
Sample records for proyek-proyek pelita ii

  1. Prospek pengembangan industri perkulitan pada pelita VI


    D. Karyadi


    The leather industry is one of the strong competitive industry, as it comes from renewable natural resources. Therefore, the leather industry has good prospect to develop at the Pelita VI to be the industrial products export competitive. To develop leather industry and leather products should be given closed attention and well managed, especially concerning raw material supply, quality and leather waste treatment.

  2. Prospek pengembangan industri perkulitan pada pelita VI

    Directory of Open Access Journals (Sweden)

    D Karyadi


    Full Text Available The leather industry is one of the strong competitive industry, as it comes from renewable natural resources. Therefore, the leather industry has good prospect to develop at the Pelita VI to be the industrial products export competitive. To develop leather industry and leather products should be given closed attention and well managed, especially concerning raw material supply, quality and leather waste treatment.

  3. Analisis Dan Perancangan Data Warehouse Pada PT Pelita Tatamas Jaya

    Directory of Open Access Journals (Sweden)

    Choirul Huda


    Full Text Available The purpose of this research is to assist in providing information to support decision-making processes in sales, purchasing and inventory control at PT Tatamas Pelita Jaya. With the support of data warehouse, business leaders can be more helpful in making decisions more quickly and precisely. Research methodology includes analysis of current systems, library research, designing a data warehousing schema using bintang. The result of this research is the availability of a data warehouse that can generate information quickly and precisely, thus helping the company in making decisions. The conclusion of this research is the application of data warehouse can be a media aide related parties on PT Tatamas Pelita Jaya in decision making. 


    Directory of Open Access Journals (Sweden)

    Azhari Azhari


    Full Text Available Normal 0 false false false IN X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} This paper presents the utilization of knowledge management system for information and knowledge model development of enterprise projects. This information and knowledge management model is based on ontology semantic data model. The ontology data model is new technique for representing information and knowledge base on more semantically conception of meanings of objects, their properties, and relations between them that may arise within certain domain knowledge. The concern of the knowledge management model is to ensure that the model allows the process of creation, access, and utilization of data in a semantically manner (for querying process and information or knowledge of enterprise projects. The experimentation shows that project ontology model has satisfied all consistent, valid, complete, and correct ontology model criteria and can be used for semantic reasoning computation. A prototype of the proposed model can access information and knowledge from the knowledge ontology model.   Kata Kunci: knowledge management system, semantic data model, ontology model, semantiq query, enterprise projects

  5. Strategy Proposal for Pelita Rakyat Hospital as Non Profit Organization in Sukabumi


    Simanjuntak, Yosua Arthur Burhandito; Wandebori, Harimukti


    The Hospital is an institution which provides health service for people with their own characteristic. It influenced by the development of health science, technological advances, and economic-social living of society. As institution, they need to fund their activites. It could be come from government subsidies or fee charge from patient. Pelita Rakyat hospital is non-profit hospital which established in 2011. As pioneer, they did not ask charge from their patient moreover they provide free m...


    Directory of Open Access Journals (Sweden)



    Full Text Available Everyone needs education, because education is the foundation for life to acquire information and knowledge to develop themselves both in the family, school and community environments. As a child mentally retarded retarded retarded intelligence but still has the potential to be developed, the main characteristics of these children have a disadvantage in thinking and reasoning. The impact of the weakness is having the ability to learn and social adaptation in below the average normal children. The purpose of this study was to determine the formation of religious for the child at students of Extraordinary School Pelita Hati Pekanbaru, while the benefits are practically as information for managers, educators, coaches, as well as referrals to families and communities who have children with intellectual challenges in developing the potential of children, especially religious values which constitute the basic provision in this life, and the theoretical results of this study are expected later obtain information that can be used as a coaching principles concerning religious values in students retarded. Religious development patterns conducted by the Extraordinary School Pelita Hati through the field of religious studies, science, PKN and commemorate the Day of the Religious, recitals by using props, concrete objects as a medium that is easily understood by students using transcendental pattern. With this pattern teacher is required to transform the science and give examples of various approaches and fostering student religious consciousness in mental retardation.

  7. Pemanfaatan Potensi Obyek Wisatawilayah Tujuan Wisata Pantai Pangandaran Untuk Pengembangan Wilayah Di Daerah Kabupaten Dati Ii Ciamis Propinsi Jawa Barat

    Directory of Open Access Journals (Sweden)

    Sujali .


    Full Text Available Sektor kepariwisataan merupakan salah satu sektor yang sedang mendapatknn perhatian dari penwrintah. Sala, satu falctor nzendorong dalam pengentbangan kepariwisataan di bcrbagai daeral; tuialtzlz program taltun lcunjungan wisata 91 (Visit Indonesian Year 91, kcntudian direncanalcan tahun kunjungan ASEAN. Selain dorongan tersebut adanya kellijaksanaan Menteri Parpostel yakni Sapta Pesona. Dengan dasar ini apakah dapat dimungkinkan obyek wisata Pantai Pangandaran dan potettsi yang ada dapat diangkat ntenjadi salah satu paket obyek wisata tingkat internasional atnu untuk wisatawan mnncanegara. Obyek wisata Pantai Pangandaran tnerupaan salnh satu obyek wisata di wilayah Kahnpaten Dati II Ciamis Propinsi Jawa Barat yang mempunyai lokasi yang sangat bra yakni di pantai selatan Pulnu Jawa dan memiliki pantai yang landai. Penelitian memputryai beberapa tujuan antara lain; mengetahui potensi obyck wisata, mengetahui samtra dan prasarana obyck wisata sebagai dasar dasar untuk pengembangan kawasan wisata Panattjung Pangandaran, dan mengetalrui kentungkinan pengembangan obyek wisata dimastz mendatang. Sektor pariwisata di Indonesia merupakan salah satu sektor ekonomi jasa yang memiliki prospek ccrah, nanturt hingga dewasa ini helm memperlihatkan peratum yang sesuai dengan ;tampon di claim, proses pornbnngunan di Indonesia. Untuk mettingkatIcatt peran kepariwisataan dalam pernbangunan telah digariskan dalam PELITA IV bahwa sektor pariwisata memperoleh prioritas yang utama di samping sektor lainnya. Data Italian analisis diperolelt dari data sekander yang dihimpun dari petranggung jmvab obyek wisata Pantai Pangandaran yang berlokasi di Pananjung Pangandaran. Sebagai balm' untuk melengkapi laporan dilakukan pengamatan/observasi di lapangan. Teknik analisis akan menyesuaikannya yakni dengan analisis yang sifatnya analisis deskriptif. Obyek wisata dikawasan Pananjung Pangandaran memiliki dua jenis obyek wisata, yaitu: Pantai Indah Pangandaran dan Cagar Alam

  8. Konsep Diri Warga Belajar Program Kesetaraan di Pkbm Pelita Riau, Kecamatan Rumbai Pesisir Kota Pekanbaru


    Sari, Shinta Aprila; Sumardi; Achmad, Said Suhil


    The purpose of this research are: 1) To know the level of self-understanding of citizens learning equality program, 2) To know the level of self-feelings of citizens learning equality program, 3) To know the level of self-view of citizens learning equality program, 4) to know the level of self-confidence (5) To know whether there is a difference between the self-concept of packet A, packet B, and package C, and 7) To know the contribution / contribution of age factor, gender , Religion, ethni...

  9. Pengaruh Disharmonisasi Keluarga Terhadap Penyalahgunaan Narkoba (Studi Kasus di SMK Tunas Pelita Kota Binjai)


    Loka, Gugus Gian


    Adult drug abuse problems are felt increasingly disturbing society, both in countries both seveloped and developing countries. Drug abuse can be attributed to the possible influence of family disharmony. From some of the theories and research results indicate that there is a relationship between family disharmony with the emergence of evil in the context of drug abuse. Child or adolescent from the family backround of the different conditions is estimated to have insight inti the thinking ...

  10. (II) complexes

    African Journals Online (AJOL)

    activities of Schiff base tin (II) complexes. Neelofar1 ... Conclusion: All synthesized Schiff bases and their Tin (II) complexes showed high antimicrobial and ...... Singh HL. Synthesis and characterization of tin (II) complexes of fluorinated Schiff bases derived from amino acids. Spectrochim Acta Part A: Molec Biomolec.

  11. Copper (II)

    African Journals Online (AJOL)


    ABSTRACT: A Schiff base was prepared from the reaction of 2 - amino - 3 – methylbutanoic acid and 2, 4 - pentanedione. The reaction of the prepared Schiff base with ethanolic solution of copper (II) chloride formed diaquo bis( N – 2 – amino – 3 - methylbutyl - 2, 4 - pentanedionato) copper (II) complex. The Schiff base is ...

  12. Ni(II), Mn(II), Zn(II)

    Indian Academy of Sciences (India)


    Abstract. Neutral tetradentate N2O2 type complexes of Cu(II), Ni(II), Mn(II),. Zn(II) and VO(II) have been synthesised using a Schiff base formed by the condensation of o-phenylenediamine with acetoacetanilide in alcohol medium. All the complexes were characterised on the basis of their microanalytical data, molar.

  13. Pb II

    African Journals Online (AJOL)

    Windows User

    used was oven-dried till constant weight and were ground to fine powder in a pestle and mortar. RESULTS AND DISCUSSION. Screening for lead sorption. 15 fungal isolates were screened for Pb(II) biosorption potential at initial pH value of 4.5 and temperature 30°C by incubating freshly harvested wet biomass corres-.

  14. Ni(II), Cu(II) and Zn(II)

    African Journals Online (AJOL)

    Chemical speciation of citric acid complexes of Co(II), Ni(II), Cu(II) and Zn(II) was investigated pH-metrically in 0.0-2.5% anionic, cationic and neutral micellar media. The primary alkalimetric data were pruned with SCPHD program. The existence of different binary species was established from modeling studies using the ...

  15. Ni(II), Cu(II) and Zn(II)

    African Journals Online (AJOL)



    Jun 15, 2010 ... physico-chemical techniques. A square planar geometry was suggested for Cu(II) and octahedral geometry proposed for Co(II),. Ni(II) and Zn(II). TG curves indicated that the complexes decompose in three to four steps. The presence of coordinated water in metal complexes was confirmed by thermal and ...

  16. (ii) and ni (ii) complexes with n

    African Journals Online (AJOL)


    II) complexes with a. Schiff base derived from. 4-dimetylamino benzaldehyde and primary amines. The chemical analysis data showed the formation of (1:1) metal - ligand ratio and a square planar geometry was suggested for Co(II) and Ni(II) ...

  17. manganese(II) and uranyl(II)

    African Journals Online (AJOL)

    Paper electrophoresis is used for the study of equilibria in binary complex systems in solution. The stability constants of ML and ML2 complex species of some metal ions copper(II), manganese(II) and uranyl(II) with a-aminobutenoic acid and hydroxyproline were determined at an ionic strength of 0.1 M and 35 ºC.

  18. Elizabeth II uus kunstigalerii

    Index Scriptorium Estoniae


    Tähistamaks oma troonile asumise 50. aastapäeva, avab Elizabeth II 6. II 2002 Buckinghami palees uue kunstigalerii, mis ehitatakse palee tiibhoonena. Arhitekt John Simpson. Elizabeth II kunstikogust

  19. and ni(ii)

    African Journals Online (AJOL)


    with nickel(II) and cobalt(II) chloride in 2:1 mole ratio yielded Ni(II) and Co(II) complexes respectively. The synthesized compounds were characterized based on melting point/decomposition temperature, solubility, molar conductance, magnetic susceptibility and infrared spectral analyses. The complexes have low molar ...

  20. Preparation and Antimicrobial Screeningof Cu (II, Ni (II, Zn (II Cd (II Complexes

    Directory of Open Access Journals (Sweden)

    R. M. Desai


    Full Text Available The metal complexes of Ni(II, Cu(II, Zn(II Cd(II with organic ligands viz Hydrazine hydrate, 1,2-N,N'-Bisammonium thiocarbamoyl ethane and 1,4-N,N'-Bisammonium thiocarbamoyl benzene have been prepared. These ligands and metal complexes of dithiocarbamates were screened for their antimicrobial activity against various microbs.

  1. Copper (II), cobalt (II), nickel (II) and zinc (II) complexes of Schiff ...

    Indian Academy of Sciences (India)

    Abstract. New Schiff base chelates of Cu(II), Co(II), Ni(II) and Zn(II) derived from benzil-2,4-dinitrophenylhydrazone with aniline have been synthesised. Microanalytical data, molar conductance, and magnetic susceptibility values have been obtained, and IR, 1H NMR, 13C NMR, UV-Vis, CV and EPR spectral studies have ...


    Directory of Open Access Journals (Sweden)

    Nurvelly Rosanti


    Full Text Available Manajemen proyek merupakan bagian yang penting dalam proyek pengembangan perangkat lunak, karenanya penggunaan teknologi untuk mendukung efektifitas dan efisiensi dari manajemen proyek. PT. Trend Communications International (TRENDcom merupakan sebuah perusahaan penyedia jasa Project Management Office (PMO dengan menawarkan keahlian mereka dalam mengelola proyek-proyek IT. Salah satu masalah yang mereka hadapi adalah dalam mengelola waktu. Keterlambatan proyek disebabkan oleh berbagai faktor yang berhubungan dengan manusia, proses dan teknologi. Dari aspek teknologi, tidak adanya aplikasi yang mampu menyediakan informasi bagi manajer proyek dan timnya tentang aktifitas yang berpotensi menyebabkan keterlambatan proyek secara keselurahan, serta tugas yang sering terlewatkan tenggat waktunya merupakan penyebabnya. Dengan menggunakan Metode Jalur Kritis, sebuah aplikasi telah dibangun untuk menyelesaikan permasalahan tersebut. Aplikasi tersebut dapat menunjukan informasi jalur kritis atau jalur yang aktifitasnya perlu dimonitor dengan seksama sehingga dapat diprioritaskan dan fitur pengingat untuk aktifitas yang tenggat waktunya sudah dekat.

  3. and Cu(II)

    African Journals Online (AJOL)


    thereby enhancing higher affinity for the metal ions when compared to the monodentate ligands. Stability constant values of various metal ion complexes involving chelating ligands such as. Ni(II) – famotidine C8H15N7O2S3 complex, Cu-. Dapsone complex, Co(II), and Ni(II) – mixed ligand complexes of amino acids and ...

  4. Spectrophotometric study of Co(II, Ni(II, Cu(II, Zn(II, Pd(II and Hg(II complexes with isatin- β-thiosemicarbazone

    Directory of Open Access Journals (Sweden)



    Full Text Available The composition and stability of the complexes of isatin-b-thiosemicarba­zone with Co(II, Ni(II, Cu(II, Zn(II, Pd(II and Hg(II have been investigated us­ing spectrophotometric method at 30 °C and constant ionic strength of 0.1 mol dm-3 (KNO3 in 70 % ethanol. Experimental results indicate the formation of MeL and MeL2 complexes for Ni(II and Co(II, and MeL for Cu(II, Zn(II, Pd(II and Hg(II complexes, whose stability constants, bn, have been calculated using a com­puteri­zed iterative method of successive approximation.

  5. Quininium tetrachloridozinc(II

    Directory of Open Access Journals (Sweden)

    Li-Zhuang Chen


    Full Text Available The asymmetric unit of the title compound {systematic name: 2-[hydroxy(6-methoxyquinolin-1-ium-4-ylmethyl]-8-vinylquinuclidin-1-ium tetrachloridozinc(II}, (C20H26N2O2[ZnCl4], consists of a double protonated quininium cation and a tetrachloridozinc(II anion. The ZnII ion is in a slightly distorted tetrahedral coordination environment. The crystal structure is stabilized by intermolecular N—H...Cl and O—H...Cl hydrogen bonds.

  6. Burkina Faso - BRIGHT II (United States)

    Millennium Challenge Corporation — Millennium Challenge Corporation hired Mathematica Policy Research to conduct an independent evaluation of the BRIGHT II program. The three main research questions...

  7. Type II universal spacetimes (United States)

    Hervik, S.; Málek, T.; Pravda, V.; Pravdová, A.


    We study type II universal metrics of the Lorentzian signature. These metrics simultaneously solve vacuum field equations of all theories of gravitation with the Lagrangian being a polynomial curvature invariant constructed from the metric, the Riemann tensor and its covariant derivatives of an arbitrary order. We provide examples of type II universal metrics for all composite number dimensions. On the other hand, we have no examples for prime number dimensions and we prove the non-existence of type II universal spacetimes in five dimensions. We also present type II vacuum solutions of selected classes of gravitational theories, such as Lovelock, quadratic and L({{Riemann}}) gravities.


    African Journals Online (AJOL)

    Chemical speciation of Pb(II), Cd(II), Hg(II), Co(II), Ni(II), Cu(II) and Zn(II) complexes of L-methionine in 0.0-60 % v/v 1,2-propanediol-water mixtures maintaining an ionic strength of 0.16 M at 303 K has been studied pH metrically. The active forms of ligand are LH2+, LH and L-. The predominant species detected are ML, ...

  9. Small Diameter Bomb Increment II (SDB II) (United States)


    Related Operations and Maintenance ACAT - Acquisition Category ADM - Acquisition Decision Memorandum APB - Acquisition Program Baseline APPN...DoN) ACAT ID program, with the USAF as the lead service. SDB II provides the warfighter the capability to attack mobile targets from stand-off, through

  10. Copper (II) Complex

    African Journals Online (AJOL)


    ABSTRACT: N – histidyl – 2, 4 – pentanedione Schiff base was prepared from the reaction of histidine and 2, 4 - pentandione. The reaction of methanolic solution of N – histidyl – 2, 4 – pentanedione Schiff base with ethanolic solution of copper (II) chloride gave diaquo bis( N – histidyl - 2, 4 - pentanedionato) copper (II) ...

  11. Synthesis and characterisation of Cu (II), Ni (II), Mn (II), Zn (II) and ...

    Indian Academy of Sciences (India)

    ... are square-planar except the Mn(II) and VO(II) chelates, which are of octahedral and square pyramidal geometry respectively. The monomeric and neutral nature of the complexes was confirmed by their magnetic susceptibility data and low conductance values. The ESR spectra of copper and vanadyl complexes in DMSO ...

  12. Rom II-forordningen

    DEFF Research Database (Denmark)

    Pii, Tine; Nielsen, Peter Arnt


    Artiklen redegør for de vigtigste regler i Europaparlamentets og Rådets forordning om lovvalgsregler for forpligtelser uden for kontraktforhold (Rom II) og sammenligner dem med dansk ret.......Artiklen redegør for de vigtigste regler i Europaparlamentets og Rådets forordning om lovvalgsregler for forpligtelser uden for kontraktforhold (Rom II) og sammenligner dem med dansk ret....

  13. Biologically active new Fe(II, Co(II, Ni(II, Cu(II, Zn(II and Cd(II complexes of N-(2-thienylmethylenemethanamine

    Directory of Open Access Journals (Sweden)

    C. SPÎNU


    Full Text Available Iron(II, cobalt(II, nickel (II, copper (II, zinc(II and cadmium(II complexes of the type ML2Cl2, where M is a metal and L is the Schiff base N-(2-thienylmethylenemethanamine (TNAM formed by the condensation of 2-thiophenecarboxaldehyde and methylamine, were prepared and characterized by elemental analysis as well as magnetic and spectroscopic measurements. The elemental analyses suggest the stoichiometry to be 1:2 (metal:ligand. Magnetic susceptibility data coupled with electronic, ESR and Mössbauer spectra suggest a distorted octahedral structure for the Fe(II, Co(II and Ni(II complexes, a square-planar geometry for the Cu(II compound and a tetrahedral geometry for the Zn(II and Cd(II complexes. The infrared and NMR spectra of the complexes agree with co-ordination to the central metal atom through nitrogen and sulphur atoms. Conductance measurements suggest the non-electrolytic nature of the complexes, except for the Cu(II, Zn(II and Cd(II complexes, which are 1:2 electrolytes. The Schiff base and its metal chelates were screened for their biological activity against Escherichia coli, Staphylococcus aureus and Pseudomonas aeruginosa and the metal chelates were found to possess better antibacterial activity than that of the uncomplexed Schiff base.

  14. Multiple endocrine neoplasia (MEN) II (United States)

    ... Multiple endocrine neoplasia (MEN) II To use the sharing features on this page, please enable JavaScript. Multiple endocrine neoplasia, type II (MEN II) is a disorder passed ...

  15. and ni(ii)

    African Journals Online (AJOL)


    decomposition ... and left in an ice bath for 3hours. The solid complexes ... Table 1. Physical Properties of the ligand and its corresponding metal (II) Complexes. Compound/Ligand. Colour. Percentage. Yield(%). Melting. Point (. °. C). Decomposition.

  16. The Belle II Experiment

    CERN Document Server

    Kahn, J


    Set to begin data taking at the end of 2018, the Belle II experiment is the next-generation B-factory experiment hosted at KEK in Tsukuba, Japan. The experiment represents the cumulative effort from the collaboration of experimental and detector physics, computing, and software development. Taking everything learned from the previous Belle experiment, which ran from 1998 to 2010, Belle II aims to probe deeper than ever before into the field of heavy quark physics. By achieving an integrated luminosity of 50 ab−1 and accumulating 50 times more data than the previous experiment across its lifetime, along with a rewritten analysis framework, the Belle II experiment will push the high precision frontier of high energy physics. This paper will give an overview of the key components and development activities that make the Belle II experiment possible.

  17. NNDSS - Table II. Vibriosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Vibriosis - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year), and...

  18. NNDSS - Table II. Vibriosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Vibriosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year), and...

  19. Leo II PC (United States)

    Kansas Data Access and Support Center — LEO II is a second-generation software system developed for use on the PC, which is designed to convert location references accurately between legal descriptions and...

  20. Gamble II Facility (United States)

    Federal Laboratory Consortium — FUNCTION: Gamble II produces a high-voltage (2 MV), high-current (1 MA), short (100 ns) pulse of energy of either positive or negative polarity. This terawatt power...

  1. Computing at Belle II (United States)

    Kuhr, Thomas


    Belle II, a next-generation B-factory experiment, will search for new physics effects in a data sample about 50 times larger than the one collected by its predecessor, the Belle experiment. To match the advances in accelerator and detector technology, the computing system and the software have to be upgraded as well. The Belle II computing model is presented and an overview of the distributed computing system and the offline software framework is given.

  2. A barium(II)

    Indian Academy of Sciences (India)


    [(pentaaqua)(4-nitrobenzoato-O,O′)barium(II)] units are linked into an infinite one-dimensional chain along b-axis with the aid of the ... long Ba⋅⋅⋅Ba distance of 6⋅750(1) Å is observed between adjacent Ba(II) ions in the chain and the oxygen atoms of the ... The colour- less crystalline blocks that separated were filtered,.

  3. II Infused Mice

    Directory of Open Access Journals (Sweden)

    Justin L. Wilson


    Full Text Available The anti-inflammatory properties of PPAR-α plays an important role in attenuating hypertension. The current study determines the anti-hypertensive and anti-inflammatory role of PPAR-α agonist during a slow-pressor dose of Ang II (400 ng/kg/min. Ten to twelve week old male PPAR-α KO mice and their WT controls were implanted with telemetry devices and infused with Ang II for 12 days. On day 12 of Ang II infusion, MAP was elevated in PPAR-α KO mice compared to WT (161±4 mmHg versus 145±4 mmHg and fenofibrate (145 mg/kg/day reduced MAP in WT + Ang II mice (134±7 mmHg. Plasma IL-6 levels were higher in PPAR-α KO mice on day 12 of Ang II infusion (30±4 versus 8±2 pg/mL and fenofibrate reduced plasma IL-6 in Ang II-treated WT mice (10±3 pg/mL. Fenofibrate increased renal expression of CYP4A, restored renal CYP2J expression, reduced the elevation in renal ICAM-1, MCP-1 and COX-2 in WT + Ang II mice. Our results demonstrate that activation of PPAR-α attenuates Ang II-induced hypertension through up-regulation of CYP4A and CYP2J and an attenuation of inflammatory markers such as plasma IL-6, renal MCP-1, renal expression of ICAM-1 and COX-2.

  4. II-VI semiconductor compounds

    CERN Document Server


    For condensed matter physicists and electronic engineers, this volume deals with aspects of II-VI semiconductor compounds. Areas covered include devices and applications of II-VI compounds; Co-based II-IV semi-magnetic semiconductors; and electronic structure of strained II-VI superlattices.

  5. Synthesis and characterization of novel M(II) (M = Mn(II), Ni(II), Cu(II ...

    African Journals Online (AJOL)

    The coordination chemistry towards the M(II) metal centre (M = Mn, Ni, Cu or Zn) of ... ligand (E)-2-amino-N'-[1-(pyridin-2-yl)ethylidene]benzohydrazide (H3L) has been ... UV-Visible spectroscopy, elemental analysis and X-ray crystal diffraction. ... KEY WORDS: Schiff base, Phenolate, Manganese(II), Nickel(II), Copper(II), ...

  6. Experiment Tgv II (United States)

    Čermák, P.; Štekl, I.; Beneš, P.; Brudanin, V. B.; Rukhadze, N. I.; Egorov, V. G.; Kovalenko, V. E.; Kovalík, A.; Salamatin, A. V.; Timkin, V. V.; Vylov, Ts.; Briancon, Ch.; Šimkovic, F.


    The project aims at the measurement of very rare processes of double-beta decay of 106Cd and 48Ca. The experimental facility TGV II (Telescope Germanium Vertical) makes use of 32 HPGe planar detectors mounted in one common cryostat. The detectors are interleaved with thin foils containing ββ sources. Besides passive shielding against background radiation made of pure copper, lead and boron dopped polyethylene additional techniques for background suppression based on digital pulse shape analysis are used. The experimental setup is located in Modane underground laboratory (France). A review of the TGV II facility, its performance parameters and capabilities are presented.

  7. Calculus II For Dummies

    CERN Document Server

    Zegarelli, Mark


    An easy-to-understand primer on advanced calculus topics Calculus II is a prerequisite for many popular college majors, including pre-med, engineering, and physics. Calculus II For Dummies offers expert instruction, advice, and tips to help second semester calculus students get a handle on the subject and ace their exams. It covers intermediate calculus topics in plain English, featuring in-depth coverage of integration, including substitution, integration techniques and when to use them, approximate integration, and improper integrals. This hands-on guide also covers sequences and series, wit

  8. Galaxy S II

    CERN Document Server

    Gralla, Preston


    Unlock the potential of Samsung's outstanding smartphone with this jargon-free guide from technology guru Preston Gralla. You'll quickly learn how to shoot high-res photos and HD video, keep your schedule, stay in touch, and enjoy your favorite media. Every page is packed with illustrations and valuable advice to help you get the most from the smartest phone in town. The important stuff you need to know: Get dialed in. Learn your way around the Galaxy S II's calling and texting features.Go online. Browse the Web, manage email, and download apps with Galaxy S II's 3G/4G network (or create you

  9. Cu (II), Zn (II) andMn (II) complexes of poly (methyl vinyl ether-alt ...

    Indian Academy of Sciences (India)

    MVE-alt-MA)) with Zn(II), Mn(II) and Cu(II) ions were synthesized from the reaction of the aqueous solution of copolymer and metal(II) chlorides at different temperatures ranging from 25° to 40°C. Elemental analysis of themetal-polymer complexes ...

  10. Structure of photosystem II

    NARCIS (Netherlands)

    van Bezouwen, Laura


    In this thesis we discuss several structures of photosystem II, which are determined by electron microscopy and single particle analysis. When the structure is known it can be combined with the function, which is of key importance for optimal use of its properties. In this thesis plants, Arabidopsis

  11. Amorphous iron (II) carbonate

    DEFF Research Database (Denmark)

    Sel, Ozlem; Radha, A.V.; Dideriksen, Knud


    Abstract The synthesis, characterization and crystallization energetics of amorphous iron (II) carbonate (AFC) are reported. AFC may form as a precursor for siderite (FeCO3). The enthalpy of crystallization (DHcrys) of AFC is similar to that of amorphous magnesium carbonate (AMC) and more...

  12. Class II Microcins (United States)

    Vassiliadis, Gaëlle; Destoumieux-Garzón, Delphine; Peduzzi, Jean

    Class II microcins are 4.9- to 8.9-kDa polypeptides produced by and active against enterobacteria. They are classified into two subfamilies according to their structure and their gene cluster arrangement. While class IIa microcins undergo no posttranslational modification, class IIb microcins show a conserved C-terminal sequence that carries a salmochelin-like siderophore motif as a posttranslational modification. Aside from this C-terminal end, which is the signature of class IIb microcins, some sequence similarities can be observed within and between class II subclasses, suggesting the existence of common ancestors. Their mechanisms of action are still under investigation, but several class II microcins use inner membrane proteins as cellular targets, and some of them are membrane-active. Like group B colicins, many, if not all, class II microcins are TonB- and energy-dependent and use catecholate siderophore receptors for recognition/­translocation across the outer membrane. In that context, class IIb microcins are considered to have developed molecular mimicry to increase their affinity for their outer membrane receptors through their salmochelin-like posttranslational modification.

  13. Surveying Lab II site

    CERN Document Server


    The network of survey reference points on the Lab II site was extended to meet the geodetic needs of the SPS and its North Experimental Area. The work was greatly eased by a geodolite, a measuring instrument on loan from the Fermi Laboratory, which uses a modulated laser beam. (See CERN Courier 14 (1974) p. 247.)


    African Journals Online (AJOL)

    (4,5) hava been reported. It has been found that several of the dicobelt (II) complexes of the coie'cial diporphyrins catalyze the four—electron reduction of dioxygen to water (6—10). In our laboratories we. have synthesized a hybrid porphyrin—like ligand 1 that allows the incorporation of two metals within one macrocyclic ...

  15. Photosystem II and photoinhibition

    NARCIS (Netherlands)

    Feikema, Willem Onno


    Plants harvest light energy and convert it into chemical energy. Light absorption by photosystems I and II (PSI and PSII) results in charge separations in their reaction centers (RCs), initiating a chain of redox reactions with PSI generating the reducing power for CO2 assimilation into sugars, and

  16. Potentiometric and spectrometric study: Copper (II), nickel (II) and ...

    Indian Academy of Sciences (India)

    Equilibrium and solution structural study of mixed-metal-mixed-ligand complexes of Cu(II), Ni(II) and Zn(II) with L-cysteine, L-threonine and imidazole are conducted in aqueous solution by potentiometry and spectrophotometry. Stability constants of the binary, ternary and quaternary complexes are determined at 25 ± 1 ° C ...

  17. Spectroscopic and potentiometric studies of Co (II) and Ni (II ...

    African Journals Online (AJOL)

    The Schiff base complexes of cobalt(II) and nickel(II) were synthesized by refluxing the mixture of ethanolic solutions of the Schiff base and metal(II) chlorides, respectively. The complexes were characterized by gravimetry, spectrophotometry, potentiometry, molar conductance and infrared analyses. The N-(1- ...

  18. Heat transfer II essentials

    CERN Document Server

    REA, The Editors of


    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Heat Transfer II reviews correlations for forced convection, free convection, heat exchangers, radiation heat transfer, and boiling and condensation.

  19. Transport phenomena II essentials

    CERN Document Server

    REA, The Editors of


    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Transport Phenomena II covers forced convention, temperature distribution, free convection, diffusitivity and the mechanism of mass transfer, convective mass transfer, concentration

  20. Numerical analysis II essentials

    CERN Document Server

    REA, The Editors of; Staff of Research Education Association


    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Numerical Analysis II covers simultaneous linear systems and matrix methods, differential equations, Fourier transformations, partial differential equations, and Monte Carlo methods.

  1. Algebra & trigonometry II essentials

    CERN Document Server

    REA, Editors of


    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Algebra & Trigonometry II includes logarithms, sequences and series, permutations, combinations and probability, vectors, matrices, determinants and systems of equations, mathematica

  2. Cervantes y Felipe II

    Directory of Open Access Journals (Sweden)

    Ludovik Osterc


    Full Text Available Como es sabido, el 13 de septiembre de 1598, a las cinco de la mañana, falleció en el Escorial el Rey Felipe II. Sevilla que según sus historiadores siempre se distinguió entre todas las ciudades de España por el fausto y suntuosidad de los sucesos solemnes, ya sea cuando los monarcas se dignaban visitarla, ya sea cuando se trataba de honrar su memoria con ocasión de su muerte, se habia excedido a si misma en el reinado de Felipe II. La pública y señorial entrada de su padre, el emperador Carlos V cuando en 1526 vino a esta ciudad para realizar sus bodas con la Infanta Isabel de Portugal, que por su magnificencia consignan sus anales, como superior a cuantas hubo antes en análogas circunstancias, no puede compararse con el recibimiento dispensado a Felipe II, el año de 1570, que por encargo de su Cabildo describió la docta pluma de Mal Lara.

  3. What is LAMPF II

    Energy Technology Data Exchange (ETDEWEB)

    Thiessen, H.A.


    The present conception of LAMPF II is a high-intensity 16-GeV synchrotron injected by the LAMPF 800-MeV H/sup -/ beam. The proton beam will be used to make secondary beams of neutrinos, muons, pions, kaons, antiprotons, and hyperons more intense than those of any existing or proposed accelerator. For example, by taking maximum advantage of a thick target, modern beam optics, and the LAMPF II proton beam, it will be possible to make a negative muon beam with nearly 100% duty factor and nearly 100 times the flux of the existing Stopped Muon Channel (SMC). Because the unique features of the proposed machine are most applicable to beams of the same momentum as LAMPF (that is, < 2 GeV/c), it may be possible to use most of the experimental areas and some of the auxiliary equipment, including spectrometers, with the new accelerator. The complete facility will provide improved technology for many areas of physics already available at LAMPF and will allow expansion of medium-energy physics to include kaons, antiprotons, and hyperons. When LAMPF II comes on line in 1990 LAMPF will have been operational for 18 years and a major upgrade such as this proposal will be reasonable and prudent.

  4. Average [O II]nebular emission associated with Mg II absorbers: Dependence on Fe II absorption (United States)

    Joshi, Ravi; Srianand, Raghunathan; Petitjean, Patrick; Noterdaeme, Pasquier


    We investigate the effect of Fe II equivalent width (W2600) and fibre size on the average luminosity of [O II]λλ3727,3729 nebular emission associated with Mg II absorbers (at 0.55 ≤ z ≤ 1.3) in the composite spectra of quasars obtained with 3 and 2 arcsec fibres in the Sloan Digital Sky Survey. We confirm the presence of strong correlations between [O II] luminosity (L_{[O II]}) and equivalent width (W2796) and redshift of Mg II absorbers. However, we show L_{[O II]} and average luminosity surface density suffers from fibre size effects. More importantly, for a given fibre size the average L_{[O II]} strongly depends on the equivalent width of Fe II absorption lines and found to be higher for Mg II absorbers with R ≡W2600/W2796 ≥0.5. In fact, we show the observed strong correlations of L_{[O II]} with W2796 and z of Mg II absorbers are mainly driven by such systems. Direct [O II] detections also confirm the link between L_{[O II]} and R. Therefore, one has to pay attention to the fibre losses and dependence of redshift evolution of Mg II absorbers on W2600 before using them as a luminosity unbiased probe of global star formation rate density. We show that the [O II] nebular emission detected in the stacked spectrum is not dominated by few direct detections (i.e., detections ≥3σ significant level). On an average the systems with R ≥0.5 and W2796 ≥2Å are more reddened, showing colour excess E(B - V) ˜ 0.02, with respect to the systems with R <0.5 and most likely traces the high H I column density systems.

  5. Algebra II workbook for dummies

    CERN Document Server

    Sterling, Mary Jane


    To succeed in Algebra II, start practicing now Algebra II builds on your Algebra I skills to prepare you for trigonometry, calculus, and a of myriad STEM topics. Working through practice problems helps students better ingest and retain lesson content, creating a solid foundation to build on for future success. Algebra II Workbook For Dummies, 2nd Edition helps you learn Algebra II by doing Algebra II. Author and math professor Mary Jane Sterling walks you through the entire course, showing you how to approach and solve the problems you encounter in class. You'll begin by refreshing your Algebr

  6. Synthesis and spectroscopic studies of biologically active tetraazamacrocyclic complexes of Mn(II, Co(II, Ni(II, Pd(II and Pt(II

    Directory of Open Access Journals (Sweden)

    Monika Tyagi


    Full Text Available Complexes of Mn(II, Co(II, Ni(II, Pd(II and Pt(II were synthesized with the macrocyclic ligand, i.e., 2,3,9,10-tetraketo-1,4,8,11-tetraazacycoletradecane. The ligand was prepared by the [2 + 2] condensation of diethyloxalate and 1,3-diamino propane and characterized by elemental analysis, mass, IR and 1H NMR spectral studies. All the complexes were characterized by elemental analysis, molar conductance, magnetic susceptibility measurements, IR, electronic and electron paramagnetic resonance spectral studies. The molar conductance measurements of Mn(II, Co(II and Ni(II complexes in DMF correspond to non electrolyte nature, whereas Pd(II and Pt(II complexes are 1:2 electrolyte. On the basis of spectral studies an octahedral geometry has been assigned for Mn(II, Co(II and Ni(II complexes, whereas square planar geometry assigned for Pd(II and Pt(II. In vitro the ligand and its metal complexes were evaluated against plant pathogenic fungi (Fusarium odum, Aspergillus niger and Rhizoctonia bataticola and some compounds found to be more active as commercially available fungicide like Chlorothalonil.

  7. Copper (II) nickel (II), cobalt (II) and oxovanadium (IV) complexes of ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 112; Issue 3. Copper(II) nickel(II), cobalt(II) and oxovanadium(IV) complexes of substituted ∙ - ... Author Affiliations. S Sevagapandian1 K Nehru1 P R Athappan1. Department of Inorganic Chemistry, Madurai Kamaraj University, Madurai 625 021, India ...

  8. Thermodynamics II essentials

    CERN Document Server

    REA, The Editors of


    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Thermodynamics II includes review of thermodynamic relations, power and refrigeration cycles, mixtures and solutions, chemical reactions, chemical equilibrium, and flow through nozzl

  9. Physical chemistry II essentials

    CERN Document Server

    REA, The Editors of


    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Physical Chemistry II includes reaction mechanisms, theoretical approaches to chemical kinetics, gravitational work, electrical and magnetic work, surface work, kinetic theory, collisional and transport properties of gases, statistical mechanics, matter and waves, quantum mechanics, and rotations and vibrations of atoms and molecules.

  10. Data structures II essentials

    CERN Document Server

    Smolarski, Dennis C


    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Data Structures II includes sets, trees, advanced sorting, elementary graph theory, hashing, memory management and garbage collection, and appendices on recursion vs. iteration, alge

  11. Engineering mathematics-II

    CERN Document Server

    Ganesh, A


    About the Book: This book Engineering Mathematics-II is designed as a self-contained, comprehensive classroom text for the second semester B.E. Classes of Visveswaraiah Technological University as per the Revised new Syllabus. The topics included are Differential Calculus, Integral Calculus and Vector Integration, Differential Equations and Laplace Transforms. The book is written in a simple way and is accompanied with explanatory figures. All this make the students enjoy the subject while they learn. Inclusion of selected exercises and problems make the book educational in nature. It shou

  12. Thin film processes II

    CERN Document Server

    Kern, Werner


    This sequel to the 1978 classic, Thin Film Processes, gives a clear, practical exposition of important thin film deposition and etching processes that have not yet been adequately reviewed. It discusses selected processes in tutorial overviews with implementation guide lines and an introduction to the literature. Though edited to stand alone, when taken together, Thin Film Processes II and its predecessor present a thorough grounding in modern thin film techniques.Key Features* Provides an all-new sequel to the 1978 classic, Thin Film Processes* Introduces new topics, and sever

  13. Computer science II essentials

    CERN Document Server

    Raus, Randall


    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Computer Science II includes organization of a computer, memory and input/output, coding, data structures, and program development. Also included is an overview of the most commonly

  14. Statistics II essentials

    CERN Document Server

    Milewski, Emil G


    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Statistics II discusses sampling theory, statistical inference, independent and dependent variables, correlation theory, experimental design, count data, chi-square test, and time se

  15. Physics II for dummies

    CERN Document Server

    Holzner, Steven


    A plain-English guide to advanced physics. Does just thinking about the laws of motion make your head spin? Does studying electricity short your circuits? Physics II For Dummies walks you through the essentials and gives you easy-to-understand and digestible guidance on this often intimidating course. Thanks to this book, you don?t have to be Einstein to understand physics. As you learn about mechanical waves and sound, forces and fields, electric potential and electric energy, and much more, you?ll appreciate the For Dummies law: The easier we make it, the faster you'll understand it!

  16. Graphics gems II

    CERN Document Server

    Arvo, James


    Graphics Gems II is a collection of articles shared by a diverse group of people that reflect ideas and approaches in graphics programming which can benefit other computer graphics programmers.This volume presents techniques for doing well-known graphics operations faster or easier. The book contains chapters devoted to topics on two-dimensional and three-dimensional geometry and algorithms, image processing, frame buffer techniques, and ray tracing techniques. The radiosity approach, matrix techniques, and numerical and programming techniques are likewise discussed.Graphics artists and comput

  17. Complex variables II essentials

    CERN Document Server

    Solomon, Alan D


    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Complex Variables II includes elementary mappings and Mobius transformation, mappings by general functions, conformal mappings and harmonic functions, applying complex functions to a

  18. Electronics II essentials

    CERN Document Server

    REA, The Editors of


    REA's Essentials provide quick and easy access to critical information in a variety of different fields, ranging from the most basic to the most advanced. As its name implies, these concise, comprehensive study guides summarize the essentials of the field covered. Essentials are helpful when preparing for exams, doing homework and will remain a lasting reference source for students, teachers, and professionals. Electronics II covers operational amplifiers, feedback and frequency compensation of OP amps, multivibrators, logic gates and families, Boolean algebra, registers, counters, arithmet

  19. The Belle II Detector (United States)

    Piilonen, Leo; Belle Collaboration, II


    The Belle II detector is now under construction at the KEK laboratory in Japan. This project represents a substantial upgrade of the Belle detector (and the KEKB accelerator). The Belle II experiment will record 50 ab-1 of data, a factor of 50 more than that recorded by Belle. This large data set, combined with the low backgrounds and high trigger efficiencies characteristic of an e+e- experiment, should provide unprecedented sensitivity to new physics signatures in B and D meson decays, and in τ lepton decays. The detector comprises many forefront subsystems. The vertex detector consists of two inner layers of silicon DEPFET pixels and four outer layers of double-sided silicon strips. These layers surround a beryllium beam pipe having a radius of only 10 mm. Outside of the vertex detector is a large-radius, small-cell drift chamber, an ``imaging time-of-propagation'' detector based on Cerenkov radiation for particle identification, and scintillating fibers and resistive plate chambers used to identify muons. The detector will begin commissioning in 2017.

  20. DARHT II Scaled Accelerator Tests on the ETA II Accelerator*

    Energy Technology Data Exchange (ETDEWEB)

    Weir, J T; Anaya Jr, E M; Caporaso, G J; Chambers, F W; Chen, Y; Falabella, S; Lee, B S; Paul, A C; Raymond, B A; Richardson, R A; Watson, J A; Chan, D; Davis, H A; Day, L A; Scarpetti, R D; Schultze, M E; Hughes, T P


    The DARHT II accelerator at LANL is preparing a series of preliminary tests at the reduced voltage of 7.8 MeV. The transport hardware between the end of the accelerator and the final target magnet was shipped to LLNL and installed on ETA II. Using the ETA II beam at 5.2 MeV we completed a set of experiments designed reduce start up time on the DARHT II experiments and run the equipment in a configuration adapted to the reduced energy. Results of the beam transport using a reduced energy beam, including the kicker and kicker pulser system will be presented.

  1. Inside ISIS II

    CERN Multimedia


    ISIS stands for Identification of Secondaries by Ionization Sampling. It was a drift chamber with an active volume of about 40 m3 built by Oxford University as a particle identifier for the European Hybrid Spectrometer (EHS). The photo shows the electrostatic grading structure and the central anode-wire plane, with Roger Giles standing just under it (Annual Report 1981 p. 57, Fig. 4). ISIS-II differed from the prototype ISIS-I only in the depth of the track (4 m instead of 1 m) thus extending the momentum range for particle identification to 50 GeV/c. See Nucl. Instr. and Meth. 224 (1984) 396, and Nucl. Instr. and Meth. 258 (1987) 26.

  2. Effect of Cu(II), Cd(II) and Zn(II) on Pb(II) biosorption by algae Gelidium-derived materials. (United States)

    Vilar, Vítor J P; Botelho, Cidália M S; Boaventura, Rui A R


    Biosorption of Pb(II), Cu(II), Cd(II) and Zn(II) from binary metal solutions onto the algae Gelidium sesquipedale, an algal industrial waste and a waste-based composite material was investigated at pH 5.3, in a batch system. Binary Pb(II)/Cu(II), Pb(II)/Cd(II) and Pb(II)/Zn(II) solutions have been tested. For the same equilibrium concentrations of both metal ions (1 mmol l(-1)), approximately 66, 85 and 86% of the total uptake capacity of the biosorbents is taken by lead ions in the systems Pb(II)/Cu(II), Pb(II)/Cd(II) and Pb(II)/Zn(II), respectively. Two-metal results were fitted to a discrete and a continuous model, showing the inhibition of the primary metal biosorption by the co-cation. The model parameters suggest that Cd(II) and Zn(II) have the same decreasing effect on the Pb(II) uptake capacity. The uptake of Pb(II) was highly sensitive to the presence of Cu(II). From the discrete model it was possible to obtain the Langmuir affinity constant for Pb(II) biosorption. The presence of the co-cations decreases the apparent affinity of Pb(II). The experimental results were successfully fitted by the continuous model, at different pH values, for each biosorbent. The following sequence for the equilibrium affinity constants was found: Pb>Cu>Cd approximately Zn.

