are termed “induced pluripotent stem (iPS" cells. iPS cells have considerable promise as a substitute for ES cells not only for regenerative medicine but also in many other fields. For example, liver and heart cells derived from iPS cells can be used in pharmaceutical research. In addition, iPS cell technology opens new avenues of disease research, for example, by construction of so-called “disease-specific iPS cells” from a patient's somatic cells.

  12. Synthesis and Characterization of the Rubidium Thiophosphate Rb 6 (PS 5 )(P 2 S 10 ) and the Rubidium Silver Thiophosphates Rb 2 AgPS 4 , RbAg 5 (PS 4 ) 2 and Rb 3 Ag 9 (PS 4 ) 4

    KAUST Repository

    Alahmary, Fatimah S.

    2016-02-18

    The metal thiophosphates Rb2AgPS4 (2), RbAg5(PS4)2 (3), and Rb3Ag9(PS4)4 (4) were synthesized by stoichiometric reactions, whereas Rb6(PS5)(P2S10) (1) was prepared with excess amount of sulfur. The compounds crystallize as follows: 1 monoclinic, P21/c (no. 14), a = 17.0123(7) Å, b = 6.9102(2) Å, c = 23.179(1) Å, β = 94.399(4)°; 2 triclinic, P ¯ (no. 2), a = 6.600(1) Å, b = 6.856(1) Å, c = 10.943(3) Å, α = 95.150(2)°, β = 107.338(2)°, γ = 111.383(2)°; 3 orthorhombic, Pbca (no. 61), a = 12.607(1) Å, b = 12.612(1) Å, c = 17.759(2) Å; 4 orthorhombic, Pbcm (no. 57), a = 6.3481(2) Å, b = 12.5782(4) Å, c = 35.975(1) Å. The crystal structures contain discrete units, chains, and 3D polyanionic frameworks composed of PS4 tetrahedral units arranged and connected in different manner. Compounds 1-3 melt congruently, whereas incongruent melting behavior was observed for compound 4. 1-4 are semiconductors with bandgaps between 2.3 and 2.6 eV and thermally stable up to 450 °C in an inert atmosphere. Copyright © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. Analisis de PPcPs (pharmaceutical and personal care products en aguas residuales y suelos

    Directory of Open Access Journals (Sweden)

    Johana Andrea Velásquez Arias

    2016-12-01

    Full Text Available Los productos farmacéuticos y de higiene personal (PPcPs son conocidos como contaminantes emergentes,  ampliamente usados  por la sociedad  moderna. Las estaciones depuradoras de aguas residuales (EDAR, mitigan la presencia de estos contaminantes emergentes en los efluentes que vierten al medio ambiente. La eficiencia de eliminación de las EDAR, varían en base a la precisión en la detección y en las técnicas utilizadas. Este estudio revisó literatura para estudios que informaron sobre la presencia de PPcPs en aguas, estaciones depuradoras de aguas residuales y suelos, las técnicas biológicas degradadoras utilizadas y la frecuencia de evaluaciones ecotoxicológicas. Tras la búsqueda bibliográfica, se obtuvieron 119 artículos relacionados con la presencia PPcPs en suelos y aguas, de los cuales el 7% son revisiones que incluyen datos de degradación por estrategias de biorremediación, técnicas físico-químicas, acumulación de PPcPs en aguas y plantas y efectos en los organismos, el 40% se centran en aguas superficiales y estaciones depuradoras de aguas residuales, el 28% en suelos irrigados con aguas residuales recuperadas o abonados con lodos de depuradoras y por último, solamente el 22% realizaron ensayos ecotoxicológicos en aguas y el 3% en suelos. A partir de estos resultados se puede concluir que, es necesario hacer énfasis en la realización de estudios sobre comunidades bacterianas con capacidad degradadora de PPcPS, así como la incorporación de ensayos ecotoxicológicos que confirmen la optimización del proceso.

  14. Basidiomycete DyPs: Genomic diversity, structural-functional aspects, reaction mechanism and environmental significance.

    Science.gov (United States)

    Linde, Dolores; Ruiz-Dueñas, Francisco J; Fernández-Fueyo, Elena; Guallar, Victor; Hammel, Kenneth E; Pogni, Rebecca; Martínez, Angel T