  3. Potentiometric studies of Nickel (II) and copper (II) acetyl acetonato ...

    African Journals Online (AJOL)

    Potentiometric studies of Nickel (II) and copper (II) acetyl acetonato complexes. HN Aliyu, A Mustapha. Abstract. The dissociation constant pKa of acetylacetone has been determined potentiometrically. The pKa value obtained is 9.40, indicating a weak acid. The stability constants of the complex compounds formed from the ...


    African Journals Online (AJOL)


    ABSTRACT. The dissociation constant pKa of acetylacetone has been determined potentiometrically. The pKa value obtained is 9.40, indicating a weak acid. The stability constants of the complex compounds formed from the reaction of nickel (II) and copper (II) with acetylacetone determined using potentiometer are ...

  5. Lead (II) and nickel (II) adsorption kinetics from aqueous metal ...

    African Journals Online (AJOL)

    This paper discusses the kinetics of lead (II) and Nickel (II) ions adsorption from aqueous solutions using chemically modified and unmodified agricultural adsorbents at 28°C, pH 6.2 and 0.01M NaCl ionic strength. The removal of the two metals were found to increase with increase in chemical modification, the sequence ...

  6. Type II Supernova Spectral Diversity. II. Spectroscopic and Photometric Correlations

    DEFF Research Database (Denmark)

    Gutierrez, Claudia P.; Anderson, Joseph P.; Hamuy, Mario


    We present an analysis of observed trends and correlations between a large range of spectral and photometric parameters of more than 100 type II supernovae (SNe II), during the photospheric phase. We define a common epoch for all SNe of 50 days post-explosion, where the majority of the sample is ...


    African Journals Online (AJOL)

    Preferred Customer

    binary complex systems contain the chemical species ML, ML2, MLH, ML2H and ML2H2 for Co(II), Ni(II) and. Cu(II) in dioxan-water ... KEY WORDS: Binary species, Stability constants, Metal, Dopa, Dioxan, pH-metry ..... application in complex equilibria to decide whether inclusion of more species in the model is necessary ...


    African Journals Online (AJOL)

    Preferred Customer

    Binary complexes of maleic acid with toxic metal ions such as Pb(II), Cd(II) and Hg(II) have been studied in 0.0-2.5% v/v .... refinement of binary systems, the correction factor and the protonation constants of maleic acid were fixed. .... In order to rely upon the 'best-fit' model for critical evaluation and application under varied.

  9. Unusual route for preparation of manganese (II), cobalt (II), zinc (II ...

    Indian Academy of Sciences (India)

    The manganese(II) carbonate, MnCO3.H2O, cobalt(II) carbonate, CoCO3.4H2O, zinc(II) carbonate, ZnCO3 and cadmium(II) carbonate, CdCO3, respectively, were synthesis by a new simple unusual route during the reaction of aqueous solutions of MnX2, CoX2, ZnX2 and CdX2, where (X = Br- and ClO 4 − ) with urea at ...

  10. Software Development at Belle II (United States)

    Kuhr, Thomas; Hauth, Thomas


    Belle II is a next generation B-factory experiment that will collect 50 times more data than its predecessor Belle. This requires not only a major upgrade of the detector hardware, but also of the simulation, reconstruction, and analysis software. The challenges of the software development at Belle II and the tools and procedures to address them are reviewed in this article.

  11. Copper (II) complexes with aroylhydrazones

    Indian Academy of Sciences (India)

    Copper(II) complexes with aroylhydrazones ... The coordination chemistry of copper(II) with tridentate aroylhydrazones is briefly discussed in this article. ... EPR spectroscopy and variable temperature magnetic susceptibility measurements have been used to reveal the nature of the coordination geometry and magnetic ...

  12. Penetrating Internet Information Services (IIS).

    African Journals Online (AJOL)



    Dec 1, 2013 ... by default. On IIS 5.0 however, unless the Internet Printing Protocol function is in use, administrators are strongly encouraged to remove the ISAPI application mapping for .printer resources. The ISAPI mappings can be defined for the entire or an individual web site from the IIS management console snap-in.

  13. (ABA)-simulating photosystem II

    African Journals Online (AJOL)

    ajl yemi


    Nov 14, 2011 ... Leaf photosynthetic activity limited by summer heat stress represents large constraint to production process of fruit trees. To cope with this problem, we tested photosystem II (PS II) thermostability in clonal apple tree rootstocks with different growth intensity - semi-vigorous-MM106 and dwarfing-J-TE-F.

  14. The Cu II Spectrum

    Directory of Open Access Journals (Sweden)

    Alexander Kramida


    Full Text Available New wavelength measurements in the vacuum ultraviolet (VUV, ultraviolet and visible spectral regions have been combined with available literature data to refine and extend the description of the spectrum of singly ionized copper (Cu II. In the VUV region, we measured 401 lines using a concave grating spectrograph and photographic plates. In the UV and visible regions, we measured 276 lines using a Fourier-transform spectrometer. These new measurements were combined with previously unpublished data from the thesis of Ross, with accurate VUV grating measurements of Kaufman and Ward, and with less accurate older measurements of Shenstone to construct a comprehensive list of ≈2440 observed lines, from which we derived a revised set of 379 optimized energy levels, complemented with 89 additional levels obtained using series formulas. Among the 379 experimental levels, 29 are new. Intensities of all lines observed in different experiments have been reduced to the same uniform scale by using newly calculated transition probabilities (A-values. We combined our calculations with published measured and calculated A-values to provide a set of 555 critically evaluated transition probabilities with estimated uncertainties, 162 of which are less than 20%.

  15. Neurofibromatosis Type II

    Directory of Open Access Journals (Sweden)

    Akram Kasiri Ghahi


    Full Text Available Neurofibromatosis type 2 (NF2 is an inherited disease which is mainly characterized by the development of multiple schwannomas and meningiomas.  Incidence of the disease is about 1 in 60,000. Affected individuals inevitably develop schwannomas, typically affecting both auditory-vestibular nerve which lead in hearing loss and deafness. The majority of patients present with hearing loss, which is usually unilateral at onset and may be accompanied or preceded by tinnitus. Vestibular schwannomas may also cause dizziness or imbalance as a first symptom. Nausea, vomiting or true vertigo are rare symptoms, except in late-stage disease. NF II is caused by a defect in the gene that normally gives rise to a product called Merlin or Schwannomin, located on chromosome 22. Diagnosis is based on clinical and neuroimaging studies. Presymptomatic genetic testing is an integral part of the management of NF2 families. Prenatal diagnosis and pre-implantation genetic diagnosis is possible.

  16. Crystal Structure of Rat Carnitine Palmitoyltransferase II (CPT-II)

    Energy Technology Data Exchange (ETDEWEB)

    Hsiao,Y.; Jogl, G.; Esser, V.; Tong, L.


    Carnitine palmitoyltransferase II (CPT-II) has a crucial role in the {beta}-oxidation of long-chain fatty acids in mitochondria. We report here the crystal structure of rat CPT-II at 1.9 Angstroms resolution. The overall structure shares strong similarity to those of short- and medium-chain carnitine acyltransferases, although detailed structural differences in the active site region have a significant impact on the substrate selectivity of CPT-II. Three aliphatic chains, possibly from a detergent that is used for the crystallization, were found in the structure. Two of them are located in the carnitine and CoA binding sites, respectively. The third aliphatic chain may mimic the long-chain acyl group in the substrate of CPT-II. The binding site for this aliphatic chain does not exist in the short- and medium-chain carnitine acyltransferases, due to conformational differences among the enzymes. A unique insert in CPT-II is positioned on the surface of the enzyme, with a highly hydrophobic surface. It is likely that this surface patch mediates the association of CPT-II with the inner membrane of the mitochondria.

  17. Can Co (II) or Cd (II) substitute for Zn (II) in zinc fingers?

    Indian Academy of Sciences (India)

    Zinc finger domains consist of sequences of amino acids containing cysteine and histidine residues tetrahedrally coordinated to a zinc ion. The role of zinc in a DNA binding finger was considered purely structural due to the absence of redox chemistry in zinc. However, whether other metals e.g. Co(II) or Cd(II) can substitute ...

  18. A comparative study on Pb(II), Cd(II), Cu(II)

    African Journals Online (AJOL)


    organic compounds form wastewater (Venema et al., 1998; Fendorf et al., 1997; Heijman et al., 1999, Sen et al., 2002; Glover et al., 2002; O'reilly ... modifying goethite either by pre treating or by doping with other metal ions. Phosphate ...... Binary component sorption of Cu(II) and Pb(II) with activated carbon from. Eucalyptus ...

  19. Options Study - Phase II

    Energy Technology Data Exchange (ETDEWEB)

    R. Wigeland; T. Taiwo; M. Todosow; W. Halsey; J. Gehin


    The Options Study has been conducted for the purpose of evaluating the potential of alternative integrated nuclear fuel cycle options to favorably address the issues associated with a continuing or expanding use of nuclear power in the United States. The study produced information that can be used to inform decisions identifying potential directions for research and development on such fuel cycle options. An integrated nuclear fuel cycle option is defined in this study as including all aspects of the entire nuclear fuel cycle, from obtaining natural resources for fuel to the ultimate disposal of used nuclear fuel (UNF) or radioactive wastes. Issues such as nuclear waste management, especially the increasing inventory of used nuclear fuel, the current uncertainty about used fuel disposal, and the risk of nuclear weapons proliferation have contributed to the reluctance to expand the use of nuclear power, even though it is recognized that nuclear power is a safe and reliable method of producing electricity. In this Options Study, current, evolutionary, and revolutionary nuclear energy options were all considered, including the use of uranium and thorium, and both once-through and recycle approaches. Available information has been collected and reviewed in order to evaluate the ability of an option to clearly address the challenges associated with the current implementation and potential expansion of commercial nuclear power in the United States. This Options Study is a comprehensive consideration and review of fuel cycle and technology options, including those for disposal, and is not constrained by any limitations that may be imposed by economics, technical maturity, past policy, or speculated future conditions. This Phase II report is intended to be used in conjunction with the Phase I report, and much information in that report is not repeated here, although some information has been updated to reflect recent developments. The focus in this Options Study was to

  20. National Energy Plan II

    Energy Technology Data Exchange (ETDEWEB)



    This volume contains the Administration's second National Energy Plan, as required by section 801 of the Department of Energy Organization Act (Public Law 95-91). A second volume will contain an assessment of the environmental trends associated with the energy futures reported here. Detailed appendices to the Plan will be published separately. The eight chapters and their subtitles are: Crisis and Uncertainty in the World Energy Future (The Immediate Crisis and the Continuing Problem, The Emergence of the Energy Problem, The Uncertainties of the World Energy Future, World Oil Prices, Consequences for the U.S.); The U.S. Energy Future: The Implications for Policy (The Near-, Mid-, and Long-Term, The Strategy in Perspective); Conservation (Historical Changes in Energy Use, Post-Embargo Changes - In Detail, Conservation Policies and Programs, The Role of Conservation); Oil and Gas (Oil, Natural Gas); Coal and Nuclear (Coal, Nuclear, Policy for Coal and Nuclear Power); Solar and Other Inexhaustible Energy Sources (Solar Energy, Geothermal, Fusion, A Strategy for Inexhaustible Resources); Making Decisions Promptly and Fairly (Managing Future Energy Crises: Emergency Planning, Managing the Current Shortfall: The Iranian Response Plan, Managing the Long-Term Energy Problem: The Institutional Framework, Fairness in Energy Policy, Public Participation in the Development of Energy Policy); and NEP-II and the Future (The Second National Energy Plan and the Nation's Energy Future, The Second National Energy Plan and the Economy, Employment and Energy Policy, The Second National Energy Plan and Individuals, The Second National Energy Plan and Capital Markets, and The Second National Energy Plan and the Environment). (ERA citation 04:041097)

  1. Stiffnites. Part II

    Directory of Open Access Journals (Sweden)

    Maria Teresa Pareschi


    Full Text Available

    The dynamics of a stiffnite are here inferred. A stiffnite is a sheet-shaped, gravity-driven submarine sediment flow, with a fabric made up of marine ooze. To infer stiffnite dynamics, order of magnitude estimations are used. Field deposits and experiments on materials taken from the literature are also used. Stiffnites can be tens or hundreds of kilometers wide, and a few centimeters/ meters thick. They move on the sea slopes over hundreds of kilometers, reaching submarine velocities as high as 100 m/s. Hard grain friction favors grain fragmentation and formation of triboelectrically electrified particles and triboplasma (i.e., ions + electrons. Marine lipids favor isolation of electrical charges. At first, two basic assumptions are introduced, and checked a posteriori: (a in a flowing stiffnite, magnetic dipole moments develop, with the magnetization proportional to the shear rate. I have named those dipoles as Ambigua. (b Ambigua are ‘vertically frozen’ along stiffnite streamlines. From (a and (b, it follows that: (i Ambigua create a magnetic field (at peak, >1 T. (ii Lorentz forces sort stiffnite particles into two superimposed sheets. The lower sheet, L+, has a sandy granulometry and a net positive electrical charge density. The upper sheet, L–, has a silty muddy granulometry and a net negative electrical charge density; the grains of sheet L– become finer upwards. (iii Faraday forces push ferromagnetic grains towards the base of a stiffnite, so that a peak of magnetic susceptibility characterizes a stiffnite deposit. (iv Stiffnites harden considerably during their motion, due to magnetic confinement. Stiffnite deposits and inferred stiffnite characteristics are compatible with a stable flow behavior against bending, pinch, or other macro instabilities. In the present report, a consistent hypothesis about the nature of Ambigua is provided.

  2. Angiotensin II and taste sensitivity

    Directory of Open Access Journals (Sweden)

    Noriatsu Shigemura, DDS, PhD


    Full Text Available The sense of taste plays a major role in evaluating the quality of food components in the oral cavity. Sweet, salty, umami, sour and bitter taste are generally accepted as five basic taste qualities. Among them, salty taste is attractive to animals and influences sodium intake. Angiotensin II (ANG II and aldosterone (ALDO, which is stimulated by ANG II are key hormones that regulate sodium homeostasis and water balance. At the peripheral gustatory organs, it has been reported that ALDO increases the amiloride-sensitivity of the rat gustatory neural responses to NaCl in a time course of several hours. A recent study demonstrated that ANG II suppresses amiloride-sensitivity of the mouse gustatory and behavioral responses to NaCl via its receptor AT1 within an hour. Moreover, ANG II enhances sweet taste sensitivity without affecting umami, sour and bitter tastes. These results suggest that the reciprocal and sequential regulatory mechanisms by ANG II (as an acute suppressor together with ALDO (as a slow enhancer on the salt taste sensitivity may exist in peripheral taste organs, contribute to salt intake, and play an important role in sodium homeostasis. Furthermore, the linkage between salty and sweet taste modulations via the ANG II signaling may optimize sodium and calorie intakes.

  3. Retrovirus Epidemiology Donor Study-II (REDS-II) (United States)


    Acquired Immunodeficiency Syndrome; Blood Donors; Blood Transfusion; HIV Infections; HIV-1; HIV-2; HTLV-I; HTLV-II; Retroviridae Infections; Hepatitis, Viral, Human; Hepatitis B; Hepacivirus; West Nile Virus

  4. Chemical speciation of Pb(II, Cd(II, Hg(II, Co(II, Ni(II, Cu(II and Zn(II binary complexes of l-methionine in 1,2-propanediol-water mixtures

    Directory of Open Access Journals (Sweden)

    M. Padma Latha


    Full Text Available Chemical speciation of Pb(II, Cd(II, Hg(II, Co(II, Ni(II, Cu(II and Zn(II complexes of L-methionine in 0.0-60 % v/v 1,2-propanediol-water mixtures maintaining an ionic strength of 0.16 M at 303 K has been studied pH metrically. The active forms of ligand are LH2+, LH and L-. The predominant species detected are ML, MLH, ML2, ML2H, ML2H2 and MLOH. Models containing different numbers of species were refined by using the computer program MINIQUAD 75. The best-fit chemical models were arrived at based on statistical parameters. The trend in variation of complex stability constants with change in the dielectric constant of the medium is explained on the basis of electrostatic and non-electrostatic forces.

  5. Manganese(II/II/II) and Manganese(III/II/III) Trinuclear Compounds. Structure and Solid and Solution Behavior. (United States)

    Tangoulis, Vasilis; Malamatari, Dora A.; Soulti, Kali; Stergiou, Voula; Raptopoulou, Catherine P.; Terzis, Aris; Kabanos, Themistoklis A.; Kessissoglou, Dimitris P.


    Two mixed-valence Mn(III)Mn(II) complexes and a homo-valence Mn(II) trinuclear manganese complex of stoichiometry Mn(III)Mn(II)Mn(III)(5-Cl-Hsaladhp)(2)(AcO)(4)(MeOH)(2).4CH(3)OH (1a), Mn(III)Mn(II)Mn(III) (Hsaladhp)(2)(AcO)(2)(5-Cl-Sal)(2)(thf)(2) (3a) and Mn(II)Mn(II)Mn(II) (AcO)(6)(pybim)(2) (1b) where H(3)saladhp is a tridentate Schiff base ligand and pybim a neutral bidentate donor ligand, have been structurally characterized by using X-ray crystallography. The structurally characterized mixed-valence complexes have strictly 180 degrees Mn(III)-Mn(II)-Mn(III) angles as required by crystallographic inversion symmetry. The complexes are valence trapped with two terminal Mn(III) ions showing Jahn-Teller distortion along the acetate or salicylate-Mn(III)-X axis. The Mn.Mn separation is 3.511 Å and 3.507 Å respectively. The mixed-valence complexes have S = (3)/(2) ground state and the homovalence complex S = (5)/(2), with small antiferromagnetic exchange J couplings, -5.6 and -1.8 cm(-1), respectively, while the powder ESR spectra at 4 K show a broad low field signal with g approximately 4.3 for Mn(III)Mn(II)Mn(III) and a broad temperature-dependent signal at g = 2 for Mn(II)Mn(II)Mn(II). Crystal data for 1a: [C(36)H(60)O(20)N(2)Cl(2)Mn(3)], triclinic, space group P&onemacr;, a = 9.272(7) Å, b = 11.046(8) Å, c = 12.635(9) Å, alpha = 76.78(2) degrees, beta = 81.84(2) degrees, gamma = 85.90(2) degrees, Z = 1. Crystal data for 3a: [C(48)H(56)O(18)N(2)Cl(2)Mn(3)], monoclinic, space group P2(1)/n, a = 8.776(3) Å, b = 22.182(7) Å, c = 13.575(4) Å, beta = 94.44(1) degrees, Z = 2. Crystal data for 1b: [C(36)H(36)O(12)N(6)Mn(3)], triclinic, space group P&onemacr;, a = 13.345(6) Å, b = 8.514(4) Å, c = 9.494(4) Å, alpha = 75.48(1) degrees, beta = 75.83(1) degrees, gamma = 76.42(1) degrees, Z = 1.

  6. High Temperature Superconducting Space Experiment II (HTSSE II) cryogenic design (United States)

    Kawecki, T. G.; Chappie, S. S.; Mahony, D. R.

    At 60 to 80 K large performance gains are possible from high temperature superconducting (HTS) microwave devices for communications applications. The High Temperature Superconducting Space Experiment II (HTSSE II) will demonstrate eight HTS experiments in space for up to 3 years of operation. HTSSE II is the first application of HTS technology to space. In addition to demonstrating HTS devices, an important secondary goal is to demonstrate the cryogenic technologies required for long life HTS space applications. HTSSE II utilizes a British Aerospace 80 K Stirling cycle cryocooler to refrigerate a central cryogenic bus of seven HTS experiments and has an additional stand-alone TRW HTS experiment cooled by a TRW Stirling cycle cryocooler. The HTSSE II flight unit has been assembled and has successfully passed vibration and thermal vacuum environmental tests. HTSSE II was developed on a fixed budget and a fast track schedule of 24 months and is due to launch in March 1997 on the ARGOS spacecraft. This paper presents the design and test results of the cryogenic subsystem, cryocooler integration and a cryogenic coaxial cable I/O assembly.

  7. Integrated Procurement Management System, Version II (United States)

    Collier, L. J.


    Integrated Procurement Management System, Version II (IPMS II) is online/ batch system for collecting developing, managing and disseminating procurementrelated data at NASA Johnson Space Center. Portions of IPMS II adaptable to other procurement situations.

  8. Tier II Chemical Storage Facilities (United States)

    Iowa State University GIS Support and Research Facility — Facilities that store hazardous chemicals above certain quantities must submit an annual emergency and hazardous chemical inventory on a Tier II form. This is a...

  9. Tier II Forms and Instructions (United States)

    Facilities must comply with the new requirements on the Tier II emergency and hazardous chemical inventory form starting reporting year 2013, which is due by March 1, 2014. Some states may have specific requirements for reporting and submission.

  10. Teaching about World War II. (United States)

    Siler, Carl S.


    Examines a unit approach to World War II that emphasizes totalitarianism, the military conduct of the war, and the Holocaust. Advocates using a variety of teaching strategies, methods, and materials. Includes several examples of innovative materials and activities. (MJP)

  11. Electrochemical, Antifungal, Antibacterial and DNA Cleavage Studies of Some Co(II), Ni(II), Cu(II) and Zn(II)-Copolymer Complexes


    Dhanaraj, C. Justin; Nair, M. Sivasankaran


    Cyclic voltammetric measurements were performed for Co(II), Ni(II), Cu(II) and Zn(II) complexes of 1 : 1 alternating copolymer, poly(3-nitrobenzylidene-1-naphthylamine-co-succinic anhydride) (L) and Ni(II) and Cu(II) complexes of 1 : 1 alternating copolymer, poly(3-nitrobenzylidene-1-naphthylamine-co-methacrylic acid) (L1). The in vitro biological screening effects of the investigated compounds were tested against the fungal species including Aspergillus niger, Rhizopus stolonifer, Aspergillu...

  12. Vibrational spectra of Cu(II), Cu(I), Ni(II), Pd(II), Pt(II) and Hg(II) complexes with dithizone (United States)

    Michalska, Danuta; Kowal, Andrzei T.


    The far i.r. spectra of Cu(II), Cu(I) and Ni(II) complexes with dithizone are presented. The assignment of the metal—ligand vibrations was carried out by 63Cu/ 65Cu and 58Ni/ 62Ni isotopic substitution. Resonance Raman spectra of Hg(II), Pd(II), Pt(II), Cu(II) and Cu(I) complexes were measured. Excitation profiles of the enhanced Raman modes of Hg(II) dithizonate allowed us to identify vibrations associated with the chromophoric azo group. It is concluded that Pd(II) dithizonate and Pt(II) dithizonate are N, S coordinated and form a trans square-planar structure, whereas in Cu(I) dithizonate the Cu(I) ion forms a strong bond with the sulfur atom and a weak secondary bond with the azo nitrogen as well as with sulfur atoms from the neighboring molecules conferring a tetrahedral configuration on the coordination sphere and polymeric structure of the complex.

  13. Pb(II), Cd(II) and Zn(II) adsorption on low grade manganese ore ...

    African Journals Online (AJOL)

    Low grade manganese ore (LMO) of Orissa containing 58.37% SiO2, 25.05% MnO2, 8.8% Al2O3, and 5.03% Fe2O3 as the main constituents was taken to study its adsorption behaviour for Pb(II), Cd(II) and Zn(II) from aqueous solutions. The XRD studies showed the crystalline phases to be quartz, ß-MnO2, d-MnO2 and ...

  14. ISLSCP II MODIS (Collection 4) Albedo, 2002 (United States)

    National Aeronautics and Space Administration — This International Satellite Land Surface Climatology Project (ISLSCP II) MODerate resolution Image Spectroradiometer (MODIS) dataset, ISLSCP II MODIS (Collection 4)...

  15. Cr(III,Mn(II,Fe(III,Co(II,Ni(II,Cu(II and Zn(II Complexes with Diisobutyldithiocarbamato Ligand

    Directory of Open Access Journals (Sweden)

    Mohammad Tarique


    Full Text Available The synthesis of sulphur and nitrogen containing dithiocarbamato ligand derived from diisobutylamine as well as its coordination compounds with 3d series transition metals is presented. These synthesized compounds were characterized on the basis of elemental analysis, conductometric measurements and IR spectral studies. The analytical data showed the stoichiometry 1:2 and 1:3 for the compounds of the types ML2 {M=Mn(II, Co(II, Ni(II, Cu(II and Zn(II} and M'L3{M'=Cr(III and Fe(III} respectively. The conductometric measurements proved the non-electrolytic behaviour of all the compounds. The bidentate nature of dithiocarbamato moiety was confirmed on the basis of IR spectral data.

  16. EBR-II Data Digitization

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, Su-Jong [Idaho National Lab. (INL), Idaho Falls, ID (United States); Rabiti, Cristian [Idaho National Lab. (INL), Idaho Falls, ID (United States); Sackett, John [Idaho National Lab. (INL), Idaho Falls, ID (United States)


    1. Objectives To produce a validation database out of those recorded signals it will be necessary also to identify the documents need to reconstruct the status of reactor at the time of the beginning of the recordings. This should comprehends the core loading specification (assemblies type and location and burn-up) along with this data the assemblies drawings and the core drawings will be identified. The first task of the project will be identify the location of the sensors, with respect the reactor plant layout, and the physical quantities recorded by the Experimental Breeder Reactor-II (EBR-II) data acquisition system. This first task will allow guiding and prioritizing the selection of drawings needed to numerically reproduce those signals. 1.1 Scopes and Deliverables The deliverables of this project are the list of sensors in EBR-II system, the identification of storing location of those sensors, identification of a core isotopic composition at the moment of the start of system recording. Information of the sensors in EBR-II reactor system was summarized from the EBR-II system design descriptions listed in Section 1.2.

  17. 24 CFR 202.12 - Title II. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Title II. 202.12 Section 202.12... INSTITUTIONS AND MORTGAGEES Title I and Title II Specific Requirements § 202.12 Title II. (a) Tiered pricing—(1... mortgagee approved for participation in Title II programs is notified by the Secretary that it had a rate of...

  18. Competitive adsorption of Pb(II), Cu(II) and Zn(II) onto xanthate-modified magnetic chitosan. (United States)

    Zhu, Yehua; Hu, Jun; Wang, Jianlong


    The competitive adsorption of Pb(II), Cu(II) and Zn(II) onto a novel xanthate-modified magnetic chitosan (XMCS) was systematically investigated in single and ternary metal systems. In single system, equilibrium studies showed that the adsorption of Pb(II), Cu(II) and Zn(II) followed the Langmuir model and the maximum adsorption capacities were found to be 76.9, 34.5 and 20.8mg/g, respectively. In ternary system, the combined action of the metals was found to be antagonistic and the metal sorption followed the order of Pb(II)>Cu(II)>Zn(II); the Langmuir isotherm fitted the data of Pb(II) and Cu(II) well while the isotherm data of Zn(II) correlated well with the Freundlich model. The Fourier transform infrared spectroscopy (FTIR) and X-ray photoelectron spectra (XPS) studies showed that the thiol and amino group participated in the adsorption of Pb(II), Cu(II) and Zn(II). Copyright © 2012 Elsevier B.V. All rights reserved.

  19. Stark broadening parameter tables for in II: Part II

    Directory of Open Access Journals (Sweden)

    Dimitrijević M.S.


    Full Text Available Electron-, proton-, and ionized helium-impact broadening parameter tables for 101 In II multiplets, are presented as a function of temperature for the perturber density of 1016cm-3. Calculations have been performed within the semiclassical perturbation approach.

  20. Propulsion Systems for Aircraft. Aerospace Education II. Instructional Unit II. (United States)

    Elmer, James D.

    This curriculum guide accompanies another publication in the Aerospace Education II series entitled "Propulsion Systems for Aircraft." The guide includes specific guidelines for teachers on each chapter in the textbook. Suggestions are included for objectives (traditional and behavioral), suggested outline, orientation, suggested key…

  1. II National Environment Congress; II Congreso Nacional de Medio Ambiente

    Energy Technology Data Exchange (ETDEWEB)

    Camacho Serna, F.


    The paper summarizes the most relevant opinions expressed during the opening act of the II Natural Environment Congress, which took place in Madrid from the 21 ``st to the 25``st of November 1994. The objective of the Congress was the analysis of the environmental situation in Spain. (Author)

  2. GRID Computing at Belle II

    CERN Document Server

    Bansal, Vikas


    The Belle II experiment at the SuperKEKB collider in Tsukuba, Japan, will start physics data taking in 2018 and will accumulate 50 ab$^{-1}$ of e$^{+}$e$^{-}$ collision data, about 50 times larger than the data set of the earlier Belle experiment. The computing requirements of Belle II are comparable to those of a run I high-p$_T$ LHC experiment. Computing will make full use of such grids in North America, Asia, Europe, and Australia, and high speed networking. Results of an initial MC simulation campaign with 3 ab$^{-1}$ equivalent luminosity will be described

  3. Preparation and characterization of multi-carboxyl-functionalized silica gel for removal of Cu (II), Cd (II), Ni (II) and Zn (II) from aqueous solution (United States)

    Li, Min; Li, Ming-yu; Feng, Chang-gen; Zeng, Qing-xuan


    In this paper, the multi-carboxyl-functionalized silica gel was prepared by surface grafting method and applied for the removal of Cu (II), Cd (II), Ni (II) and Zn (II) from aqueous solution. The adsorbent was characterized by FT-IR, thermogravimetry, Brunauer-Emmett-Teller surface area measurement and elemental analysis, and it proved that the organic functional group, carboxyl group, was grafted successfully onto the silica gel surface. The effect of solution pH on removal efficiencies of Cu (II), Cd (II), Ni (II) and Zn (II) was investigated and it was found that with the exception of Zn (II), the removal efficiencies of the rest of metal ions increased with the increasing of pH in the solution, the maximum removal efficiency occurred at pH 6.0, whereas the maximum removal efficiency for Zn (II) was found to be at pH 7.0. Adsorption equilibrium data were well fitted to Langmuir than Freundlich isotherm model and the maximum adsorption capacity for Cu (II), Cd (II), Ni (II) and Zn (II) was 47.07, 41.48, 30.80 and 39.96 mg/g, respectively. Competitive adsorption experiments demonstrated that the adsorbent material had excellent adsorption amount and high affinity for the Cu (II) in the binary systems. In addition, the column experiments were used to investigate stability and reusability of the adsorbent, the dynamic adsorption performance, and desorption of metal ions absorbed from the adsorbent. The results confirmed that the adsorbent presents good dynamic adsorption performance for Cu (II), Cd (II), Ni (II) and Zn (II) and these metal ions adsorbed were easy to be desorbed from the adsorbent. The adsorption capacities of metal ions did not present an obvious decrease after five cycles of adsorption-desorption.


    African Journals Online (AJOL)

    B. S. Chandravanshi

    and their structures consist of polymeric layers of │M−Ni(CN)4│∞ with the pdz bound to the metal (M) atom. KEY WORDS: Hofmann-type complexes, Vibrational spectra, Pyridazine, Tetracyanonickelate(II), Thermal analysis. INTRODUCTION. Cyano-bridged complexes have been shown to form polymeric structures by ...

  5. Tech Area II: A history

    Energy Technology Data Exchange (ETDEWEB)

    Ullrich, R. [Ktech Corp., Albuquerque, NM (United States)


    This report documents the history of the major buildings in Sandia National Laboratories` Technical Area II. It was prepared in support of the Department of Energy`s compliance with Section 106 of the National Historic Preservation Act. Technical Area II was designed and constructed in 1948 specifically for the final assembly of the non-nuclear components of nuclear weapons, and was the primary site conducting such assembly until 1952. Both the architecture and location of the oldest buildings in the area reflect their original purpose. Assembly activities continued in Area II from 1952 to 1957, but the major responsibility for this work shifted to other sites in the Atomic Energy Commission`s integrated contractor complex. Gradually, additional buildings were constructed and the original buildings were modified. After 1960, the Area`s primary purpose was the research and testing of high-explosive components for nuclear weapons. In 1994, Sandia constructed new facilities for work on high-explosive components outside of the original Area II diamond-shaped parcel. Most of the buildings in the area are vacant and Sandia has no plans to use them. They are proposed for decontamination and demolition as funding becomes available.


    Skeggs, Leonard T.; Kahn, Joseph R.; Shumway, Norman P.


    The enzymatic conversion of hypertensin I to hypertensin II is described together with the subsequent purification of the product by means of counter-current distribution. Improved methods are also presented for the preparation of renin and its substrate, as well as in methods for the reaction of these materials and the purification of the resulting hypertensin I. PMID:13295488

  7. Military Aerospace. Aerospace Education II. (United States)

    Smith, J. C.

    This book is a revised publication in the series on Aerospace Education II. It describes the employment of aerospace forces, their methods of operation, and some of the weapons and equipment used in combat and combat support activities. The first chapter describes some of the national objectives and policies served by the Air Force in peace and…

  8. Case 22:Type II diabetes (United States)

    Diabetes mellitus is characterized by elevated blood glucose levels. It is composed of two types depending on the pathogenesis. Type I diabetes is characterized by insulin deficiency and usually has its onset during childhood or teenage years. This is also called ketosis-prone diabetes. Type II diab...

  9. On commuting operator exponentials, II

    Indian Academy of Sciences (India)

    Home; Journals; Proceedings – Mathematical Sciences; Volume 123; Issue 1. On Commuting Operator Exponentials, II. Fotios C Paliogiannis. Volume 123 Issue 1 February 2013 pp 27-31. Fulltext. Click here to view fulltext PDF. Permanent link: Keywords.

  10. Rahvusvaheline "Scripta manent II" Tallinnas

    Index Scriptorium Estoniae


    Eduard Taska 110. sünniaastapäevale pühendatud rahvusvaheline köitekunsti- ja kalligraafianäitus "Scripta manent II" Tallinna Kunstihoones. Köitekunsti osas pälvis "kuldraamatu" Marielle Liivat, ergutusauhinnad: Marje Kask, Kadi Kiipus, Urve Kolde

  11. Multiple functions of photosystem II

    NARCIS (Netherlands)

    Rensen, van J.J.S.; Curwiel, V.B.


    The most important function of photosystem II (PSII) is its action as a water-plastoquinone oxido-reductase. At the expense of light energy, water is split, and oxygen and plastoquinol are formed. In addition to this most important activity, PSII has additional functions, especially in the

  12. Light harvesting in photosystem II

    NARCIS (Netherlands)

    van Amerongen, H.; Croce, R.


    Water oxidation in photosynthesis takes place in photosystem II (PSII). This photosystem is built around a reaction center (RC) where sunlight-induced charge separation occurs. This RC consists of various polypeptides that bind only a few chromophores or pigments, next to several other cofactors. It

  13. cis-Dichloridobis(triisopropoxyphosphineplatinum(II

    Directory of Open Access Journals (Sweden)

    Alexandra M. Z. Slawin


    Full Text Available The title compound, [PtCl2(C9H21O3P2], was obtained from a solution of PtCl2(COD (COD = 1,5-cyclooctadiene and triisopropylphosphite in dichloromethane. The complex features a Pt(II atom coordinated by two Cl and two P atoms, yielding a slightly distorted cis square-planar geometry.

  14. Designing screened enclosures: Part II. (United States)

    Bearpark, J


    Techniques to achieve cost-effective emissions and immunity screening solutions that meet electromagnetic compatibility requirements were provided in Part I of this article, which covered design options for seams and gaskets. Part II continues with a discussion of materials compatibility, corrosion and apertures.

  15. Elizabeth II / Fagira D. Morti

    Index Scriptorium Estoniae

    Fagira D. Morti, pseud., 1974-


    Järjejutt Elizabeth II elust. Järgneb nr. 80, lk. 30-33, nr. 81, lk. 30-32, nr. 82, lk. 34-36, nr. 83, lk. 34-37, nr. 84, lk. 42-45, nr. 85, lk. 36-38, 86, lk. 44-47, nr. 87, lk. 32-35. Nr. 86 ja 87 autor: Helene Wait

  16. binuclear copper(II) complexes

    Indian Academy of Sciences (India)


    403. Synthesis, electrochemical and magnetic properties of new acylic. 'end-off' binuclear copper(II) complexes. T M RAJENDIRAN, R KANNAPPAN, R VENKATESAN and. P SAMBASIVA RAO. Department of Chemistry, Pondicherry University, R.V. Nagar, Kalapet,. Pondicherry 605 014, India. A series of nonbridged nitrito ...

  17. Axiomatic Differential Geometry II-4


    Nishimura, Hirokazu


    In our previous paper (Axiomatic Differential Geometry II-3) we have discussed the general Jacobi identity, from which the Jacobi identity of vector fields follows readily. In this paper we derive Jacobi-like identities of tangent-vector-valued forms from the general Jacobi identity.

  18. Synthesis, spectroscopic, antimicrobial and DNA cleavage studies of new Co(II), Ni(II), Cu(II), Cd(II), Zn(II) and Hg(II) complexes with naphthofuran-2-carbohydrazide Schiff base (United States)

    Halli, Madappa B.; Sumathi, R. B.


    A series of Co(II), Ni(II), Cu(II), Cd(II), Zn(II) and Hg(II) complexes have been synthesized with newly synthesized Schiff base derived from naphthofuran-2-carbohydrazide and cinnamaldehyde. The elemental analyses of the complexes are confined to the stoichiometry of the type MLCl2 [M = Co(II) and Cu(II)], ML2Cl2 [M = Ni(II), Cd(II), Zn(II) and Hg(II)] respectively, where L is Schiff base ligand. Structures have been proposed from elemental analyses, IR, electronic, mass, 1H NMR, ESR spectral data, magnetic, and thermal studies. The measured low molar conductance values in DMF indicate that the complexes are non-electrolytes. Spectroscopic studies suggest coordination occurs through azomethine nitrogen and carbonyl oxygen of the ligand with the metal ions. The Schiff base and its complexes have been screened for their antibacterial (Escherichia coli, Staphylococcus aureus, Bacillus subtilis and Salmonella typhi) and antifungal (Aspergillus niger, Aspergillus flavus, Cladosporium and Candida albicans) activities by minimum inhibitory concentration (MIC) method. The DNA cleavage studies by agarose gel electrophoresis method was studied for all the complexes.

  19. Type II Supernova Spectral Diversity. II. Spectroscopic and Photometric Correlations (United States)

    Gutiérrez, Claudia P.; Anderson, Joseph P.; Hamuy, Mario; González-Gaitan, Santiago; Galbany, Lluis; Dessart, Luc; Stritzinger, Maximilian D.; Phillips, Mark M.; Morrell, Nidia; Folatelli, Gastón


    We present an analysis of observed trends and correlations between a large range of spectral and photometric parameters of more than 100 type II supernovae (SNe II), during the photospheric phase. We define a common epoch for all SNe of 50 days post-explosion, where the majority of the sample is likely to be under similar physical conditions. Several correlation matrices are produced to search for interesting trends between more than 30 distinct light-curve and spectral properties that characterize the diversity of SNe II. Overall, SNe with higher expansion velocities are brighter, have more rapidly declining light curves, shorter plateau durations, and higher 56Ni masses. Using a larger sample than previous studies, we argue that “Pd”—the plateau duration from the transition of the initial to “plateau” decline rates to the end of the “plateau”—is a better indicator of the hydrogen envelope mass than the traditionally used optically thick phase duration (OPTd: explosion epoch to end of plateau). This argument is supported by the fact that Pd also correlates with s 3, the light-curve decline rate at late times: lower Pd values correlate with larger s 3 decline rates. Large s 3 decline rates are likely related to lower envelope masses, which enables gamma-ray escape. We also find a significant anticorrelation between Pd and s 2 (the plateau decline rate), confirming the long standing hypothesis that faster declining SNe II (SNe IIL) are the result of explosions with lower hydrogen envelope masses and therefore have shorter Pd values. This paper includes data gathered with the 6.5 m Magellan Telescopes located at Las Campanas Observatory, Chile; and the Gemini Observatory, Cerro Pachon, Chile (Gemini Program GS- 2008B-Q-56). Based on observations collected at the European Organisation for Astronomical Research in the Southern Hemisphere, Chile (ESO Programs 076.A-0156, 078.D-0048, 080.A-0516, and 082.A-0526).

  20. Information on Asse II; Informationen ueber die Schachtanlage Asse II

    Energy Technology Data Exchange (ETDEWEB)



    The information brochure on Asse II describes the situation in the repository for radioactive wastes that was closed by law due to the violations of safety standards. The discussed topics include the necessity of waste retrieval, the problems with public anxiety and public information, the hazard of an uncontrolled water ingress (worst case scenario), the work sites in the cavern, man-machine interactions and the cost of the project.


    Directory of Open Access Journals (Sweden)

    Suriadi Gunawan


    Full Text Available Karangan ini merupakan tinjauan mengenai situasi malaria di Irian Jaya hingga tahun 1980. Malaria merupakan masalah kesehatan masyarakat yang penting karena menyebabkan 14% dari kematian di rumah sakit dan 20% dari kunjungan ke fasilitas kesehatan. Malaria adalah hiper sampai mesoendemik di daerah pantai dan dataran rendah, sedangkan di dae­rah pegunungan sampai ketinggian 1700 m malaria tidak stabil dan potensial epidemik. Yang menjadi vektor ialah kelompok Anopheles punctulatus yang exo atau endophagik secara fakultatif serta bersifat exofilik. Program pemberantasan malaria yang didasarkan pada penyemprotan rumah dengan DDT melin­dungi sekitar 300.000 penduduk di 15 lokasi. Di semua lokasi penyemprotan angka parasit memang turun, kecuali di daerah Genyem (Nimboran di mana dicurigai adanya resistensi nyamuk terhadap DDT, tetapi transmisi malaria masih berjalan terus. Pembagian obat secara massal (chloroquin dan pyrimethamin juga tidak menghasilkan penurunan penu­laran yang diharapkan. Pemberantasan malaria di Irian Jaya menghadapi berbagai hambatan yang sangat besar. Selain ma­salah operasional, keuangan dan perilaku manusia, terdapat pula masalah teknis seperti berkembangnya resistensi P. falciparum terhadap pyrimethamin dan proguanil (1959, chloroquin (1973 dan sulfadoxin/ fansidar (1979 serta kemungkinan berkembangnya resistensi vektor terhadap DDT. Pemberantasan malaria di Irian Jaya perlu dievaluasi secara menyeluruh dan penelitian yang ber­sifat operasional perlu dilaksanakan untuk menyusun suatu program yang lebih rasional dan sesuai de­ngan kondisi setempat. Meningkatnya malaria akan menghambat pembangunan, maka penanggulangannya mutlak dilak­sanakan untuk menjamin berhasilnya proyek-proyek pembangunan sosial-ekonomi di propinsi tersebut.

  2. Binding Selectivity of Methanobactin from Methylosinus trichosporium OB3b for Copper(I), Silver(I), Zinc(II), Nickel(II), Cobalt(II), Manganese(II), Lead(II), and Iron(II) (United States)

    McCabe, Jacob W.; Vangala, Rajpal; Angel, Laurence A.


    Methanobactin (Mb) from Methylosinus trichosporium OB3b is a member of a class of metal binding peptides identified in methanotrophic bacteria. Mb will selectively bind and reduce Cu(II) to Cu(I), and is thought to mediate the acquisition of the copper cofactor for the enzyme methane monooxygenase. These copper chelating properties of Mb make it potentially useful as a chelating agent for treatment of diseases where copper plays a role including Wilson's disease, cancers, and neurodegenerative diseases. Utilizing traveling wave ion mobility-mass spectrometry (TWIMS), the competition for the Mb copper binding site from Ag(I), Pb(II), Co(II), Fe(II), Mn(II), Ni(II), and Zn(II) has been determined by a series of metal ion titrations, pH titrations, and metal ion displacement titrations. The TWIMS analyses allowed for the explicit identification and quantification of all the individual Mb species present during the titrations and measured their collision cross-sections and collision-induced dissociation patterns. The results showed Ag(I) and Ni(II) could irreversibly bind to Mb and not be effectively displaced by Cu(I), whereas Ag(I) could also partially displace Cu(I) from the Mb complex. At pH ≈ 6.5, the Mb binding selectivity follows the order Ag(I)≈Cu(I)>Ni(II)≈Zn(II)>Co(II)>>Mn(II)≈Pb(II)>Fe(II), and at pH 7.5 to 10.4 the order is Ag(I)>Cu(I)>Ni(II)>Co(II)>Zn(II)>Mn(II)≈Pb(II)>Fe(II). Breakdown curves of the disulfide reduced Cu(I) and Ag(I) complexes showed a correlation existed between their relative stability and their compact folded structure indicated by their CCS. Fluorescence spectroscopy, which allowed the determination of the binding constant, compared well with the TWIMS analyses, with the exception of the Ni(II) complex. [Figure not available: see fulltext.

  3. Complexation of the fungal metabolite tenuazonic acid with copper (II), iron (III), nickel (II), and magnesium (II) ions. (United States)

    Lebrun, M H; Duvert, P; Gaudemer, F; Gaudemer, A; Deballon, C; Boucly, P


    Tenuazonic acid (TA) is a phytotoxin produced by a fungal pathogen of rice, Pyricularia oryzae. We have synthesized and characterized the metal complexes of TA with copper (II), iron (III), nickel (II), and magnesium (II). The stoichiometry of the complexes determined by microanalysis and mass spectroscopy (D/CI) are Cu(II)TA2, Fe(III)TA3, Ni(II)TA2, and Mg(TA)2. Voltammograms of Fe(III)TA3, and Cu(II)TA2 in methanolic solutions confirmed this stoichiometry. Ni(II)TA2 paramagnetism and visible absorption data suggest an octahedral geometry. Fe(III)TA3 showed a characteristic visible absorption at 450 nm. Addition of Fe(III)Cl3 and Mg(II)Cl2 did not reverse the toxicity of NaTA to rice and bacterial cells, showing that this toxicity is not due to the privation of the cells of these metals essential for cell growth.

  4. Speciation of L-aspartic acid complexes of Co(II), Ni(II), Cu(II) and Zn ...

    African Journals Online (AJOL)

    The models for the binary species contained ML2H2, ML2H and ML2 for Co(II) and Zn(II), ML, ML2H2 and ML2 for Ni(II) and Cu(II) in acetonitrile- and ethylene glycol-water mixtures. The trend in variation of stability constants with change in the dielectric constant of the medium was explained on the basis of electrostatic and ...

  5. Physicochemical properties of 3,4,5-trimethoxybenzoates of Mn(II, Co(II, Ni(II and Zn(II

    Directory of Open Access Journals (Sweden)



    Full Text Available The complexes of Mn(II, Co(II, Ni(II, Cu(II and Zn(II with 3,4,5-trimethoxybenzoic acid anion of the formula: M(C10H11O52·nH2O, where n = 6 for Ni(II, n = 1 for Mn(II, Co(II, Cu(II, and n = 0 for Zn, have been synthesized and characterized by elemental analysis, IR spectroscopy, X–ray diffraction measurements, thermogravimetry and magnetic studies. They are crystalline compounds characterized by various symmetry. They decompose in various ways when heated in air to 1273 K. At first, they dehydrate in one step and form anhydrous salts. The final products of decomposition are oxides of the respective metals (Mn2O3, Co3O4, NiO, CuO, ZnO. The solubilities of the analysed complexes in water at 293 K are in the orders of 10-2 – 10-4 mol dm-3. The magnetic susceptibilities of the Mn(II, Co(II, Ni(II and Cu(II complexes were measured over the range of 76–303 K and the magnetic moments were calculated. The results show that the 3,4,5-trimethoxybenzoates of Mn(II, Co(II and Ni(II are high-spin complexes but that of Cu(II forms a dimer [Cu2(C10H11O54(H2O2]. The carboxylate groups bind as monodentate or bidentate chelating or bridging ligands.

  6. Roget's II the new thesaurus

    CERN Document Server


    Roget’s II: The New Thesaurus, Third Edition, allows the user to find the right synonym with a minimum of effort. Unlike many thesauruses, this easy-to-use reference lists main entry words alphabetically, as in a dictionary, for quick lookup. Each entry is divided into senses, with brief definitions and a full list of synonyms for each sense, to ensure that the selected usage is the most appropriate one. All special usages, such as slang terms, are labeled and grouped together at the end of each synonym list. Following each list is a cross-reference to a related entry in the thesaurus’s unique Category Index. This index leads the reader from the starting word to dozens of others that have related or opposite meanings. All these features make Roget’s II the best resource for finding the right word every time.

  7. 2IrrigatioIi)Division

    African Journals Online (AJOL)

    i'deVices 'were 'insiailed ii{ej"s'tilt"ioni aliitii'ooa I cana(.whiie;-Goa i ca~ai· stations,."were left ... I996 season which was'under the-study was 4·tonlha and 2.9 'tonlha for Goa I and Goa 2. (-~. ...... 9f.f!-o.l'!jus~'UPStr~_~;.0~ ~r.we,ir axis, and ~e.



    Drozdek, Adam


    Catherine II produced a fairly large number of plays in which she satirized particular vices and included a moderate number de moral teachings. However, in many of them Catherine was primarily occupied with amorous pursuits. Her so-called French plays are weak, full of gossip and ridiculing. Catherine also addressed the problem of education, but in most cases this was reduced to crude criticism, particularly of the masonry, fairly popular then in Russia. Although she was technically the head ...

  9. phenylenediamine zinc(ii) phosphate

    African Journals Online (AJOL)


    Zn2+ ions yielded a metallo-ligand of composition [ZnL2Ph(NH3)2(H2O)2] I. Compound I melts at 126oC and is soluble in common organic solvents such as ... H3PO4 and 0.137g of p-amino benzoic acid under vigorous stirring. The stirring ... low melting point of 126oC while compound II was thermally stable up to 3000C.

  10. The synthesis and characterization of complexes of zinc(II, cadmium(II, platinum(II and palladium(II with potassium 3-dithiocarboxy-3-aza-5-aminopentanoate

    Directory of Open Access Journals (Sweden)



    Full Text Available Complexes of zinc(II, cadmium(II, platinum(II and palladium(II with a new polydentate dithiocarbamate ligand, 3-dithiocarboxy-3-aza-5-aminopentanoate (daap-, of the type M(daap2·nH2O (M = Zn(II, Cd(II, n = 2, or M = Pt(II, Pd(II, n = 0, have been prepared and characterized by elemental analysis, IR and UV/VIS spectroscopy, as well as magnetic measurements. The spectra of the complexes suggest a bidentate coordination of the daap- ligand to the metal ions via the sulfur atoms of the deprotonated dithiocarbamato group. The fact that under the same experimental conditions its S-methyl ester does not form complexes could be taken as proof of the suggested coordination mode.

  11. World War II Weather Record Transmittances (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — World War II Weather Record Transmittances are a record of the weather and meteorological data observed during World War II and transferred to the archive. It...

  12. Topaz II preliminary safety assessment (United States)

    Marshall, Albert C.; Standley, Vaughn; Voss, Susan S.; Haskin, Eric


    The Strategic Defense Initiative Organization (SDIO) decided to investigate the possibility of launching a Russian Topaz II space nuclear power system. A preliminary safety assessment was conducted to determine whether or not a space mission could be conducted safely and within budget constraints. As part of this assessment, a safety policy and safety functional requirements were developed to guide both the safety assessment and future Topaz II activities. A review of the Russian flight safety program was conducted and documented. Our preliminary safety assessment included a top level event tree, neutronic analysis of normal and accident configurations, an evaluation of temperature coefficients of reactivity, a reentry and disposal analysis, and analysis of postulated launch abort impact accidents, and an analysis of postulated propellant fire and explosion accidents. Based on the assessment, it appears that it will be possible to safely launch the Topaz II system in the U.S. with some possible system modifications. The principal system modifications will probably include design changes to preclude water flooded criticality and to assure intact reentry.

  13. PEP-II Operations Report

    Energy Technology Data Exchange (ETDEWEB)

    Zisman, Michael S.


    PEP-II is a two-ring asymmetric B factory operating at the Upsilon(4S) resonance. It was constructed by a SLAC-LBNL-LLNL collaboration. The collider comprises two rings, a High-Energy Ring (HER) storing 9 GeV electrons, and a Low-Energy Ring (LER) storing 3.1 GeV positrons. Commissioning of the HER began in mid-1997 and commissioning of the LER began in mid-1998. First evidence for collisions was obtained on July 23, 1998. The BaBar detector was installed in early 1999, and commissioning with the detector commenced in May 1999. By September 1999, PEP-II had reached a peak luminosity of 1.35 x 10{sup 33} cm{sup {minus}2} s{sup {minus}1}. In the present run, which began in October 1999, the peak luminosity has reached 3.1 x 10{sup 33} cm{sup {minus}2} s{sup {minus}1} and the integrated luminosity delivered is 25 fb{sup {minus}1}. At present, PEP-II is the world's highest luminosity collider. In this paper we describe the startup experience and summarize the operational experience during fiscal year 2000 (from October 1999 through September 2000). Plan s for luminosity upgrades are briefly described.

  14. Urotensin II in cardiovascular regulation

    Directory of Open Access Journals (Sweden)

    Fraser D Russell


    Full Text Available Fraser D RussellSchool of Health and Sport Sciences, Faculty of Science, Health and Education, University of the Sunshine Coast, Sippy Downs, Queensland, AustraliaAbstract: Cardiovascular function is modulated by neuronal transmitters, circulating hormones, and factors that are released locally from tissues. Urotensin II (UII is an 11 amino acid peptide that stimulates its’ obligatory G protein coupled urotensin II receptors (UT to modulate cardiovascular function in humans and in other animal species, and has been implicated in both vasculoprotective and vasculopathic effects. For example, tissue and circulating concentrations of UII have been reported to increase in some studies involving patients with atherosclerosis, heart failure, hypertension, preeclampsia, diabetes, renal disease and liver disease, raising the possibility that the UT receptor system is involved in the development and/or progression of these conditions. Consistent with this hypothesis, administration of UT receptor antagonists to animal models of cardiovascular disease have revealed improvements in cardiovascular remodelling and hemodynamics. However, recent studies have questioned this contributory role of UII in disease, and have instead postulated a protective effect on the cardiovascular system. For example, high concentrations of circulating UII correlated with improved clinical outcomes in patients with renal disease or myocardial infarction. The purpose of this review is to consider the regulation of the cardiovascular system by UII, giving consideration to methodologies for measurement of plasma concentrations, sites of synthesis and triggers for release.Keywords: urotensin II, cardiovascular disease, heart failure, hypertension

  15. Synthesis and characterization of heterobimetallic complexes of the type [Cu(pn2][MCl4] where M = Co(II, Ni(II, Cu(II, Zn(II, Cd(II, and Hg(II

    Directory of Open Access Journals (Sweden)

    Seema Yadav


    Full Text Available A series of new bimetallic transition metal complexes of the type [Cu(pn2] [MCl4] have been synthesized (where M = Co(II, Ni(II, Cu(II, Zn(II, Cd(II and Hg(II, pn = 1,3-diaminopropane and characterized by elemental analysis, molar conductance, TGA, IR and electronic spectra. All the compounds are 1:1 electrolyte in DMF. The Cu(II ion is square-planar while metal ions in the anionic moiety acquire their usual tetrahedral arrangement. On the basis of these studies it is concluded that anionic moiety is electrically stabilized by its cationic counterpart.

  16. Levels of Cd (II, Mn (II, Pb (II, Cu (II, and Zn (II in Common Buzzard (Buteo buteo from Sicily (Italy by Derivative Stripping Potentiometry

    Directory of Open Access Journals (Sweden)

    P. Licata


    Full Text Available The purpose of this study was to determine the concentrations of heavy metals (Cd, Pb, Cu, Mn, and Zn in different organs (liver, kidney, muscle, lung, skin, and feathers of buzzards (Buteo buteo, utilized as a “biological indicator” for environmental contamination, from different areas of Sicily and to investigate the relationships between birds sex, age, and weight and metal levels in these samples. All samples of common buzzards were collected at the “Recovery Center of Wild Fauna” of Palermo, through the Zooprophilactic Institute. Potentiometric stripping analysis (PSA was used to determine the content of Cd(II, Cu(II, Mn(II, Pb(II, and Zn(II in bird tissues. For toxic metals, the highest levels of Pb were in liver and those of Cd in lung; Zn levels were higher than Cu and Mn in all tissues analyzed. The concentrations in liver, lung, kidney, and muscle could be considered as an indicative of chronic exposure to metals while the presence of metals in skin could be consequential to storing and elimination processes. The found concentrations of metals in the studied matrices required a highly sensitive method for their determination and a simple sample preparation procedure, and the proposed method was well suited for this purpose.

  17. (I-Morphlinobenzyl) semicarbazide Manganese (II)

    African Journals Online (AJOL)

    The interaction of ethanolic solution of semicarbazide hydrochloride, benzyldehyde and morpholine yielded N-(I-Morpholinobenzyl) Semicarbazide Schiff base. The Schiff base complexes of manganese(II) and iron(II) were synthesized by refluxing the mixture of ethanolic solutions of the Schiff base and metal(II) chlorides, ...

  18. 21 CFR 1308.12 - Schedule II. (United States)


    ... 21 Food and Drugs 9 2010-04-01 2010-04-01 false Schedule II. 1308.12 Section 1308.12 Food and Drugs DRUG ENFORCEMENT ADMINISTRATION, DEPARTMENT OF JUSTICE SCHEDULES OF CONTROLLED SUBSTANCES Schedules § 1308.12 Schedule II. (a) Schedule II shall consist of the drugs and other substances, by...

  19. Competition from Cu(II), Zn(II) and Cd(II) in Pb(II) binding to Suwannee River Fulvic Acid

    NARCIS (Netherlands)

    Chakraborty, P.; Chakrabarti, C.L.


    This is a study of trace metal competition in the complexation of Pb(II) by well-characterized humic substances, namely Suwannee River Fulvic Acid (SRFA) in model solutions. It was found that Cu(II) seems to compete with Pb(II) for strong binding sites of SRFA when present at the same concentration

  20. Eight joint BER II and BESSY II users meeting. Abstracts

    Energy Technology Data Exchange (ETDEWEB)



    The following topics were dealt with: Accelerator operation and projecs, photon science and instrumentation at BESSY II, status of energy materials in-situ Lab at BESSY II, high resolution spectrometer PEAXIS at BESSY II, sample environment at BESSY II, molecular control mechanisms in the Brr2 RNA helicase for efficient and regulated splicing, the Li conversion reaction of 4CoFe{sub 2}O{sub 4} nanoparticles, buried interfaces in lithium ion batteries probed with HAXPES, ARPES studies of the STO(001) 2DEG, all-in/all-out magnetic order in rare earth iridates, oxygen reduction reaction on graphene in Li-air batteries, electronic order in high-T{sub c} superconductors, in-siu observation of novel switching phenomena in highly porous metal-organic frameworks, photoinduced demagnetization and insulator-to-metal transition in ferromagnetic insulating BaFeO{sub 3} thin films, ARPES measurement of the ferroelectric bulk Rashba system GeTe, bisphenol A on Cu(111) and Ag(111), reverse water-gas shift or Sabathier methanation on N(110), structural studies of molecular machines, multi-MHz time-of-flight electronic band-structure imaging of graphene on Ir(111), diffusion pathways in ion conductors, ground-state potential energy surfaces around selected atoms from resonant inelastic X-ray scattering, solar energy in an emerging country, in-situ neutron analysis of electrode materials for electrochemical energy storage, structure and transport properties in thermoelectric skutterudites, investigation of the interphase formation on solid lithium-ion conductors by neutron reflectometry, load partitin and damage characterization of cast AlSi{sub 12}CuMgNi alloy with ceramic reinforcement, methane adsorption in highly porous metal-organics, structure and magnetic interactions in dimer system Ba{sub (3-x)}Sr{sub x}Cr{sub 2}O{sub 8}, distribution of S in C-S nanocomposites, current status of HFM-EXED FACITIY; SPIN NEAMTICITY IN s=1/2 frustrated zigzag chaIN β-TeVO{sub 4}, electronic

  1. Synthesis, spectral characterization and biological evaluation of Mn(II), Co(II), Ni(II), Cu(II), Zn(II) and Cd(II) complexes with thiosemicarbazone ending by pyrazole and pyridyl rings (United States)

    Yousef, T. A.; Abu El-Reash, G. M.; Al-Jahdali, M.; El-Rakhawy, El-Bastawesy R.


    Here we present the synthesis of the new Mn(II), Co(II), Ni(II), Cu(II), Zn(II) and Cd(II) complexes with chelating ligand (Z)-(2-((1,3-diphenyl-1H-pyrazol-4-yl)methylene) hydrazinyl)(pyridin-2-ylamino)methanethiol. All the complexes were characterized by elemental analysis, IR, 1H NMR, UV-vis, magnetic susceptibility measurements and EPR spectral studies. IR spectra of complexes showed that the ligand behaves as NN neutral bidentate, NSN mononegative tridentate and NSNN mononegative tetradentate. The electronic spectra and the magnetic measurements suggested the octahedral geometry for all complexes as well as the EPR confirmed the tetragonal distorted octahedral for Cu(II) complex. Cd(II) complex showed the highest inhibitory antioxidant activity either using ABTS method. The SOD-like activity exhibited those Cd(II) and Zn(II) complexes have strong antioxidative properties. We tested the synthesized compounds for antitumor activity and showed that the ability to kill liver (HePG2) and breast (MCF-7) cancer cells definitely.

  2. Angiotensin II-like material extracted from the rat brain is distinct from authentic angiotensin II. (United States)

    Pohl, M; Carayon, A; Cesselin, F; Hamon, M


    Specific radioimmunoassay and radioreceptor assay for angiotensin II (A II) were used for the possible identification of this peptide in the rat brain. An A II-like material (A II-LM) was detected with both assays applied to acidic extracts of various brain structures. The regional distribution of A II-LM was uneven, but absolute levels (in A II equivalents) could not be accurately determined, as they were highly dependent on the assay used. Partial purification of A II-LM by Sep-Pak C 18 chromatography and affinity chromatography using anti-A II antibodies bound to Ultrogel gave a compound coeluting with authentic A II in reverse-phase HPLC. However, gel filtration through Sephadex G-25 and TSK Spherogel 3000 SW as well as anion exchange HPLC demonstrated that A II-LM did not correspond to authentic A II. Partial characterization of A II-LM indicated that this compound was probably a peptide with an apparent molecular weight of 5,000-7,000 (instead of 1,046 for A II) and more polar but less positively charged than A II. Whether A II-LM is, in fact, the endogenous ligand of A II binding sites in brain remains an interesting hypothesis for further investigations.

  3. Synthesis and Characterization of Multimetallic Fe(II) and Mn(II ...

    African Journals Online (AJOL)


    Mustapha and Gani. 56. Synthesis and Characterization of Multimetallic Fe(II) and Mn(II) Using. N4O3 Potentially Heptadentate Ligand. Mustapha, A. and Gani, S. M.. Department of Chemistry, Federal University Dutse, PMB 7156, Jigawa State ... ligands and their complexes with nickel(II) and copper(II) has also been ...

  4. Syntheses and spectroscopic properties of mercury(II) and nickel(II ...

    African Journals Online (AJOL)

    Mercury(II) complex, [Hg2(BPTU-2H)Cl2] and nickel(II) complex, [Ni(BPTU-H)2] were prepared by reacting Bis(N-phenylthiourea), BPTU, with mercury(II) chloride and nickel(II) acetate respectively. The complexes were characterized by IR, diffuse reflectance, 1H NMR spectra and elemental analysis. BPTU acts as ...


    African Journals Online (AJOL)

    Preferred Customer

    ABSTRACT. Chemical speciation of binary complexes of Co(II), Ni(II), Cu(II) and Zn(II) with L-aspartic acid was investigated pH-metrically in acetonitrile- and ethylene glycol-water mixtures. The stability constants were calculated using the computer program MINIQUAD75. The best-fit chemical models were selected based ...


    African Journals Online (AJOL)

    [Zn(H2L)2] (4) have been isolated and characterized by IR, UV-Visible ... KEY WORDS: Schiff base, Phenolate, Manganese(II), Nickel(II), Copper(II), Zinc(II), Mononuclear ... spectra were recorded as KBr discs on a Bruker IFS-66V spectrophotometer. ... The molar conductance of 10-3 M solutions of the metal complexes.

  7. Spectroscopy of Bioactive Manganese(II) and Copper(II) Complexes with Mannich Bases (United States)

    Harbatsevich, H. I.; Loginova, N. V.; Koval‧chuk, T. V.; Osipovich, N. P.; Gres, A. T.; Azarko, I. I.; Polozov, G. I.


    The compositions and geometries of coordination polyhedra in Cu(II) and Mn(II) complexes with Mannich bases were determined using IR, EPR, and electron spectroscopy. It was shown that bidentate ligands were coordinated to the metal ions in these complexes. The coordination polyhedra of mononuclear Cu(II) and Mn(II) complexes consisted of two mono-anionic ligands. Polyhedra of the Mn(II) complexes also contained two water molecules. The Cu(II) complexes had characteristic square-planar [CuN2O2] coordination polyhedra; Mn(II) complexes, [MnN2O4] octahedra.

  8. Synthesis of tin (II) oxide from tin (II) oxohydroxide (United States)

    Kuznetsova, Svetlana; Lisitsa, Konstantin


    Sufficiently limited use of tin (II) oxide is associated with the difficulties of its preparation without impurities of tin (IV) oxide. Understanding the cause of the oxidation process will make it possible to develop methods for obtaining SnO without impurities. The influence of ammonium chloride concentration in the suspension on the oxide composition was investigated. The temperature of oxidation (400 °C) on the air and temperature decomposition in the argon (350 °C) of Sn6O4(OH)4 in the solid phase were determined by the thermal analysis method. The decomposition temperature of the oxyhydroxide in the suspension of ammonium chloride does not exceed 100 °C. An increase in the content of ammonium chloride in an aqueous solution leads to an increase i n the solubility of oxohydroxide and leads to an increase in pH. The suspensions of Sn6O4(OH)4 were subjected to heat treatment on a sand bath and under microwave irradiation. Samples of tin oxide were obtained. The quantitative composition of the mixture of tin oxides was determined. The research also highlights emphasizes that the oxidation of tin (II) to tin (IV) is associated with the dissolved oxygen content in the suspension.

  9. Simultaneous Determination of Cobalt (II and Nickel (II By First Order Derivative Spectrophotometry in Micellar Media

    Directory of Open Access Journals (Sweden)

    Rajni Rohilla


    Full Text Available A first-derivative spectrophotometry method for the simultaneous determination of Co (II and Ni (II with Alizarin Red S in presence of Triton X-100 is described. Measurements were made at the zero-crossing wavelengths at 549.0 nm for Co (II and 546.0 nm for Ni (II. The linearity is obtained in the range of 0.291- 4.676 μg/ml of Ni (II and 0.293- 4.124 μg/ml of Co (II in the presence of each other by using first derivative spectrophotometric method. The possible interfering effects of various ions were studied. The validity of the method was examined by using synthetic mixtures of Co (II and Ni (II. The developed derivative procedure, using the zero crossing technique, has been successfully applied for the simultaneous analysis of Co (II and Ni (II in spiked water samples.

  10. Belle II Technical Design Report

    CERN Document Server

    Abe, T; Adamczyk, K; Ahn, S; Aihara, H; Akai, K; Aloi, M; Andricek, L; Aoki, K; Arai, Y; Arefiev, A; Arinstein, K; Arita, Y; Asner, D M; Aulchenko, V; Aushev, T; Aziz, T; Bakich, A M; Balagura, V; Ban, Y; Barberio, E; Barvich, T; Belous, K; Bergauer, T; Bhardwaj, V; Bhuyan, B; Blyth, S; Bondar, A; Bonvicini, G; Bozek, A; Bracko, M; Brodzicka, J; Brovchenko, O; Browder, T E; Cao, G; Chang, M -C; Chang, P; Chao, Y; Chekelian, V; Chen, A; Chen, K -F; Chen, P; Cheon, B G; Chiang, C -C; Chistov, R; Cho, K; Choi, S -K; Chung, K; Comerma, A; Cooney, M; Cowley, D E; Critchlow, T; Dalseno, J; Danilov, M; Dieguez, A; Dierlamm, A; Dillon, M; Dingfelder, J; Dolenec, R; Dolezal, Z; Drasal, Z; Drutskoy, A; Dungel, W; Dutta, D; Eidelman, S; Enomoto, A; Epifanov, D; Esen, S; Fast, J E; Feindt, M; Garcia, M Fernandez; Fifield, T; Fischer, P; Flanagan, J; Fourletov, S; Fourletova, J; Freixas, L; Frey, A; Friedl, M; Fruehwirth, R; Fujii, H; Fujikawa, M; Fukuma, Y; Funakoshi, Y; Furukawa, K; Fuster, J; Gabyshev, N; Cueto, A Gaspar de Valenzuela; Garmash, A; Garrido, L; Geisler, Ch; Gfall, I; Goh, Y M; Golob, B; Gorton, I; Grzymkowski, R; Guo, H; Ha, H; Haba, J; Hara, K; Hara, T; Haruyama, T; Hayasaka, K; Hayashi, K; Hayashii, H; Heck, M; Heindl, S; Heller, C; Hemperek, T; Higuchi, T; Horii, Y; Hou, W -S; Hsiung, Y B; Huang, C -H; Hwang, S; Hyun, H J; Igarashi, Y; Iglesias, C; Iida, Y; Iijima, T; Imamura, M; Inami, K; Irmler, C; Ishizuka, M; Itagaki, K; Itoh, R; Iwabuchi, M; Iwai, G; Iwai, M; Iwasaki, M; Iwasaki, M; Iwasaki, Y; Iwashita, T; Iwata, S; Jang, H; Ji, X; Jinno, T; Jones, M; Julius, T; Kageyama, T; Kah, D H; Kakuno, H; Kamitani, T; Kanazawa, K; Kapusta, P; Kataoka, S U; Katayama, N; Kawai, M; Kawai, Y; Kawasaki, T; Kennedy, J; Kichimi, H; Kikuchi, M; Kiesling, C; Kim, B K; Kim, G N; Kim, H J; Kim, H O; Kim, J -B; Kim, J H; Kim, M J; Kim, S K; Kim, K T; Kim, T Y; Kinoshita, K; Kishi, K; Kisielewski, B; van Dam, K Kleese; Knopf, J; Ko, B R; Koch, M; Kodys, P; Koffmane, C; Koga, Y; Kohriki, T; Koike, S; Koiso, H; Kondo, Y; Korpar, S; Kouzes, R T; Kreidl, Ch; Kreps, M; Krizan, P; Krokovny, P; Krueger, H; Kruth, A; Kuhn, W; Kuhr, T; Kumar, R; Kumita, T; Kupper, S; Kuzmin, A; Kvasnicka, P; Kwon, Y -J; Lacasta, C; Lange, J S; Lee, I -S; Lee, M J; Lee, M W; Lee, S -H; Lemarenko, M; Li, J; Li, W D; Li, Y; Libby, J; Limosani, A; Liu, C; Liu, H; Liu, Y; Liu, Z; Liventsev, D; Virto, A Lopez; Makida, Y; Mao, Z P; Marinas, C; Masuzawa, M; Matvienko, D; Mitaroff, W; Miyabayashi, K; Miyata, H; Miyazaki, Y; Miyoshi, T; Mizuk, R; Mohanty, G B; Mohapatra, D; Moll, A; Mori, T; Morita, A; Morita, Y; Moser, H -G; Martin, D Moya; Mueller, T; Muenchow, D; Murakami, J; Myung, S S; Nagamine, T; Nakamura, I; Nakamura, T T; Nakano, E; Nakano, H; Nakao, M; Nakazawa, H; Nam, S -H; Natkaniec, Z; Nedelkovska, E; Negishi, K; Neubauer, S; Ng, C; Ninkovic, J; Nishida, S; Nishimura, K; Novikov, E; Nozaki, T; Ogawa, S; Ohmi, K; Ohnishi, Y; Ohshima, T; Ohuchi, N; Oide, K; Olsen, S L; Ono, M; Ono, Y; Onuki, Y; Ostrowicz, W; Ozaki, H; Pakhlov, P; Pakhlova, G; Palka, H; Park, H; Park, H K; Peak, L S; Peng, T; Peric, I; Pernicka, M; Pestotnik, R; Petric, M; Piilonen, L E; Poluektov, A; Prim, M; Prothmann, K; Regimbal, K; Reisert, B; Richter, R H; Riera-Babures, J; Ritter, A; Ritter, A; Ritter, M; Roehrken, M; Rorie, J; Rosen, M; Rozanska, M; Ruckman, L; Rummel, S; Rusinov, V; Russell, R M; Ryu, S; Sahoo, H; Sakai, K; Sakai, Y; Santelj, L; Sasaki, T; Sato, N; Sato, Y; Scheirich, J; Schieck, J; Schwanda, C; Schwartz, A J; Schwenker, B; Seljak, A; Senyo, K; Seon, O -S; Sevior, M E; Shapkin, M; Shebalin, V; Shen, C P; Shibuya, H; Shiizuka, S; Shiu, J -G; Shwartz, B; Simon, F; Simonis, H J; Singh, J B; Sinha, R; Sitarz, M; Smerkol, P; Sokolov, A; Solovieva, E; Stanic, S; Staric, M; Stypula, J; Suetsugu, Y; Sugihara, S; Sugimura, T; Sumisawa, K; Sumiyoshi, T; Suzuki, K; Suzuki, S Y; Takagaki, H; Takasaki, F; Takeichi, H; Takubo, Y; Tanaka, M; Tanaka, S; Taniguchi, N; Tarkovsky, E; Tatishvili, G; Tawada, M; Taylor, G N; Teramoto, Y; Tikhomirov, I; Trabelsi, K; Tsuboyama, T; Tsunada, K; Tu, Y -C; Uchida, T; Uehara, S; Ueno, K; Uglov, T; Unno, Y; Uno, S; Urquijo, P; Ushiroda, Y; Usov, Y; Vahsen, S; Valentan, M; Vanhoefer, P; Varner, G; Varvell, K E; Vazquez, P; Vila, I; Vilella, E; Vinokurova, A; Visniakov, J; Vos, M; Wang, C H; Wang, J; Wang, M -Z; Wang, P; Wassatch, A; Watanabe, M; Watase, Y; Weiler, T; Wermes, N; Wescott, R E; White, E; Wicht, J; Widhalm, L; Williams, K M; Won, E; Xu, H; Yabsley, B D; Yamamoto, H; Yamaoka, H; Yamaoka, Y; Yamauchi, M; Yin, Y; Yoon, H; Yu, J; Yuan, C Z; Yusa, Y; Zander, D; Zdybal, M; Zhang, Z P; Zhao, J; Zhao, L; Zhao, Z; Zhilich, V; Zhou, P; Zhulanov, V; Zivko, T; Zupanc, A; Zyukova, O


    The Belle detector at the KEKB electron-positron collider has collected almost 1 billion Y(4S) events in its decade of operation. Super-KEKB, an upgrade of KEKB is under construction, to increase the luminosity by two orders of magnitude during a three-year shutdown, with an ultimate goal of 8E35 /cm^2 /s luminosity. To exploit the increased luminosity, an upgrade of the Belle detector has been proposed. A new international collaboration Belle-II, is being formed. The Technical Design Report presents physics motivation, basic methods of the accelerator upgrade, as well as key improvements of the detector.

  11. Commissioning of NSLS-II

    Energy Technology Data Exchange (ETDEWEB)

    Willeke, F.


    NSLS-II, the new 3rd generation light source at BNL was designed for a brightness of 1022 photons s-1mm-2mrad-2 (0.1%BW)-1. It was constructed between 2009 and 2014. The storage ring was commissioned in April 2014 which was followed by insertion device and beamline commissioning in the fall of 2014. All ambitious design parameters of the facility have already been achieved except for commissioning the full beam intensity of 500mA which requires more RF installation. This paper reports on the results of commissioning.

  12. (Diethylenetriaminebis(theophyllinatozinc(II dihydrate

    Directory of Open Access Journals (Sweden)

    Attila-Zsolt Kun


    Full Text Available In the title compound, [Zn(C7H7N4O22(C4H13N3]·2H2O, the ZnII ion is pentacoordinated by three N atoms of the diethylenetriamine ligand and one N atom of each of the two theophyllinate anions in a distorted trigonal-bipyramidal geometry. The Zn—N distances range from 2.076 (3 to 2.221 (3 Å. The crystal packing is stabilized by O—H...O, O—H...N and N—H...O hydrogen bonds involving the theophylline and diethylenetriamine ligands and uncoordinated water molecules.

  13. DNA damage by the cobalt (II) and zinc (II) complexes of ...

    African Journals Online (AJOL)

    Using the single cell gel electrophoresis method, the tetraazamacrocycle Zn(II) complex (Zn(II)-L) and the tetraazamacrocycle Co(II) complex (Co(II)-L) were investigated focusing on their DNA damage to Tetrahymena thermophila. When the cells were treated with the 0.05, 0.25 and 0.50 mg/ml Zn(II)-L, the tail length ...

  14. DNA damage by the cobalt (II) and zinc (II) complexes of ...

    African Journals Online (AJOL)



    Sep 3, 2008 ... Using the single cell gel electrophoresis method, the tetraazamacrocycle Zn(II) complex (Zn(II)-L) and the tetraazamacrocycle Co(II) complex (Co(II)-L) were investigated focusing on their DNA damage to. Tetrahymena thermophila. When the cells were treated with the 0.05, 0.25 and 0.50 mg/ml Zn(II)-L, the.

  15. Structural alteration of hexagonal birnessite by aqueous Mn(II): Impacts on Ni(II) sorption

    Energy Technology Data Exchange (ETDEWEB)

    Lefkowitz, Joshua P.; Elzinga, Evert J.


    We studied the impacts of aqueous Mn(II) (1 mM) on the sorption of Ni(II) (200 μM) by hexagonal birnessite (0.1 g L- 1) at pH 6.5 and 7.5 with batch experiments and XRD, ATR-FTIR and Ni K-edge EXAFS analyses. In the absence of Mn(II)aq, sorbed Ni(II) was coordinated predominantly as triple corner-sharing complexes at layer vacancies at both pH values. Introduction of Mn(II)aq into Ni(II)-birnessite suspensions at pH 6.5 caused Ni(II) desorption and led to the formation of edge-sharing Ni(II) complexes. This was attributed to competitive displacement of Ni(II) from layer vacancies by either Mn(II) or by Mn(III) formed through interfacial Mn(II)-Mn(IV) comproportionation, and/or incorporation of Ni(II) into the birnessite lattice promoted by Mn(II)-catalyzed recrystallization of the sorbent. Similar to Mn(II)aq, the presence of HEPES or MES caused the formation of edge-sharing Ni(II) sorption complexes in Ni(II)-birnessite suspensions, which was attributed to partial reduction of the sorbent by the buffers. At pH 7.5, interaction with aqueous Mn(II) caused reductive transformation of birnessite into secondary feitknechtite that incorporated Ni(II), enhancing removal of Ni(II) from solution. These results demonstrate that reductive alteration of phyllomanganates may significantly affect the speciation and solubility of Ni(II) in anoxic and suboxic environments.

  16. Synthesis, Characterization, and Antibacterial Activity of Co(II, Ni(II, Cu(II, Zn(II, Cd(II, and Hg(II Complexes of Schiff's Base Type Ligands Containing Benzofuran Moiety

    Directory of Open Access Journals (Sweden)

    N. Shashidhar Reddy


    Full Text Available Six new complexes of Co(II, Ni(II, Cu(II, Zn(II, Cd(II, and Hg(II with substituted benzofuran derivatives have been synthesized and characterized by elemental analysis, magnetic moments, conductance measurements, spectral characterization, and so forth. Elemental data coincide with the general formula MLC1n, where L = (E-7-Methoxy-N1-(2,4,5-trimethoxy benzylidene benzofuran-2-carbohydrazide (L1 or (E-N1-(2,6-dichloro benzylidene-7-methoxy benzofuran-2-carbohydrazide (L2, of the complexes. The ligands coordinate to the metal ions through the oxygen of the carbonyl group and the nitrogen of the hydrazine group. Electronic spectral data of the complexes suggests the probable geometry is octahedral in nature. All the complexes and ligands were screened for their antibacterial activity. Among them, Co, Ni, and Cu complexes of L2 showed good activity against all microbes.

  17. Theory of function spaces II

    CERN Document Server

    Triebel, Hans


    Theory of Function Spaces II deals with the theory of function spaces of type Bspq and Fspq as it stands at the present. These two scales of spaces cover many well-known function spaces such as Hölder-Zygmund spaces, (fractional) Sobolev spaces, Besov spaces, inhomogeneous Hardy spaces, spaces of BMO-type and local approximation spaces which are closely connected with Morrey-Campanato spaces. Theory of Function Spaces II is self-contained, although it may be considered an update of the author’s earlier book of the same title. The book’s 7 chapters start with a historical survey of the subject, and then analyze the theory of function spaces in Rn and in domains, applications to (exotic) pseudo-differential operators, and function spaces on Riemannian manifolds. ------ Reviews The first chapter deserves special attention. This chapter is both an outstanding historical survey of function spaces treated in the book and a remarkable survey of rather different techniques developed in the last 50 years. It is s...

  18. The Spectrum of Fe II (United States)

    Nave, Gillian; Johansson, Sveneric


    The spectrum of singly ionized iron (Fe II) has been recorded using high-resolution Fourier transform (FT) and grating spectroscopy over the wavelength range 900 Å to 5.5 μm. The spectra were observed in high-current continuous and pulsed hollow cathode discharges using FT spectrometers at the Kitt Peak National Observatory, Tucson, AZ and Imperial College, London and with the 10.7 m Normal Incidence Spectrograph at the National Institute of Standards and Technology. Roughly 12,900 lines were classified using 1027 energy levels of Fe II that were optimized to measured wavenumbers. The wavenumber uncertainties of lines in the FT spectra range from 10-4 cm-1 for strong lines around 4 μm to 0.05 cm-1 for weaker lines around 1500 Å. The wavelength uncertainty of lines in the grating spectra is 0.005 Å. The ionization energy of (130,655.4 ± 0.4) cm-1 was estimated from the 3d6(5D)5g and 3d6(5D)6h levels.


    Jensen, Roy A.; Haas, Felix L.


    Jensen, Roy A. (The University of Texas M. D. Anderson Hospital and Tumor Institute, Houston) and Felix L. Haas. Electrokinetics and cell physiology. II. Relationship of surface charge to onset of bacterial competence for genetic transformation. J. Bacteriol. 86:79–86. 1963.—A reliable cell fractionation scheme, which is sensitive to the electrokinetic properties of Bacillus subtilis cells, has been described in detail. Recipient cell populations, characterized by a wide range of competency for transformation to independence of nutritional markers, were subjected to electrokinetic fractionation. Results indicated that (i) physiological competency is directly related to the electrical charge on the cell surface, (ii) newly competent cells carry a maximal negative charge, (iii) the newly competent cell appears with spontaneous abruptness, (iv) a kinetic flow of competent cells from the highly charged fractions to the lower charged fractions indicates the progressive loss of the surface charge maintained by a competent cell, and (v), by token of the latter statement, cells competent to undergo transformation do so within a range of surface-charge values. PMID:14051826

  20. BNL ATF II beamlines design

    Energy Technology Data Exchange (ETDEWEB)

    Fedurin, M. [Brookhaven National Lab. (BNL), Upton, NY (United States); Jing, Y. [Brookhaven National Lab. (BNL), Upton, NY (United States); Stratakis, D. [Brookhaven National Lab. (BNL), Upton, NY (United States); Swinson, C. [Brookhaven National Lab. (BNL), Upton, NY (United States)


    The Brookhaven National Laboratory. Accelerator Test Facility (BNL ATF) is currently undergoing a major upgrade (ATF-II). Together with a new location and much improved facilities, the ATF will see an upgrade in its major capabilities: electron beam energy and quality and CO2 laser power. The electron beam energy will be increased in stages, first to 100-150 MeV followed by a further increase to 500 MeV. Combined with the planned increase in CO2 laser power (from 1-100 TW), the ATF-II will be a powerful tool for Advanced Accelerator research. A high-brightness electron beam, produced by a photocathode gun, will be accelerated and optionally delivered to multiple beamlines. Besides the energy range (up to a possible 500 MeV in the final stage) the electron beam can be tailored to each experiment with options such as: small transverse beam size (<10 um), short bunch length (<100 fsec) and, combined short and small bunch options. This report gives a detailed overview of the ATFII capabilities and beamlines configuration.

  1. Quiet High Speed Fan II (QHSF II): Final Report (United States)

    Kontos, Karen; Weir, Don; Ross, Dave


    This report details the aerodynamic, mechanical, structural design and fabrication of a Honey Engines Quiet High Speed Fan II (lower hub/tip ratio and higher specific flow than the Baseline I fan). This fan/nacelle system incorporates features such as advanced forward sweep and an advanced integrated fan/fan exit guide vane design that provides for the following characteristics: (1) Reduced noise at supersonic tip speeds, in comparison to current state-of-the-art fan technology; (2) Improved aeroelastic stability within the anticipated operating envelope; and (3) Aerodynamic performance consistent with current state-of-the-art fan technology. This fan was fabricated by Honeywell and tested in the NASA Glenn 9- by 15-Ft Low Speed Wind Tunnel for aerodynamic, aeromechanical, and acoustic performance.

  2. District heating concept Hirtenwiesen II; Nahwaermekonzept Hirtenwiesen II

    Energy Technology Data Exchange (ETDEWEB)

    Wagner, Josef [Stadtwerke Crailsheim GmbH, Crailsheim (Germany)


    Hirtenwiesen II is a new urban development project on an abandoned industrial site west of Crailsheim, Germany. It will house a population of about 2,000 and provide a comprehensive infrastructure including kindergarten, schools, sports centers and shopping centers. Modern amenities will be combined with environment-friendly energy concepts based on solar energy. A school building - Lise-Meitner-Gymnasium - and a sports hall - Hirtenwiesenhalle - will be supplied with solar power as well. Solar energy will provide more than 50 % of the energy required, which is more than average. Also, the solar power plant will have a collector surface of 10,000 m{sup 3} and a capacity of 7 MW{sub th}, which will make it Germany's biggest individual thermal solar power plant. (orig./AKB)

  3. Mass spectrometry and potentiometry studies of Pb(II)-, Cd(II)- and Zn(II)-cystine complexes. (United States)

    Furia, Emilia; Aiello, Donatella; Di Donna, Leonardo; Mazzotti, Fabio; Tagarelli, Antonio; Thangavel, Hariprasad; Napoli, Anna; Sindona, Giovanni


    Cd(II)-, Pb(II)- and Zn(II)-cystine complexes were investigated by potentiometric and different mass spectrometric (MS) methodologies. Laser desorption mass spectrometry has provided both the composition and structure of metal-cystine complexes according to the speciation models proposed on the basis of the potentiometric data. Detection of neutral complexes was achieved by protonation or electrochemical reduction during mass spectrometric experiments. The redox activity of metal-cystine complexes was confirmed by laser desorption and charge transfer matrix assisted laser assisted MS experiments, which allowed us to observe the formation of complexes with a reduction of cystine. The stoichiometry of Cd(II)-, Pb(II)- and Zn(II)-cystine complexes was defined by observing the isotopic pattern of the investigated compound. The results suggest that interaction occurs through the carboxylate group of the ligand.

  4. Speciation of Co(II), Ni(II) and Cu(II) Complexes with L-Glutamic ...

    African Journals Online (AJOL)



    Aug 10, 2011 ... Chemical speciation of Co(II), Ni(II) and Cu(II) complexes of L-glutamic acid in the presence of Dioxan-Water mixtures at an ionic strength of 0.16 mol L–1 at 303 K was studied pH– metrically. Glu is taken as a model compound for amino acid residues and dioxan is used to mimic the low dielectric constant ...

  5. Formation of binary complexes of Co(II), Ni(II) and Cu(II) with L ...

    African Journals Online (AJOL)

    ... on statistical parameters like crystallographic R factor and sum of the squares of residuals in mass-balance equations. The models for binary complex systems contain the chemical species ML, ML2, MLH, ML2H and ML2H2 for Co(II), Ni(II) and Cu(II) in dioxan-water mixtures. The trend in the variation of stability constants ...

  6. Porous cellulosic adsorbent for the removal of Cd (II), Pb(II) and Cu(II) ions from aqueous media (United States)

    Barsbay, Murat; Kavaklı, Pınar Akkaş; Tilki, Serhad; Kavaklı, Cengiz; Güven, Olgun


    The main objective of this work is to prepare a renewable cellulosic adsorbent by γ-initiated grafting of poly(glycidyl methacrylate) (PGMA) from cellulose substrate and subsequent modification of PGMA with chelating species, iminodiacetic acid (IDA), for Cd (II), Pb(II) and Cu(II) removal from aqueous media. Modification of PGMA grafted cellulose with IDA in aqueous solution under mild conditions has proceeded efficiently to yield a natural-based and effective porous adsorbent with well-defined properties as provided by the controlled polymerization technique, namely RAFT, applied during the radiation-induced graft copolymerization step and with sufficient degree of IDA immobilization as confirmed by XPS, FTIR, contact angle measurements and elemental analysis. In order to examine the Cd (II), Pb(II) and Cu(II) removing performance of the resulting adsorbent, batch experiments were carried out by ICP-MS. The adsorption capacities were determined as 53.4 mg Cd(II)/g polymer, 52.0 mg Pb(II)/g polymer and 69.6 mg Cu(II)/g polymer at initial feed concentration of 250 ppm, showing the promising potential of the natural-based adsorbent to steadily and efficiently chemisorb toxic metal ions.

  7. Preparation and thermal decomposition of copper(II, zinc(II and cadmium(II chelates with 8-hydroxyquinoline

    Directory of Open Access Journals (Sweden)

    Crespi Marisa S.