    2015-05-15

    The first enzyme with dye-decolorizing peroxidase (DyP) activity was described in 1999 from an arthroconidial culture of the fungus Bjerkandera adusta. However, the first DyP sequence had been deposited three years before, as a peroxidase gene from a culture of an unidentified fungus of the family Polyporaceae (probably Irpex lacteus). Since the first description, fewer than ten basidiomycete DyPs have been purified and characterized, but a large number of sequences are available from genomes. DyPs share a general fold and heme location with chlorite dismutases and other DyP-type related proteins (such as Escherichia coli EfeB), forming the CDE superfamily. Taking into account the lack of an evolutionary relationship with the catalase-peroxidase superfamily, the observed heme pocket similarities must be considered as a convergent type of evolution to provide similar reactivity to the enzyme cofactor. Studies on the Auricularia auricula-judae DyP showed that high-turnover oxidation of anthraquinone type and other DyP substrates occurs via long-range electron transfer from an exposed tryptophan (Trp377, conserved in most basidiomycete DyPs), whose catalytic radical was identified in the H2O2-activated enzyme. The existence of accessory oxidation sites in DyP is suggested by the residual activity observed after site-directed mutagenesis of the above tryptophan. DyP degradation of substituted anthraquinone dyes (such as Reactive Blue 5) most probably proceeds via typical one-electron peroxidase oxidations and product breakdown without a DyP-catalyzed hydrolase reaction. Although various DyPs are able to break down phenolic lignin model dimers, and basidiomycete DyPs also present marginal activity on nonphenolic dimers, a significant contribution to lignin degradation is unlikely because of the low activity on high redox-potential substrates. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

  15. Moveout-based geometrical-spreading correction for PS-waves in layered anisotropic media

    Science.gov (United States)

    Xu, Xiaoxia; Tsvankin, Ilya

    2008-06-01

    This paper is devoted to pre-stack amplitude analysis of reflection seismic data from anisotropic (e.g., fractured) media. Geometrical-spreading correction is an important component of amplitude-variation-with-offset (AVO) analysis, which provides high-resolution information for anisotropic parameter estimation and fracture characterization. Here, we extend the algorithm of moveout-based anisotropic spreading correction (MASC) to mode-converted PSV-waves in VTI (transversely isotropic with a vertical symmetry axis) media and symmetry planes of orthorhombic media. While the geometrical-spreading equation in terms of reflection traveltime has the same form for all wave modes in laterally homogeneous media, reflection moveout of PS-waves is more complicated than that of P-waves (e.g., it can become asymmetric in common-midpoint geometry). Still, for models with a horizontal symmetry plane, long-spread reflection traveltimes of PS waves can be well approximated by the Tsvankin-Thomsen and Alkhalifah-Tsvankin moveout equations, which are widely used for P-waves. Although the accuracy of the Alkhalifah-Tsvankin equation is somewhat lower, it includes fewer moveout parameters and helps to maintain the uniformity of the MASC algorithm for P- and PS-waves. The parameters of both moveout equations are obtained by least-squares traveltime fitting or semblance analysis and are different from those for P-waves. Testing on full-waveform synthetic data generated by the reflectivity method for layered VTI media confirms that MASC accurately reconstructs the plane-wave conversion coefficient from conventional-spread PS data. Errors in the estimated conversion coefficient, which become noticeable at moderate and large offsets, are mostly caused by the offset-dependent transmission loss of PS-waves.

  16. Differential expression of GSK3β and pS9GSK3β in normal human tissues: can pS9GSK3β be an epithelial marker?

    Science.gov (United States)

    Lee, Hojung; Ro, Jae Y

    2015-01-01

    Glycogen synthase kinase 3β (GSK3β) and phosphorylated GSK3β at Ser9 (pS9GSK3β) are crucial in cellular proliferation and metabolism. GSK3β and pS9GSK3β are deregulated in many diseases including tumors. Data on altered expression of GSK3β and pS9GSK3β are mainly limited to tumor tissues, thus the expression of GSK3β and pS9GSK3β in normal human tissue has been largely unknown. Thus, we examined the immunohistochemical localization of GSK3β and pS9GSK3β in human fetal and adult tissues, and also compared the expression pattern of GSK3β and pS9GSK3β with that of the CK7 and CK20. We found GSK3β expression in neurons of brain, myenteric plexus in gastrointestinal tract, squamous epithelium of skin, and mammary gland. The expression of pS9GSK3β was restricted to the epithelial cells of breast and pancreaticobiliary duct, distal nephron of kidney, gastrointestinal tract, fallopian tube, epididymis, secretory cell of prostatic gland, and umbrella cell of urinary tract. The staining pattern of pS9GSK3β and CK7 was overlapped in most organs except for gastrointestinal tract where CK7 was negative and CK20 was positive. Our results show that the expression of GSK3β may be associated with differentiation of ectodermal derived tissues and pS9GSK3β with that of epithelial cells of endodermal derived tissues in human. In addition, the expression of pS9GSK3β in the selective epithelial cells may indicate its association with secretory or barrier function of specific cells and may serve as another immunohistochemical marker for epithelial cells.