    Full Text Available When the compounds are heated in an inert atmosphere it can be verified the consecutive partial sublimation, fusion, partial volatilization and partial thermal decomposition of the anhydrous complexes. When in an oxidating atmosphere the above process is only verified to Cu(II chelates. Anhydrous copper(II complexes present a monoclinic structure in the b form and the volatilized compound in a a form. Zinc(II and cadmium(II hydrated complexes are isomorphous and they present different cell dimensions from those reported previously.

  8. Chelation of Cu(II), Zn(II), and Fe(II) by tannin constituents of selected edible nuts. (United States)

    Karamać, Magdalena


    The tannin fractions isolated from hazelnuts, walnuts and almonds were characterised by colorimetric assays and by an SE-HPLC technique. The complexation of Cu(II) and Zn(II) was determined by the reaction with tetramethylmurexide, whereas for Fe(II), ferrozine was employed. The walnut tannins exhibited a significantly weaker reaction with the vanillin/HCl reagent than hazelnut and almond tannins, but the protein precipitation capacity of the walnut fraction was high. The SE-HPLC chromatogram of the tannin fraction from hazelnuts revealed the presence of oligomers with higher molecular weights compared to that of almonds. Copper ions were most effectively chelated by the constituents of the tannin fractions of hazelnuts, walnuts and almonds. At a 0.2 mg/assay addition level, the walnut tannins complexed almost 100% Cu(II). The Fe(II) complexation capacities of the tannin fractions of walnuts and hazelnuts were weaker in comparison to that of the almond tannin fraction, which at a 2.5 mg/assay addition level, bound Fe(II) by approximately 90%. The capacity to chelate Zn(II) was quite varied for the different nut tannin fractions: almond tannins bound as much as 84% Zn(II), whereas the value for walnut tannins was only 8.7%; and for hazelnut tannins, no Zn(II) chelation took place at the levels tested.

  9. Elaboration of a Highly Porous Ru(II,II) Analogue of HKUST-1. (United States)

    Zhang, Wenhua; Freitag, Kerstin; Wannapaiboon, Suttipong; Schneider, Christian; Epp, Konstantin; Kieslich, Gregor; Fischer, Roland A


    When the dinuclear Ru(II,II) precursor [Ru2(OOCCH3)4] is employed under redox-inert conditions, a Ru(II,II) analogue of HKUST-1 was successfully prepared and characterized as a phase-pure microcrystalline powder. X-ray absorption near-edge spectroscopy confirms the oxidation state of the Ru centers of the paddle-wheel nodes in the framework. The porosity of 1371 m(2)/mmol of Ru(II,II)-HKUST-1 exceeds that of the parent compound HKUST1 (1049 m(2)/ mmol).

  10. Dimethylammonium tetraaqua(hydrogensulfatosulfatocuprate(II

    Directory of Open Access Journals (Sweden)

    Peter Held


    Full Text Available In the title salt, [(CH32NH2][Cu(HSO4(SO4(H2O4], one type of cation and anion is present in the asymmetric unit. The CuII atom in the complex anion, [Cu(HSO4(SO4(H2O4]−, has a tetragonal bipyramidal [4 + 2] coordination caused by a Jahn–Teller distortion, with the aqua ligands in equatorial and two O atoms of tetrahedral HSO4 and SO4 units in apical positions. Both types of ions form sheets parallel to (010. The interconnection within and between the sheets is reinforced by O—H...O and N—H...O hydrogen bonds, respectively, involving the water molecules, the two types of sulfate anions and the ammonium groups.

  11. Cobalt(II) fluorophosphate frameworks. (United States)

    Armstrong, Jennifer A; Williams, Edward R; Weller, Mark T


    Nine new cobalt fluorophosphates frameworks have been synthesised hydrothermally in a fluoride-rich medium, through the use of CoF(3) and HPF(6) as reactants in combination with Group I/II metal hydroxides and organic cations as templating species. Products have been structurally characterised using single crystal X-ray diffraction. Reaction in fluoride-rich conditions produces chain, layer and three dimensional framework structures containing new and unusual structural features based on the linking of PO(3)F, PO(2)(OH,F)(2) and Co(O,F)(n) polyhedra (n = 5-6) including μ(2), μ(3) and μ(4) bridging fluoride. Structures exhibiting inter-layer spaces and channels frequently have these lined by terminal fluoride anions of the PO(3)F, PO(2)(OH,F)(2) and Co(O,F)(n) polyhedra.

  12. Quantum mechanics II advanced topics

    CERN Document Server

    Rajasekar, S


    Quantum Mechanics II: Advanced Topics uses more than a decade of research and the authors’ own teaching experience to expound on some of the more advanced topics and current research in quantum mechanics. A follow-up to the authors introductory book Quantum Mechanics I: The Fundamentals, this book begins with a chapter on quantum field theory, and goes on to present basic principles, key features, and applications. It outlines recent quantum technologies and phenomena, and introduces growing topics of interest in quantum mechanics. The authors describe promising applications that include ghost imaging, detection of weak amplitude objects, entangled two-photon microscopy, detection of small displacements, lithography, metrology, and teleportation of optical images. They also present worked-out examples and provide numerous problems at the end of each chapter.

  13. CDF II integrated calorimetry environment

    CERN Document Server

    Dell'Agnello, S


    The Run IIa integrated calorimetry environment of CDF II comprises: sampling scintillator calorimeters, e.m. preshower and shower-maximum detectors (gas based in the central, scintillator based in the forward), crack-filler detectors, radioactive source calibration systems, light pulse calibration systems, dedicated triggers for critical low energy calibrations, new FEE, a Windows NT slow control system, the master online-offline Oracle Database and an online data validation framework, distilled over the previous years of CDF data taking (now based on the CERN Root). The preexisting central calorimeters are the bridge between the energy and time measurement of the past and current physics runs. New forward calorimeters (the "plugs"), built with the modern scintillating tile-fiber technique, replaced the old gas calorimeters. Together they form an integrated, general-purpose calorimetry system which has been successfully commissioned with the 2000-2001 collider data. The time measurement, before present only i...

  14. Adsorption of Ca(II, Mg(II, Zn(II, and Cd(II on Chitosan Membrane Blended with Rice Hull Ash Silica and Polyethylene Glycol

    Directory of Open Access Journals (Sweden)

    F. Widhi Mahatmanti


    Full Text Available In this research, chitosan based membrane blended with rice hull ash (RHA silica and polyethylene glycol (PEG has been applied as adsorbent of Ca(II, Mg(II, Zn(II and Cd(II in an aqueous solution. Membrane was synthesized by blending RHA silica and polyethylene glycol into chitosan. Silica and polyethylene glycol blended into the chitosan to improve the mechanical properties and the membrane porous. The membrane was characterized using Fourier Transform infrared (FTIR spectroscopy, X-Ray Diffraction (XRD, Scanning Electron Microscopy (SEM, and swelling degree analyzer. Adsorption of metal ions investigated was conducted in a batch system with variation of pH, initial ion concentration and contact time. Thermodynamics and kinetics of adsorption were evaluated based on the adsorption data at initial metal ion concentration and contact time variations, respectively. Results showed that the optimum condition of adsorption was at pH 9.0 for Ca(II, 6.0 for both Mg(II and Zn(II and 5.5 for Cd(II, and contact time of 24 h for all ions investigated. Kinetics of all investigated metal ion adsorption followed a kinetic model of pseudo-second-order. Adsorption of Ca(II and Mg(II on the membrane fitted to Freundlich model with the affinity of 1.266 and 1.099, respectively; and Zn(II and Cd(II fitted to Langmuir one with the capacity of 182 and 106 µmol/g, respectively.

  15. Oro-facial-digital syndrome type II. (United States)

    Kalyan, Meenakshi; Kanitkar, S; John, Robby; Gireesh, G; Bhate, Amit; Mithun, M


    Oro-facial-digital syndrome type II (OFD-II) is characterized by frenulated tongue, midline cleft lip, high arched or cleft palate, micrognathia, syndactyly and polydactyly, bilateral reduplicated hallux, conductive hearing loss, choroidal coloboma and normal intelligence. There are nine forms of oro-facial-digital syndromes with different modes of inheritance. A young female with features of oro-facio-digital syndrome type-II is being reported.

  16. ORF Sequence: cds [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cds gnl|CMER >gnl|CMER|CMP119C GTP cyclohydrolase II / 3,4-dihydroxy-2-butanone 4-phosphate synthase... (dhbp synthase) MFQCVPARVSWSVSGVHARRQLASNFLGRRNYFKIIGTMKNLSLMRGALAQSAGDGTAAERAPGATPAPAPAA

  17. Angiotensin II in Refractory Septic Shock. (United States)

    Antonucci, Elio; Gleeson, Patrick J; Annoni, Filippo; Agosta, Sara; Orlando, Sergio; Taccone, Fabio Silvio; Velissaris, Dimitrios; Scolletta, Sabino


    Refractory septic shock is defined as persistently low mean arterial blood pressure despite volume resuscitation and titrated vasopressors/inotropes in patients with a proven or suspected infection and concomitant organ dysfunction. Its management typically requires high doses of catecholamines, which can induce significant adverse effects such as ischemia and arrhythmias. Angiotensin II (Ang II), a key product of the renin-angiotensin-aldosterone system, is a vasopressor agent that could be used in conjunction with other vasopressors to stabilize critically ill patients during refractory septic shock, and reduce catecholamine requirements. However, very few clinical data are available to support Ang II administration in this setting. Here, we review the current literature on this topic to better understand the role of Ang II administration during refractory septic shock, differentiating experimental from clinical studies. We also consider the potential role of exogenous Ang II administration in specific organ dysfunction and possible pitfalls with Ang II in sepsis. Various issues remain unresolved and future studies should investigate important topics such as: the optimal dose and timing of Ang II administration, a comparison between Ang II and the other vasopressors (epinephrine; vasopressin), and Ang II effects on microcirculation.

  18. Probing outflows in z = 1 ∼ 2 galaxies through Fe II/Fe II* multiplets

    Energy Technology Data Exchange (ETDEWEB)

    Tang, Yuping; Giavalisco, Mauro [Department of Astronomy, University of Massachusetts, Amherst, MA 01003 (United States); Guo, Yicheng [UCO/Lick Observatory, Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Kurk, Jaron, E-mail: [Max-Planck-Institut für Extraterrestrial Physik, Gießenbachstrasse, D-85748 Garching bei München (Germany)


    We report on a study of the 2300-2600 Å Fe II/Fe II* multiplets in the rest-UV spectra of star-forming galaxies at 1.0 < z < 2.6 as probes of galactic-scale outflows. We extracted a mass-limited sample of 97 galaxies at z ∼ 1.0-2.6 from ultra-deep spectra obtained during the GMASS spectroscopic survey in the GOODS South field with the Very Large Telescope and FORS2. We obtain robust measures of the rest equivalent width of the Fe II absorption lines down to a limit of W{sub r} > 1.5 Å and of the Fe II* emission lines to W{sub r} > 0.5 Å. Whenever we can measure the systemic redshift of the galaxies from the [O II] emission line, we find that both the Fe II and Mg II absorption lines are blueshifted, indicating that both species trace gaseous outflows. We also find, however, that the Fe II gas has generally lower outflow velocity relative to that of Mg II. We investigate the variation of Fe II line profiles as a function of the radiative transfer properties of the lines, and find that transitions with higher oscillator strengths are more blueshifted in terms of both line centroids and line wings. We discuss the possibility that Fe II lines are suppressed by stellar absorptions. The lower velocities of the Fe II lines relative to the Mg II doublet, as well as the absence of spatially extended Fe II* emission in two-dimensional stacked spectra, suggest that most clouds responsible for Fe II absorption lie close (3 ∼ 4 kpc) to the disks of galaxies. We show that the Fe II/Fe II* multiplets offer unique probes of the kinematic structure of galactic outflows.

  19. Carbonic anhydrase isozymes IV and II in urinary membranes from carbonic anhydrase II-deficient patients

    Energy Technology Data Exchange (ETDEWEB)

    Sato, Seiji; Zhu, Xin L.; Sly, W.S. (Saint Louis Univ. School of Medicine, MO (USA))


    Carbonic anhydrase II (CA II) deficiency has been shown to be the primary defect in the recessively inherited syndrome of osteopetrosis with renal tubular acidosis. Until now, the absence of CA II in kidney of CA II-deficient patients has not been shown directly, and the status of the membrane-associated CA in kidney of CA II-deficient patients has been unclear. To address these questions, the authors analyzed urinary membranes and soluble fractions from normal and CA II-deficient subjects. The CA activity in membrane fractions of normal urine was found to comprise two components-(i) a vesicle-enclosed, sodium dodecyl sulfate (SDS)-sensitive fraction, which was shown immunochemically to be the 29-kDa CA II, and (ii) an SDS-resistant fraction, which was due to native and cleaved forms of the 35-kDa, membrane-anchored isozyme CA IV. Urinary membranes from CA II-deficient patients showed little or no SDS-sensitive activity and no immunoreactivity for CA II, providing direct evidence that their mutation, which produces CA II deficiency in erythrocytes, also affects CA II in kidney. CA IV activity and immunoreactivity were present in normal amounts in urinary membranes from CA II-deficient patients. They conclude from the enzymatic and immunological evidence presented that both CA II and CA IV are present in urinary membranes from normal subjects, that renal CA IV is present but renal CA II is absent in urinary membranes from patients with the CA II-deficiency syndrome, and that the methods presented should be useful in studying renal CA II and renal CA IV in other disorders of impaired bicarbonate reabsorption.

  20. A substituted sulfonamide and its Co (II), Cu (II), and Zn (II) complexes as potential antifungal agents. (United States)

    Diaz, Jorge R A; Fernández Baldo, Martín; Echeverría, Gustavo; Baldoni, Héctor; Vullo, Daniela; Soria, Delia B; Supuran, Claudiu T; Camí, Gerardo E


    A sulfonamide 1-tosyl-1-H-benzo(d)imidazol-2-amine (TBZA) and three new complexes of Co(II), Cu(II), and Zn(II) have been synthesized. The compounds have been characterized by elemental analyses, FTIR, 1 H, and 13 C-NMR spectroscopy. The structure of the TBZA, and its Co(II) and Cu(II) complexes, was determined by X-ray diffraction methods. TBZA and its Co(II) complex crystallize in the triclinic P-1 space group, while the Cu(II) complex crystallizes in the monoclinic P2 1 /c space group. Antifungal activity was screened against eight pathogenic yeasts: Candida albicans (DMic 972576), Candida krusei (DMic 951705), Candida glabrata (DMic 982882), Candida tropicalis (DMic 982884), Candida dubliniensis (DMic 93695), Candida guilliermondii (DMic 021150), Cryptococcus neoformans (ATCC 24067), and Cryptococcus gattii (ATCC MYA-4561). Results on the inhibition of various human (h) CAs, hCA I, II, IV, VII, IX, and XII, and pathogenic beta and gamma CAs are also reported.

  1. Early failure of Class II resin composite versus Class II amalgam restorations placed by dental students

    National Research Council Canada - National Science Library

    Overton, J D; Sullivan, Diane J


    Using the information from remake request slips in a dental school's predoctoral clinic, we examined the short-term survival of Class II resin composite restorations versus Class II dental amalgam restorations...

  2. FOREWORD: HELAS II International Conference (United States)

    Gizon, Laurent; Roth, Markus


    Volume 118 (2008) of Journal of Physics: Conference Series provides a written record of the talks and posters presented at the HELAS II International Conference `Helioseismology, Asteroseismology and MHD Connections'. The conference was held during the week 20-24 August 2007 in Göttingen, Germany, jointly hosted by the Max Planck Institute for Solar System Research and the Faculty of Physics of the University of Göttingen. A total of 140 scientists from all over the world attended. The Scientific Organizing Committee consisted of Conny Aerts, Annie Baglin, Jørgen Christensen-Dalsgaard, Thierry Corbard, Jadwiga Daszyńska-Daszkiewicz, Stefan Dreizler, Yvonne Elsworth, Laurent Gizon (Chairman), Wolfgang Glatzel, Frank Hill, Donald Kurtz, Oskar von der Lühe, Maria Pia Di Mauro, Mário Monteiro, Pere Pallé, Markus Roth, Philip Scherrer, Manfred Schüssler, and Michael Thompson. HELAS stands for the European Helio- and Asteroseismology Network, a Coordination Action supported by the sixth Framework Programme of the European Union. It aims to bring together researchers in the fields of solar and stellar oscillations. This volume consists of 91 articles organized into sections that reflect the scientific programme of the conference: 012001-07 Wave diagnostics in physics, geophysics and astrophysics 012008-09 Perspectives on helio- and asteroseismology 012010-17 Asteroseismology: Observations 012018-25 Asteroseismology: Theory 012026-32 Global helioseismology and solar models 012033-38 Local helioseismology and magnetic activity 012039-44 Future observational projects in helio- and asteroseismology 012045-91 Poster papers. The overwhelming majority of papers discuss the seismology of the Sun and stars. Papers in the first section provide a broader perspective on wave phenomena and techniques for probing other physical systems, from living beings to the universe as a whole. We were extremely fortunate to have particularly distinguished experts to cover these topics

  3. Cohesin regulates major histocompatibility complex class II genes through interactions with MHC-II insulators1 (United States)

    Majumder, Parimal; Boss, Jeremy M.


    Cohesin is a multiprotein ringed complex that is most well known for its role in stabilizing the association of sister chromatids between S phase and M. More recently cohesin was found to be associated with transcriptional insulators, elements that are associated with the organization of chromatin into regulatory domains. The human major histocompatibility complex class II (MHC-II) locuscontains ten intergenic elements, termed MHC-II insulators, which bind the transcriptional insulator protein CCCTC transcription factor (CTCF). MHC-II insulators interact with each other forming a base architecture of discrete loops and potential regulatory domains. When MHC-II genes are expressed, their proximal promoter regulatory regions reorganize to the foci established by the interacting MHC-II insulators. MHC-II insulators also bind cohesin, but the functional role of cohesin in regulating this system is not known. Here we show that the binding of cohesin to MHC-II insulators occurred irrespective of MHC-II expression but was required for optimal expression of the HLA-DR and HLA-DQ genes. In a DNA dependent manner, cohesin subunits interacted with CTCF and the MHC-II specific transcription factors RFX and CIITA. Intriguingly, cohesin subunits were important for DNA looping interactions between the HLA-DRA promoter region and a 5’ MHC-II insulator but were not required for interactions between the MHC-II insulators themselves. This latter observation introduces cohesin as a regulator of MHC-II expression by initiating or stabilizing MHC-II promoter regulatory element interactions with the MHC-II insulator elements; events which are required for maximal MHC-II transcription. PMID:21911605


    African Journals Online (AJOL)

    Preferred Customer

    0.1 M solutions of Co(II), Ni(II), Cu(II) and Zn(II) nitrates (GR, E-Merck, Germany) were prepared by maintaining 0.05 M acid (HNO3) concentration to suppress the hydrolysis. Acetonitrile (GR, E-Merck) and ethylene glycol (AR, Qualigen) were used as received. 2.0 M sodium nitrate solution was prepared to maintain ionic ...

  5. Mutation and biochemical analysis in carnitine palmitoyltransferase type II (CPT II) deficiency

    DEFF Research Database (Denmark)

    Olpin, S E; Afifi, A; Clark, S


    Carnitine palmitoyltransferase type II (CPT II) deficiency has three basic phenotypes, late-onset muscular (mild), infantile/juvenile hepatic (intermediate) and severe neonatal. We have measured fatty acid oxidation and CPT II activity and performed mutation studies in 24 symptomatic patients...

  6. Chemical speciation of L-glutamine complexes with Co(II), Ni(II) and ...

    African Journals Online (AJOL)

    The impact of cationic micelles on the protonation equilibria of L-glutamine and chemical speciation of its complexes with Co(II), Ni(II) and Cu(II) have been studied by monitoring hydrogen ion concentration pH metrically at 303 K and at an ionic strength of 0.16 M. The protonation constants and binary stability constants ...

  7. Biosorption of Cd(II) and Zn(II) by nostoc commune: isotherm and kinetics studies

    Energy Technology Data Exchange (ETDEWEB)

    Morsy, Fatthy M. [Faculty of Science, Botany Department, Assiut University, Assiut (Egypt); Hassan, Sedky H.A. [Department of Biological Environment, Kangwon National University, Kangwon-do (Korea, Republic of); Koutb, Mostafa [Faculty of Science, Botany Department, Assiut University, Assiut (Egypt); Umm Al-Qura University, Faculty of Applied Science, Biology Department, Mecca (Saudi Arabia)


    In this study, Nostoc commune (cyanobacterium) was used as an inexpensive and efficient biosorbent for Cd(II) and Zn(II) removal from aqueous solutions. The effect of various physicochemical factors on Cd(II) and Zn(II) biosorption such as pH 2.0-7.0, initial metal concentration 0.0-300 mg/L and contact time 0-120 min were studied. Optimum pH for removal of Cd(II) and Zn(II) was 6.0, while the contact time was 30 min at room temperature. The nature of biosorbent and metal ion interaction was evaluated by infrared (IR) technique. IR analysis of bacterial biomass revealed the presence of amino, carboxyl, hydroxyl, and carbonyl groups, which are responsible for biosorption of Cd(II) and Zn (II). The maximum biosorption capacities for Cd(II) and Zn(II) biosorption by N. commune calculated from Langmuir biosorption isotherm were 126.32 and 115.41 mg/g, respectively. The biosorption isotherm for two biosorbents fitted well with Freundlich isotherm than Langmuir model with correlation coefficient (r{sup 2} < 0.99). The biosorption kinetic data were fitted well with the pseudo-second-order kinetic model. Thus, this study indicated that the N. commune is an efficient biosorbent for the removal of Cd(II) and Zn(II) from aqueous solutions. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  8. Synthesis, spectroscopic and antimicrobial properties of Co(II), Ni (II ...

    African Journals Online (AJOL)

    The results suggest a 1:2 [M:L] stoichiometry for the copper and cobalt complexes and a 1:1 [M:L] ratio for the nickel complex. The electronic absorption spectral data support octahedral geometry for cobalt(II) and copper(II) complexes and square planar for nickel (II). In-vitro antimicrobial properties of the compounds ...

  9. TRUPACT-II procedures and maintenance instructions

    Energy Technology Data Exchange (ETDEWEB)



    The purpose of this document is to provide the technical requirements for operation, inspection and maintenance of a TRUPACT-II Shipping Package and directly related components. This document shall supply the minimum requirements as specified in the TRUPACT-II Safety Analysis Report for Packaging (SARP) and Certificate of Compliance (C of C) 9218. In the event there is a conflict between this document and the TRUPACT-II SARP (NRC Certificate of Compliance No. 9218), the TRUPACT-II SARP shall govern. This document details the operations, maintenance, repair, replacement of components, as well as the documentation required and the procedures to be followed to maintain the integrity of the TRUPACT-II container. These procedures may be modified for site use, but as a minimum all parameters and format listed herein must be included in any site modified version. For convenience and where applicable steps may be performed out of sequence. Packaging and payload handling equipment and transport trailers have been specifically designed for use with the TRUPACT-II Packaging. This document discusses the minimum required procedures for use of the adjustable center of gravity lift fixture and the TRUPACT-II transport trailer in conjunction with the TRUPACT-II Packaging.


    Skeggs, Leonard T.; Lentz, Kenneth E.; Kahn, Joseph R.; Shumway, Norman P.; Woods, Kenneth R.


    The amino acid sequence of horse hypertensin II has been determined by the use of chymotrypsin, the fluorodinitrobenzene method, and stepwise phenylisothiocyanate degradation. The results indicate that the amino acids of hypertensin II are arranged in the following order: asp-arg-val-tyr-iso-hist-pro-phe. PMID:13345964

  11. Metallothionein-I+II in neuroprotection

    DEFF Research Database (Denmark)

    Pedersen, Mie Ø; Jensen, Rikke; Pedersen, Dan S


    -I+II decrease inflammation and secondary tissue damage (oxidative stress, neurodegeneration, and apoptosis) and promote post-injury repair and regeneration (angiogenesis, neurogenesis, neuronal sprouting and tissue remodelling). Intracellularly the molecular MT-I+II actions involve metal ion control...

  12. Multi-Nuclear NMR Investigation of Nickel(II), Palladium(II), Platinum(II) and Ruthenium(II) Complexes of an Asymmetrical Ditertiary Phosphine

    Energy Technology Data Exchange (ETDEWEB)

    Raj, Joe Gerald Jesu [Institut National de la Recherche Scientifique, Quebec (China); Pathak, Devendra Deo [Indian School of Mines, Dhanbad (India); Kapoor, Pramesh N. [Univ. of Delhi, Delhi (India)


    Complexes synthesized by reacting alkyl and aryl phosphines with different transition metals are of great interest due to their catalytic properties. Many of the phosphine complexes are soluble in polar solvents as a result they find applications in homogeneous catalysis. In our present work we report, four transition metal complexes of Ni(II), Pd(II), Pt(II) and Ru(II) with an asymmetrical ditertiaryphosphine ligand. The synthesized ligand bears a less electronegative substituent such as methyl group on the aromatic nucleus hence makes it a strong σ-donor to form stable complexes and thus could effectively used in catalytic reactions. The complexes have been completely characterized by elemental analyses, FTIR, {sup 1}HNMR, {sup 31}PNMR and FAB Mass Spectrometry methods. Based on the spectroscopic evidences it has been confirmed that Ni(II), Pd(II) and Pt(II) complexes with the ditertiaryphosphine ligand showed cis whereas the Ru(II) complex showed trans geometry in their molecular structure.

  13. Present Status of the Experiment TGV II (United States)

    Štekl, I.; Čermák, P.; Beneš, P.; Brudanin, V. B.; Rukhadze, N. I.; Egorov, V. G.; Kovalenko, V. E.; Kovalík, A.; Salamatin, A. V.; Vylov, Ts.; Šimkovic, F.


    Present status of the experiment TGV II is given. The experiment TGV II is devoted to the measurement of double-beta decay of 106Cd and 48Ca. The new HPGe multi-detector TGV spectrometer has been constructed and installed in the Modane underground laboratory (in France). Preliminary results of the first background measurement are presented.

  14. Photocleavage of DNA by copper (II) complexes

    Indian Academy of Sciences (India)

    The chemistry of ternary and binary copper(II) complexes showing efficient visible lightinduced DNA cleavage activity is summarized in this article. The role of the metal in photo-induced DNA cleavage reactions is explored by designing complex molecules having a variety of ligands. Ternary copper(II) complexes with amino ...

  15. ATLAS Phase-II trigger upgrade

    CERN Document Server

    Sankey, Dave; The ATLAS collaboration


    This talk for ACES summarises the current status of the ATLAS Phase-II trigger upgrade, describing and comparing the two architectures under consideration, namely the two hardware level system described in the Phase-II Upgrade Scoping Document and the more recent single hardware level system.

  16. DART II documentation. Volume III. Appendices

    Energy Technology Data Exchange (ETDEWEB)


    The DART II is a remote, interactive, microprocessor-based data acquistion system suitable for use with air monitors. This volume of DART II documentation contains the following appendixes: adjustment and calibration procedures; mother board signature list; schematic diagrams; device specification sheets; ROM program listing; 6800 microprocessor instruction list, octal listing; and cable lists. (RWR)

  17. The PM3 beamline at BESSY II

    Directory of Open Access Journals (Sweden)

    Torsten Kachel


    Full Text Available PM3 merges the developments of the former BESSY I SX700 III monochromator for elliptically polarized VUV radiation and of BESSY II collimated plane grating monochromators. This way it is possible to achieve circular polarization from a BESSY II dipole in the range 20 – 2000 eV with high photon flux, high energy resolution and high stability.

  18. metal complexes of copper(ii)

    African Journals Online (AJOL)

    Zinc(II) complex is diamagnetic. The cobalt(II) complex was found with paramagnetic character (4.11 B.M.). Also, in the FT-IR spectra of oligomer-metal complexes, there was no evidence associated with coordinated water molecules. Because this band generally was observed at 3700-3500 cm-1 region as a broad band.

  19. Copper(II) complexes with aroylhydrazones

    Indian Academy of Sciences (India)


    The coordination chemistry of copper(II) with tridentate aroylhydrazones is briefly discussed in this article. ... the metal ions 3. In the following account, the results obtained in our study on copper(II) chemistry with these ..... Rev.77165;. (b) Fenton D E 1983 Advances in inorganic and bio-organic mechanisms (ed.) A G Sykes.

  20. Obesity may impair lactogenesis II. (United States)

    Rasmussen, K M; Hilson, J A; Kjolhede, C L


    Data from livestock species and experimental animal models suggest that excess body fatness may impair lactogenesis. For example, it has long been known that overfed dairy cows are at risk of fat cow syndrome, a condition characterized by lactation failure in the early postpartum period. Obese rats often lose their litters in the early postpartum period to primary lactation failure. A negative association between high body mass index (BMI) before conception and the duration of lactation has been documented in studies from diverse human populations. Findings from our laboratory establish that among women who ever attempted to breastfeed their infants, high BMI before conception was also associated with failure to initiate breastfeeding successfully. In a more recent study, we found that high prepregnant BMI was specifically associated with later onset of lactogenesis II. This was mediated by parity but not by breastfeeding behavior. Psychosocial factors related to a woman's intention to breastfeed and her planned duration of breastfeeding did not modify this association. Taken together, these findings in animals and women strongly suggest that maternal obesity in the perinatal period is a cause of delayed lactogenesis.

  1. Aspects of differential geometry II

    CERN Document Server

    Gilkey, Peter


    Differential Geometry is a wide field. We have chosen to concentrate upon certain aspects that are appropriate for an introduction to the subject; we have not attempted an encyclopedic treatment. Book II deals with more advanced material than Book I and is aimed at the graduate level. Chapter 4 deals with additional topics in Riemannian geometry. Properties of real analytic curves given by a single ODE and of surfaces given by a pair of ODEs are studied, and the volume of geodesic balls is treated. An introduction to both holomorphic and Kähler geometry is given. In Chapter 5, the basic properties of de Rham cohomology are discussed, the Hodge Decomposition Theorem, Poincaré duality, and the Künneth formula are proved, and a brief introduction to the theory of characteristic classes is given. In Chapter 6, Lie groups and Lie algebras are dealt with. The exponential map, the classical groups, and geodesics in the context of a bi-invariant metric are discussed. The de Rham cohomology of compact Lie groups an...

  2. MHC Class II epitope predictive algorithms

    DEFF Research Database (Denmark)

    Nielsen, Morten; Lund, Ole; Buus, S


    Major histocompatibility complex class II (MHC-II) molecules sample peptides from the extracellular space, allowing the immune system to detect the presence of foreign microbes from this compartment. To be able to predict the immune response to given pathogens, a number of methods have been...... developed to predict peptide-MHC binding. However, few methods other than the pioneering TEPITOPE/ProPred method have been developed for MHC-II. Despite recent progress in method development, the predictive performance for MHC-II remains significantly lower than what can be obtained for MHC-I. One reason...... in the predictions. All attempts to make ab initio predictions based on protein structure have failed to reach predictive performances similar to those that can be obtained by data-driven methods. Thousands of different MHC-II alleles exist in humans. Recently developed pan-specific methods have been able to make...

  3. Aldosterone response to angiotensin II during hypoxemia

    Energy Technology Data Exchange (ETDEWEB)

    Colice, G.L.; Ramirez, G.


    Exercise stimulates the renin-angiotensin-aldosterone system (RAAS). However, increases in plasma aldosterone concentrations (PAC) are suppressed when exercise is performed at high altitude or under hypoxemic conditions. As the angiotensin-II response to high-altitude exercise is normal, it is speculated that an inhibitor, discharged during hypoxemia, acted to suppress angiotensin-II-mediated aldosterone release. A study was conducted to test this hypothesis, taking into account the measurement of the aldosterone response to exogenous angiotensin II during normoxemia and hypoxemia. It was found that the dose-response curve of PAC to angiotensin II was not significantly inhibited by the considered model of hypoxemia. The hypoxemia-mediated release of an angiotensin II inhibitor does, therefore, not explain the previous observations of PAC suppression during hypoxemic exercise. 28 references.

  4. Equilibrium and kinetic studies of Pb(II, Cd(II and Zn(II sorption by Lagenaria vulgaris shell

    Directory of Open Access Journals (Sweden)

    Mitić-Stojanović Dragana-Linda


    Full Text Available The sorption of lead, cadmium and zinc ions from aqueous solution by Lagenaria vulgaris shell biosorbent (LVB in batch system was investigated. The effect of relevant parameters such as contact time, biosorbent dosage and initial metal ions concentration was evaluated. The Pb(II, Cd(II and Zn(II sorption equilibrium (when 98% of initial metal ions were sorbed was attained within 15, 20 and 25 min, respectively. The pseudo first, pseudo-second order, Chrastil’s and intra-particle diffusion models were used to describe the kinetic data. The experimental data fitted the pseudo-second order kinetic model and intra-particle diffusion model. Removal efficiency of lead(II, cadmium(II and zinc(II ions rapidly increased with increasing biosorbent dose from 0.5 to 8.0 g dm-3. Optimal biosorbent dose was set to 4.0 g dm-3. An increase in the initial metal concentration increases the sorption capacity. The sorption data of investigated metal ions are fitted to Langmuir, Freundlich and Temkin isotherm models. Langmuir model best fitted the equilibrium data (r2 > 0.99. Maximal sorption capacities of LVB for Pb(II, Cd(II and Zn(II at 25.0±0.5°C were 0.130, 0.103 and 0.098 mM g-1, respectively. The desorption experiments showed that the LVB could be reused for six cycles with a minimum loss of the initial sorption capacity.

  5. Early failure of Class II resin composite versus Class II amalgam restorations placed by dental students. (United States)

    Overton, J D; Sullivan, Diane J


    Using the information from remake request slips in a dental school's predoctoral clinic, we examined the short-term survival of Class II resin composite restorations versus Class II dental amalgam restorations. In the student clinic, resin composite is used in approximately 58 percent of Class II restorations placed, and dental amalgam is used in the remaining 42 percent. In the period examined, Class II resin composite restorations were ten times more likely to be replaced at no cost to the patient than Class II dental amalgam restorations. A total of eighty-four resin composite restorations and six amalgam restorations were replaced due to an identified failure.


    Directory of Open Access Journals (Sweden)

    A. S. Truba


    Full Text Available First, the complexes MCl2*HTMA*xH2O/SiO2 (M = Cu(II, Co(II, Mn(II with hexa-methylenetetramine (HMTA molecule weakly bound with a central M atom (CM ranging from 5.010-7 to 5.010-6 mol/g have been found to catalyse the ozone decomposition. Their activity and turnover number exceeded much those for MCl2*хН2О/ SiO2 acido complexes

  7. Unsaturated b-ketoesters and their Ni(II, Cu(II and Zn(II complexes

    Directory of Open Access Journals (Sweden)



    Full Text Available A new series of b-ketoesters in which the keto group is attached to the olefinic linkage were synthesized by the reaction of methyl acetoacetate and aromatic aldehydes under specified conditions. The existence of these compounds predominantly in the intramolecularly hydrogen bonded enol form was well demonstrated from their IR, 1H-NMR and mass spectral data. Details on the formation of their [ML2] complexes with Ni(II, Cu(II and Zn(II and the nature of the bonding are discussed on the basis of analytical and spectral data.

  8. Carlos II: el centenario olvidado

    Directory of Open Access Journals (Sweden)

    Luis Antonio RIBOT GARCÍA


    Full Text Available RESUMEN: A partir de una reflexión inicial sobre el fenómeno de las conmemoraciones, el autor se plantea las causas por las que el tercer centenario de la muerte de Carlos II no dará lugar a ninguna conmemoración. Con independencia de las valoraciones de todo tipo que puedan hacerse de dichas celebraciones, lo cierto es que, en este caso, tal vez hubieran permitido acercar al gran público a uno de los monarcas peor conocidos y menos valorados de la historia de España. Lo más grave, sin embargo, es que la sombra del desconocimiento y el juicio peyorativo se extienden también sobre todo su reinado. Las investigaciones sobre aquel periodo, sin embargo, a pesar de que no abundan, muestran una realidad bastante distinta, en la que la decadencia y la pérdida de la hegemonía internacional convivieron con importantes iniciativas y realizaciones políticas, tanto en el ámbito interno de la Monarquía, como en las relaciones internacionales.ABSTRACT: Parting from an initial reflection about the phenomenon of commemorations, the author ponders the causes for which the third centenary of Charles IFs death will not be the subjet of any celebrations. Besides any evaluations which might be made of these events, the truth is that, perhaps, in this case, a commemoration would have brought the general public closer to one of the least known and worst valued monarchs in the history of Spain. What is more serious, however, is the fact that the shadow of ignorance and pejorative judgement extend also over the entirety of his reign. Though scarce, research about this period shows a very different reality, in wich decadence and the loss of international hegemony cohabitated with important political initiatives and achievements, both in the monarchy's internal domain and in the international arena.

  9. TFOS DEWS II pathophysiology report. (United States)

    Bron, Anthony J; de Paiva, Cintia S; Chauhan, Sunil K; Bonini, Stefano; Gabison, Eric E; Jain, Sandeep; Knop, Erich; Markoulli, Maria; Ogawa, Yoko; Perez, Victor; Uchino, Yuichi; Yokoi, Norihiko; Zoukhri, Driss; Sullivan, David A


    The TFOS DEWS II Pathophysiology Subcommittee reviewed the mechanisms involved in the initiation and perpetuation of dry eye disease. Its central mechanism is evaporative water loss leading to hyperosmolar tissue damage. Research in human disease and in animal models has shown that this, either directly or by inducing inflammation, causes a loss of both epithelial and goblet cells. The consequent decrease in surface wettability leads to early tear film breakup and amplifies hyperosmolarity via a Vicious Circle. Pain in dry eye is caused by tear hyperosmolarity, loss of lubrication, inflammatory mediators and neurosensory factors, while visual symptoms arise from tear and ocular surface irregularity. Increased friction targets damage to the lids and ocular surface, resulting in characteristic punctate epithelial keratitis, superior limbic keratoconjunctivitis, filamentary keratitis, lid parallel conjunctival folds, and lid wiper epitheliopathy. Hybrid dry eye disease, with features of both aqueous deficiency and increased evaporation, is common and efforts should be made to determine the relative contribution of each form to the total picture. To this end, practical methods are needed to measure tear evaporation in the clinic, and similarly, methods are needed to measure osmolarity at the tissue level across the ocular surface, to better determine the severity of dry eye. Areas for future research include the role of genetic mechanisms in non-Sjögren syndrome dry eye, the targeting of the terminal duct in meibomian gland disease and the influence of gaze dynamics and the closed eye state on tear stability and ocular surface inflammation. Copyright © 2017 Elsevier Inc. All rights reserved.

  10. Poised RNA polymerase II gives pause for thought. (United States)

    Margaritis, Thanasis; Holstege, Frank C P


    Transcription by RNA polymerase II (Pol II) is thought to be predominantly regulated by recruitment of Pol II to promoters. Recent genome-wide analyses demonstrate that many genes are in fact regulated after recruitment of Pol II, by mechanisms such as pausing of Pol II proximal to promoters.

  11. Determination of activities of human carbonic anhydrase II inhibitors ...

    African Journals Online (AJOL)

    Purpose: To evaluate the activities of new curcumin analogs as carbonic anhydrase II (CA-II) inhibitor. Methods: Carbonic anhydrase II (CA-II) inhibition was determined by each ligand capability to inhibit the esterase activity of CA-II using 4-NPA as a substrate in 96-well plates. Dimethyl sulfoxide was used to dissolve each ...

  12. Synthesis, characterization and biological activities of Cu(II), Co(II), Mn(II), Fe(II), and UO2(VI) complexes with a new Schiff Base hydrazone: O-hydroxyacetophenone-7-chloro-4-quinoline hydrazone

    National Research Council Canada - National Science Library

    Al-Shaalan, Nora H


    .... This was accounted for be the presence in the ligand of a phenolic azomethine and imine groups. It reacts with Cu(II), Ni(II), Co(II), Mn(II), UO(2) (VI) and Fe(II) to form either mono- or binuclear complexes...

  13. [O II] nebular emission from Mg II absorbers: star formation associated with the absorbing gas (United States)

    Joshi, Ravi; Srianand, Raghunathan; Petitjean, Patrick; Noterdaeme, Pasquier


    We present nebular emission associated with 198 strong Mg II absorbers at 0.35 ≤z ≤ 1.1 in the fibre spectra of quasars from the Sloan Digital Sky Survey. Measured [O II] luminosities (L_[O II]) are typical of sub-L⋆ galaxies with derived star formation rate (uncorrected for fibre losses and dust reddening) in the range of 0.5-20 M⊙ yr-1. Typically less than ∼3 per cent of the Mg II systems with rest equivalent width, W2796≥2Å, show L_[O II] ≥0.3 L^{\\star }_[O II]. The detection rate is found to increase with increasing W2796 and z. No significant correlation is found between W2796 and L_[O II] even when we restrict the samples to narrow z ranges. A strong correlation is seen between L_[O II] and z. While this is expected from the luminosity evolution of galaxies, we show that finite fibre size plays a very crucial role in this correlation. The measured nebular line ratios (like [O III]/[O II] and [O III]/H β) and their z evolution are consistent with those of galaxies detected in deep surveys. Based on the median stacked spectra, we infer the average metallicity (log Z ∼8.3), ionization parameter (log q∼7.5) and stellar mass (log (M/M⊙) ∼ 9.3). The Mg II systems with nebular emission typically have W2796 ≥2 Å, Mg II doublet ratio close to 1 and W(Fe II λ2600)/W2796∼0.5 as often seen in damped Ly α and 21-cm absorbers at these redshifts. This is the biggest reported sample of [O II] emission from Mg II absorbers at low-impact parameters ideally suited for probing various feedback processes at play in z ≤ 1 galaxies.

  14. Use of APACHE II and SAPS II to predict mortality for hemorrhagic and ischemic stroke patients. (United States)

    Moon, Byeong Hoo; Park, Sang Kyu; Jang, Dong Kyu; Jang, Kyoung Sool; Kim, Jong Tae; Han, Yong Min


    We studied the applicability of the Acute Physiology and Chronic Health Evaluation II (APACHE II) and Simplified Acute Physiology Score II (SAPS II) in patients admitted to the intensive care unit (ICU) with acute stroke and compared the results with the Glasgow Coma Scale (GCS) and National Institutes of Health Stroke Scale (NIHSS). We also conducted a comparative study of accuracy for predicting hemorrhagic and ischemic stroke mortality. Between January 2011 and December 2012, ischemic or hemorrhagic stroke patients admitted to the ICU were included in the study. APACHE II and SAPS II-predicted mortalities were compared using a calibration curve, the Hosmer-Lemeshow goodness-of-fit test, and the receiver operating characteristic (ROC) curve, and the results were compared with the GCS and NIHSS. Overall 498 patients were included in this study. The observed mortality was 26.3%, whereas APACHE II and SAPS II-predicted mortalities were 35.12% and 35.34%, respectively. The mean GCS and NIHSS scores were 9.43 and 21.63, respectively. The calibration curve was close to the line of perfect prediction. The ROC curve showed a slightly better prediction of mortality for APACHE II in hemorrhagic stroke patients and SAPS II in ischemic stroke patients. The GCS and NIHSS were inferior in predicting mortality in both patient groups. Although both the APACHE II and SAPS II systems can be used to measure performance in the neurosurgical ICU setting, the accuracy of APACHE II in hemorrhagic stroke patients and SAPS II in ischemic stroke patients was superior. Copyright © 2014 Elsevier Ltd. All rights reserved.

  15. Dinuclear Metallacycles with Single M-X-M Bridges (X = Cl-, Br-; M = Fe(II), Co(II), Ni(II), Cu(II), Zn(II), Cd(II)): Strong Antiferromagnetic Superexchange Interactions. (United States)

    Reger, Daniel L; Pascui, Andrea E; Foley, Elizabeth A; Smith, Mark D; Jezierska, Julia; Wojciechowska, Agnieszka; Stoian, Sebastian A; Ozarowski, Andrew


    A series of monochloride-bridged, dinuclear metallacycles of the general formula [M2(μ-Cl)(μ-L)2](ClO4)3 have been prepared using the third-generation, ditopic bis(pyrazolyl)methane ligands L = m-bis[bis(1-pyrazolyl)methyl]benzene (Lm), M = Cu(II), Zn(II), and L = m-bis[bis(3,5-dimethyl-1-pyrazolyl)methyl]benzene (Lm*), M = Fe(II), Co(II), Ni(II), Cu(II), Zn(II), Cd(II). These complexes were synthesized from the direct reactions of M(ClO4)2·6H2O, MCl2, and the ligand, Lm or Lm*, in the appropriate stoichiometric amounts. Three analogous complexes of the formula [M2(μ-Cl)(μ-L)2](BF4)3, L = Lm, M = Cu(II), and L = Lm*, M = Co(II), Cu(II), were prepared from the reaction of [M2(μ-F)(μ-L)2](BF4)3 and (CH3)3SiCl. The bromide-bridged complex [Cu2(μ-Br)(μ-Lm*)2](ClO4)3 was prepared by the first method. Three acyclic complexes, [Co2(μ-Lm)μ-Cl4], [Co2(μ-Lm*)Cl4], and [Co2(μ-Lm*)Br4], were also prepared. The structures of all [M2(μ-X)(μ-L)2]3+ (X = Cl-, Br-) complexes have two ditopic bis(pyrazolyl)methane ligands bridging two metals in a metallacyclic arrangement. The fifth coordination site of the distorted trigonal bipyramidal metal centers is filled by a bridging halide ligand that has an unusual linear or nearly linear M-X-M angle. The NMR spectra of [Zn2(μ-Cl)(μ-Lm*)2](ClO4)3 and especially [Cd2(μ-Cl)(μ-Lm*)2](ClO4)3 demonstrate that the metallacycle structure is maintained in solution. Solid state magnetic susceptibility data for the copper(II) compounds show very strong antiferromagnetic exchange interactions, with -J values of 536 cm-1 for [Cu2(μ-Cl)(μ-Lm)2](ClO4)3·xCH3CN, 720 cm-1 for [Cu2(μ-Cl)(μ-Lm*)2](ClO4)3, and 945 cm-1 for [Cu2(μ-Br)(μ-Lm*)2](ClO4)3·2CH3CN. Smaller but still substantial antiferromagnetic interactions are observed with other first row transition metals, with -J values of 98 cm-1 for [Ni2(μ-Cl)(μ-Lm*)2](ClO4)3, 55 cm-1 for [Co2(μ-Cl)(μ-Lm*)2](ClO4)3, and 34 cm-1 for [Fe2(μ-Cl)(μ-Lm*)2](ClO4)3. EPR spectra of [Cu

  16. Synthesis, characterization and cytotoxicity of mixed ligand Mn(II, Co(II and Ni(II complexes

    Directory of Open Access Journals (Sweden)

    Osman Souad A.


    Full Text Available Complexes of the type [ML'L(OH(H2O] {where M= Ni(II, Co(II or Mn(II, L'= isatin and HL= 3-(2-phenylhydrazonoacetylacetone, 3-(2-(4-chlorophenylhydrazonoacetylacetone or 3-(2-(4-bromophenylhydrazono-acetylacetone} have been synthesized by equimolar reaction of a metal(II chloride with isatin and 3-(2-(arylhydrazonoacetylacetone. The resulting complexes have been characterized by elemental analyses, molar conductivity, spectral data (IR, 1H NMR, mass and magnetic moments. Furthermore, the ligands and their metal complexes have been screened for their cytotoxicity against different human cancer cell lines by using SRB assay. The results showed that most of the mixed ligand metal complexes have high cytotoxicity in comparison with the reference drugs used.

  17. Processing of angiotensin II (A-II) and (Sar1,Ala8)A-II by cultured bovine adrenocortical cells. (United States)

    Crozat, A; Penhoat, A; Saez, J M


    Bovine adrenocortical cells, cultured in a chemically defined medium, were used to study the fate of [125I] iodoangiotensin II ([125I]iodo-A-II) and its antagonist (Sar1,Ala8)A-II ([125I]iodo-Saralasin). The binding of both ligands was time and temperature dependent. The maximum specific binding at 37 C, which was reached within 1 h, was followed by a decline with a half-life of about 2 h and 8 h for [125I]iodo-A-II and [125I]iodo-Saralasin, respectively. The decrease of the specific binding was parallel to the appearance in the medium of degraded ligand. At 4 C, the binding of [125I]iodo-A-II was stable for 12 h and no degradation of ligand occurred. Under several experimental conditions, about 70% of the total [125I]iodo-A-II bound was internalized, whereas, in the case of [125I]iodo-Saralasin, less than 25% of the total bound ligand was internalized. These differences in the binding kinetics between A-II and its antagonist were mainly the differences in the rate of internalization of the bound ligands, more rapid for [125I]iodo-A-II (t1/2 approximately equal to 10 min) than for [125I]iodo-Saralasin (t1/2 = 90 min). On the other hand, the rate of degradation of internalized ligand was similar for both ligands (t1/2 = 15 min). Ionophore monensin enhanced the total cellular uptake of both ligands by increasing the amount of internalized ligands. Monensin did not modify the rate of internalization of the two ligands but markedly decreased their rate of degradation (t1/2 approximately equal to 60 min). These results indicate that both A-II and its antagonist are internalized and degraded by adrenocortical cells, but the rate of internalization of the antagonist is lower than that of the agonist. They also show that receptor-mediated endocytosis is the main pathway by which A-II is rapidly degraded by adrenocortical cells. Since A-II receptors are present in many tissues, the receptor-mediated degradation could explain the very short half-life in plasma of this

  18. Level II Ergonomic Analyses, Dover AFB, DE (United States)


    IERA-RS-BR-TR-1999-0002 UNITED STATES AIR FORCE IERA Level II Ergonomie Analyses, Dover AFB, DE Andrew Marcotte Marilyn Joyce The Joyce...Project (070401881, Washington, DC 20503. 1. AGENCY USE ONLY (Leave blank) 2. REPORT DATE 4. TITLE AND SUBTITLE Level II Ergonomie Analyses, Dover...1.0 INTRODUCTION 1-1 1.1 Purpose Of The Level II Ergonomie Analyses : 1-1 1.2 Approach 1-1 1.2.1 Initial Shop Selection and Administration of the

  19. Phase II clinical development of new drugs

    CERN Document Server

    Ting, Naitee; Ho, Shuyen; Cappelleri, Joseph C


    This book focuses on how to appropriately plan and develop a Phase II program, and how to design Phase II clinical trials and analyze their data. It provides a comprehensive overview of the entire drug development process and highlights key questions that need to be addressed for the successful execution of Phase II, so as to increase its success in Phase III and for drug approval. Lastly it warns project team members of the common potential pitfalls and offers tips on how to avoid them.

  20. CAPPS II: the foundation of aviation security? (United States)

    Barnett, Arnold


    A new computer system is being developed to classify U.S. air travelers by the degree of terrorist threat they might pose. Reports indicate that the system--called CAPPS II--would use large amounts of information about each passenger, perhaps including such personal details as his or her magazine-subscription behavior. We argue that what is publicly known about CAPPS II raises questions about how substantially the system would improve aviation security. We discuss conditions under which CAPPS II could yield safety benefits, but suggest that it might be more prudent to view the system as one component of future security arrangements rather than the centerpiece of these arrangements.

  1. Angiotensin II and Renal Tubular Ion Transport

    Directory of Open Access Journals (Sweden)

    Patricia Valles


    Evidence for the regulation of H+-ATPase activity in vivo and in vitro by trafficking/exocytosis has been provided. An additional level of H+-ATPase regulation via protein synthesis may be important as well. Recently, we have shown that both aldosterone and angiotensin II provide such a mechanism of regulation in vivo at the level of the medullary collecting tubule. Interestingly, in this part of the nephron, the effects of aldosterone and angiotensin II are not sodium dependent, whereas in the cortical collecting duct, both aldosterone and angiotensin II, by contrast, affect H+ secretion by sodium-dependent mechanisms.

  2. LHC II system sensitivity to magnetic fluids

    CERN Document Server

    Cotae, Vlad


    Experiments have been designed to reveal the influences of ferrofluid treatment and static magnetic field exposure on the photosynthetic system II, where the light harvesting complex (LHC II) controls the ratio chlorophyll a/ chlorophyll b (revealing, indirectly, the photosynthesis rate). Spectrophotometric measurement of chlorophyll content revealed different influences for relatively low ferrofluid concentrations (10-30 mul/l) in comparison to higher concentrations (70-100 mul/l). The overlapped effect of the static magnetic field shaped better the stimulatory ferrofluid action on LHC II system in young poppy plantlets.

  3. Synthesis, spectral characterization thermal stability, antimicrobial studies and biodegradation of starch–thiourea based biodegradable polymeric ligand and its coordination complexes with [Mn(II, Co(II, Ni(II, Cu(II, and Zn(II] metals

    Directory of Open Access Journals (Sweden)

    Nahid Nishat


    Full Text Available A biodegradable polymer was synthesized by the modification reaction of polymeric starch with thiourea which is further modified by transition metals, Mn(II, Co(II, Ni(II, Cu(II and Zn(II. All the polymeric compounds were characterized by (FT-IR spectroscopy, 1H NMR spectroscopy, 13C NMR spectroscopy, UV–visible spectra, magnetic moment measurements, thermogravimetric analysis (TGA and antibacterial activities. Polymer complexes of Mn(II, Co(II and Ni(II show octahedral geometry, while polymer complexes of Cu(II and Zn(II show square planar and tetrahedral geometry, respectively. The TGA revealed that all the polymer metal complexes are more thermally stable than their parental ligand. In addition, biodegradable studies of all the polymeric compounds were also carried out through ASTM-D-5338-93 standards of biodegradable polymers by CO2 evolution method which says that coordination decreases biodegradability. The antibacterial activity was screened with the agar well diffusion method against some selected microorganisms. Among all the complexes, the antibacterial activity of the Cu(II polymer–metal complex showed the highest zone of inhibition because of its higher stability constant.

  4. Antiviral Activity of Substituted Chalcones and their Respective Cu(ii, Ni(ii and Zn(ii Complexes

    Directory of Open Access Journals (Sweden)

    K. G. Mallikarjun


    Full Text Available Complexes of Cu(II, Ni(II and Zn(II with of 3-(phenyl-1-(2’-hydroxynaphthyl – 2 – propen – 1 – one (PHPO , 3 - (4-chlorophenyl - 1- (2’-hydroxynaphthyl–2–propen – 1 – one (CPHPO, 3 - (4 -methoxyphenyl -1-(2’-hydroxynapthyl-2-propen-1-one(MPHPO,3 - (3,4-dimethoxyphenyl –1-(2’-hydroxynaphthyl – 2 - propen– 1 – one (DMPHPO have been prepared and the purity of the samples were checked by elemental analysis. The ligands and their Cu(II, Ni(II and Zn(II complexes were tested on the infectivity of tobacco ring spot virus(TRSV using cowpea (Vigna Sinensis as a local lesions assay host. All the compounds were tested at different concentrations (250 ppm to 1500 ppmon the infectivity of the virus by applying them either with virus inoculum or 24 h before of after virus inoculation to the test plants. The compounds were found to have varied effects on virus infectivity depending on compounds concentration and method of application. The statistical significance of the data was determined by using analysis of variance.

  5. Copper(II), cobalt(II) and nickel(II) complexes of juglone: synthesis, structure, DNA interaction and enhanced cytotoxicity. (United States)

    Tabrizi, Leila; Fooladivanda, Mahrokh; Chiniforoshan, Hossein


    Three novel copper(II), cobalt(II), and nickel(II) complexes of juglone (Jug) containing 1,10-phenanthroline (phen) ligand, [M(Jug) 2 (phen)] (M = Cu(II), 1, Co(II), 2, and Ni(II), 3), have been synthesized and characterized using, elemental analysis and spectroscopic studies. Their interactions with calf thymus DNA were investigated using viscosity measurements, UV-visible and fluorescence spectrophotometric methods. The catalytic activities on DNA cleavage of the complexes 1-3 were studied, which copper complex 1 showed better catalyst activity in the DNA cleavage process than complexes 2 and 3. The in vitro cytotoxic potential of the complexes 1-3 against human cervical carcinoma (HeLa), human liver hepatocellular carcinoma (HepG-2), and human colorectal adenocarcinoma (HT-29) cells indicated their promising antitumor activity with quite low IC 50 values in the range of 0.09-1.89 μM, which are 75 times lower than those of cisplatin.

  6. Pecan nutshell as biosorbent to remove Cu(II), Mn(II) and Pb(II) from aqueous solutions. (United States)

    Vaghetti, Julio C P; Lima, Eder C; Royer, Betina; da Cunha, Bruna M; Cardoso, Natali F; Brasil, Jorge L; Dias, Silvio L P


    In the present study we reported for the first time the feasibility of pecan nutshell (PNS, Carya illinoensis) as an alternative biosorbent to remove Cu(II), Mn(II) and Pb(II) metallic ions from aqueous solutions. The ability of PNS to remove the metallic ions was investigated by using batch biosorption procedure. The effects such as, pH, biosorbent dosage on the adsorption capacities of PNS were studied. Four kinetic models were tested, being the adsorption kinetics better fitted to fractionary-order kinetic model. Besides that, the kinetic data were also fitted to intra-particle diffusion model, presenting three linear regions, indicating that the kinetics of adsorption should follow multiple sorption rates. The equilibrium data were fitted to Langmuir, Freundlich, Sips and Redlich-Peterson isotherm models. Taking into account a statistical error function, the data were best fitted to Sips isotherm model. The maximum biosorption capacities of PNS were 1.35, 1.78 and 0.946mmolg(-1) for Cu(II), Mn(II) and Pb(II), respectively.

  7. Kinetics of homogeneous and surface-catalyzed mercury(II) reduction by iron(II) (United States)

    Amirbahman, Aria; Kent, Douglas B.; Curtis, Gary P.; Marvin-DiPasquale, Mark C.


    Production of elemental mercury, Hg(0), via Hg(II) reduction is an important pathway that should be considered when studying Hg fate in environment. We conducted a kinetic study of abiotic homogeneous and surface-catalyzed Hg(0) production by Fe(II) under dark anoxic conditions. Hg(0) production rate, from initial 50 pM Hg(II) concentration, increased with increasing pH (5.5–8.1) and aqueous Fe(II) concentration (0.1–1 mM). The homogeneous rate was best described by the expression, rhom = khom [FeOH+] [Hg(OH)2]; khom = 7.19 × 10+3 L (mol min)−1. Compared to the homogeneous case, goethite (α-FeOOH) and hematite (α-Fe2O3) increased and γ-alumina (γ-Al2O3) decreased the Hg(0) production rate. Heterogeneous Hg(0) production rates were well described by a model incorporating equilibrium Fe(II) adsorption, rate-limited Hg(II) reduction by dissolved and adsorbed Fe(II), and rate-limited Hg(II) adsorption. Equilibrium Fe(II) adsorption was described using a surface complexation model calibrated with previously published experimental data. The Hg(0) production rate was well described by the expression rhet = khet [>SOFe(II)] [Hg(OH)2], where >SOFe(II) is the total adsorbed Fe(II) concentration; khet values were 5.36 × 10+3, 4.69 × 10+3, and 1.08 × 10+2 L (mol min)−1 for hematite, goethite, and γ-alumina, respectively. Hg(0) production coupled to reduction by Fe(II) may be an important process to consider in ecosystem Hg studies.

  8. Comparison of APACHE II and SAPS II Scoring Systems in Prediction of Critically Ill Patients' Outcome. (United States)

    Aminiahidashti, Hamed; Bozorgi, Farzad; Montazer, Seyyed Hosein; Baboli, Majid; Firouzian, Abolfazl


    Using physiologic scoring systems for identifying high-risk patients for mortality has been considered recently. This study was designed to evaluate the values of Acute Physiology and Chronic Health Evaluation II (APACHE II) and Simplified Acute Physiologic Score (SAPS II) models in prediction of 1-month mortality of critically ill patients. The present prospective cross sectional study was performed on critically ill patients presented to emergency department during 6 months. Data required for calculation of the scores were gathered and performance of the models in prediction of 1-month mortality were assessed using STATA software 11.0. 82 critically ill patients with the mean age of 53.45 ± 20.37 years were included (65.9% male). Their mortality rate was 48%. Mean SAPS II (p APACHE II (p = 0.0007) scores were significantly higher in dead patients. Area under the ROC curve of SAPS II and APACHE II for prediction of mortality were 0.75 (95% CI: 0.64 - 0.86) and 0.72 (95% CI: 0.60 - 0.83), respectively (p = 0.24). The slope and intercept of SAPS II were 1.02 and 0.04, respectively. In addition, these values were 0.92 and 0.09 for APACHE II, respectively. The findings of the present study showed that APACHE II and SAPS II had similar value in predicting 1-month mortality of patients. Discriminatory powers of the mentioned models were acceptable but their calibration had some amount of lack of fit, which reveals that APACHE II and SAPS II are partially perfect.

  9. Investigation of the oxygen affinity of manganese(II, cobalt(II and nickel(II complexes with some tetradentate Schiff bases

    Directory of Open Access Journals (Sweden)

    Adel A.A. Emara


    Full Text Available Oxygen absorption–desorption processes for square planar Mn(II, Co(II and Mn(II complexes of tetradentate Schiff base ligands in DMF and chloroform solvents were investigated. The tetradentate Schiff base ligands were obtained by condensation reaction of ethylenediamine with salcyldehyde, o-hydroxyacetophenone or acetylacetone in the molar ratio 1:2. The square planar complexes were prepared by the reaction of the Schiff base ligands with Mn(II acetate, Co(II nitrate and Ni(II nitrate in dry ethanol under nitrogen atmosphere. The sorption processes were undertaken in the presence and absence of (pyridine axial-base in 1:1 M ratio of (pyridine:metal(II complexes. Complexes in DMF indicate significant oxygen affinity than in chloroform solvent. Cobalt(II complexes showed significant sorption processes compared to Mn(II and Ni(II complexes. The presence of pyridine axial base clearly increases oxygen affinity.

  10. NNDSS - Table II. Invasive Pneumococcal to Legionellosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal to Legionellosis - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals...

  11. NNDSS - Table II. Lyme disease to Meningococcal (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Lyme disease to Meningococcal - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  12. NNDSS - Table II. Lyme disease to Meningococcal (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Lyme disease to Meningococcal - 2014In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases...

  13. NNDSS - Table II. Lyme disease to Meningococcal (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Lyme disease to Meningococcal - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  14. Stark broadening parameter tables for In II

    Directory of Open Access Journals (Sweden)

    Dimitrijević M.S.


    Full Text Available Electron-, proton-, and ionized helium-impact broadening parameter tables for In II spectral lines, are presented as a function of the temperature and the perturber density. Calculations have been performed within the semiclassical perturbation approach.

  15. Genetics Home Reference: glutaric acidemia type II (United States)

    ... blood and tissues to become too acidic (metabolic acidosis). Glutaric acidemia type II usually appears in infancy ... sudden episode called a metabolic crisis, in which acidosis and low blood sugar (hypoglycemia) cause weakness, behavior ...

  16. NNDSS - Table II. Meningococcal disease to Pertussis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Meningococcal disease to Pertussis - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  17. NNDSS - Table II. Salmonellosis to Shigellosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Salmonellosis to Shigellosis - 2014. In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases...

  18. Aleksi II kritikujet "Kod da Vintshi"

    Index Scriptorium Estoniae


    Dan Browni samanimelise romaani järgi valminud põnevusfilm "Da Vinci kood" : režissöör Ron Howard : Ameerika Ühendriigid 2006. Venemaa patriarh Aleksius II nimetas filmi linastamist lugupidamatuseks moraalinormide vastu

  19. NNDSS - Table II. Hepatitis (viral, acute) (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases but...

  20. NNDSS - Table II. Hepatitis (viral, acute) (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  1. NNDSS - Table II. Hepatitis (viral, acute) C (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) C - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  2. NNDSS - Table II. Hepatitis (viral, acute) (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  3. NNDSS - Table II. West Nile to Zika (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile to Zika - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year), and...

  4. NNDSS - Table II. Cryptosporidiosis to Dengue (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  5. NNDSS - Table II. Cryptosporidiosis to Dengue (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  6. NNDSS - Table II. Mumps to Rabies, animal (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Mumps to Rabies, animal - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases but...

  7. NNDSS - Table II. Mumps to Rabies, animal (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Mumps to Rabies, animal - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...


    National Research Council Canada - National Science Library

    Stephen Bullivant


    ...] of the Gospel of Christ and his Church. " This article examines (1) Vatican II's understanding of such "inculpable ignorance" and its relationship to the traditional concept "invincible ignorance" and (2...

  9. NNDSS - Table II. Cryptosporidiosis to Dengue (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  10. NNDSS - Table II. Salmonellosis to Shigellosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Salmonellosis to Shigellosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  11. NNDSS - Table II. West Nile virus disease (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile virus disease - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  12. NNDSS - Table II. Ehrlichiosis and Anaplasmosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis and Anaplasmosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  13. NNDSS - Table II. Meningococcal to Pertussis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Meningococcal to Pertussis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  14. NNDSS - Table II. Giardiasis to Haemophilus influenza (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  15. NNDSS - Table II. Babesiosis to Campylobacteriosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  16. NNDSS - Table II. Chlamydia to Coccidioidomycosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Chlamydia to Coccidioidomycosis - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  17. NNDSS - Table II. Tetanus to Varicella (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Varicella - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  18. NNDSS - Table II. Chlamydia to Coccidioidomycosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Chlamydia to Coccidioidomycosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  19. Training experience at Experimental Breeder Reactor II

    Energy Technology Data Exchange (ETDEWEB)

    Driscoll, J.W.; McCormick, R.P.; McCreery, H.I.


    The EBR-II Training Group develops, maintains,and oversees training programs and activities associated with the EBR-II Project. The group originally spent all its time on EBR-II plant-operations training, but has gradually spread its work into other areas. These other areas of training now include mechanical maintenance, fuel manufacturing facility, instrumentation and control, fissile fuel handling, and emergency activities. This report describes each of the programs and gives a statistical breakdown of the time spent by the Training Group for each program. The major training programs for the EBR-II Project are presented by multimedia methods at a pace controlled by the student. The Training Group has much experience in the use of audio-visual techniques and equipment, including video-tapes, 35 mm slides, Super 8 and 16 mm film, models, and filmstrips. The effectiveness of these techniques is evaluated in this report.

  20. NNDSS - Table II. Invasive Pneumococcal to Legionellosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal to Legionellosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  1. NNDSS - Table II. Invasive Pneumococcal to Legionellosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal to Legionellosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during...

  2. NNDSS - Table II. Giardiasis to Haemophilus influenza (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2014. In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000...

  3. NNDSS - Table II. Giardiasis to Haemophilus influenza (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  4. NNDSS - Table II. Giardiasis to Haemophilus influenza (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  5. NNDSS - Table II. Giardiasis to Haemophilus influenza (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  6. NNDSS - Table II. Babesiosis to Campylobacteriosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  7. Pavement performance evaluation, phase II : data collection. (United States)


    Phase I and II of this study tested approximately 1500 rehabilitated pavements (asphalt and PCC) : throughout the State. These pavements ranged from 5 to 15 years old and were intended to develop a : snapshot of how various rehabilitations were perfo...

  8. ISLSCP II Global Sea Ice Concentration (United States)

    National Aeronautics and Space Administration — ABSTRACT: This International Satellite Land Surface Climatology Project (ISLSCP) Initiative II data set is based on the Goddard Space Flight Center (GSFC) Sea Ice...

  9. NNDSS - Table II. Rubella to Salmonellosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Rubella to Salmonellosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  10. NNDSS - Table II. Babesiosis to Coccidioidomycosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Coccidioidomycosis - 2014.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  11. NNDSS - Table II. Tetanus to Vibriosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Vibriosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  12. NNDSS - Table II. Tetanus to Vibriosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Vibriosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  13. GRACE-II Small Satellite Study Project (United States)

    National Aeronautics and Space Administration — Quantify the science benefits of GRACE-II mission comprised of multiple pairs of smallsats using realistic expected performance of smallsats and a miniaturized...

  14. NNDSS - Table II. Rubella to Salmonellosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Rubella to Salmonellosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  15. PAN Localization - phase II | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Outputs. Reports. Phase II - Research Synthesis Phase - 1st May 2010 to 31st March 2012. Papers. Outcome mapping learning community : newsletter no. 2, 2009. Journal articles. Maria Ng conferred medal by Cambodian government ...

  16. Input data to run Landis-II (United States)

    U.S. Geological Survey, Department of the Interior — The data are input data files to run the forest simulation model Landis-II for Isle Royale National Park. Files include: a) Initial_Comm, which includes the location...

  17. NNDSS - Table II. Legionellosis to Malaria (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Legionellosis to Malaria - 2017. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  18. NNDSS - Table II. Legionellosis to Malaria (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Legionellosis to Malaria - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  19. NNDSS - Table II. Ehrlichiosis/Anaplasmosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis/Anaplasmosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  20. RADAP II, an interim radar data processor (United States)

    Greene, D. R.; Nilsen, J. D.; Saffle, R. E.; Holmes, D. W.; Hudlow, M. D.; Ahnert, P. R.

    The RADAP (radar data processor) II system, which is developed by the National Weather Service and is a follow-up of the D/RADEX (Digitized Radar Experiment) is described. RADAP maintains the present automatic digital processing capabilities at the D/RADEX sites and extends these capabilities to include 10 network sites in order to fulfill the digital radar data requirements during the period before the production of the Next-Generation Weather Radar (NEXRAD) systems. Consideration is given to the current and future users of the RADAP II data, to the system capability, operational requirements, and hardware; to the installation schedule, and to the products of RADAP II. RADAP II is used for the continued development and testing of applications software to provide feedback on the operational usefulness of the software which is critical to the successful design and development of the NEXRAD system.

  1. NNDSS - Table II. West Nile virus disease (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile virus disease - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  2. Genetics Home Reference: mucopolysaccharidosis type II (United States)

    ... a soft out-pouching around the belly-button (umbilical hernia ) or lower abdomen (inguinal hernia). People with MPS II usually have thick skin that is not very stretchy. Some affected individuals ...

  3. NNDSS - Table II. Chlamydia to Coccidioidomycosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Chlamydia to Coccidioidomycosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  4. NNDSS - Table II. Ehrlichiosis/Anaplasmosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis/Anaplasmosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  5. NNDSS - Table II. Shiga toxin to Shigellosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Shiga toxin to Shigellosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  6. NNDSS - Table II. Babesiosis to Campylobacteriosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  7. NNDSS - Table II. Shiga toxin to Shigellosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Shiga toxin to Shigellosis - 2015. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  8. NNDSS - Table II. Ehrlichiosis/Anaplasmosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis/Anaplasmosis - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases but...

  9. NNDSS - Table II. Babesiosis to Campylobacteriosis (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  10. NNDSS - Table II. Tetanus to Varicella (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Varicella - 2018. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  11. Courseware Review: Vernier Software: Precision Timer II. (United States)

    Park, John C.


    Reviews "Vernier Software: Precision Timer II" for high school through college mechanics. Introduces 14 different modes including pulse time, pendulum timer, bouncer timer, gate timer, collision timers, and stroke calibration. Provides two typical displays and ratings of the software. (YP)

  12. Nickel(II) biosorption by Rhodotorula glutinis. (United States)

    Suazo-Madrid, Alicia; Morales-Barrera, Liliana; Aranda-García, Erick; Cristiani-Urbina, Eliseo


    The present study reports the feasibility of using Rhodotorula glutinis biomass as an alternative low-cost biosorbent to remove Ni(II) ions from aqueous solutions. Acetone-pretreated R. glutinis cells showed higher Ni(II) biosorption capacity than untreated cells at pH values ranging from 3 to 7.5, with an optimum pH of 7.5. The effects of other relevant environmental parameters, such as initial Ni(II) concentration, shaking contact time and temperature, on Ni(II) biosorption onto acetone-pretreated R. glutinis were evaluated. Significant enhancement of Ni(II) biosorption capacity was observed by increasing initial metal concentration and temperature. Kinetic studies showed that the kinetic data were best described by a pseudo-second-order kinetic model. Among the two-, three-, and four-parameter isotherm models tested, the Fritz-Schluender model exhibited the best fit to experimental data. Thermodynamic parameters (activation energy, and changes in activation enthalpy, activation entropy, and free energy of activation) revealed that the biosorption of Ni(II) ions onto acetone-pretreated R. glutinis biomass is an endothermic and non-spontaneous process, involving chemical sorption with weak interactions between the biosorbent and Ni(II) ions. The high sorption capacity (44.45 mg g(-1) at 25°C, and 63.53 mg g(-1) at 70°C) exhibited by acetone-pretreated R. glutinis biomass places this biosorbent among the best adsorbents currently available for removal of Ni(II) ions from aqueous effluents.

  13. Removal of Pb(II), Cd(II), Cu(II), and Zn(II) by hematite nanoparticles: effect of sorbent concentration, pH, temperature, and exhaustion. (United States)

    Shipley, Heather J; Engates, Karen E; Grover, Valerie A


    Nanoparticles offer the potential to improve environmental treatment technologies due to their unique properties. Adsorption of metal ions (Pb(II), Cd(II), Cu(II), Zn(II)) to nanohematite was examined as a function of sorbent concentration, pH, temperature, and exhaustion. Adsorption experiments were conducted with 0.05, 0.1, and 0.5 g/L nanoparticles in a pH 8 solution and in spiked San Antonio tap water. The adsorption data showed the ability of nanohematite to remove Pb, Cd, Cu, and Zn species from solution with adsorption increasing as the nanoparticle concentration increased. At 0.5 g/L nanohematite, 100 % Pb species adsorbed, 94 % Cd species adsorbed, 89 % Cu species adsorbed and 100 % Zn species adsorbed. Adsorption kinetics for all metals tested was described by a pseudo second-order rate equation with lead having the fastest rate of adsorption. The effect of temperature on adsorption showed that Pb(II), Cu(II), and Cd(II) underwent an endothermic reaction, while Zn(II) underwent an exothermic reaction. The nanoparticles were able to simultaneously remove multiple metals species (Zn, Cd, Pb, and Cu) from both a pH 8 solution and spiked San Antonio tap water. Exhaustion experiments showed that at pH 8, exhaustion did not occur for the nanoparticles but adsorption does decrease for Cd, Cu, and Zn species but not Pb species. The strong adsorption coupled with the ability to simultaneously remove multiple metal ions offers a potential remediation method for the removal of metals from water.

  14. Genetic heterogeneity of Usher syndrome type II. (United States)

    Pieke Dahl, S; Kimberling, W J; Gorin, M B; Weston, M D; Furman, J M; Pikus, A; Möller, C


    Usher syndrome is an autosomal recessive disorder characterised by retinitis pigmentosa and congenital sensorineural hearing loss. A gene for Usher syndrome type II (USH2) has been localised to chromosome 1q32-q41. DNA from a family with four of seven sibs affected with clinical characteristics of Usher syndrome type II was genotyped using markers spanning the 1q32-1q41 region. These included D1S70 and D1S81, which are believed to flank USH2. Genotypic results and subsequent linkage analysis indicated non-linkage of this family to these markers. The A test analysis for heterogeneity with this family and 32 other Usher type II families was statistically significant at p < 0.05. Further clinical evaluation of this family was done in light of the linkage results to determine if any phenotypic characteristics would allow for clinical identification of the unlinked type. No clear phenotypic differences were observed; however, this unlinked family may represent a previously unreported subtype of Usher type II characterised by a milder form of retinitis pigmentosa and mild vestibular abnormalities. Heterogeneity of Usher syndrome type II complicates efforts to isolate and clone Usher syndrome genes using linkage analysis and limits the use of DNA markers in early detection of Usher type II. Images PMID:7901420

  15. Feasibility of the Helping Alliance Questionnaire – II (HAq- II) in psychiatric patients receiving music therapy

    DEFF Research Database (Denmark)

    Hannibal, Niels Jørgensen; Licht, Rasmus Wentzer; Rodrigo, Maria


    Background: High adherence to music therapy in psychiatry may indicate the forming of a helping alliance. However, no prior attempts have been made to measure the alliance during music therapy. Objective: To evaluate the applicability of the Helping Alliance Questionnaire – II (HAq-II) in patients...... receiving music therapy. Internal consistency and associations between patient variables and HAq-II scores were also examined. Methods: Between October 2013 and April 2014, psychiatric patients receiving music therapy were invited to fill out the HAq-II. Clinical data were collected from the patient records...... predictors of interest w ere found. Conclusions: The HAq-II was applicable to the majority of a group of psychiatric patients receiving music therapy. An acceptable internal consistency of the questionnaire was found. Relatively high HAq-II scores suggest a high degree of therapeutic alliance...

  16. Differential Effect of Solution Conditions on the Conformation of the Actinoporins Sticholysin II and Equinatoxin II

    Directory of Open Access Journals (Sweden)



    Full Text Available Actinoporins are a family of pore-forming proteins with hemolytic activity. The structural basis for such activity appears to depend on their correct folding. Such folding encompasses a phosphocholine binding site, a tryptophan-rich region and the activity-related N-terminus segment. Additionally, different solution conditions are known to be able to influence the pore formation by actinoporins, as for Sticholysin II (StnII and Equinatoxin II (EqtxII. In this context, the current work intends to characterize the influence of distinct solution conditions in the conformational behavior of these proteins through molecular dynamics (MD simulations. The obtained data offer structural insights into actinoporins dynamics in solution, characterizing its conformational behavior at the atomic level, in accordance with previous experimental data on StnII and EqtxII hemolytic activities.

  17. Genetics of type II diabetes. (United States)

    Permutt, M A; Chiu, K; Ferrer, J; Glaser, B; Inoue, H; Nestorowicz, A; Stanley, C A; Tanizawa, Y


    Defining the genetic basis of Type II or non-insulin dependent diabetes mellitus (NIDDM) will accelerate our progress toward understanding its etiology and will provide new therapeutic targets for treatment of this common disease. Here we present a brief overview of the history of the search for diabetes genes and report current strategies employed by our laboratory and by others in this effort. Isolation and subsequent mapping of candidate genes involved in insulin production and action has been a major effort in this field. Our lab has focused on pancreatic islet beta-cell genes, since the insulin lack of NIDDM is often the result of resistance to the action of insulin that is superimposed on a limited ability to produce insulin. A number of islet genes have been evaluated, including those involved in glucose metabolism, islet K+ channel genes, and transcription factors. For each gene, human cDNAs and genomic clones have been isolated and simple sequence repeat polymorphisms (SSRPs) identified. The SSRPs were used to map the genes by linkage in CEPH pedigrees, or sequence-tagged sites (STSs) were used to map the genes to radiation hybrids (RH) or to YAC clones containing SSRPs. The SSRPs have then been used as markers for linkage analyses in families with NIDDM. Mutation screening by single-strand conformational polymorphism analysis and by sequencing has revealed variants that have been tested in association studies. A strategy was devised to generate novel expressed sequence tags (ESTs) from human pancreatic islet genes by differential display of islet mRNA. In the first phase of this project we identified 42 cDNAs that were preferentially expressed in pancreatic islets relative to exocrine tissue. When compared to sequences in GenBank, novel genes were represented by 69%. Enhanced islet expression was confirmed by Northern analysis of RNA. Sequence-tagged sites were synthesized for a number of islet ESTs and used to map these genes to human chromosomes. This

  18. Coordination Modes of a Schiff Base Derived from Substituted 2-Aminothiazole with Chromium(III, Manganese(II, Iron(II, Cobalt(II, Nickel(II and Copper(II Metal Ions: Synthesis, Spectroscopic and Antimicrobial Studies

    Directory of Open Access Journals (Sweden)

    Ambit Thakar


    Full Text Available Transition metal complexes of Cr(III, Mn(II, Fe(II, Co(II, Ni(II and Cu(II metal ions with general stoichiometry [ML2.2H2O] and [ML3], where M= Mn(II, Cr(III, Fe(II, Co(II, Ni(II and Cu(II, L= Schiff base derived from the condensation of 2-amino-4(4’-phenyl/methylphenyl-5-methyl-thiazole with 4-acetyl-1(3-chloro phenyl-3-methyl-2-pyrazoline-5-ones, have been synthesized and structurally characterized by elemental analysis, molar conductance measurements, magnetic susceptibility measurements and spectral techniques like IR, UV, 1H NMR, 13C NMR and Mass Spectra. All the complexes were found to be octahedral geometry. The ligand and its complexes have been screened for their antifungal and antibacterial activities against three fungi, i.e. Alternaria brassicae, Aspergillus niger and Fesarium oxysporum and two bacteria, i.e. Xanthomonas compestris and Pseudomonas aeruginosa.

  19. Removal of nickel(II and palladium(II from surface waters

    Directory of Open Access Journals (Sweden)

    V. Sharifzade


    Full Text Available A new sorbent was prepared using alumina and 5-Br-PADAP, and its adsorption ability for the removal of Ni(II and Pd(II from different waters was investigated. The procedure is based on retention of the analytes on the alumina load with 5-Br-PADAP at pH ~ 6. The separation/preconcentration conditions for the quantitative recoveries were investigated. The limit of detections (LOD based on three times the standard deviations of the blank, were 0.187 and 0.253 ng mL-1 for Ni(II and Pd(II, respectively. Obtained sorption capacities for 1 g sorbent were 6.0 mg Ni(II and 11.0 mg Pd(II. The linearity was maintained in the concentration range of 0.625 to 6.0 ng mL-1 for Ni(II and 0.416 to 7.0 ng mL-1 for Pd(II in the original solution. Eight replicate determinations of a mixture containing 2.0 µg mL-1 each of the elements in the final solution gave relative standard deviation of ±0.82 and ±1.12% for Ni(II and Pd(II, respectively. The proposed method was successfully applied to the determination trace amounts of Ni(II and Pd(II in the surface water samples.DOI:

  20. Phosphate effects on copper(II) and lead(II) sorption to ferrihydrite (United States)

    Tiberg, Charlotta; Sjöstedt, Carin; Persson, Ingmar; Gustafsson, Jon Petter


    Transport of lead(II) and copper(II) ions in soil is affected by the soil phosphorus status. Part of the explanation may be that phosphate increases the adsorption of copper(II) and lead(II) to iron (hydr)oxides in soil, but the details of these interactions are poorly known. Knowledge about such mechanisms is important, for example, in risk assessments of contaminated sites and development of remediation methods. We used a combination of batch experiments, extended X-ray absorption fine structure (EXAFS) spectroscopy and surface complexation modeling with the three-plane CD-MUSIC model to study the effect of phosphate on sorption of copper(II) and lead(II) to ferrihydrite. The aim was to identify the surface complexes formed and to derive constants for the surface complexation reactions. In the batch experiments phosphate greatly enhanced the adsorption of copper(II) and lead(II) to ferrihydrite at pH < 6. The largest effects were seen for lead(II).

  1. Lateral cephalometric diagnosis of asymmetry in Angle Class II subdivision compared to Class I and II

    National Research Council Canada - National Science Library

    Meloti, Aparecida Fernanda; Gonçalves, Renata de Cássia; Silva, Ertty; Martins, Lídia Parsekian; dos Santos-Pinto, Ary


    .... The objective of the present study was to use lateral cephalometric radiographs to identify existing skeletal and dentoalveolar morphological alterations in Class II subdivision and to compare...

  2. Redox-active dirhodium(II,II) species covalently entrapped into a methylmethacrylate backbone. (United States)

    Lo Schiavo, Sandra; Mineo, Placido; Tresoldi, Giuseppe; Cardiano, Paola; Piraino, Pasquale


    A novel class of polymers was obtained by insertion of dirhodium(II,II) metal systems into a methacrylate backbone; the synthesis was realized by free radical polymerization of an appropriate methacrylate-functionalized dirhodium polymer precursor, namely [Rh2(form)2(MA-COO)2](form =N,N'-di-p-tolylformamidinate)(MA-COO = 2-(methacroyloxy)ethyl-phthalate), with methylmethacrylate (MMA); the new copolymers, in solution, show reversible CO-absorption, connected to the axial reactivity of dirhodium(II,II) species.

  3. Processing of angiotensin II (A-II) and (Sar1,Ala8)A-II by cultured bovine adrenocortical cells

    Energy Technology Data Exchange (ETDEWEB)

    Crozat, A.; Penhoat, A.; Saez, J.M.


    Bovine adrenocortical cells, cultured in a chemically defined medium, were used to study the fate of (/sup 125/I) iodoangiotensin II ((/sup 125/I)iodo-A-II) and its antagonist (Sar1,Ala8)A-II ((/sup 125/I)iodo-Saralasin). The binding of both ligands was time and temperature dependent. The maximum specific binding at 37 C, which was reached within 1 h, was followed by a decline with a half-life of about 2 h and 8 h for (/sup 125/I)iodo-A-II and (/sup 125/I)iodo-Saralasin, respectively. The decrease of the specific binding was parallel to the appearance in the medium of degraded ligand. At 4 C, the binding of (/sup 125/I)iodo-A-II was stable for 12 h and no degradation of ligand occurred. Under several experimental conditions, about 70% of the total (/sup 125/I)iodo-A-II bound was internalized, whereas, in the case of (/sup 125/I)iodo-Saralasin, less than 25% of the total bound ligand was internalized. These differences in the binding kinetics between A-II and its antagonist were mainly the differences in the rate of internalization of the bound ligands, more rapid for (/sup 125/I)iodo-A-II (t1/2 approximately equal to 10 min) than for (/sup 125/I)iodo-Saralasin (t1/2 = 90 min). On the other hand, the rate of degradation of internalized ligand was similar for both ligands (t1/2 = 15 min). Ionophore monensin enhanced the total cellular uptake of both ligands by increasing the amount of internalized ligands. Monensin did not modify the rate of internalization of the two ligands but markedly decreased their rate of degradation (t1/2 approximately equal to 60 min). These results indicate that both A-II and its antagonist are internalized and degraded by adrenocortical cells, but the rate of internalization of the antagonist is lower than that of the agonist.

  4. Electrochemical studies of DNA interaction and antimicrobial activities of MnII, FeIII, CoII and NiII Schiff base tetraazamacrocyclic complexes (United States)

    Kumar, Anuj; Vashistha, Vinod Kumar; Tevatia, Prashant; Singh, Randhir


    Tetraazamacrocyclic complexes of MnII, FeIII, CoII and NiII have been synthesized by template method. These tetraazamacrocycles have been analyzed with various techniques like molar conductance, IR, UV-vis, mass spectral and cyclic voltammetric studies. On the basis of all these studies, octahedral geometry has been assigned to these tetraazamacrocyclic complexes. The DNA binding properties of these macrocyclic complexes have been investigated by electronic absorption spectra, fluorescence spectra, cyclic voltammetric and differential pulse voltammetric studies. The cyclic voltammetric data showed that ipc and ipa were effectively decreased in the presence of calf thymus DNA, which is a strong evidence for the interaction of these macrocyclic complexes with the calf thymus DNA (ct-DNA). The heterogeneous electron transfer rate constant found in the order: KCoII > KNiII > KMnII which indicates that CoII macrocyclic complex has formed a strong intercalated intermediate. The Stern-Volmer quenching constant (KSV) and voltammetric binding constant were found in the order KSV(CoII) > KSV(NiII) > KSV(MnII) and K+(CoII) > K+(NiII) > K+(MnII) which shows that CoII macrocyclic complex exhibits the high interaction affinity towards ct-DNA by the intercalation binding. Biological studies of the macrocyclic complexes compared with the standard drug like Gentamycin, have shown antibacterial activities against E. coli, P. aeruginosa, B. cereus, S. aureus and antifungal activity against C. albicans.

  5. Structural properties of MHC class II ligands, implications for the prediction of MHC class II epitopes.

    Directory of Open Access Journals (Sweden)

    Kasper Winther Jørgensen

    Full Text Available Major Histocompatibility class II (MHC-II molecules sample peptides from the extracellular space allowing the immune system to detect the presence of foreign microbes from this compartment. Prediction of MHC class II ligands is complicated by the open binding cleft of the MHC class II molecule, allowing binding of peptides extending out of the binding groove. Furthermore, only a few HLA-DR alleles have been characterized with a sufficient number of peptides (100-200 peptides per allele to derive accurate description of their binding motif. Little work has been performed characterizing structural properties of MHC class II ligands. Here, we perform one such large-scale analysis. A large set of SYFPEITHI MHC class II ligands covering more than 20 different HLA-DR molecules was analyzed in terms of their secondary structure and surface exposure characteristics in the context of the native structure of the corresponding source protein. We demonstrated that MHC class II ligands are significantly more exposed and have significantly more coil content than other peptides in the same protein with similar predicted binding affinity. We next exploited this observation to derive an improved prediction method for MHC class II ligands by integrating prediction of MHC- peptide binding with prediction of surface exposure and protein secondary structure. This combined prediction method was shown to significantly outperform the state-of-the-art MHC class II peptide binding prediction method when used to identify MHC class II ligands. We also tried to integrate N- and O-glycosylation in our prediction methods but this additional information was found not to improve prediction performance. In summary, these findings strongly suggest that local structural properties influence antigen processing and/or the accessibility of peptides to the MHC class II molecule.

  6. Spectroscopic evaluation of Co(II), Ni(II) and Cu(II) complexes derived from thiosemicarbazone and semicarbazone (United States)

    Chandra, Sulekh; Kumar, Anil


    Co(II), Ni(II) and Cu(II) complexes were synthesized with thiosemicarbazone (L 1) and semicarbazone (L 2) derived from 2-acetyl furan. These complexes were characterized by elemental analysis, molar conductance, magnetic moment, mass, IR, electronic and EPR spectral studies. The molar conductance measurement of the complexes in DMSO corresponds to non-electrolytic nature. All the complexes are of high-spin type. On the basis of different spectral studies six coordinated geometry may be assigned for all the complexes except Co(L) 2(SO 4) and Cu(L) 2(SO 4) [where L = L 1 and L 2] which are of five coordinated square pyramidal geometry.

  7. Interactions of anti-Parkinson drug benserazide with Zn(II), Cu(II), Fe(II) ions. (United States)

    Szyrwiel, Lukasz; Pap, József S; Malinka, Wieslaw; Szewczuk, Zbigniew; Kotynia, Aleksandra; Brasun, Justyna


    One of the treatments of Parkinson disease is based on increasing the brain dopamine level by L-DOPA (LD) applications. To prevent the peripheral degradation of levodopa, another drug, benserazide is applied. On the other hand, during this neurodegenerative disease changes in the homeostasis of metals are observed and the increasing brain zinc levels are postulated to have therapeutic effects. Here we present studies on interactions of Zn(II), Cu(II), Fe(II) ions with benserazide and with benserazide/levodopa in ternary system. By applying mass spectrometry and UV-vis methods we describe the interactions between selected metal ions and the drug additives in the investigated systems. The results show forming of equimolar complexes in the binary and ternary systems. Copyright © 2012 Elsevier B.V. All rights reserved.