  17. Effect of angiotensin II on proliferation and differentiation of mouse induced pluripotent stem cells into mesodermal progenitor cells

    Energy Technology Data Exchange (ETDEWEB)

    Ishizuka, Toshiaki, E-mail: tishizu@ndmc.ac.jp [Department of Pharmacology, National Defense Medical College, Tokorozawa, Saitama 359-8513 (Japan); Goshima, Hazuki; Ozawa, Ayako; Watanabe, Yasuhiro [Department of Pharmacology, National Defense Medical College, Tokorozawa, Saitama 359-8513 (Japan)

    2012-03-30

    Highlights: Black-Right-Pointing-Pointer Treatment with angiotensin II enhanced LIF-induced DNA synthesis of mouse iPS cells. Black-Right-Pointing-Pointer Angiotensin II may enhance the DNA synthesis via induction of superoxide. Black-Right-Pointing-Pointer Treatment with angiotensin II significantly increased JAK/STAT3 phosphorylation. Black-Right-Pointing-Pointer Angiotensin II enhanced differentiation into mesodermal progenitor cells. Black-Right-Pointing-Pointer Angiotensin II may enhance the differentiation via activation of p38 MAPK. -- Abstract: Previous studies suggest that angiotensin receptor stimulation may enhance not only proliferation but also differentiation of undifferentiated stem/progenitor cells. Therefore, in the present study, we determined the involvement of the angiotensin receptor in the proliferation and differentiation of mouse induced pluripotent stem (iPS) cells. Stimulation with angiotensin II (Ang II) significantly increased DNA synthesis in mouse iPS cells cultured in a medium with leukemia inhibitory factor (LIF). Pretreatment of the cells with either candesartan (a selective Ang II type 1 receptor [AT{sub 1}R] antagonist) or Tempol (a cell-permeable superoxide scavenger) significantly inhibited Ang II-induced DNA synthesis. Treatment with Ang II significantly increased JAK/STAT3 phosphorylation. Pretreatment with candesartan significantly inhibited Ang II- induced JAK/STAT3 phosphorylation. In contrast, induction of mouse iPS cell differentiation into Flk-1-positive mesodermal progenitor cells was performed in type IV collagen (Col IV)- coated dishes in a differentiation medium without LIF. When Col IV-exposed iPS cells were treated with Ang II for 5 days, the expression of Flk-1 was significantly increased compared with that in the cells treated with the vehicle alone. Pretreatment of the cells with both candesartan and SB203580 (a p38 MAPK inhibitor) significantly inhibited the Ang II- induced increase in Flk-1 expression

  18. Screening for PS1 mutations in a referral-based series of AD cases: 21 novel mutations

    NARCIS (Netherlands)

    Rogaeva, E. A.; Fafel, K. C.; Song, Y. Q.; Medeiros, H.; Sato, C.; Liang, Y.; Richard, E.; Rogaev, E. I.; Frommelt, P.; Sadovnick, A. D.; Meschino, W.; Rockwood, K.; Boss, M. A.; Mayeux, R.; St George-Hyslop, P.

    2001-01-01

    Mutations in the presenilin-1 gene (PS1) account for a majority of patients with early-onset familial AD. However, the clinical indications and algorithms for genetic testing in dementia are still evolving. The entire open reading frame of the PS1 gene was sequenced in a series of 414 consecutive

  19. Small cyclic amphipathic peptides (SCAmpPs) genes in citrus provide promising tools for more effective tissue specific transgenic expression

    Science.gov (United States)

    A gene family encoding Small Cyclic Amphipathic Peptides (SCAmpPs) has been identified in citrus. Citrus genomes include 100-150 SCAmpPs genes, and about fifty transcripts are represented in the citrus EST database. These genes encode small ~50 residue precursor proteins that are post-translation...

  20. Preparation and evaluation of the bioinspired PS/PDMS photochromic films by the self-assembly dip-drawing method.

    Science.gov (United States)

    Shieh, Jen-Yu; Kuo, Jen-Yu; Weng, Hsueh-Ping; Yu, Hsin Her

    2013-01-15

    Emulsifier-free emulsion polymerization was employed to synthesize polystyrene (PS) microspheres, which were then self-assembled into an ordered periodic structure. A photochromic film was formed by adding polydimethylsiloxane (PDMS) around the self-assembly of PS microspheres on a PDMS substrate. During polymerization, the PS microspheres shrunk depending on the amount of the hydrophilic comonomer, sodium 4-styrenesulfonate (NaSS). Variation in structural color was strongly affected by the size of the PS microspheres. Scanning electron microscopy was used to observe the surface and cross sections of the self-assembled microspheres. Results showed that the order and stacking thickness of microspheres were dependent on the drawing rate of the substrate and suspension concentration. High-transmittance photochromic films could be prepared when the drawing rate was lower than 1 μm/s and the suspension concentration was 20 wt %. PDMS surrounding the vacant space between regularly arranged PS microspheres could not only protect them but also increase the degree of matching between the refractive indices of PS and PDMS. The stability of the reflected structural color increased, and the optical transmittance of the photochromic film approached 95% after PDMS was poured between the PS microspheres. A special pattern could be designed and embedded inside the photochromic film. The PS/PDMS photochromic films can also be applied in decorative painting as well as in security devices, color-changing false nails, and privacy filters.