  8. Mg(II) binding by bovine prothrombin fragment 1 via equilibrium dialysis and the relative roles of Mg(II) and Ca(II) in blood coagulation

    Energy Technology Data Exchange (ETDEWEB)

    Deerfield, D.W. 2d.; Olson, D.L.; Berkowitz, P.; Byrd, P.A.; Koehler, K.A.; Pedersen, L.G.; Hiskey, R.G.


    The first direct equilibrium dialysis titration of the blood coagulation protein bovine prothrombin fragment 1 with Mg(II) is presented. Fragment 1 has fewer thermodynamic binding sites for Mg(II) than Ca(II), less overall binding affinity, and significantly less cooperativity. Several nonlinear curve fitting models were tested for describing the binding of fragment 1 with Mg(II), Ca(II), and mixed metal binding data. The Mg(II) data is represented by essentially five equivalent, noninteracting sites; for Ca(II), a model with three tight, cooperative sites and four ''loose'', equal affinity, noninteracting sites provides the best model. Based on the reported equilibrium dialysis data and in conjunction with other experimental data, a model for the binding of Ca(II) and Mg(II) to bovine prothrombin fragment 1 is proposed. The key difference between the binding of these divalent ions is that Ca(II) apparently causes a specific conformational change reflected by the cooperativity observed in the Ca(II) titration. The binding of Ca(II) ions to the three tight, cooperative sites establishes a conformation that is essential for phospholipid X Ca(II) X protein binding. The filling of the loose sites with Ca(II) ions leads to charge reduction and subsequent phospholipid X Ca(II) X protein complex interaction. Binding of Mg(II) to bovine prothrombin fragment 1 does not yield a complex with the necessary phospholipid-binding conformation. However, Mg(II) is apparently capable of stabilizing the Ca(II) conformation as is observed in the mixed metal ion binding data and the synergism in thrombin formation.

  9. Synthesis, physico-chemical studies of manganese(II), cobalt(II), nickel(II), copper(II) and zinc(II) complexes with some p-substituted acetophenone benzoylhydrazones and their antimicrobial activity. (United States)

    Singh, Vinod P; Singh, Shweta; Katiyar, Anshu


    Complexes of the type [M(pabh)(H2O)Cl], [M(pcbh)(H2O)Cl] and [M(Hpabh)(H2O)2 (SO4)] where, M = Mn(II), Co(II), Ni(II), Cu(II) and Zn(II); Hpabh = p-amino acetophenone benzoyl hydrazone and Hpcbh = p-chloro acetophenone benzoyl hydrazone have been synthesized and characterized with the help of elemental analyses, electrical conductance, magnetic susceptibility measurements, electronic, ESR and IR spectra, thermal (TGA & DTA) and X-ray diffraction studies. Co(II), Ni(II) and Cu(II) chloride complexes are square planar, whereas their sulfate complexes have spin-free octahedral geometry. ESR spectra of Cu(II) complexes with Hpabh are axial and suggest d(x(2)-y(2) as the ground state. The ligand is bidentate bonding through > C = N--and deprotonated enolate group in all the chloro complexes, whereas, >C = N and >C = O groups in all the sulfato complexes. Thermal studies (TGA & DTA) on [Cu(Hpabh)(H2O)2(SO4)] indicate a multistep decomposition pattern, which are both exothermic and endothermic in nature. X-ray powder diffraction parameters for [Co(pabh)(H2O)Cl] and [Ni(Hpabh)(H2O)2(SO4)] correspond to tetragonal and orthorhombic crystal lattices, respectively. The ligands as well as their complexes show a significant antifungal and antibacterial activity. The metal complexes are more active than the ligand.

  10. The PIP-II Conceptual Design Report

    Energy Technology Data Exchange (ETDEWEB)

    Ball, M. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Burov, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Chase, B. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Chakravarty, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Chen, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Dixon, S. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Edelen, J. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Grassellino, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Johnson, D. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Holmes, S. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Kazakov, S. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Klebaner, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Kourbanis, I. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Leveling, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Melnychuk, O. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Neuffer, D. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Nicol, T. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Ostiguy, J. -F. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Pasquinelli, R. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Passarelli, D. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Ristori, L. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Pellico, W. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Patrick, J. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Prost, L. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Rakhno, I. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Saini, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Schappert, W. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Shemyakin, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Steimel, J. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Scarpine, V. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Vivoli, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Warner, A. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Yakovlev, V. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Ostroumov, P. [Argonne National Lab. (ANL), Argonne, IL (United States); Conway, Z. [Argonne National Lab. (ANL), Argonne, IL (United States)


    The Proton Improvement Plan-II (PIP-II) encompasses a set of upgrades and improvements to the Fermilab accelerator complex aimed at supporting a world-leading neutrino program over the next several decades. PIP-II is an integral part of the strategic plan for U.S. High Energy Physics as described in the Particle Physics Project Prioritization Panel (P5) report of May 2014 and formalized through the Mission Need Statement approved in November 2015. As an immediate goal, PIP-II is focused on upgrades to the Fermilab accelerator complex capable of providing proton beam power in excess of 1 MW on target at the initiation of the Long Baseline Neutrino Facility/Deep Underground Neutrino Experiment (LBNF/DUNE) program, currently anticipated for the mid- 2020s. PIP-II is a part of a longer-term goal of establishing a high-intensity proton facility that is unique within the world, ultimately leading to multi-MW capabilities at Fermilab....

  11. Belle-II Experiment Network Requirements

    Energy Technology Data Exchange (ETDEWEB)

    Asner, David [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Bell, Greg [ESnet; Carlson, Tim [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Cowley, David [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Dart, Eli [ESnet; Erwin, Brock [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Godang, Romulus [Univ. of South Alabama, Mobile, AL (United States); Hara, Takanori [High Energy Accelerator Research Organization (KEK), Tsukuba (Japan); Johnson, Jerry [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Johnson, Ron [Univ. of Washington, Seattle, WA (United States); Johnston, Bill [ESnet; Dam, Kerstin Kleese-van [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Kaneko, Toshiaki [High Energy Accelerator Research Organization (KEK), Tsukuba (Japan); Kubota, Yoshihiro [NII; Kuhr, Thomas [Karlsruhe Inst. of Technology (KIT) (Germany); McCoy, John [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Miyake, Hideki [High Energy Accelerator Research Organization (KEK), Tsukuba (Japan); Monga, Inder [ESnet; Nakamura, Motonori [NII; Piilonen, Leo [Virginia Polytechnic Inst. and State Univ. (Virginia Tech), Blacksburg, VA (United States); Pordes, Ruth [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Ray, Douglas [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Russell, Richard [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Schram, Malachi [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Schroeder, Jim [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Sevior, Martin [Univ. of Melbourne (Australia); Singh, Surya [Pacific Northwest National Laboratory (PNNL), Richland, WA (United States); Suzuki, Soh [High Energy Accelerator Research Organization (KEK), Tsukuba (Japan); Sasaki, Takashi [High Energy Accelerator Research Organization (KEK), Tsukuba (Japan); Williams, Jim [Indiana Univ., Bloomington, IN (United States)


    The Belle experiment, part of a broad-based search for new physics, is a collaboration of ~400 physicists from 55 institutions across four continents. The Belle detector is located at the KEKB accelerator in Tsukuba, Japan. The Belle detector was operated at the asymmetric electron-positron collider KEKB from 1999-2010. The detector accumulated more than 1 ab-1 of integrated luminosity, corresponding to more than 2 PB of data near 10 GeV center-of-mass energy. Recently, KEK has initiated a $400 million accelerator upgrade to be called SuperKEKB, designed to produce instantaneous and integrated luminosity two orders of magnitude greater than KEKB. The new international collaboration at SuperKEKB is called Belle II. The first data from Belle II/SuperKEKB is expected in 2015. In October 2012, senior members of the Belle-II collaboration gathered at PNNL to discuss the computing and neworking requirements of the Belle-II experiment with ESnet staff and other computing and networking experts. The day-and-a-half-long workshop characterized the instruments and facilities used in the experiment, the process of science for Belle-II, and the computing and networking equipment and configuration requirements to realize the full scientific potential of the collaboration's work.

  12. Early characteristic radiographic changes in mucolipidosis II

    Energy Technology Data Exchange (ETDEWEB)

    Lai, Lillian M. [Lucile Packard Children' s Hospital and Stanford University, Pediatric Radiology, Palo Alto, CA (United States); Lachman, Ralph S. [Lucile Packard Children' s Hospital and Stanford University, Pediatric Radiology, Palo Alto, CA (United States); University of California, International Skeletal Dysplasia Registry, Los Angeles, CA (United States)


    Although mucolipidosis type II has similar metabolic abnormalities to those found in all the mucopolysaccharidoses and mucolipidoses, there are distinctive diagnostic radiographic changes of mucolipidosis II in the perinatal/newborn/infant period. To describe the early characteristic radiographic changes of mucolipidosis II and to document when these changes manifest and resolve. We retrospectively reviewed radiographs and clinical records of 19 cases of mucolipidosis II from the International Skeletal Dysplasia Registry (1971-present; fetal age to 21/2 years). A radiologist with special expertise in skeletal dysplasias evaluated the radiographs. The most common abnormalities were increased vertebral body height (80%, nonspecific), talocalcaneal stippling (86%), periosteal cloaking (74%) and vertebral body rounding (50%). Unreported findings included sacrococcygeal sclerosis (54%) and vertebral body sclerosis (13%). Rickets and hyperparathyroidism-like (pseudohyperparathyroidism) changes (rarely reported) were found in 33% of cases. These changes invariably started in the newborn period and resolved by 1 year of age. The conversion from these early infantile radiographic features to dysostosis multiplex changes occurred in 41% of cases, and within the first year after birth. Several findings strongly suggest the diagnosis of mucolipidosis II, including cloaking in combination with one or more of the following radiographic criteria: talocalcaneal stippling, sacrococcygeal or generalized vertebral body sclerosis, vertebral body rounding, or rickets/hyperparathyroidism-like changes in the perinatal/newborn/infancy period. These findings are not found in the other two forms of mucolipidosis nor in any of the mucopolysaccharidoses. (orig.)

  13. TRUPACT-II Operating and Maintenance Instructions

    Energy Technology Data Exchange (ETDEWEB)

    Westinghouse Electric Corporation, Waste Isolation Division


    The purpose of this document is to provide the technical requirements for preparation for use, operation, inspection, and maintenance of a Transuranic Package Transporter Model II (TRUPACT-II) Shipping Package and directly related components. This document complies with the minimum requirements as specified in the TRUPACT-II Safety Analysis Report for Packaging (SARP) and Nuclear Regulatory Commission (NRC) Certificate of Compliance (C of C) 9218. In the event there is a conflict between this document and the TRUPACT-II SARP, the TRUPACT-II SARP shall govern. TRUPACT-II C of C number 9218 states, ''... each package must be prepared for shipment and operated in accordance with the procedures described in Chapter 7.0, Operating Procedures, of the application.'' It further states, ''... each package must be tested and maintained in accordance with the procedures described in Chapter 8.0, Acceptance Tests and Maintenance Program of the application.'' Chapter 9 of the TRUPACT-II SARP charges the Westinghouse Electric Corporation Waste Isolation Division (WID) with assuring that the TRUPACT-II is used in accordance with the requirements of the C of C. To meet this requirement and verify consistency of operations when loading and unloading the TRUPACT-II on the trailer, placing a payload in the packaging, unloading the payload from the packaging, or performing maintenance, the U.S. Department of Energy Carlsbad Area Office (U.S. DOE/CAO) finds it necessary to implement the changes that follow. This TRUPACT-II maintenance document represents a change to previous philosophy regarding site specific procedures for the use of the TRUPACT-II. This document details the instructions to be followed to consistently operate and maintain the TRUPACT-II. The intent of these instructions is to ensure that all users of the TRUPACT-II follow the same or equivalent instructions. Users may achieve this intent by any of the following methods: (1

  14. LCLS-II Cryomodules Production at Fermilab

    Energy Technology Data Exchange (ETDEWEB)

    Arkan, Tug [Fermilab; Grimm, Chuck [Fermilab; Kaluzny, Joshua [Fermilab; Orlov, Yuriy [Fermilab; Peterson, Thomas [Fermilab; Premo, Ken [Fermilab


    LCLS-II is an upgrade project for the linear coherent light source (LCLS) at SLAC. The LCLS-II linac will consist of thirty-five 1.3 GHz and two 3.9 GHz superconducting RF continuous wave (CW) cryomodules that Fermilab and Jefferson Lab (JLab) will assemble in collaboration with SLAC. The LCLS-II 1.3 GHz cryomodule design is based on the European XFEL pulsed-mode cryomodule design with modifications needed for CW operation. Fermilab and JLab will each assemble and test a prototype 1.3 GHz cryomodule to assess the results of the CW modifications, in advance of 16 and 17 production 1.3 GHz cryomodules, respectively. Fermilab is solely responsible for the 3.9 GHz cryomodules. After the prototype cryomodule tests are complete and lessons learned incorporated, both laboratories will increase their cryomodule production rates to meet the challenging LCLS-II project requirement of approximately one cryomodule per month per laboratory. This paper presents the Fermilab Cryomodule Assembly Facility (CAF) infrastructure for LCLS-II cryomodule production, the Fermilab prototype 1.3 GHz CW cryomodule (pCM) assembly and readiness for production assembly.

  15. Centrifuge workers study. Phase II, completion report

    Energy Technology Data Exchange (ETDEWEB)

    Wooten, H.D.


    Phase II of the Centrifuge Workers Study was a follow-up to the Phase I efforts. The Phase I results had indicated a higher risk than expected among centrifuge workers for developing bladder cancer when compared with the risk in the general population for developing this same type of cancer. However, no specific agent could be identified as the causative agent for these bladder cancers. As the Phase II Report states, Phase I had been limited to workers who had the greatest potential for exposure to substances used in the centrifuge process. Phase II was designed to expand the survey to evaluate the health of all employees who had ever worked in Centrifuge Program Departments 1330-1339 but who had not been interviewed in Phase I. Employees in analytical laboratories and maintenance departments who provided support services for the Centrifuge Program were also included in Phase II. In December 1989, the Oak Ridge Associated Universities (ORAU), now known as Oak Ridge Institute for Science and Education (ORISE), was contracted to conduct a follow-up study (Phase II). Phase H of the Centrifuge Workers Study expanded the survey to include all former centrifuge workers who were not included in Phase I. ORISE was chosen because they had performed the Phase I tasks and summarized the corresponding survey data therefrom.

  16. Morphological caracteristics of malocclusion class II

    Directory of Open Access Journals (Sweden)

    Pavlović J.


    Full Text Available Class II malocclusion are complex anomalies of the skeletal and dental systems. The aim of this study is that the rengenkefalometrics analysis closer determine the morphological characteristics of this malocclusion. For this study were used 30 patients aged 18-30, previously clinically diagnosed class II, before the planned orthodontic treatment. The results analisis lateral cephalometric radiographs were compared with the 30 patients with class I malocclusion. Analyzed three linear and two angular cranial base dimensions and nine angular and four linear measures from the facial skeleton. The Results show: No statistically significant differensis in cranial base angle (SNBa and anterior cranial base length (S-N between class II and control Class I. Angle maxillar prognathism ( SNA is no signifikant different between class I and Class II but SNB angle were signifikant smaller. The length of maxillary base (A'-SnP is longer and the length of mandibule (Pg'-MT1/MT is signifficantly smaller. The gonial angle (ArGo-Me was smaller with open articular angle (GoArSN. Morphological characteristics of class II malocclusion are , retrognathic and smaller mandibular ligth, normognathic and longer maxilla, open articular angle with vertical tendency of the craniofacial growth pattern.

  17. Spectroscopic, electrochemical, magnetic and structural investigations of dimanganese-(II/II) and mixed-valence-(II/III)-tetraiminodiphenolate complexes


    Rocha, Julio C. da; Poneti, Giordano; Ferreira,Janaina G.; Ribeiro, Ronny R.; Nunes, Fábio S.


    Synthesis, spectroscopic [electron paramagnetic resonance (EPR), UV-Vis and Fourier transform infrared spectroscopy (FTIR)], magnetic and spectroeletrochemical properties of [MnII2(tidf)(OAc)(ClO4)(MeOH)] (tidf = a Robson type macrocyclic ligand obtained through condensation of 2,6-diformyl-4-methylphenol and 1,3-diaminopropane) are reported. Compound [MnII2(tidf)(OAc)(ClO4)(MeOH)] shows a weak antiferromagnetic behavior with exchange coupling constant J = -1.59(1) cm-1. UV-Vis and EPR spectr...

  18. Alcatel-Lucent Network Routing Specialist II (NRS II) Self-Study Guide Preparing for the NRS II Certification Exams

    CERN Document Server

    Warnock, Glenn


    The definitive resource for the NRS II exams—three complete courses in a book Alcatel-Lucent is a world leader in designing and developing scalable systems for service providers. If you are a network designer or operator who uses Alcatel-Lucent's 7750 family of service routers, prepare for certification as an A-L network routing specialist with this complete self-study course. You'll get thorough preparation for the NRS II exams while you learn to build state-of-the-art, scalable IP/MPLS-based service networks. The book provides you with an in-depth understanding of the protocols and tec

  19. The type II collagen fragments Helix-II and CTX-II reveal different enzymatic pathways of human cartilage collagen degradation

    DEFF Research Database (Denmark)

    Charni-Ben Tabassi, N; Desmarais, S; Jensen, Anne-Christine Bay


    that they may be generated through different collagenolytic pathways. In this study we analyzed the release of Helix-II and CTX-II from human cartilage collagen by the proteinases reported to play a role in cartilage degradation. METHODS: In vitro, human articular cartilage extract was incubated with activated...... sections were then incubated for up to 84h in the presence or absence of E-64 and GM6001, inhibitors of cysteine proteases and MMPs, respectively. RESULTS: In vitro, Cats K, L and S generated large amount of Helix-II, but not CTX-II. Cat B generated CTX-II fragment, but destroyed Helix-II immunoreactivity...

  20. Zn(II, Pb(II and Cd(II levels in livers and muscles of wild duck (Anas platyrhynchos hunting in El Melah Lagoon (NE Tunisia

    Directory of Open Access Journals (Sweden)

    Cherif Ensibi


    Full Text Available We investigated the levels of Zn(II], Pb(II] and Cd(II] in livers and muscles of the wild duck (Anas platyrhynchos hunting in El Melah lagoon in northeastern Tunisia from December 2010. Analysis of variance shows that no significant differences in metals levels were found between samples, but it should be pointed out that the number of samples was small. HSD Tukey test show that the amount of Cd(II], Zn(II] and Pb(II] in the levers was higher than in the muscles. The results obtained suggest the importance of wild ducks as bioindicators of heavy metal pollution.

  1. Elimination of Cu (II) and Zn (II) ions in mono-element and the bi ...

    African Journals Online (AJOL)

    This work was undertaken to evaluate the potential of the clay of Bikougou to remove copper (II) and zinc (II) ions (Cu2+ and Zn2+) in mono-element and binary aqueous solutions. The experiments were carried out by employing the batch technique through the variations of pH, clay mass, ionic strength, concentration in ...

  2. Validation of the Sexual Assault Symptom Scale II (SASS II) Using a Panel Research Design (United States)

    Ruch, Libby O.; Wang, Chang-Hwai


    To examine the utility of a self-report scale of sexual assault trauma, 223 female victims were interviewed with the 43-item Sexual Assault Symptom Scale II (SASS II) at 1, 3, 7, 11, and 15 months postassault. Factor analyses using principal-components extraction with an oblimin rotation yielded 7 common factors with 31 items. The internal…

  3. Biosorption of Fe (II) and Cd (II) ions from aqueous solution using a ...

    African Journals Online (AJOL)


    Biosorption of Fe (II) and Cd (II) ions from aqueous solution using a low cost ... Department of Industrial Chemistry, Faculty of Physical Sciences, University of ... human activities in the environment poses a lot of risk ... heavy metals using various agricultural waste by- ... disadvantages such as low efficiency, high energy and.

  4. Protolitic Equilibria and Stability Constants of Mn (II) and Ni (II ...

    African Journals Online (AJOL)

    Protonation constant of nicotinaldehyde thiosemicarbazone (NTSC) and its complexation with Mn (II) and Ni (II) were studied in SDS-water (1.15%w/v) mixture at 303K under nitrogen atmosphere and an ionic strength of 0.1 mol dm-3 pH-potentiometrically. The protonation constant of the ligand and stability constant of its ...

  5. I, IGF-II and IGFBP-II with production traits in breeder hens of ...

    African Journals Online (AJOL)



    Feb 8, 2010 ... randomly from 160 individuals and genomic DNA was extracted using modified salting out method. A ..... The effects of polymorphism of IGF-I, IGF-II and IGFBP-II marker loci on these traits are presented in Table 4. There were no significant associations between these three loci and body weight at 8 weeks ...

  6. Removal of Zn(II) and Pb (II) ions Using Rice Husk in Food Industrial ...

    African Journals Online (AJOL)

    Michael Horsfall

    Full-text Available Online at Removal of Zn(II) and Pb (II) ions Using Rice ... wastes such as tea waste and coffee (Orhan and. Buyukgungor, 1993), hazelnut straws, peanut hull, saw dusts ... Adsorbent: Rice husks were washed carefully first with tap water and then deionized water to remove particulate ...


    African Journals Online (AJOL)



    Jun 1, 2010 ... Department of Chemistry Bayero University, P. M. B. 3011, Kano, Nigeria. Correspondence author: ABSTRACT. The complexes of Mn (II) and Ni (II) with Schiff base derived from salicylaldehyde and 2- aminobenzoic acid have been prepared and characterized by gravimetry, ...

  8. Adsorption characteristics of Cu(II) and Pb(II) onto expanded perlite from aqueous solution. (United States)

    Sari, Ahmet; Tuzen, Mustafa; Citak, Demirhan; Soylak, Mustafa


    The adsorption characteristics of Cu(II) and Pb(II) onto expanded perlite (EP) from aqueous solution were investigated with respect to the changes in pH of solution, adsorbent dosage, contact time and temperature of solution. For the adsorption of both metal ions, the Langmuir isotherm model fitted to equilibrium data better than the Freundlich isotherm model. Using the Langmuir model equation, the monolayer adsorption capacity of EP was found to be 8.62 and 13.39 mg/g for Cu(II) and Pb(II) ions, respectively. Dubinin-Radushkevich (D-R) isotherm model was also applied to the equilibrium data and the mean free energies of adsorption were found as 10.82 kJ/mol for Cu(II) and 9.12 kJ/mol for Pb(II) indicating that the adsorption of both metal ions onto EP was taken place by chemical ion-exchange. Thermodynamic functions, the change of free energy (DeltaG degrees ), enthalpy (DeltaH degrees ) and entropy (DeltaS degrees ) of adsorption were also calculated for each metal ions. These parameters showed that the adsorption of Cu(II) and Pb(II) ions onto EP was feasible, spontaneous and exothermic at 20-50 degrees C. Experimental data were also evaluated in terms of kinetic characteristics of adsorption and it was found that adsorption process for both metal ions followed well pseudo-second-order kinetics.


    African Journals Online (AJOL)

    equilibrium adsorption capacity for lead and cadmium ions were obtained from Freundlich, Langmuir, Temkin and DRK isotherms and the experimental data were found to fit best the Langmuir isotherm with values of 21.28 and 40.00 mg/g for Cd(II) and Pb(II) ions, respectively. The Pseudo-second order kinetics model had ...

  10. Interesting properties of some iron(II), copper(I) and copper(II ...

    Indian Academy of Sciences (India)


    Tridendate ligands with nitrogen centers, generally well-known as the tripod ligands, have been of considerable interest to inorganic chemists dealing with the preparation of model compounds for hemocyanin, tyrosinase etc. We have found that such ligands when complexed with iron(II) and copper(II) and copper(I) ions ...

  11. Removal of copper (II), iron (III) and lead (II) ions from Mono ...

    African Journals Online (AJOL)


    Removal of copper (II), iron (III) and lead (II) ions from. Mono-component Simulated Waste Effluent by. Adsorption on Coconut Husk. Oyedeji O. Abdulrasaq* and Osinfade G. Basiru. Department of Science Laboratory Technology, Federal Polytechnic, Ilaro, Ogun State, Nigeria. Accepted 28 April 2010. The use of coconut ...

  12. Cobalt (III), nickel (II) and ruthenium (II) complexes of 1, 10 ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences; Volume 112; Issue 1. Cobalt(III), nickel(II) and ruthenium(II) complexes of 1,10-phenanthroline family of ligands: DNA binding and photocleavage studies. S Arounaguiri D Easwaramoorthy A Ashokkumar Aparna Dattagupta Bhaskar G Maiya. Inorganic and Analytical Volume ...

  13. Ion Flotation of Copper(II) and Lead(II) from Environmental Water ...

    African Journals Online (AJOL)

    The present study aims to develop a simple, rapid and economic procedure for copper(II) and lead(II) removal under the optimum conditions investigated. It is based on the complex formation between Cu2+ and Pb2+ ions and diphenylcarbazone (HDPC) followed by flotation with oleic acid (HOL) surfactant. The different ...

  14. Copper(II and lead(II complexation by humic acid and humic-like ligands

    Directory of Open Access Journals (Sweden)



    Full Text Available The stability of metal–humate complexes is an important factor determining and predicting speciation, mobility and bioavailability of heavy metals in the environment. A comparative investigation of the complexation of Cu(II and Pb(II with humic acid and humic-like ligands, such as benzoic and salicylic acid, was performed. The analysis was realized at pH 4.0, a temperature of 25 °C and at an ionic strength of 0.01 mol dm-3 (NaCl using the Schubert ion-exchange method and its modified form. The stability constants were calculated from the experimental data by the Schubert method for complexes with benzoic and humic acid. A modified Schubert method was used for the determination of the stability constants of the complexes with salicylic acid. It was found that Cu(II and Pb(II form mononuclear complexes with benzoic and humic acid while with salicylic acid both metals form polynuclear complexes. The results indicate that Pb(II has a higher binding ability than Cu(II to all the investigated ligands. The Cu(II–salicylate and Pb(II–salicylate complexes showed noticeable higher stability constants compared with their complexes with humic acid, while the stabilities of the complexes with benzoic acid differed less. Salicylic and benzoic acids as humic-like ligands can be used for setting the range of stability constants of humic complexes with Cu(II and Pb(II.

  15. Nickel(II) and copper(II) complexes with humic acid anions and their derivatives

    Energy Technology Data Exchange (ETDEWEB)

    Ryabova, I.N. [Kazakh Academy of Science, Karaganda (Kazakhstan)


    Complexation of Ni(II) and Cu(II) in aqueous solutions with anions of humic acids, extracted from naturally oxidized coal, and with their hydroxymethyl derivatives is studied spectrophotometrically and potentiometrically. The complexation stoichiometry and the stability constants of the complexes are determined.

  16. FeII/MgII Emission Line Ratio in High Redshift Quasars

    DEFF Research Database (Denmark)

    Dietrich, M.; Hamann, F.; Appenzeller, I.


    We present results of the analysis of near infrared spectroscopic observations of 6 high-redshift quasars (z > 4), emphasizing the measurement of the ultraviolet FeII/MgII emission line strength in order to estimate the beginning of intense star formation in the early universe. To investigate the...

  17. Endothelial-monocyte activating polypeptide II disrupts alveolar epithelial type II to type I cell transdifferentiation

    Directory of Open Access Journals (Sweden)

    Chen Yao


    Full Text Available Abstract Background Distal alveolar morphogenesis is marked by differentiation of alveolar type (AT-II to AT-I cells that give rise to the primary site of gas exchange, the alveolar/vascular interface. Endothelial-Monocyte Activating Polypeptide (EMAP II, an endogenous protein with anti-angiogenic properties, profoundly disrupts distal lung neovascularization and alveolar formation during lung morphogenesis, and is robustly expressed in the dysplastic alveolar regions of infants with Bronchopulmonary dysplasia. Determination as to whether EMAP II has a direct or indirect affect on ATII→ATI trans-differentiation has not been explored. Method In a controlled nonvascular environment, an in vitro model of ATII→ATI cell trans-differentiation was utilized to demonstrate the contribution that one vascular mediator has on distal epithelial cell differentiation. Results Here, we show that EMAP II significantly blocked ATII→ATI cell transdifferentiation by increasing cellular apoptosis and inhibiting expression of ATI markers. Moreover, EMAP II-treated ATII cells displayed myofibroblast characteristics, including elevated cellular proliferation, increased actin cytoskeleton stress fibers and Rho-GTPase activity, and increased nuclear:cytoplasmic volume. However, EMAP II-treated cells did not express the myofibroblast markers desmin or αSMA. Conclusion Our findings demonstrate that EMAP II interferes with ATII → ATI transdifferentiation resulting in a proliferating non-myofibroblast cell. These data identify the transdifferentiating alveolar cell as a possible target for EMAP II's induction of alveolar dysplasia.

  18. Adsorption of Mn(II) and Co(II) ions from aqueous solution using ...

    African Journals Online (AJOL)

    Adsorption of Mn(II) and Co(II) ions from aqueous solution using Maize cob activated carbon: Kinetics and Thermodynamics Studies. ... The SEM micrograph shows particle grains and jelly like rough surfaces, FTIR analysis results show different functional group in the MCAB adsorbent such as O-H, C=O, and C=C stretching ...

  19. Dynamic adsorption studies for the removal of Cd (II) and Ni (II) from ...

    African Journals Online (AJOL)

    A dynamic adsorption study was carried out using mahogany leaves (ML) powder as an adsorbent for the removal of Cd (II) and Ni (II) from their aqueous solutions. ... Recommendation was made such that, mahogany leaves should be studied for the remediation of other heavy metals, such as lead, chromium, mercury, zinc ...

  20. Synthesis and characterization of iron (ii) and nickel (ii) schiff base ...

    African Journals Online (AJOL)

    The complexes of iron (II) and nickel (II) with schiff base derived from benzoin and 2-amino benzoic acid have been prepared. Solubility, melting point, decomposition temperature, conductance measurement, infrared (IR) and UV – Visible spectrophotometric studies were used in characterizing the compounds. The melting ...


    African Journals Online (AJOL)


    planar complexes are diamagnetic [23]. The Ni(II) complexes reported in this work, are diamagnetic and consequently, four coordinate, square planar in geometry [19-20, 23], ruling out the presence of paramagnetic, tetrahedral forms. The room temperature magnetic moments of the copper(II) compounds are expected to be.

  2. Studies on some VO(IV), Ni(II) and Cu(II) complexes of non ...

    African Journals Online (AJOL)

    The ligands are tetradentately coordinating via the imine N and enolic O atoms, resulting in 5-coordinate square-pyramidal geometry for the VO(IV) complexes and 4-coordinate square-planar geometry for the Ni(II) and Cu(II) complexes. The assignment of geometry is supported by magnetic and spectral measurements.

  3. Synthesis, characterisation and electrochemical behaviour of Cu (II ...

    Indian Academy of Sciences (India)

    Neutral tetradentate N2O2 type complexes of Cu(II), Ni(II), Co(II) and Zn(II) have been synthesised using the Schiff base formed by the condensation of acetylacetone and p-anisidine. Microanalysis, molar conductance, magnetic susceptibility, IR, UV-Vis, 1H NMR, CV and EPR studies have been carried out to determine the ...

  4. The role of metallothionein II in neuronal differentiation and survival

    DEFF Research Database (Denmark)

    Køhler, Lene B; Berezin, Vladimir; Bock, Elisabeth


    Metallothionein I and II (MT-I+II) are antioxidant and tissue protective factors. We have previously shown that MT-I+II prevent oxidative stress and apoptotic cell death and are of therapeutic value in brain inflammation. However, MT-I+II are expressed in glia and it remains to be elucidated if M...

  5. Processing of MHC class II in dendritic cells

    NARCIS (Netherlands)

    ten Broeke, A.G.


    In the past years we performed studies to gain more insight into the processing of major histocompatibility class II (MHC class II) in dendritic cells. We focused on the sorting mechanisms of MHC class II, the degradation of its associated Ii and peptide loading at the endosomal system. In addition,

  6. ORF Sequence: NC_005810 [GENIUS II[Archive

    Lifescience Database Archive (English)


  7. 20 CFR 226.32 - Spouse tier II. (United States)


    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Spouse tier II. 226.32 Section 226.32... Spouse tier II. The spouse tier II benefit is computed as follows: (a) The employee's tier II amount as... before reduction for the railroad retirement family maximum, is multiplied by 45 percent. The spouse tier...

  8. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Pressurized With Xenon Gas ... pdb|1FZ9|D Chain D, Methane Monooxygenase Hydroxylase, ... Form Ii Cocrystallized...genase Hydroxylase, Form Ii ... Cocrystallized With Iodoethane pdb|1FZ8|D Chain D, ... Methane... Monooxygenase Hydroxylase, Form Ii ... Cocrystallized With Dibromomethane pdb|1FZ8|C Chain C, ... ... ... Methane Monooxygenase Hydroxylase, Form Ii ... Cocrystallized With Dibromomethane pdb|1FZ6|D Cha

  9. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available , Methane Monooxygenase Hydroxylase, ... Form Ii Cocrystallized With Iodoethane pdb|1FZ9|E Chain ... ... ... E, Methane Monooxygenase Hydroxylase, Form Ii ... Cocrystallized With Iodoethane pdb|1FZ8|F Ch...ain F, ... Methane Monooxygenase Hydroxylase, Form Ii ... Cocrystallized With Dibromomethane p...db|1FZ8|E Chain E, ... Methane Monooxygenase Hydroxylase, Form Ii ... Cocrystallized

  10. Synthesis, stereochemistry and antimicrobial activity of copper(II ...

    African Journals Online (AJOL)

    On the basis of the analytical data, magnetic moments and spectral data, a square-planar geometry has been proposed for the nickel(II) and copper(II) complexes with these ligands. Some representative complexes of copper(II) and nickel(II) were found to have remarkable antifungal and antibacterial activity. KEY WORDS: ...

  11. Biosorption of copper(II) and lead(II) onto potassium hydroxide treated pine cone powder. (United States)

    Ofomaja, A E; Naidoo, E B; Modise, S J


    Pine cone powder surface was treated with potassium hydroxide and applied for copper(II) and lead(II) removal from solution. Isotherm experiments and desorption tests were conducted and kinetic analysis was performed with increasing temperatures. As solution pH increased, the biosorption capacity and the change in hydrogen ion concentration in solution increased. The change in hydrogen ion concentration for lead(II) biosorption was slightly higher than for copper(II) biosorption. The results revealed that ion-exchange is the main mechanism for biosorption for both metal ions. The pseudo-first order kinetic model was unable to describe the biosorption process throughout the effective biosorption period while the modified pseudo-first order kinetics gave a better fit but could not predict the experimentally observed equilibrium capacities. The pseudo-second order kinetics gave a better fit to the experimental data over the temperature range from 291 to 347 K and the equilibrium capacity increased from 15.73 to 19.22 mg g(-1) for copper(II) and from 23.74 to 26.27 for lead(II). Activation energy was higher for lead(II) (22.40 kJ mol(-1)) than for copper(II) (20.36 kJ mol(-1)). The free energy of activation was higher for lead(II) than for copper(II) and the values of DeltaH* and DeltaS* indicate that the contribution of reorientation to the activation stage is higher for lead(II) than copper(II). This implies that lead(II) biosorption is more spontaneous than copper(II) biosorption. Equilibrium studies showed that the Langmuir isotherm gave a better fit for the equilibrium data indicating monolayer coverage of the biosorbent surface. There was only a small interaction between metal ions when simultaneously biosorbed and cation competition was higher for the Cu-Pb system than for the Pb-Cu system. Desorption studies and the Dubinin-Radushkevich isotherm and energy parameter, E, also support the ion-exchange mechanism. Copyright 2010 Elsevier Ltd. All rights reserved.

  12. Technoshamanic Visions from the Underworld II

    DEFF Research Database (Denmark)

    Weinel, Jonathan


    such as painting, other materials are also designed by creating pixel-art and by programming generative computer animations. These are ultimately combined with psychedelic music to form composites, which are mixed live with audio-reactive effects, using the VJ software VDMX. Aesthetically the work draws upon......Technoshamanic Visions from the Underworld II is an audio-visual art installation by Jon Weinel. The artwork consists of a video projection in which various analogue and digital animations are created as a compliment to music. While parts of the animations are created with traditional techniques...... the artist’s extensive practice-based research regarding altered states of consciousness. -- The paper describes an audio-visual arts installation/VJ mix with accompanying paintings, which was presented at the Carbon Meets Silicon II exhibition, Glyndwr University, Wrexham. Carbon Meets Silicon II was an art...

  13. Management of Skeletal Class II, deep bite

    Directory of Open Access Journals (Sweden)

    Poorya Naik Dhenu Shilya


    Full Text Available Class II, Division 2 malocclusion is a clinical entity, which presents a considerable difficulty in the provision of the stable result. Management of deep bite in adults has always been critical and requires proper diagnosis, individualized treatment planning and efficient application of treatment technique. Treatment modality depends on various types of skeletal, dental, and soft tissue problems. The correction of deep bite includes one or more of maxillary incisor intrusion, mandibular incisor intrusion, mandibular incisor proclination, maxillary posterior tooth extrusion, mandibular posterior tooth extrusion, or an increase of the lower face height. This case report describes the orthodontic treatment of an adult patient, who had presented a skeletal Class II, hypo divergent jaw pattern, skeletal deep bite, angles Class II Division 2 Malocclusion. The patient was treated with a combination of orthodontics and surgical line of treatment.

  14. Moessbauer-Spectrometer MIMOS II: Future applications

    Energy Technology Data Exchange (ETDEWEB)

    Klingelhoefer, Goestar; Blumers, Mathias; Schroeder, Christian; Fleischer, Iris; Lopez, Jordi G.; Sanchez, Jose F.; Hahn, Michaela; Upadhyay, Chandan [Institut fuer Anorganische Chemie und Analytische Chemie, Johannes Gutenberg Universitaet, Staudinger Weg 9, 55128 Mainz (Germany); Rodionov, Daniel [Institut fuer Anorganische Chemie und Analytische Chemie, Johannes Gutenberg Universitaet, Staudinger Weg 9, 55128 Mainz (Germany); Space Research Institute IKI, 117997 Moskau (Russian Federation)


    The Miniaturized Moessbauer Spectrometer MIMOS II operates on the surface of Mars for the last three years (part of NASA Mars Exploration Rovers scientific payload). Successful application of MIMOS II as a tool for detection/analysis of Fe-bearing minerals on the extraterrestrial surfaces has proven its use for other missions. Currently MIMOS II is a part of ExoMars and Phobos-Grunt missions. ExoMars is managed by the European Space Agency and planned to be launched in 2013. It involves the development of a sophisticated Mars rover with set of instruments to further characterize the biological environment on Mars in preparation for robotic missions and human exploration. Data from the mission should provide an input for broader studies of exobiology. Phobos-Grunt is developed by Russian Space Agency. Currently, launch is planned in 2009. The main goals of the mission are Phobos regolith sample return, Phobos in situ study and Mars/Phobos remote sensing.

  15. DARHT-II Downstream Beam Transport Beamline

    Energy Technology Data Exchange (ETDEWEB)

    Westenskow, G A; Bertolini, L R; Duffy, P T; Paul, A C


    This paper describes the mechanical design of the downstream beam transport line for the second axis of the Dual Axis Radiographic Hydrodynamic Test (DARHT II) Facility. The DARHT-II project is a collaboration between LANL, LBNL and LLNL. DARHT II is a 20-MeV, 2000-Amperes, 2-{micro}sec linear induction accelerator designed to generate short bursts of x-rays for the purpose of radiographing dense objects. The downstream beam transport line is approximately 20-meter long region extending from the end of the accelerator to the bremsstrahlung target. Within this proposed transport line there are 15 conventional solenoid, quadrupole and dipole magnets; as well as several specialty magnets, which transport and focus the beam to the target and to the beam dumps. There are two high power beam dumps, which are designed to absorb 80-kJ per pulse during accelerator start-up and operation. Aspects of the mechanical design of these elements are presented.

  16. TRUPACT-II residue pipe payload container

    Energy Technology Data Exchange (ETDEWEB)

    Geinitz, R. [Rocky Flats Environmental Technology Site, Golden, CO (United States); Gregory, P. [Westinghouse Electric Corp., Carlsbad, NM (United States). Waste Isolation Div.


    This paper summarizes the project to develop, test and certify a new payload container for the TRUPACT-II, a Type B packaging for the shipment of transuranic waste. The new payload container will provide segregation of plutonium waste materials within the TRUPACT-II. This segregation of fissile contents will support a new criticality safety analysis that may allow an increase in the TRUPACT-II Pu-239 Fissile Gram Equivalent (FGE) limit from 325 grams to 2800 grams. The need for this project was brought about by the end of the Cold War and the resulting shift in value of plutonium residues from providing recoverable Defense Program material to being considered disposable waste. This paper will not cover many of the details of the project but will instead aim to provide a general picture of all the project activities.

  17. Commissioning of the PLS-II (United States)

    Shin, S.; Kwon, S.; Kim, D.-T.; Kim, D.-E.; Kim, M.; Kim, S.-H.; Kim, S.-C.; Kim, J.; Kim, C.; Park, B.; Park, S.-S.; Park, S.-J.; Park, E.; Son, Y.; Yoon, J.; Lee, B.; Lee, E.; Lee, J.-W.; Lee, H.-S.; Joo, Y.; Choi, J.; Ha, T.; Hwang, W.; Hwang, I.; Lee, J.-Y.; Oh, B.; Lee, C.-H.; Lee, H.-S.; Kim, J.-Y.; Hwang, J. Y.; Nam, S. H.; Cho, M.


    After 14 years of successful operation, the Pohang Light Source (PLS) has completed PLS-II upgrade to meet the increasing demand from the growing user community. The PLS-II upgrade has increased the beam energy from 2.5 GeV to 3 GeV; the number of insertion devices has been increased by a factor of two (20 IDs); and the beam current has been increased to 400 mA from 200 mA. The beam emittance has been reduced to below 10 nm while retaining the existing PLS tunnel as well as the existing injection system. During the six months of commissioning in the latter half of 2011, we have successfully achieved 14 insertion device operations and top-up operations with 100 mA beam current and 5.8 nm beam emittance. In this paper, we report the experimental results obtained from the PLS-II commissioning.

  18. Sister chromatid segregation in meiosis II (United States)

    Wassmann, Katja


    Meiotic divisions (meiosis I and II) are specialized cell divisions to generate haploid gametes. The first meiotic division with the separation of chromosomes is named reductional division. The second division, which takes place immediately after meiosis I without intervening S-phase, is equational, with the separation of sister chromatids, similar to mitosis. This meiotic segregation pattern requires the two-step removal of the cohesin complex holding sister chromatids together: cohesin is removed from chromosome arms that have been subjected to homologous recombination in meiosis I and from the centromere region in meiosis II. Cohesin in the centromere region is protected from removal in meiosis I, but this protection has to be removed—deprotected”—for sister chromatid segregation in meiosis II. Whereas the mechanisms of cohesin protection are quite well understood, the mechanisms of deprotection have been largely unknown until recently. In this review I summarize our current knowledge on cohesin deprotection. PMID:23574717

  19. Angiotensin II during Experimentally Simulated Central Hypovolemia

    DEFF Research Database (Denmark)

    Jensen, Theo Walther; Olsen, Niels Vidiendal


    Central hypovolemia, defined as diminished blood volume in the heart and pulmonary vascular bed, is still an unresolved problem from a therapeutic point of view. The development of pharmaceutical agents targeted at specific angiotensin II receptors, such as the non-peptidergic AT2-receptor agonist...... compound 21, is yielding many opportunities to uncover more knowledge about angiotensin II receptor profiles and possible therapeutic use. Cardiovascular, anti-inflammatory, and neuroprotective therapeutic use of compound 21 have been suggested. However, there has not yet been a focus on the use...... of these agents in a hypovolemic setting. We argue that the latest debates on the effect of angiotensin II during hypovolemia might guide for future studies, investigating the effect of such agents during experimentally simulated central hypovolemia. The purpose of this review is to examine the role...

  20. Synthesis and characterization of thermally stable oligomer-metal complexes of copper(II, nickel(II, zinc(II and cobalt(II derived from oligo-p-nitrophenylazomethinephenol

    Directory of Open Access Journals (Sweden)

    Ufuk S. Vural


    Full Text Available Thermally stable metal complexes based on oligomers were prepared by the reaction between oligo-p-nitrophenilazomethinephenol (ONPAP and Cu(II, Ni(II, Zn(II and Co(II ions. The properties of oligomer-metal complexes were studied by elemental, FT-IR and magnetic moments analyses. The thermal stabilities of the oligomer-metal complexes were compared by thermogravimetric (TG and differential thermal (DTA analyses. According to TG, oligomer-metal complexes were stable against to temperature and thermooxidative decomposition. The weight losses of oligomer-metal complexes were found to be 5 and 50 % at 200 and > 850 (Cu(II, 172 and 600 (Ni(II, 252 and > 850 (Zn(II and 174 and 510 (Co(II, oC, respectively. Based on half degradation temperature parameters Cu(II and Zn(II complexes were more resistant than the others.

  1. Intrafibrillar Mineral May be Absent in Dentinogenesis Imperfecta Type II (DI-II)

    Energy Technology Data Exchange (ETDEWEB)

    Pople, John A


    High-resolution synchrotron radiation computed tomography (SRCT) and small angle x-ray scattering (SAXS) were performed on normal and dentinogenesis imperfecta type II (DI-II) teeth. Three normal and three DI-II human third molars were used in this study. The normal molars were unerupted and had intact enamel; donors were female and ranged in age from 18-21y. The DI-II specimens, which were also unerupted with intact enamel, came from a single female donor age 20y. SRCT showed that the mineral concentration was 33% lower on average in the DI-II dentin with respect to normal dentin. The SAXS spectra from normal dentin exhibited low-angle diffraction peaks at harmonics of 67.6 nm, consistent with nucleation and growth of the apatite phase within gaps in the collagen fibrils (intrafibrillar mineralization). In contrast, the low-angle peaks were almost nonexistent in the DI-II dentin. Crystallite thickness was independent of location in both DI-II and normal dentin, although the crystallites were significantly thicker in DI-II dentin (6.8 nm (s.d. = 0.5) vs 5.1 nm (s.d. = 0.6)). The shape factor of the crystallites, as determined by SAXS, showed a continuous progression in normal dentin from roughly one-dimensional (needle-like) near the pulp to two-dimensional (plate-like) near the dentin-enamel junction. The crystallites in DI-II dentin, on the other hand, remained needle-like throughout. The above observations are consistent with an absence of intrafibrillar mineral in DI-II dentin.

  2. Five coordinate M(II)-diphenolate [M = Zn(II), Ni(II), and Cu(II)] Schiff base complexes exhibiting metal- and ligand-based redox chemistry. (United States)

    Franks, Mark; Gadzhieva, Anastasia; Ghandhi, Laura; Murrell, David; Blake, Alexander J; Davies, E Stephen; Lewis, William; Moro, Fabrizio; McMaster, Jonathan; Schröder, Martin


    Five-coordinate Zn(II), Ni(II), and Cu(II) complexes containing pentadentate N(3)O(2) Schiff base ligands [1A](2-) and [1B](2-) have been synthesized and characterized. X-ray crystallographic studies reveal five coordinate structures in which each metal ion is bound by two imine N-donors, two phenolate O-donors, and a single amine N-donor. Electron paramagnetic resonance (EPR) spectroscopic studies suggest that the N(3)O(2) coordination spheres of [Cu(1A)] and [Cu(1B)] are retained in CH(2)Cl(2) solution and solid-state superconducting quantum interference device (SQUID) magnetometric studies confirm that [Ni(1A)] and [Ni(1B)] adopt high spin (S = 1) configurations. Each complex exhibits two reversible oxidation processes between +0.05 and +0.64 V vs [Fc](+)/[Fc]. The products of one- and two-electron oxidations have been studied by UV/vis spectroelectrochemistry and by EPR spectroscopy which confirm that each oxidation process for the Zn(II) and Cu(II) complexes is ligand-based with sequential formation of mono- and bis-phenoxyl radical species. In contrast, the one-electron oxidation of the Ni(II) complexes generates Ni(III) products. This assignment is supported by spectroelectrochemical and EPR spectroscopic studies, density functional theory (DFT) calculations, and the single crystal X-ray structure of [Ni(1A)][BF(4)] which contains Ni in a five-coordinate distorted trigonal bipyramidal geometry.

  3. MEDEA II two-pulse generator development

    Energy Technology Data Exchange (ETDEWEB)

    Bieniosek, F.M.; Honig, J.; Theby, E.A. (McDonnell Douglas Research Laboratories, P. O. Box 516, St. Louis, Missouri 63166 (USA))


    This article discusses improvements in the efficiency, output power, and operational flexibility of MEDEA II, a double-pulse electron beam accelerator at McDonnell Douglas Research Laboratories. A modified charging circuit, based on the triple-resonance pulse transformer concept, was implemented on both of MEDEA II's two stages. The output switches were modified to increase maximum output voltages, and a new, second output switch with asymmetric breakdown characteristics was developed. To avoid degradation of the second-pulse output waveform at the diode, a keep-alive circuit was installed. The effects of diode closure on double-pulse operation are also discussed.

  4. MEDEA II two-pulse generator development (United States)

    Bieniosek, F. M.; Honig, J.; Theby, E. A.


    This article discusses improvements in the efficiency, output power, and operational flexibility of MEDEA II, a double-pulse electron beam accelerator at McDonnell Douglas Research Laboratories. A modified charging circuit, based on the triple-resonance pulse transformer concept, was implemented on both of MEDEA II's two stages. The output switches were modified to increase maximum output voltages, and a new, second output switch with asymmetric breakdown characteristics was developed. To avoid degradation of the second-pulse output waveform at the diode, a keep-alive circuit was installed. The effects of diode closure on double-pulse operation are also discussed.

  5. The PIP-II Reference Design Report

    Energy Technology Data Exchange (ETDEWEB)

    Lebedev, Valeri, [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); et al.


    The Proton Improvement Plan-II (PIP-II) is a high-intensity proton facility being developed to support a world-leading neutrino program over the next two decades at Fermilab. PIP-II is an integral part of the U.S. Intensity Frontier Roadmap as described in the Particle Physics Project Prioritization Panel (P5) report of May 2014 [1]. As an immediate goal PIP-II is focused on upgrades to the Fermilab accelerator complex capable of providing a beam power in excess of 1 MW on target at the initiation of LBNF [1,2] operations. PIP-II is a part of a longer-term concept for a sustained campaign of upgrades and improvements to achieve multi-MW capabilities at Fermilab. PIP-II is based on three major thrusts. They are (1) the recently completed upgrades to the Recycler and Main Injector (MI) for the NOvA experiment, (2) the Proton Improvement Plan [3] currently underway, and (3) the Project X Reference Design [4]. Note that: The Proton Improvement Plan (PIP) consolidates a set of improvements to the existing Linac, Booster, and Main Injector (MI) aimed at supporting 15 Hz Booster beam operation. In combination, the NOvA upgrades and PIP create a capability of delivering 700 kW beam power from the Main Injector at 120 GeV; The scope of the Project X Reference Design Report was aimed well beyond PIP. It described a complete concept for a multi-MW proton facility that could support a broad particle physics program based on neutrino, kaon, muon, and nucleon experiments [5,6]. The Project X conceptual design has evolved over a number of years, incorporating continuous input on physics research goals and advances in the underlying technology development programs [7,8,9]. PIP-II, to high degree, inherits these goals as the goals for future developments and upgrades. This document (PIP-II Reference Design Report) describes an initial step in the development of the Fermilab accelerating complex. The plan described in this Report balances the far-term goals of the Laboratory

  6. Rare kaon decays at LAMPF II

    Energy Technology Data Exchange (ETDEWEB)

    Sanford, T.W.L.


    At LAMPF II, intense beams of kaons will be available that will enable the rare kaon-decay processes to be investigated. This note explores some of the possibilities, which divide into two classes: (1) those that test the standard model of Weinberg and Salam and (2) those that are sensitive to new interactions. For both classes, experiments have been limited not by systematic errors but rather by statistical ones. LAMPF II with its intense flux of kaons thus will enable the frontier of rare kaon decay to be realistically probed.

  7. The Mark II Vertex Drift Chamber

    Energy Technology Data Exchange (ETDEWEB)

    Alexander, J.P.; Baggs, R.; Fujino, D.; Hayes, K.; Hoard, C.; Hower, N.; Hutchinson, D.; Jaros, J.A.; Koetke, D.; Kowalski, L.A.


    We have completed constructing and begun operating the Mark II Drift Chamber Vertex Detector. The chamber, based on a modified jet cell design, achieves 30 {mu}m spatial resolution and <1000 {mu}m track-pair resolution in pressurized CO{sub 2} gas mixtures. Special emphasis has been placed on controlling systematic errors including the use of novel construction techniques which permit accurate wire placement. Chamber performance has been studied with cosmic ray tracks collected with the chamber located both inside and outside the Mark II. Results on spatial resolution, average pulse shape, and some properties of CO{sub 2} mixtures are presented. 10 refs., 12 figs., 1 tab.

  8. CLADS analysis deliverables. Volume II. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Holland, L.L.; Frede, W.G.; Schleuter, M.E.; Grant, S.E.; Glass, H.H.; Atkinson, K.C.


    The functional specification for the Laboratory Technical Information System is contained in Volumes I and II of the CLADS Analysis Deliverables. This specification is the result of applying Structured Analysis and Information Analysis to the Materials Evaluation Laboratory during the analysis phase of this project. Volume I includes 22 data flow diagrams (DFDs), a complete data dictionary containing data elements, data flows, and dialog definitions. Definitions also are included for 77 automated stores or files. These deliverables comprise the user's functional system specification and will be used as input to subsequent project phases, including software design. Volume II of the CLADS Analysis Deliverables covers Data Flow and Element Definitions.

  9. Psychometric Properties of the Beck Depression Inventory-II (BDI-II) among Community-Dwelling Older Adults (United States)

    Segal, Daniel L.; Coolidge, Frederick L.; Cahill, Brian S.; O'Riley, Alisa A.


    The psychometric properties of the Beck Depression Inventory-II (BDI-II) as a self-administered screening tool for depressive symptoms were examined in a sample of community-dwelling older and younger adults. Participants completed the BDI-II, the Center for Epidemiologic Studies Depression Scale, the Coolidge Axis II Inventory, the Perceived…

  10. Spectroscopic, DNA binding ability, biological activity, DFT calculations and non linear optical properties (NLO) of novel Co(II), Cu(II), Zn(II), Cd(II) and Hg(II) complexes with ONS Schiff base (United States)

    Abdel Aziz, Ayman A.; Elantabli, Fatma M.; Moustafa, H.; El-Medani, Samir M.


    The reaction of Co(II), Cu(II), Zn(II), Cd(II) and Hg(II) with the synthesized N-(2-hydroxy-1-naphthylidene)-2-aminothiophenol Schiff base ligand (H2L) at room temperature resulted in the formation of the five complexes; [Co(HL)2]H2O, 1; [M(HL)2] (M = Cu, Zn and Cd), (2-4) and [Hg(HL)Cl], 5. The ligand and its complexes were characterized based on elemental analyses, IR, 1H NMR, magnetic measurement, molar conductance, and thermal analysis. Coats and Redfern method was used to compute the kinetic and thermodynamic parameters. Antimicrobial activities of H2L and its complexes have been studied. The binding of Co(II), Cu(II) and Zn(II) complexes to calf thymus DNA (CT-DNA) has been investigated using UV-Vis and fluorescence absorption spectra. The results indicated that the ligand and its complexes may bind to DNA by intercalation modes, with a much higher binding affinity of the complexes than that of the ligand. The equilibrium geometries of the studied complexes are investigated theoretically at the B3LYP/LANL2DZ level of theory, and it was found that these geometries are non-linear. The calculated EHOMO and ELUMO energies of the studied complexes can be used to calculate the global properties. The calculated nonlinear optical parameters (NLO); first order hyperpolarizibility (β) of the studied complexes show promising optical properties.

  11. Kinetically controlled separation of cadmium(II) from zinc(II) with dithizone in the presence of nitrilotriacetic acid. (United States)

    Itabashi, H; Yoshida, M; Kawamoto, H


    The extraction rates of cadmium(II) and zinc(II) with dithizone (H2dz) in the presence of nitrilotriacetic acid (NTA) were measured, and the possible kinetic separation of cadmium(II) from zinc(II) was investigated. Upon the addition of NTA, the difference in the extraction rate between cadmium(II) and zinc(II) became large. Based on the observed rate constant under the condition [NTA] = 1 x 10(-2) mol dm-3, [H2dz]org = 1 x 10(-3) mol dm-3, and pH = 7.0, the shaking time required for the quantitative separation of cadmium(II) from zinc(II) was calculated to be between 326 and 995 s. The experimental results agreed with the prediction, and the quantitative separation of cadmium(II) from zinc(II) was performed within the above-mentioned range of shaking times.

  12. Synthesis and Spectral Investigations of Manganese(II, Cobalt(II, Nickel(II, Copper(II and Zinc(II Complexes of New Polydentate Ligands Containing a 1,8-Naphthyridine Moiety

    Directory of Open Access Journals (Sweden)

    Sunkari Jyothi


    Full Text Available 2-(o-Hydroxyphenyl-1,8-naphthyridine (HN, 2-(4-hydroxy-6-methylpyran-2-one-3-yl-1,8-naphthyridine (HMPN and 2-(benzimidazol-2-yl-1,8-naphthyridine(BN react with acetates of Mn(II, Co(II, Ni(II, Cu(II and Zn(II to yield metal ioncomplexes of definite composition. These compounds were characterized by elementalanalyses, molar conductivity, magnetic susceptibility measurements, thermal studies, IR,UV-visible, NMR and mass spectral investigations. The complexes are found to have theformulae [M(HN2(H2O2], [M(HMPN2(H2O2] and [M(BN2(OAc2], respectively.

  13. Biosorption studies on copper (II) and cadmium (II) using pretreated rice straw and rice husk. (United States)

    Li, W C; Law, F Y; Chan, Y H M


    This study investigated the adsorption and removal behaviour of copper (Cu) (II) and cadmium (Cd) (II) ions using rice husk and rice straw in aqueous solutions. Different parameters were used to investigate their adsorption performance in saline conditions and the optimal level of biosorption at different pH levels. The main parameters were pH (3, 6 and 9), initial concentration level of heavy metals (Cu (II) 5, 10, 20, 40 and 60 mg/L and Cd (II) 0.5, 1, 2, 4 and 8 mg/L, respectively), salinity (0, 50 and 100 mM NaCl) and contact time (ranging from 3 to 60 min). Langmuir and Freundlich isotherm models were applied to analyse the removal efficiency and sorption capacity of the pretreated rice husk and rice straw. The removal efficiency and adsorption capacity generally increased with the pH and reached a plateau in alkaline conditions. The percentage removal of Cu (II) by rice husk reached 97 % at pH 9 and 95 % by rice straw at pH 6. Biosorption performance increased in the absence of NaCl. Kinetic studies for both metals revealed that the biosorption of Cu (II) and Cd (II) onto rice straw and husk was pseudo-second order.

  14. Potentiometric and spectrophotometric studies of Mn{sup II} and Ni{sup II} cimetidine complexes

    Energy Technology Data Exchange (ETDEWEB)

    Kanumfre, Francieli; Lima, Eliane M. de; Scheidt, Gabriele; Carneiro, Paulo I.B.; Rosso, Neiva D., E-mail: ndrosso@uepg.b [Universidade Estadual de Ponta Grossa, PR (Brazil). Dept. de Quimica


    Cimetidine is an important hydrogen histamine receptor which has the ability to chelate metal ions in blood plasma and in different tissues. This study aimed to determine the stability constants for the cimetidine ligand with Mn{sup II} and Ni{sup II} metallic ions, synthesizing complexes and characterizing them by infrared spectroscopy, IR, and hydrogen nuclear magnetic resonance, {sup 1}H NMR. Cimetidine protonation constant regarding to the imidazole group was log K 7.05 and the stability constants for Mn{sup II} and Ni{sup II} complexes, ML{sub 2} species were log K 3.75 and 2.97, respectively, in 0.100 mol L{sup -1} KCl. The interpretation of IR and {sup H}1 NMR spectra for complexes Mn{sup II}-cim{sub 2} and Ni{sup II}-cim{sub 2} indicated that their formation occurs through the sulfur atoms in the thiol group, nitrogen atoms of imidazole ring, and nitrogen atoms of secondary amine. The nitrile group seems to be involved in the complexation of the Ni{sup II}-cim{sub 2} complex. (author)

  15. Expression Profiles of Cellular Retinol-binding Protein, Type II (CRBP II) in Erlang Mountainous Chickens. (United States)

    Yin, H D; Tian, K; Li, D Y; Gilbert, E R; Xiao, L H; Chen, S Y; Wang, Y; Liu, Y P; Zhao, X L; Zhu, Q


    Cellular retinol-binding protein II (CRBP II) belongs to the family of cellular retinol-binding proteins and plays a major role in absorption, transport, and metabolism of vitamin A. In addition, because vitamin A is correlated with reproductive performance, we measured CRBP II mRNA abundance in erlang mountainous chickens by real-time PCR using the relative quantification method. The expression of CRBP II showed a tissue-specific pattern and egg production rate-dependent changes. The expression was very high (p<0.05) in jejunum and liver, intermediate in kidney, ovary, and oviduct, and lowest (p<0.05) in heart, hypothalamus, and pituitary. In the hypothalamus, oviduct, ovary, and pituitary, CRBP II mRNA abundance were correlated to egg production rate, which increased from 12 wk to 32 wk, peaked at 32 wk relative to the other time points, and then decreased from 32 wk to 45 wk. In contrast, the expression of CRBP II mRNA in heart, jejunum, kidney, and liver was not different at any of the ages evaluated in this study. These data may help to understand the genetic basis of vitamin A metabolism, and suggest that CRBP II may be a candidate gene to affect egg production traits in chickens.

  16. Expression Profiles of Cellular Retinol-binding Protein, Type II (CRBP II in Erlang Mountainous Chickens

    Directory of Open Access Journals (Sweden)

    H. D. Yin


    Full Text Available Cellular retinol-binding protein II (CRBP II belongs to the family of cellular retinol-binding proteins and plays a major role in absorption, transport, and metabolism of vitamin A. In addition, because vitamin A is correlated with reproductive performance, we measured CRBP II mRNA abundance in erlang mountainous chickens by real-time PCR using the relative quantification method. The expression of CRBP II showed a tissue-specific pattern and egg production rate-dependent changes. The expression was very high (p<0.05 in jejunum and liver, intermediate in kidney, ovary, and oviduct, and lowest (p<0.05 in heart, hypothalamus, and pituitary. In the hypothalamus, oviduct, ovary, and pituitary, CRBP II mRNA abundance were correlated to egg production rate, which increased from 12 wk to 32 wk, peaked at 32 wk relative to the other time points, and then decreased from 32 wk to 45 wk. In contrast, the expression of CRBP II mRNA in heart, jejunum, kidney, and liver was not different at any of the ages evaluated in this study. These data may help to understand the genetic basis of vitamin A metabolism, and suggest that CRBP II may be a candidate gene to affect egg production traits in chickens.

  17. Comparison of APACHE II and three abbreviated APACHE II scores for predicting outcome among emergency trauma patients


    Polita,Jorge Roberto; Gomez, Jussara; Friedman,Gilberto; Ribeiro, Sérgio Pinto


    Objective: to compare the ability of the APACHE II score and three different abbreviated APACHE II scores: simplified APACHE II (s-APACHE II), Rapid Acute Physiology score (RAPS) and Rapid Emergency Medicine score to evaluate in-hospital mortality of trauma patients at the emergency department (ED). Methods: retrospective analysis of a prospective cohort study. All patients' victims of trauma admitted to the ED, during a 5 months period. For all entries to the ED, APACHE II score was calcu...

  18. The Bipolar II Depression Questionnaire: A Self-Report Tool for Detecting Bipolar II Depression.

    Directory of Open Access Journals (Sweden)

    Chi Ming Leung

    Full Text Available Bipolar II (BP-II depression is often misdiagnosed as unipolar (UP depression, resulting in suboptimal treatment. Tools for differentiating between these two types of depression are lacking. This study aimed to develop a simple, self-report screening instrument to help distinguish BP-II depression from UP depressive disorder. A prototype BP-II depression questionnaire (BPIIDQ-P was constructed following a literature review, panel discussions and a field trial. Consecutively assessed patients with a diagnosis of depressive disorder or BP with depressive episodes completed the BPIIDQ-P at a psychiatric outpatient clinic in Hong Kong between October and December 2013. Data were analyzed using discriminant analysis and logistic regression. Of the 298 subjects recruited, 65 (21.8% were males and 233 (78.2% females. There were 112 (37.6% subjects with BP depression [BP-I = 42 (14.1%, BP-II = 70 (23.5%] and 182 (62.4% with UP depression. Based on family history, age at onset, postpartum depression, episodic course, attacks of anxiety, hypersomnia, social phobia and agoraphobia, the 8-item BPIIDQ-8 was constructed. The BPIIDQ-8 differentiated subjects with BP-II from those with UP depression with a sensitivity/specificity of 0.75/0.63 for the whole sample and 0.77/0.72 for a female subgroup with a history of childbirth. The BPIIDQ-8 can differentiate BP-II from UP depression at the secondary care level with satisfactory to good reliability and validity. It has good potential as a screening tool for BP-II depression in primary care settings. Recall bias, the relatively small sample size, and the high proportion of females in the BP-II sample limit the generalization of the results.

  19. Ulex europaeus agglutinin II (UEA-II) is a novel, potent inhibitor of complement activation. (United States)

    Lekowski, R; Collard, C D; Reenstra, W R; Stahl, G L


    Complement is an important mediator of vascular injury following oxidative stress. We recently demonstrated that complement activation following endothelial oxidative stress is mediated by mannose-binding lectin (MBL) and activation of the lectin complement pathway. Here, we investigated whether nine plant lectins which have a binding profile similar to that of MBL competitively inhibit MBL deposition and subsequent complement activation following human umbilical vein endothelial cell (HUVEC) oxidative stress. HUVEC oxidative stress (1% O(2), 24 hr) significantly increased Ulex europaeus agglutinin II (UEA-II) binding by 72 +/- 9% compared to normoxic cells. UEA-II inhibited MBL binding to HUVEC in a concentration-dependent manner following oxidative stress. Further, MBL inhibited UEA-II binding to HUVEC in a concentration-dependent manner following oxidative stress, suggesting a common ligand. UEA-II (< or = 100 micromol/L) did not attenuate the hemolytic activity, nor did it inhibit C3a des Arg formation from alternative or classical complement pathway-specific hemolytic assays. C3 deposition (measured by ELISA) following HUVEC oxidative stress was inhibited by UEA-II in a concentration-dependent manner (IC(50) = 10 pmol/L). UEA-II inhibited C3 and MBL co-localization (confocal microscopy) in a concentration-dependent manner on HUVEC following oxidative stress (IC(50) approximately 1 pmol/L). Finally, UEA-II significantly inhibited complement-dependent neutrophil chemotaxis, but failed to inhibit fMLP-mediated chemotaxis, following endothelial oxidative stress. These data demonstrate that UEA-II is a novel, potent inhibitor of human MBL deposition and complement activation following human endothelial oxidative stress.

  20. Solvent Refined Coal-II (SRC-II) detailed environmental plan

    Energy Technology Data Exchange (ETDEWEB)


    This document describes environmental research which will: aid in the development of an environmentally acceptable SRC-II process; and provide data for environmental assessment of the process. The SRC-II process is described, criteria for selection of samples to undergo environmental analyses are given, and approximate timelines are presented for obtaining pertinent samples. At this time, the SRC-II process is at the pilot-plant stage of development and a demonstration facility is scheduled to begin operation in 1984. Since design criteria may change, the environmental research described in this document is organized in four phases which correlate with and will provide information early in process development. Phase I research (screening) evaluates samples from existing SRC-II facilities (pilot, process demonstration unit (PDU), bench) which may bracket potential demonstration/commercial practice in terms of physical and chemical criteria. The samples are being subjected to a battery of short-term biomedical and ecological assays. Chemical fractionation and analysis are being performed to determine compounds and compound classes of potential concern. Phase II (baseline) research will evaluate SRC-II materials which are considered most representative of potential demonstration/commercial practice. These materials will be subjected to longer-term, more-extensive biological and ecological analyses relative to effects and environmental fate. Phase III research will examine effects of process modification, control technologies and changing operational conditions on potential environmental properties of SRC-II materials. Phase IV research (onsite monitoring) will develop methods and initiate environmental monitoring for effects at the SRC-II demonstration facility and potential commercial sites. This document also describes industrial hygiene programs which must occur throughout SRC-II process development.

  1. Application II: Search Arts and Sports Photography

    Indian Academy of Sciences (India)

    First page Back Continue Last page Overview Graphics. Application II: Search Arts and Sports Photography. Depth variation induces defocus. Defocus blur is severe in nature and sports photography. Given a low DOF image, segment the focused region and retrieve the images based similarities in the focused region.

  2. Non-Destructive Inspection Practices. Volume II (United States)


    structure. Distitnds and other tlaws miodifyv the elastic propierties of this structure thus creating variations in the crystal load Tile Sonic Resonator...ii rese~al blisters which mayv disappedir when the paurt aook .aad thle intern~al pressutre as redaced Wheat ! %oid-tree Iiviiiti~le facings are used

  3. Cobalt (II) supported on ethylenediamine-functionalized ...

    Indian Academy of Sciences (India)

    Ethylenediamine-functionalized nanocellulose complexed with cobalt(II) was found to be a highly efficient heterogeneous catalyst for the room temperature aerobic oxidation of various types of primary and secondary benzylic alcohols into their corresponding aldehydes and ketones, respectively. The catalyst showed no ...

  4. EBR-II fuel slug casting experience

    Energy Technology Data Exchange (ETDEWEB)

    Wilkes, C. W.; Batte`, G. L.; Tracy, D. B.; Griffiths, V.


    The following paper presents a chronology of EBR-II fuel slug casting experience. Starting with the early vendor campaigns, the paper explains how production of EBR-II fuel, as well as fuel for off-site reactors, has evolved. The production facilities (i.e., EFL, Room 20, FMF, etc.) and casting techniques are discussed in detail. The paper also presents how the original casting operations have improved and the problems encountered as the techniques were developed. Extensive descriptions and data are given on the major experimental programs currently ongoing at EBR-II. Major programs include the IFR lead subassemblies, large diameter slugs, IFR metal fuel RBCB, and the FFTF subassembly program. Concluding the paper is a brief description of future development projects being considered and a summation of how EBR-II Fuels and Materials has been able to overcome various administration obstacles (i.e., improved security and safeguards measures) to continue to meet the increasing demands of fuel production while maintaining an aggressive and active research and development program in fuel slug production.

  5. Microbunching phenomena in LCLS-II

    Energy Technology Data Exchange (ETDEWEB)

    Venturini, M. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Qiang, J. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Papadopoulos, C. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Ding, Y. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Emma, P. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Huang, Z. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Marcus, G. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Marinelli, A. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Nosochkov, Y. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Raubenheimer, T. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Wang, L. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Woodley, M. [SLAC National Accelerator Lab., Menlo Park, CA (United States)


    The microbunching instability has long been recognized as a potential limiting factor to the performance of X-ray FELs. It is of particular relevance in LCLS-II due, in part, to a layout that includes a long bypass beamline between the Linac and the undulators. Here we focus on two aspects of the instability that highlight the importance of 3D effects.

  6. Cyclometallated ruthenium (II) carbonyl complexes with 1 ...

    Indian Academy of Sciences (India)

    A facile method for the synthesis of a series of cyclometallated ruthenium(II) carbonyl complexes with 1-pyrenaldehyde 4-R-3-thiosemicarbazones (H2Ln where the two H's represent the dissociable thioamide and pyrenyl protons; R = H, Me and Ph) has been described. The characterization of the complexes having the ...

  7. An Emphasis on World War II. (United States)

    Larrabee, Larry


    Argues that World War II's central place in 20th century history justifies a longer time unit. Asserts that connections must be drawn between prewar and postwar political events. Contains many suggestions for class activities, including debates, statistical projects, and oral reports. (MJP)

  8. Properties of Chemically Synthesized Nanostructured Copper (II ...

    African Journals Online (AJOL)

    Wet chemical method has been successfully used in preparation of Copper (II) Oxide Thin Film by spin coating on glass substrates, at an annealing temperature of 600°C for 1 hour in air. It has high absorbency within visible region wavelength 400 – 700 nm of the electromagnetic wave, making it a suitable absorber in the ...

  9. NNDSS - Table II. West Nile virus disease (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile virus disease - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  10. Ni (II) decorated nano silicoaluminophosphate molecular sieves ...

    Indian Academy of Sciences (India)

    Ni(II) decorated nano silicoaluminophosphate molecular sieves-modified carbon paste electrode as an electrocatalyst for electrooxidation of methanol ... of Science, Babol University of Technology, Babol 47148-71167, Iran; Biofuel & Renewable Energy Research Center, Faculty of Chemical Engineering, Babol University ...

  11. NNDSS - Table II. Mumps to Rabies, animal (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Mumps to Rabies, animal - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  12. Finanzierungsprobleme des Mittelstandes durch Basel II?


    Eggert, Rolf; Bös, Dieter; Paffenholz, Guido; Kolbeck, Christoph D.


    Der Mittelstand befürchtet durch die Neufassung der Baseler Eigenkapitalrichtlinien für Kreditinstitute Finanzierungsschwierigkeiten. Welche Bedeutung haben Bankkredite gegenwärtig bei der Finanzierung mittelständischer Unternehmen? Wird es als Folge von Basel II zu einer Kreditverknappung kommen?

  13. Toward an Integrated Psychological Approach - Phase II

    International Development Research Centre (IDRC) Digital Library (Canada)

    Trauma, Development and Peacebuilding : Toward an Integrated Psychological Approach - Phase II. Over the past decade, the peace, conflict and development community has begun to question the value of medicalized approaches such as post-traumatic stress disorder (PTSD) in dealing with aftermath of political violence ...

  14. LHC Experiments Phase II - TDRs Approval Process

    CERN Document Server

    Forti, F


    The overall review process and steps of Phase II were described in CERN-LHCC-2015-077. As experiments submit detailed technical design reports (TDRs), the LHCC and UCG work in close connection to ensure a timely review of the scientific and technical feasibility as well as of the budget and schedule of the upgrade programme.

  15. Computational Lower Bounds Using Diagonalization-II

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 15; Issue 4. Computational Lower Bounds Using Diagonalization - II. M V Panduranga Rao. General Article Volume 15 Issue 4 April 2010 pp 337-346 ... Keywords. Diagonalization; time–hierarchy theorem; relativization; Baker–Gill–Solovay theorem.

  16. Technoshamanic Visions from the Underworld II

    DEFF Research Database (Denmark)

    Audio-visual arts installation/VJ mix with accompanying paintings, for presentation at the Carbon Meets Silicon II exhibition, Glyndwr University, Wrexham. Accompanying article in proceedings/exhibition catalogue. The audio-visual work was also presented at Breaking Convention 2017, University...

  17. Wavelets: Applications to Image Compression-II

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 3. Wavelets: Applications to Image Compression – II. Sachin P Nanavati ... National PARAM Supercomputing Facility, Centre for Development of Advanced Computing (C-DAC). Pune University Campus, Ganesh Khind, Pune 411 007, India.

  18. The Nanocluster Trap endstation at BESSY II

    Directory of Open Access Journals (Sweden)

    Tobias Lau


    Full Text Available The Nanocluster Trap endstation at BESSY II combines a cryogenic linear radio-frequency ion trap with an applied magnetic field for x-ray magnetic circular dichroism studies of cold and size-selected trapped ions. Applications include atomic, molecular, and cluster ions as well as ionic complexes.

  19. Cu(II) promotes amyloid pore formation

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Hangyu, E-mail: [Weldon School of Biomedical Engineering, Purdue University, West Lafayette, IN 47907 (United States); Rochet, Jean-Christophe [Department of Medicinal Chemistry and Molecular Pharmacology, Purdue University, West Lafayette, IN 47907 (United States); Stanciu, Lia A. [Weldon School of Biomedical Engineering, Purdue University, West Lafayette, IN 47907 (United States); School of Materials Engineering, Purdue University, West Lafayette, IN 47907 (United States)


    The aggregation of α-synuclein is associated with dopamine neuron death in Parkinson's disease. There is controversy in the field over the question of which species of the aggregates, fibrils or protofibrils, are toxic. Moreover, compelling evidence suggested the exposure to heavy metals to be a risk of PD. Nevertheless, the mechanism of metal ions in promoting PD remains unclear. In this research, we investigated the structural basis of Cu(II) induced aggregation of α-synuclein. Using transmission electron microscopy experiments, Cu(II) was found to promote in vitro aggregation of α-synuclein by facilitating annular protofibril formation rather than fibril formation. Furthermore, neuroprotective baicalein disaggregated annular protofibrils accompanied by considerable decrease of β-sheet content. These results strongly support the hypothesis that annular protofibrils are the toxic species, rather than fibrils, thereby inspiring us to search novel therapeutic strategies for the suppression of the toxic annular protofibril formation. - Highlights: • Cu(II) promoted the annular protofibril formation of α-synuclein in vitro. • Cu(II) postponed the in vitro fibrillization of α-synuclein. • Neuroprotective baicalein disaggregated annular protofibrils.

  20. Theory of Aircraft Flight. Aerospace Education II. (United States)

    Elmer, James D.

    This revised textbook, one in the Aerospace Education II series, provides answers to many questions related to airplanes and properties of air flight. The first chapter provides a description of aerodynamic forces and deals with concepts such as acceleration, velocity, and forces of flight. The second chapter is devoted to the discussion of…

  1. The Meaning of Integration-II

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 5. The Meaning of Integration – II. A K Nandakumaran. General Article Volume 9 Issue 5 May 2004 pp 41-50. Fulltext. Click here to view fulltext PDF. Permanent link: Keywords. Riemann ...

  2. PIP-II Transfer Line Design

    Energy Technology Data Exchange (ETDEWEB)

    Vivoli, A. [Fermilab


    The U.S. Particle Physics Project Prioritization Panel (P5) report encouraged the realization of Fermilab's Proton Improvement Plan II (PIP-II) to support future neutrino programs in the United States. PIP-II aims at enhancing the capabilities of the Fermilab existing accelerator complex while simultaneously providing a flexible platform for its future upgrades. The central part of PIP-II project is the construction of a new 800 MeV H- Superconducting (SC) Linac together with upgrades of the Booster and Main Injector synchrotrons. New transfer lines will also be needed to deliver beam to the down-stream accelerators and facilities. In this paper we present the recent development of the design of the transfer lines discussing the principles that guided their design, the constraints and requirements imposed by the existing accelerator complex and the following modifications implemented to comply with a better understanding of the limitations and further requirements that emerged during the development of the project.

  3. Site Environmental Report for 2008, Volume II

    Energy Technology Data Exchange (ETDEWEB)

    Lackner, Regina; Baskin, David; Fox, Robert; Jelinski, John; Pauer, Ron; Thorson, Patrick; Wahl, Linnea; Xu, Suying


    The Site Environmental Report for 2008 is an integrated report on environmental programs at Lawrence Berkeley National Laboratory and satisfies the requirements of DOE Order 231.1 A., Environment, Safety, and Health Reporting. Volume II contains individual data results from surveillance and monitoring activities

  4. Country report INDIA - MFS II EVALUATIONS

    NARCIS (Netherlands)

    Lensink, R.; Bedi, A.; Gangopadhyay, S.; Ghosh, N.; Goderis, B.; Kumar Yadav, B.; Meesters, A.; Prasad Mohapatra, B.; Rao Sahib, P.; Sethi, S.; Sharma, P.; Srinivasan, S.; Klaver, D.C.; Desalos, C.B.; Hofstede, M.; Wadhwa, S.; Pandey, R.; Madaan, A.; Kalra, A.; Kusters, C.S.L.; Bhargava, S.; Buizer, N.N.; Kishore Das, A.; Wilson Bhatra, R.; Sen, P.; Bulte, E.; Pradhan, M.


    This report on India is one of a series of evaluation reports, consisting of ten reports in total, reflecting the results of the jointly-organised MFS II evaluation: - Eight country reports (India, Bangladesh, Ethiopia, Uganda, Indonesia, DR Congo, Liberia, Pakistan); - A synthesis report (covering


    NARCIS (Netherlands)

    Klaver, D.C.; Kusters, C.S.L.; Pradhan, M.; Vigh, M.; Groot Bruinderink, M.; Rossum, van I.; Böhnke, L.; Wallaart, K.; Malamas, S.; Berkhout, E.; Ni Wayan Suriasatini,; Sikoki, B.; Ginting, M.B.; Mulia, M.; Ningsih, K.; Pujiastuti, S.; Dwi Andari, B.; Suprobo, N.; Priyahita, W.; Sihombing, R.R.; Rokhmatulloh, S.W.; Rosita, I.; Wieriks, M.; Smidt, H.; Nugroho, K.; Prasetyo, K.; Larastiti, C.; Amir, S.; Sutikno,


    This report on Indonesia is one of a series of evaluation reports, consisting of ten reports in total, reflecting the results of the jointly-organised MFS II evaluation: - eight country reports (India, Bangladesh, Ethiopia, Uganda, Indonesia, DR Congo, Liberia, Pakistan); - a synthesis report


    NARCIS (Netherlands)

    Lensink, R.; Asenso-Okyere, K.; Bahiigwa, G.; Cao, De E.; Eriksen, S.; Jemaneh, S.; Gutu, T.; Hansen, N.; Lutz, C.; Tadesse, G.; Tefera, W.; Yirga, C.; Zerfu, E.; Berg, van der M.; Klaver, D.C.; Jacobs, J.; Hofstede, M.; Ingen, van T.; Getew, H.; Tigabu, A.; Babu, S.; Buizer, N.N.; Desalos, C.B.; Kefyalew, D.; Kusters, C.S.L.; Bulte, E.; Pradhan, M.


    This report on Ethiopia is one of a series of evaluation reports, consisting of ten reports in total, reflecting the results of the jointly-organised MFS II evaluation: - Eight country reports (India, Bangladesh, Ethiopia, Uganda, Indonesia, DR Congo, Liberia, Pakistan); - A synthesis report

  7. Unlearning Established Organizational Routines--Part II (United States)

    Fiol, C. Marlena; O'Connor, Edward J.


    Purpose: The purpose of Part II of this two-part paper is to uncover important differences in the nature of the three unlearning subprocesses, which call for different leadership interventions to motivate people to move through them. Design/methodology/approach: The paper draws on research in behavioral medicine and psychology to demonstrate that…

  8. Class II malocclusion occlusal severity description

    Directory of Open Access Journals (Sweden)

    Guilherme Janson


    Full Text Available OBJECTIVES: It is well known that the efficacy and the efficiency of a Class II malocclusion treatment are aspects closely related to the severity of the dental anteroposterior discrepancy. Even though, sample selection based on cephalometric variables without considering the severity of the occlusal anteroposterior discrepancy is still common in current papers. In some of them, when occlusal parameters are chosen, the severity is often neglected. The purpose of this study is to verify the importance given to the classification of Class II malocclusion, based on the criteria used for sample selection in a great number of papers published in the orthodontic journal with the highest impact factor. MATERIAL AND METHODS: A search was performed in PubMed database for full-text research papers referencing Class II malocclusion in the history of the American Journal of Orthodontics and Dentofacial Orthopedics (AJO-DO. RESULTS: A total of 359 papers were retrieved, among which only 72 (20.06% papers described the occlusal severity of the Class II malocclusion sample. In the other 287 (79.94% papers that did not specify the anteroposterior discrepancy severity, description was considered to be crucial in 159 (55.40% of them. CONCLUSIONS: Omission in describing the occlusal severity demands a cautious interpretation of 44.29% of the papers retrieved in this study.

  9. Synthesis and characterization of mononuclear copper (II ...

    Indian Academy of Sciences (India)

    Synthesis and characterization of mononuclear copper(II) complexes of pyridine 2-carboxamide: Their application as catalyst in peroxidative oxidation and antimicrobial agents. Suvendu Samanta Shounak Ray Sutapa Joardar Supriya Dutta. Regular Articles Volume 127 Issue 8 August 2015 pp 1451-1463 ...

  10. Optimizing the structure of Tetracyanoplatinate(II)

    DEFF Research Database (Denmark)

    Dohn, Asmus Ougaard; Møller, Klaus Braagaard; Sauer, Stephan P. A.


    The geometry of tetracyanoplatinate(II) (TCP) has been optimized with density functional theory (DFT) calculations in order to compare different computational strategies. Two approximate scalar relativistic methods, i.e. the scalar zeroth-order regular approximation (ZORA) and non-relativistic ca...

  11. An ADC Interface for the Apple II. (United States)

    Leiker, P. Steven


    Described is the construction of a simple analog-to-digital convertor circuit to interface an Apple II+ microcomputer to a light sensor used in conjunction with a holographic gear inspector. A list of parts, circuit diagram, and a simple BASIC program for the convertor are provided. (CW)

  12. The Sun's Mysteries from Space-II

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 1. The Sun's Mysteries from Space – II. B N Dwivedi A Mohan. General Article Volume 10 Issue 1 January 2005 pp 6-16. Fulltext. Click here to view fulltext PDF. Permanent link: ...

  13. Maailmamajanduse konjunktuur : 2005 II poolaasta / B Pulver

    Index Scriptorium Estoniae

    Pulver, B


    Lühiülevaade maailmamajanduse konjunktuurist 2005. aasta II poolaastal on koostatud Müncheni Majandusuuringute Instituudi väljaande World Economic Survey nr 89 alusel. 2005. aasta juuli vaatlus näitas maailma majanduskliima stabiliseerumist soodsal tasemel. Tabelid: Ekspertide hinnangud juulis 2005 (max=9); Arenenud riikide majandusindikaatorid; Konjunktuuribaromeetrite kindlustunde indikaatorid Euroopa Liidu maades

  14. Fluid Mud in Energetic Systems: FLUMES II (United States)


    FINAL REPORT Fluid Mud in Energetic Systems: FLUMES II Gail C. Kineke Dept of...the dynamics of fluid mud and its role in the transport and deposition of sediment in coastal environments. In particular, we sought greater...understanding of the processes that influence the formation and maintenance of fluid mud in energetic environments. OBJECTIVES The research is a process

  15. Molecular Medicine II: Hormone Dependent Cancers (United States)


    family, member 4 deiodinase, iodothyronine, -3.1 Dio2 thyroid hormone catabolism type II serne (cysteine) -4.3 Serpina3n proteinas inhibitor, clade A...ElO, and the anti- p44/42 teins and recruit various proteinases , including matrix metal- MAPK rabbit polyclonal antibody were from Cell Signaling Tech

  16. II Zw 40 - 30 Doradus on Steroids (United States)

    Leitherer, Claus; Lee, Janice C.; Levesque, Emily M.


    We obtained HST COS G140L spectra of the enigmatic nearby blue compact dwarf galaxy II Zw 40. The galaxy hosts a nuclear super star cluster embedded in a radio-bright nebula, similar to those observed in the related blue compact dwarfs NGC 5253 and Henize 2-10. The ultraviolet spectrum of II Zw 40 is exceptional in terms of the strength of He II 1640, O III] 1666 and C III] 1909. We determined reddening, age, and the cluster mass from the ultraviolet data. The super nebula and the ionizing cluster exceed the ionizing luminosity and stellar mass of the local benchmark 30 Doradus by an order of magnitude. Comparison with stellar evolution models accounting for rotation reveals serious short-comings: these models do not account for the presence of Wolf-Rayet-like stars at young ages observed in II Zw 40. Photoionization modeling is used to probe the origin of the nebular lines and determine gas phase abundances. C/O is solar, in agreement with the result of the stellar-wind modeling.

  17. Metalloantibiotics: synthesis, characterization and in-vitro antibacterial studies on cobalt (II), copper (II), nickel (II) and zinc (II) complexes with cloxacillin. (United States)

    Chohan, Zahid H; Supuran, Claudiu T


    The synthesis and characterization of cloxacillin (clox) complexes with divalent metal ions [Co (II), Cu (II), Ni (II) and Zn (II)] is described. The nature of bonding of the chelated cloxacillin and the structures of the metal complexes have been elucidated on the basis of their physical and spectroscopic data. In all the complexes, the cloxacillin acts as a uninegatively charged bidentate ligand with coordination involving the carboxylate-O and endocyclic-N of the beta-lactam ring. The new compounds have been screened for in-vitro antibacterial activity against Escherichia coli (a), Klebsiella pneumonae (b), Proteus mirabilis (c), Pseudomonas aeruginosa (d), Salmonella typhi (e), Shigella dysentriae (f), Bacillus cereus (g), Corynebacterium diphtheriae (h), Staphylococcus aureus (j) and Streptococcus pyogenes (k) bacterial strains. The brine shrimp bioassay was also carried out to study their in-vitro cytotoxic properties. All compounds, respectively, showed a promising activity (90%) against five bacterial species at 10 microg/ml concentration and a significant activity (52%) against the same test bacteria at 25 microg/ml concentration.

  18. Redetermination of (d-penicillaminatolead(II

    Directory of Open Access Journals (Sweden)

    Adam C. Schell


    Full Text Available In the title coordination polymer, [Pb(C5H9NO2S]n {systematic name: catena-poly[(μ-2-amino-3-methyl-3-sulfidobutanoatolead(II]}, the d-penicillaminate ligand coordinates to the metal ion in an N,S,O-tridentate mode. The S atom acts as a bridge to two neighbouring PbII ions, thereby forming a double thiolate chain. Moreover, the coordinating carboxylate O atom forms bridges to the PbII ions in the adjacent chain. The overall coordination sphere of the PbII ion can be described as a highly distorted pentagonal bipyramid with a void in the equatorial plane between the long Pb—S bonds probably occupied by the stereochemically active inert electron pair. The amino H atoms form N—H...S and N—H...O hydrogen bonds, resulting in a cluster of four complex units, giving rise to an R44(16 ring lying in the ab plane. The crystal structure of the title compound has been reported previously [Freeman et al. (1974. Chem. Soc. Chem. Commun. pp. 366–367] but the atomic coordinates have not been deposited in the Cambridge Structural Database (refcode DPENPB. Additional details of the hydrogen bonding are presented here.

  19. He II λ4686 in η Carinae

    DEFF Research Database (Denmark)

    Teodoro, M.; Damineli, A.; Arias, J.I.


    during the 2009 low-excitation event, resulting in a set of data of unprecedented quality and sampling. The intrinsic luminosity of the He II lambda 4686 emission line (L similar to 310 L-circle dot) just before periastron reveals the presence of a very luminous transient source of extreme UV radiation...

  20. The Conception of Photons–Part II

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 21; Issue 1. The Conception of Photons – Part II: Bose's Derivation, and the Complete Quantum Description of Light. Urjit A Yajnik. General Article Volume 21 Issue 1 January 2016 pp 49-69 ...

  1. Project Final Report: HPC-Colony II

    Energy Technology Data Exchange (ETDEWEB)

    Jones, Terry R [ORNL; Kale, Laxmikant V [University of Illinois, Urbana-Champaign; Moreira, Jose [IBM T. J. Watson Research Center


    This report recounts the HPC Colony II Project which was a computer science effort funded by DOE's Advanced Scientific Computing Research office. The project included researchers from ORNL, IBM, and the University of Illinois at Urbana-Champaign. The topic of the effort was adaptive system software for extreme scale parallel machines. A description of findings is included.

  2. Micellar effect on metal-ligand complexes of Co(II, Ni(II, Cu(II and Zn(II with citric acid

    Directory of Open Access Journals (Sweden)

    Nageswara Rao Gollapalli


    Full Text Available Chemical speciation of citric acid complexes of Co(II, Ni(II, Cu(II and Zn(II was investigated pH-metrically in 0.0-2.5% anionic, cationic and neutral micellar media. The primary alkalimetric data were pruned with SCPHD program. The existence of different binary species was established from modeling studies using the computer program MINIQUAD75. Alkalimetric titrations were carried out in different relative concentrations (M:L:X = 1:2:5, 1:3:5, 1:5:3 of metal (M to citric acid. The selection of best chemical models was based on statistical parameters and residual analysis. The species detected were MLH, ML2, ML2H and ML2H2. The trend in variation of stability constants with change in mole fraction of the medium is explained on the basis of electrostatic and non-electrostatic forces. Distributions of the species with pH at different compositions of micellar media are also presented.

  3. Site Environmental Report for 2007 Volume II

    Energy Technology Data Exchange (ETDEWEB)

    Lackner, Regina E; Baskin, David; Fox, Robert; Jelinski, John; Pauer, Ron; Thorson, Patrick; Wahl, Linnea; Wyrick, Steve


    The Site Environmental Report for 2007 is an integrated report on the environmental programs at Lawrence Berkeley National Laboratory and satisfies the requirements of DOE Order 231.1A, Environment, Safety, and Health Reporting. Volume II contains individual data results from surveillance and monitoring activities.


    Goicoechea, Javier R.; Teyssier, D.; Etxaluze, M.; Goldsmith, P.F.; Ossenkopf, V.; Gerin, M.; Bergin, E.A.; Black, J.H.; Cernicharo, J.; Cuadrado, S.; Encrenaz, P.; Falgarone, E.; Fuente, A.; Hacar, A.; Lis, D.C.; Marcelino, N.; Melnick, G.J.; Müller, H.S.P.; Persson, C.; Pety, J.; Röllig, M.; Schilke, P.; Simon, R.; Snell, R.L.; Stutzki, J.


    We present the first ~7.5′×11.5′ velocity-resolved (~0.2 km s−1) map of the [C ii] 158 μm line toward the Orion molecular cloud 1 (OMC 1) taken with the Herschel/HIFI instrument. In combination with far-infrared (FIR) photometric images and velocity-resolved maps of the H41α hydrogen recombination and CO J=2-1 lines, this data set provides an unprecedented view of the intricate small-scale kinematics of the ionized/PDR/molecular gas interfaces and of the radiative feedback from massive stars. The main contribution to the [C ii] luminosity (~85 %) is from the extended, FUV-illuminated face of the cloud (G0>500, nH>5×103 cm−3) and from dense PDRs (G≳104, nH≳105 cm−3) at the interface between OMC 1 and the H ii region surrounding the Trapezium cluster. Around ~15 % of the [C ii] emission arises from a different gas component without CO counterpart. The [C ii] excitation, PDR gas turbulence, line opacity (from [13C ii]) and role of the geometry of the illuminating stars with respect to the cloud are investigated. We construct maps of the L[C ii]/LFIR and LFIR/MGas ratios and show that L[C ii]/LFIR decreases from the extended cloud component (~10−2–10−3) to the more opaque star-forming cores (~10−3–10−4). The lowest values are reminiscent of the “[C ii] deficit” seen in local ultra-luminous IR galaxies hosting vigorous star formation. Spatial correlation analysis shows that the decreasing L[C ii]/LFIR ratio correlates better with the column density of dust through the molecular cloud than with LFIR/MGas. We conclude that the [C ii] emitting column relative to the total dust column along each line of sight is responsible for the observed L[C ii]/LFIR variations through the cloud. PMID:26568638

  5. Cd(II and Pb(II complexes of the polyether ionophorous antibiotic salinomycin

    Directory of Open Access Journals (Sweden)

    Tanabe Makoto


    Full Text Available Abstract Background The natural polyether ionophorous antibiotics are used for the treatment of coccidiosis in poultry and ruminants. They are effective agents against infections caused by Gram-positive microorganisms. On the other hand, it was found that some of these compounds selectively bind lead(II ions in in vivo experiments, despite so far no Pb(II-containing compounds of defined composition have been isolated and characterized. To assess the potential of polyether ionophores as possible antidotes in the agriculture, a detailed study on their in vitro complexation with toxic metal ions is required. In the present paper we report for the first time the preparation and the structure elucidation of salinomycin complexes with ions of cadmium(II and lead(II. Results New metal(II complexes of the polyether ionophorous antibiotic salinomycin with Cd(II and Pb(II ions were prepared and structurally characterized by IR, FAB-MS and NMR techniques. The spectroscopic information and elemental analysis data reveal that sodium salinomycin (SalNa undergoes a reaction with heavy metal(II ions to form [Cd(Sal2(H2O2] (1 and [Pb(Sal(NO3] (2, respectively. Abstraction of sodium ions from the cavity of the antibiotic is occurring during the complexation reaction. Salinomycin coordinates with cadmium(II ions as a bidentate monoanionic ligand through the deprotonated carboxylic moiety and one of the hydroxyl groups to yield 1. Two salinomycin anions occupy the equatorial plane of the Cd(II center, while two water molecules take the axial positions of the inner coordination sphere of the metal(II cation. Complex 2 consists of monoanionic salinomycin acting in polydentate coordination mode in a molar ratio of 1: 1 to the metal ion with one nitrate ion for charge compensation. Conclusion The formation of the salinomycin heavy metal(II complexes indicates a possible antidote activity of the ligand in case of chronic/acute intoxications likely to occur in the stock

  6. Angiotensin II during experimentally simulated central hypovolemia

    Directory of Open Access Journals (Sweden)

    Theo Walther Jensen


    Full Text Available Abstract:Central hypovolemia, defined as diminished blood volume in the heart and pulmonary vascular bed, is still an unresolved problem from a therapeutic point of view. The development of pharmaceutical agents targeted at specific angiotensin II receptors, like the non-peptidergic AT2-receptor agonist compound 21, is yielding many opportunities to uncover more knowledge about angiotensin II receptor profiles and possible therapeutic use. Cardiovascular, anti-inflammatory and neuroprotective therapeutic use of compound 21 have been suggested. However, there has not yet been a focus on the use of these agents in a hypovolemic setting. We argue that the latest debates on the effect of angiotensin II during hypovolemia might guide for future studies investigating the effect of such agents during experimentally simulated central hypovolemia. The purpose of this review is to examine the role of angiotensin II during episodes of central hypovolemia.To examine this, we reviewed results from studies with three experimental models of simulated hypovolemia: head up tilt table test, lower body negative pressure, and hemorrhage of animals. A systemic literature search was made with the use of PubMed/MEDLINE for studies that measured variables of the renin-angiotensin system or its effect during simulated hypovolemia. 12 articles, using one of the three models, were included and showed a possible organ protective effect and an effect on the sympathetic system of angiotensin II during hypovolemia. The results support the possible organ protective vasodilatory role for the AT2-receptor during hypovolemia on both the kidney and the splanchnic tissue.

  7. [Laryngeal tube II : alternative airway for children?]. (United States)

    Schalk, R; Scheller, B; Peter, N; Rosskopf, W; Byhahn, C; Zacharowski, K; Meininger, D


    Difficult airway situations both expected and unexpected, present major challenges to every anesthesiologist, especially in pediatric anesthesia. However, the integration of extraglottic airway devices, such as the laryngeal mask, into the algorithm of difficult airways has improved the handling of difficult airway situations. A device for establishing a supraglottic airway, the laryngeal tube (LT), was introduced in 1999. The LT is an extraglottic airway designed to secure a patent airway during either spontaneous breathing or controlled ventilation. The design of the device has been revised several times and a further development is the LTS II/LTS-D, which provides an additional channel for the insertion of a gastric drain tube. This article reports on the successful use of the LTS II in 12 children aged from 2 days to 6 years when endotracheal intubation, alternative mask or laryngeal mask ventilation failed. Use of the LTS II was associated with a high level of success, securing the airway when other techniques had failed. The potential advantage of the LTS II over the standard LT is an additional suction port, which allows gastric tube placement and can be used as an indirect indicator of correct placement. With a modified insertion technique using an Esmarch manoeuvre, placement was simple and fast to perform. In emergency situations when direct laryngoscopy fails or is too time-consuming the LTS II tube is recommended as an alternative device to secure the airway. As with all extraglottic airway devices, familiarity and clinical experience with the respective device and the corresponding insertion technique are essential for safe and successful use, especially in emergency situations.

  8. Angiotensin II: multitasking in the brain. (United States)

    Saavedra, Juan M; Benicky, Julius; Zhou, Jin


    In addition to controlling systemic blood pressure, angiotensin II (Ang II) has several roles in the brain, including the regulation of cerebrovascular flow and the reaction to stress. In order to clarify the central effects of Ang II and its type 1 (AT1) receptors, we reviewed the literature reporting recent research on the effects of pretreatment with the AT1-receptor blocker, candesartan, on experimental ischemia, cerebrovascular remodeling, and inflammation in spontaneously hypertensive rats (SHRs), and the responses to stress induced by isolation and by cold-restraint. Angiotensin II regulates the brain circulation through stimulation of AT1-receptors located in the cerebrovascular endothelium and central pathways. SHRs express greater numbers of endothelial AT1-receptors and a central sympathetic overdrive, resulting in pathological cerebrovascular growth, inflammation, decreased cerebrovascular compliance, and enhanced vulnerability to brain ischemia. Sustained central AT1-receptor antagonism reverses these effects. Sustained reduction of AT1-receptor stimulation before stress prevents the hormonal and sympathoadrenal stress responses during isolation and prevents the gastric ulceration stress response to cold-restraint, indicating that increased AT1-receptor stimulation is essential to enhance the central sympathetic response and the formation and release of corticotropin-releasing factor (CRF) and arginine vasopressin that occur during stress. AT1-receptor blocking agents reverse the cortical alterations in CRF1 and benzodiazepine receptors characteristic of isolation stress, effects probably related to their anti-anxiety effect in rodents. Sustained reduction of Ang II tone by AT1-receptor antagonism could be considered as a preventive and therapeutic approach for brain ischemia and stress-related and mood disorders. Additional preclinical studies and controlled clinical trials are necessary to confirm the efficacy of this novel therapeutic approach.

  9. Mechanism of Cu(II), Cd(II) and Pb(II) ions sorption from aqueous solutions by macroporous poly(glycidyl methacrylate-co-ethylene glycol dimethacrylate)

    Energy Technology Data Exchange (ETDEWEB)

    Nastasović, Aleksandra B., E-mail: [University of Belgrade, Institute of Chemistry Technology and Metallurgy, Department of Chemistry, Department of Microelectronic Technologies, Njegoševa 12, Belgrade (Serbia); Ekmeščić, Bojana M. [University of Belgrade, Institute of Chemistry Technology and Metallurgy, Department of Chemistry, Department of Microelectronic Technologies, Njegoševa 12, Belgrade (Serbia); and others


    Highlights: • Macroporous PGME-deta sorption potential for Pb(II), Cd(II) and Cu(II) was studied. • Sorption kinetics obeyed pseudo-second order model. • Maximal Pb(II), Cd(II) and Cu(II) sorption capacities were 164, 152 and 120 mg g{sup −1}. • AFM indicates that metal sorption changes the size and morphology of PGME-deta. • XPS suggests complexation through the formation of Me−O and Me−N bonds in PGME-deta. - Abstract: The mechanism of Cu(II), Cd(II) and Pb(II) ions sorption from aqueous solutions by macroporous poly(glycidyl methacrylate-co-ethylene glycol dimethacrylate) (PGME) functionalized by reaction of the pendant epoxy groups with diethylene triamine (PGME-deta) was studied using X-ray photoelectron spectroscopy (XPS) and Fourier transform infrared spectroscopy (FTIR) analysis. Atomic force microscopy (AFM) and scanning energy-dispersive X-ray spectroscopy (SEM-EDX) were used for the determination of surface morphology of the copolymer particles. The sorption behavior of heavy metals Cu(II), Cd(II) and Pb(II) ions sorption was investigated in batch static experiments under non-competitive conditions at room temperature (298 K). The obtained results were fitted to pseudo-first order, pseudo-second order and intraparticle diffusion kinetic model. The kinetics studies showed that Cu(II), Cd(II) and Pb(II) sorption obeys the pseudo-second-order model under all investigated operating conditions with evident influence of pore diffusion.

  10. Influence of different mineral and Organic pesticide treatments on Cd(II), Cu(II), Pb(II), and Zn(II) contents determined by derivative potentiometric stripping analysis in Italian white and red wines. (United States)

    Salvo, Francesco; La Pera, Lara; Di Bella, Giuseppa; Nicotina, Mariano; Dugo, Giacomo


    This paper deals with the use of derivative potentiometric stripping analysis (dPSA) as a rapid and precise method to determine Cd(II), Cu(II), Pb(II), and Zn(II) levels in red and white wine samples from Sicily, Campania, and Tuscany and to investigate the possible connection between the content of these metals and the pesticide treatments used in vine-growing to control plant diseases and pests. dPSA allowed direct quantitation of heavy metals in acidified wines without any sample pretreatment. Mean recoveries of Cd(II), Cu(II), Pb(II), and Zn(II) ranged from 95.5 to 99.2% for white wine samples and from 96.1 to 100.0% for red wine samples. The obtained results showed that Cd(II) was not found in any sample and that Cu(II), Pb(II), and Zn(II) levels were always lower than the toxicity limits in both fungicide- and water-treated wines. Nevertheless, the contents of metals were increased in samples from organic and inorganic pesticides treatment with respect to the water-treated samples. In particular, quinoxyfen, dinocap-penconazole, and dinocap applications considerably increased Cu(II) and Zn(II) contents in white and red wines. The levels of lead were significantly raised by azoxystrobin and sulfur treatments.

  11. Preparation and Spectral Properties of Mixed-Ligand Complexes of VO(IV, Ni(II, Zn(II, Pd(II, Cd(II and Pb(II with Dimethylglyoxime and N-acetylglycine

    Directory of Open Access Journals (Sweden)

    Shayma A. Shaker


    Full Text Available A number of mixed-ligand complexes of the general formula [M(D(G] where D=dimethylglyoximato monoanion, G=N-acetylglycinato and M=VO(IV, Ni(II, Zn(II, Pd(II, Cd(II and Pb(II were prepared. Each complex was characterized by elemental analysis, determination of metal, infrared spectra, electronic spectra, (1H and 13C NMR spectra, conductivity and magnetic moments. All these complexes were not soluble in some of the organic solvent but highly soluble in dimethylformamide. The conductivity data showed the non-electrolytic nature of the complexes. The electronic spectra exhibited absorption bands in the visible region caused by the d-d electronic transition such as VO(IV, Ni(II and Pd(II. The IR and (1H, 13C NMR spectra which have indicate that the dimethylglyoxime was coordinated with the metal ions through the N and O atoms of the oxime group and N-acetylglycine was coordinated with metal ions through the N atom and terminal carboxyl oxygen atom.

  12. Complexes cobalt(II, zinc(II and copper(II with some newly synthesized benzimidazole derivatives and their antibacterial activity

    Directory of Open Access Journals (Sweden)



    Full Text Available The preparation and properties of some complexes of cobalt(II, zinc(II and copper(II with several newly synthesized benzimidazole derivatives (L are reported. The complexes, of the general formula [MCl2L2] (M=Co(II, Zn(II and [CuCl2L(H2O], have a tetrahedral structure. The complexes were characterized by elemental analysis, molar conductivity, magnetic susceptibility measurements, IR and absorption electronic spectra. The antibacterial activitiy of the benzimidazoles and their complexes was evaluated against Erwinia carotovora subsp. carotovora and Erwinia amylovora. The complexes were found to be more toxic than the ligands.

  13. Fabrication of carbon nanotubes paste electrode for determination of Cd (II) and Pb (II) ions (United States)

    Le Hai, Tran; Hai, Tran Duy


    In this study, the electrode for determination of Cd (II) and Pb (II) was prepared by a paste composition of multi-wall carbon nanotubes (MWCNTs) and paraffin oil as a binder. Effect of MWCNTs/paraffin oil ratio on electrochemical behaviors of the electrodes was investigated. For the characterization of the fabricated MWCNT paste electrodes, the cyclic voltammetry, SEM images, RAMAN and XRD spectroscopy were employed. It was found that the electrode containing 20% (w/w) paraffin oil and 80 % (w/w) MWCNTs exhibited the satisfactory properties through the anodic stripping voltammetry (ASV) results. This electrode showed a reversible redox process with an electrochemical mechanism of controlled diffusion. Furthermore, the ASV results of the prepared electrode revealed a linear response of Pb (II) and Cd (II) concentrations with a detection limit of 6.33 µmol.L-1 and 0.42 µmol.L-1, respectively

  14. Transport with Astra in TJ-II; Transporte con Astra en TJ-II

    Energy Technology Data Exchange (ETDEWEB)

    Lopez-Bruna, D.; Castejon, F.; Fontdecaba, J. M.


    This report describes the adaptation of the numerical transport shell ASTRA for performing plasma calculations in the TJ-II stellarator device. Firstly, an approximation to the TJ-II geometry is made and a simple transport model is shared with two other codes in order to compare these codes (PROCTR, PRETOR-Stellarator) with ASTRA as calculation tool for TJ-II plasmas are provided: interpretative and predictive transport. The first consists in estimating the transport coefficients from real experimental data, thes being taken from three TJ-II discharges. The predictive facet is illustrated using a model that is able to includes self-consistently thedynamics of transport barriers. The report includes this model, written in the ASTRA programming language, to illustrate the use of ASTRA. (Author) 26 refs.

  15. The federations' agreement II on network utilisation; Die Verbaendevereinbarung II zur Netznutzung

    Energy Technology Data Exchange (ETDEWEB)

    Birkner, P. [Lech-Elektrizitaetswerke AG, Augsburg (Germany)


    Against the background of the experience of the regional supplier Lech Elektrizitaetswerke AG (LEW AG) and in the view of the operator of a regional distribution network the author deals with three complexes of themes: 1. Federations' Agreement II on network utilisation - Flexible instrument for competition or unsuited attempt? 2. What progress and obstacles are identifiable on route towards the implementation of the Federations' Agreement II on network utilisation? 3. What adjustment of existing sets of rules towards the requirements of competition is necessary? (orig.) [German] Vor dem Erfahrungshintergrund des Erfahrungsbereiches des Regionalversorgers Lech-Elektrizitaetswerke AG (LEW AG) und aus der Sicht des Betreibers eines regionalen Verteilungsnetzes behandelt der Verfasser die drei Themenkomplexe: 1. Verbaendevereinbarung II zur Netznutzung - Flexibles Instrument fuer den Wettbewerb oder ungeeigneter Versuch? 2. Welche Fortschritte und Hindernisse sind auf dem Wege der Umsetzung der Verbaendevereinbarung II zur Netznutzung erkennbar? 3. Welche Anpassung vorhandener Regelwerke an die Erfordernisse des Wettbewerbs sind notwendig? (orig.)

  16. Model of the extradiol-cleaving manganese(II) dioxygenase penicillamine-manganese(II) complex. (United States)

    Sakurai, H; Shimomura, S; Yoshimura, T


    The structure of the green penicillamine(Pen)-Mn(II) complex prepared under air was determined from its electronic spectra, molar ratio, ESR spectra and oxygen consumptions at various pH values and by potentiometric titration. Pen bound with Mn(II) in a molar ratio of approximately 1:1 forming coordination bonds with a thiolate and an amino group, and the complex consumed about 1 mol of oxygen at pH 9-10. Oxygen binding to this complex was found to be reversible at room temperature. The oxygen adduct complex catalysed oxidative extradiol-cleavage of catechol at pH 7.0-7.5. The Pen-Mn(II)-02 complex seems to be a simple model of extradiol-cleaving manganese(II) dioxygenase, which was recently found in Bacillus brevis.

  17. Preparation, characterization and biological evaluation of copper(II) and zinc(II) complexes with cephalexin. (United States)

    Iqbal, M S; Ahmad, A R; Sabir, M; Asad, S M


    Copper(II) and zinc(II) complexes of cephalexin have been prepared and characterized by microanalysis and by thermogravimetric, magnetic and spectroscopic analysis. The complexes were found to be five-coordinate, monohydrate, and ML2 type. The electron paramagnetic resonance spectral lines revealed rhombic distortion from axial symmetry, with g(parallel) > g(perpendicular) > g(e), in the elongated-tetragonal copper(II) complex. The geometry of the zinc(II) complex seems to be square-pyramidal. On complexation with copper and zinc the antimicrobial activity of cephalexin improved significantly. The copper complex was found to be active against kaolin paw oedema whereas the parent drug was inactive. These results suggest that the metallic elements should be seriously considered during drug design, and that complexes already reported should be subjected to clinical evaluation. Their use could provide an easy way of improving the activity and reducing the toxicity of drug substances.

  18. Ionized gas in the Scutum spiral arm as traced in [N II] and [C II (United States)

    Langer, W. D.; Velusamy, T.; Goldsmith, P. F.; Pineda, J. L.; Chambers, E. T.; Sandell, G.; Risacher, C.; Jacobs, K.


    Context. The warm ionized medium (WIM) occupies a significant fraction of the Galactic disk. Determining the WIM properties at the leading edge of spiral arms is important for understanding its dynamics and cloud formation. Aims: We derive the properties of the WIM at the inner edge of the Scutum arm tangency, which is a unique location in which to disentangle the WIM from other components, using the ionized gas tracers C+ and N+. Methods: We use high spectral resolution [C II] 158 μm and [N II] 205 μm fine structure line observations taken with the upGREAT and GREAT instruments, respectively, on SOFIA, along with auxiliary H I and 13CO observations. The observations consist of samples in and out of the Galactic plane along 18 lines of sight (LOS) between longitude 30° and 32°. Results: We detect strong [N II] emission throughout the Scutum tangency. At VLSR = 110 to 125 km s-1 where there is little, if any, 13CO, we are able to disentangle the [N II] and [C II] emission that arises from the WIM at the arm's inner edge. We find an average electron density 0.9 cm-3 in the plane, and 0.4 cm-3 just above the plane. The [N II] emission decreases exponentially with latitude with a scale height 55 pc. For VLSRfalls into the potential well of the arm. The widespread distribution of [N II] in the molecular layers shows that high density ionized gas is distributed throughout the Scutum arm. The electron densities derived from [N II] for these molecular cloud regions are 30 cm-3, and probably arise in the ionized boundary layers of clouds. The [N II] detected in the molecular portion of the spiral arm arises from several cloud components with a combined total depth 8 pc. This [N II] emission most likely arises from ionized boundary layers, probably the result of the shock compression of the WIM as it impacts the arm's neutral gas, as well as from extended H II regions.

  19. Crowfunding: A Way to Financing Creative Business in Australia

    Directory of Open Access Journals (Sweden)

    Bima Yudhistira


    Full Text Available AbstractCrowdfunding, a new term in financial industries. It provides fund for a new start-up project. In Australia where it becomes the basis of this study, Pozible as a leading crowdfunding platform has already launched 6.929 projects. The fund of US$22.930.536 was used for financing the projects, and 56 percent of the projects were successful. This research has an objective; it is to measure the degree of significancy using linear regression model. The result shows that among the businesses that has already funded by crowdfunding system, ‘video game’ is one of the most favorite project. It is successful in getting pledges. However, food and drink did not get fund as much as the favorites project. It was based on the percentage of fund that has already got from crowdfunding. In short, crowdfunding can help creative business as a top rank start-up rather than manufacture business.Crowdfunding, istilah baru dalam industri keuangan. Crowdfunding adalah dana untuk proyek rintisan. Pozible sebagai platform crowdfunding terkemuka telah meluncurkan 6,929 proyek di Australia. Negara tersebut menjadi dasar dari penelitian ini. Dana sebesar $ 22.930.536 US digunakan untuk membiayai proyek-proyek dan 56 persen dari proyek tersebut sukses. Penelitian ini bertujuan untuk mengukur tingkat signifikansi dengan menggunakan model regresi linier. Hasilnya menunjukkan bahwa di antara bisnis yang sudah didanai oleh sistem crowdfunding, ‘video game’ adalah salah satu proyek yang paling favorit dan sukses dalam mendapatkan jaminan. Sedangkan makanan dan minuman tidak mendapatkan dana sebanyak proyek favorit. Hal ini didasarkan pada persentase dana yang telah diperoleh dari crowdfunding. Kesimpulannya adalah crowdfunding lebih bisa membantu bisnis kreatif sebagai a top rank start-up daripada bisnis manufaktur

  20. Assembly and properties of heterobimetallic Co(II/III)/Ca(II) complexes with aquo and hydroxo ligands. (United States)

    Lacy, David C; Park, Young Jun; Ziller, Joseph W; Yano, Junko; Borovik, A S


    The use of water as a reagent in redox-driven reactions is advantageous because it is abundant and environmentally compatible. The conversion of water to dioxygen in photosynthesis illustrates one example, in which a redox-inactive Ca(II) ion and four manganese ions are required for function. In this report we describe the stepwise formation of two new heterobimetallic complexes containing Co(II/III) and Ca(II) ions and either hydroxo or aquo ligands. The preparation of a four-coordinate Co(II) synthon was achieved with the tripodal ligand, N,N',N"-[2,2',2"-nitrilotris(ethane-2,1-diyl)]tris(2,4,6-trimethylbenzenesulfonamido, [MST](3-). Water binds to [Co(II)MST](-) to form the five-coordinate [Co(II)MST(OH(2))](-) complex that was used to prepare the Co(II)/Ca(II) complex [Co(II)MST(μ-OH(2))Ca(II)⊂15-crown-5(OH(2))](+) ([Co(II)(μ-OH(2))Ca(II)OH(2)](+)). [Co(II)(μ-OH(2))CaOH(2)](+) contained two aquo ligands, one bonded to the Ca(II) ion and one bridging between the two metal ions, and thus represents an unusual example of a heterobimetallic complex containing two aquo ligands spanning different metal ions. Both aquo ligands formed intramolecular hydrogen bonds with the [MST](3-) ligand. [Co(II)MST(OH(2))](-) was oxidized to form [Co(III)MST(OH(2))] that was further converted to [Co(III)MST(μ-OH)Ca(II)⊂15-crown-5](+) ([Co(III)(μ-OH)Ca(II)](+)) in the presence of base and Ca(II)OTf(2)/15-crown-5. [Co(III)(μ-OH)Ca(II)](+) was also synthesized from the oxidation of [Co(II)MST](-) with iodosylbenzene (PhIO) in the presence of Ca(II)OTf(2)/15-crown-5. Allowing [Co(III)(μ-OH)Ca(II)](+) to react with diphenylhydrazine afforded [Co(II)(μ-OH(2))Ca(II)OH(2)](+) and azobenzene. Additionally, the characterization of [Co(III)(μ-OH)Ca(II)](+) provides another formulation for the previously reported Co(IV)-oxo complex, [(TMG(3)tren)Co(IV)(μ-O)Sc(III)(OTf)(3)](2+) to one that instead could contain a Co(III)-OH unit.

  1. Psychometric properties of the Beck Depression Inventory II (BDI-II) among community-dwelling older adults. (United States)

    Segal, Daniel L; Coolidge, Frederick L; Cahill, Brian S; O'Riley, Alisa A


    The psychometric properties of the Beck Depression Inventory-II (BDI-II) as a self-administered screening tool for depressive symptoms were examined in a sample of community-dwelling older and younger adults. Participants completed the BDI-II, the Center for Epidemiologic Studies Depression Scale, the Coolidge Axis II Inventory, the Perceived Stress Scale, and the Short Psychological Well-Being Scale. Internal reliability of the BDI-II was found to be good among older and younger adults. The average BDI-II depression score did not differ between younger and older adults. Solid evidence for convergent and discriminant validity was demonstrated by correlations between the BDI-II with the other measures. The BDI-II appears to have strong psychometric support as a screening measure for depression among older adults in the general population. Implications for using the BDI-II as an assessment instrument in behaviorally based psychotherapy are discussed.

  2. Coordination of Fe(III), Co(II), Ni(II), Cu(II), Zn(II), Cd(II), Hg(II), Pd(II) and Pt(II) with 2,5-hexanedione bis(thiosemicarbazone), HBTS: Crystal structure of cis-[Pd(HBTS)]Cl2 and 1-(2,5-dimethyl-1H-pyrrol-yl)-thiourea (United States)

    Jeragh, Bakir; El-Asmy, Ahmed A.


    Metal complexes of Fe3+, Co2+, Ni2+, Cu2+, Zn2+, Cd2+, Hg2+, Pd2+ or Pt2+ with 2,5-hexanedione bis(thiosemicarbazone), HBTS; have been prepared and spectroscopically investigated. The empirical formulae of the complexes were suggested based on the elemental analysis. Single crystal of Pd(II) has been solved to be cis-form of square-planar geometry by the X-ray crystallography. 1H and 13C NMR spectra have been recorded for HBTS, Zn(II), Cd(II), Hg(II), Pd(II) and Pt(II) complexes, in DMSO-d6, showing the mode of chelation. The ligand acts as a neutral or a binegative tetradentate (N2S2) or neutral bidentate on the basis of FT-IR. The magnetic moments and electronic spectra provide information about the geometry of the complexes which supported by calculating the ligand field parameters for the Co(II) and Fe(III) complexes. The Ni(II) complex has subnormal magnetic moment (0.71 BM) indicative of a mixed stereochemistry of square-planar and tetrahedral structure. [Cu(HBTS-2H)] measured 0.93 BM indicating high interaction between the copper centers. The ligand may be ordered at the top of the spectrochemical series which giving high ligand field splitting energy (10Dq = 17,900 cm-1 for Co2+ complex). The mass spectra of some complexes proved their stable chemical formulae while the TGA depicts the degradation steps and the final residue. In evaporating the mother liquor during the preparation of HBTS, new compound is obtained naming 1-(2,5-dimethyl-1H-pyrrol-yl)thiourea and its crystal was solved.

  3. Speciation of binary complexes of Pb(II) and Cd(II) with L ...

    African Journals Online (AJOL)

    Chemical speciation of L-Asparagine complexes of Pb(II) and Cd(II) in presence of (0-50% v/v) dimethyl sulfoxide(DMSO)-water mixtures has been studied potentiometrically at 303.0 K and at an ionic strength of 0.16 mol L-1. The models containing different number of species were refined by using the computer program ...

  4. Sci-Fri PM: Planning-12: Class II division interpretation of the amended Class II regulations. (United States)

    Plante, J


    The proposed amendments to the Class II regulations are expected to come into effect in May 2008. This presentation will provide highlights of the change to Class II regulations and how those changes will be interpreted by the CNSC during licence assessments and inspections. The changes to the regulations are designed to correct a number of regulatory deficiencies that have come to light since the regulations came into force. © 2008 American Association of Physicists in Medicine.

  5. Removal of Cu (II) and Zn (II) ions from wastewater by cassava ...

    African Journals Online (AJOL)

    The ability of cassava waste biomass (untreated and acid treated) to remove heavy metals (Cu(II) and Zn(II) ) from single-ion solution and wastewater was investigated. All experiments were conducted using 10mM solutions of mixed metal ions of CuSO4.5H2O and ZnCl2. The uptake capacities of the two metal ions tested ...

  6. Synthesis, Characterization, and Biological Activity of Nickel (II) and Palladium (II) Complex with Pyrrolidine Dithiocarbamate (PDTC)


    Sk Imadul Islam; Suvendu Bikash Das; Sutapa Chakrabarty; Sudeshna Hazra; Akhil Pandey; Animesh Patra


    The synthesis of square planar Ni(II) and Pd(II) complexes with pyrrolidine dithiocarbamate (PDTC) was characterized by elemental, physiochemical, and spectroscopic methods. Two complexes were prepared by the reaction of nickel acetate and palladium acetate with pyrrolidine dithiocarbamate (PDTC) in 1 : 2 molar ratio. The bovine serum albumin (BSA) interaction with complexes was examined by absorption and fluorescence spectroscopic techniques at pH 7.4. All the spectral data suggest that coor...


    African Journals Online (AJOL)

    ABSTRACT. Chemical speciation of L-Asparagine complexes of Pb(II) and Cd(II) in presence of (0-50% v/v) dimethyl sulfoxide(DMSO)-water mixtures has been studied potentiometrically at 303.0 K and at an ionic strength of 0.16 mol L-1. The models containing different number of species were refined by using the ...

  8. Cd(II) and Pb(II) complexes of the polyether ionophorous antibiotic salinomycin


    Tanabe Makoto; Simova Svetlana; Mitewa Mariana; Pantcheva Ivayla N; Ivanova Juliana; Osakada Kohtaro


    Abstract Background The natural polyether ionophorous antibiotics are used for the treatment of coccidiosis in poultry and ruminants. They are effective agents against infections caused by Gram-positive microorganisms. On the other hand, it was found that some of these compounds selectively bind lead(II) ions in in vivo experiments, despite so far no Pb(II)-containing compounds of defined composition have been isolated and characterized. To assess the potential of polyether ionophores as poss...

  9. Coordination studies of copper(II), cobalt(II) and iron(II) with isomeric pyridyl-tetrazole ligands

    DEFF Research Database (Denmark)

    Bond, A. D.; Fleming, A.; Gaire, J.


    The reaction of 2-(2H-tetrazol-5-yl)pyridine (L1) with 1,6-dibromohexane results in formation of the isomers 2-(6 ''-bromohexyl)-(1-tetrazol-5-yl)pyridine (12) and 2-(6 ''-bromohexyl)-(2-tetrazol-5-yl)pyridine (L3). Coordination reactions of 12 and 13 with CuCl2 center dot 2H(2)O, Co(SCN)(2) and Fe......(II) compounds. X-ray crystal structures were obtained for complexes 1-5. In each complex, ligands L2 and L3 coordinate to the metal centre through the pyridyl N atom and the 1-N site of the tetrazole ring, and the pyridyl-tetrazole ligand remains planar in all cases except 3. Complexes 1 and 2 comprise...... a central Cu2Cl2 dimeric core with Cu(II) in an essentially square-pyramidal coordination environment. Complexes 3 and 4 contain co(II) in a distorted octahedral coordination environment. In 3, the pyridyl and tetrazole rings of L2 are twisted with respect to each other and the complex adopts a puckered...

  10. Root resorption in Class II malocclusion treatment with Class II elastics. (United States)

    Janson, Guilherme; Niederberger, Ana; Garib, Daniela Gamba; Caldas, Waleska


    The objective of this investigation was to compare the amount of apical root resorption in nonextraction treatment of Class II malocclusions with and without Class II elastics. A sample of 54 patients with Class II Division 1 malocclusion, retrospectively selected, was divided into 2 groups. The elastic group consisted of 27 patients who were exclusively treated with fixed appliances associated with elastics, and the headgear group consisted of 27 patients treated with fixed appliances and extraoral headgear. The groups were matched regarding initial age, treatment time, amount of overjet, initial malocclusion severity, final occlusal status, and severity of Class II molar relationship. Posttreatment periapical radiographs of the maxillary and mandibular central and lateral incisors were used to evaluate root resorption. The amounts of resorption in the groups were compared with Mann-Whitney U tests. There was no statistically significant difference in the amounts of root resorption between the elastic and the headgear groups. Nonextraction treatment of Class II malocclusions with Class II elastics associated with fixed appliances causes similar root resorption as treatment with extraoral headgear and fixed appliances. Apical root resorption was predominantly mild and similar in the 2 groups. Copyright © 2016 American Association of Orthodontists. Published by Elsevier Inc. All rights reserved.

  11. Synthesis and cytotoxic effect on RD cell line of Pd(II and Cu(II

    Directory of Open Access Journals (Sweden)

    Mahasin Alias


    Full Text Available Complexes of Cr(III, Cd(II, Ni(II, Pd(II and Cu(II with new ligand sodium [5-(p-nitro phenyl-/4-phenyl-1,2,4-triazole-3-dithiocarbamato hydrazide] (TRZ.DTC have been prepared and characterized in solid state by using flame atomic absorption, elemental analysis C.H.N.S, FT-IR, UV–vis spectrophotometry, thermal analysis TGA, conductivity and magnetic susceptibility measurements. The ratio of M:L and logK was determined by molar ratio method. From the spectral studies, an octahedral monomer structure was proposed for all complexes except copper(II which has a dimeric structure. Cadmium(II has tetrahedral geometry. Structural geometries of these compounds were also suggested in gas phase by using hyper chem-8 program. The heat of formation, binding energy, and dipole moment were calculated by PM3 and ZINDO/1 methods. ZINDO/1 was used to evaluate the vibration spectra of the (TRZ.DTC ligand and starting material as authentic compound. Cytotoxic effect of Pd, Cu and ligand was evaluated against Rhabdomyosarcoma cell line by using four different concentrations (500, 250, 125 & 62.5 μg/ml in three exposure times 24, 48 and 72 h and compared this effect with control positive Cis-Pt. The efficiency of these new compounds on RD cell line may be attributed to blocking the protein synthesis of the cells.

  12. Adsorption of Ni(II and Cd(II from Aqueous Solutions Using Modified Rice Husk

    Directory of Open Access Journals (Sweden)

    Soheil Sobhanardakani


    Full Text Available Background and purpose: Recently, release of pollutants such as heavy metal ions to the environment becomes one of the most important problems for soil and water. The present study was conducted to introduce modified rice husk (RH as a new low-cost adsorbent. Materials and Methods: In this study, tartaric acid modified RH (TARH, was used as an adsorbent for removal of Ni(II and Cd(II from water samples. This study was conducted in laboratory scale. Employing batch method, solution pH, adsorbent dose, contact time, and initial metals concentration were optimized. Results: The optimum pH for removing of both the investigated metal ions from water solutions was found to be 4.0. The process of Ni(II and Cd(II adsorption on TARH reached equilibrium within 45 min. The isotherm evaluations revealed that the Langmuir model attained better fits of the experimental equilibrium data than the Freundlich model. In addition, adsorption kinetics data were well-fitted by the pseudo-second-order rate model with high regression coefficients. Conclusion: It was found that TARH is a highly efficient adsorbent for Ni and Cd from aqueous solution, and the maximum predicted adsorption capacities for Ni(II and Cd(II were obtained as 55.5 and 45.5 mg/g, respectively.

  13. Two new cobalt(II) fumarates and a redetermination of tetraaquacobalt(II) fumarate monohydrate. (United States)

    Bekö, Sándor L; Bats, Jan W; Schmidt, Martin U


    Poly[triaqua-mu(4)-fumarato-cobalt(II)], [Co(C(4)H(2)O(4))(H(2)O)(3)](n), (I), contains two symmetry-independent octahedrally coordinated Co(2+) ions, both on inversion centers. One Co(2+) ion is coordinated by two water molecules and four fumarate dianions, whereas the other Co(2+) ion is surrounded by four water molecules and two fumarate dianions. Each fumarate dianion is bonded to three Co(2+) ions, leading to a two-dimensional structure. The fumarate dianions are nonplanar; the angle between the planes of the two carboxylate groups is 54.9 (2) degrees. The cobalt(II) fumarate layers are connected by hydrogen bonding into a three-dimensional network. Compound (I) is not isostructural with calcium(II) fumarate trihydrate [Gupta et al. (1972). Acta Cryst. B28, 135-139]. In poly[mu(4)-fumarato-dimethanolcobalt(II)], [Co(C(4)H(2)O(4))(CH(4)O)(2)](n), (II), the Co(2+) ions are octahedrally coordinated by four fumarate dianions and two methanol molecules, leading to a three-dimensional structure. The fumarate group is planar. The Co(2+) ions and the fumarate dianions both lie on inversion centers. Additionally, the one-dimensional structure of catena-poly[[[tetraaquacobalt(II)]-mu(2)-fumarato] monohydrate], {[Co(C(4)H(2)O(4))(H(2)O)(4)].H(2)O}(n), (III), was redetermined at a higher resolution, and the space group C2/c was confirmed.

  14. Biosorption kinetics of Cd (II, Cr (III and Pb (II in aqueous solutions by olive stone

    Directory of Open Access Journals (Sweden)

    M. Calero


    Full Text Available A by-product from olive oil production, olive stone, was investigated for the removal of Cd (II, Cr (III and Pb (II from aqueous solutions. The kinetics of biosorption are studied, analyzing the effect of the initial concentration of metal and temperature. Pseudo-first-order, pseudo-second-order, Elovich and intraparticle diffusion models have been used to represent the kinetics of the process and obtain the main kinetic parameters. The results show that the pseudo-second order model is the one that best describes the biosorption of the three metal ions for all the range of experimental conditions investigated. For the three metal ions, the maximum biosoption capacity and the initial biosorption rate increase when the initial metal concentration rises. However, the kinetic constant decreases when the initial metal concentration increases. The temperature effect on biosorption capacity for Cd (II and Cr (III is less significant; however, for Pb (II the effect of temperature is more important, especially when temperature rises from 25 to 40ºC. The biosorption capacity at mmol/g of olive stone changes in the following order: Cr>Cd>Pb. Thus, for an initial concentration of 220 mg/ℓ, a maximum sorption capacity of 0.079 mmol/g for Cr (III, 0.065 mmol/g for Cd (II and 0.028 mmol/g for Pb (II has been obtained.

  15. Predictive value of SAPS II and APACHE II scoring systems for patient outcome in a medical intensive care unit

    Directory of Open Access Journals (Sweden)

    Amina Godinjak


    Full Text Available Objective. The aim is to determine SAPS II and APACHE II scores in medical intensive care unit (MICU patients, to compare them for prediction of patient outcome, and to compare with actual hospital mortality rates for different subgroups of patients. Methods. One hundred and seventy-four patients were included in this analysis over a oneyear period in the MICU, Clinical Center, University of Sarajevo. The following patient data were obtained: demographics, admission diagnosis, SAPS II, APACHE II scores and final outcome. Results. Out of 174 patients, 70 patients (40.2% died. Mean SAPS II and APACHE II scores in all patients were 48.4±17.0 and 21.6±10.3 respectively, and they were significantly different between survivors and non-survivors. SAPS II >50.5 and APACHE II >27.5 can predict the risk of mortality in these patients. There was no statistically significant difference in the clinical values of SAPS II vs APACHE II (p=0.501. A statistically significant positive correlation was established between the values of SAPS II and APACHE II (r=0.708; p=0.001. Patients with an admission diagnosis of sepsis/septic shock had the highest values of both SAPS II and APACHE II scores, and also the highest hospital mortality rate of 55.1%. Conclusion. Both APACHE II and SAPS II had an excellent ability to discriminate between survivors and non-survivors. There was no significant difference in the clinical values of SAPS II and APACHE II. A positive correlation was established between them. Sepsis/septic shock patients had the highest predicted and observed hospital mortality rate.

  16. New Mn(II, Ni(II, Cd(II, Pb(II complexes with 2-methylbenzimidazole and other ligands. Synthesis, spectroscopic characterization, crystal structure, magnetic susceptibility and biological activity studies

    Directory of Open Access Journals (Sweden)

    Shayma A. Shaker


    Full Text Available Synthesis and characterization of Mn(II, Ni(II, Cd(II and Pb(II mixed ligand complexes of 2-methylbenzimidazole with other ligands have been reported. The structure of the ligands and their complexes was investigated using elemental analysis, IR, UV–Vis, (1H, 13C NMR spectroscopy, molar conductivity and magnetic susceptibility measurements. In all the studies of complexes, the 2-methylbenzimidazole behaves as a neutral monodentate ligand which is coordinated with the metal ions through the N atom. While benzotriazole behaves as a neutral bidentate ligand which is coordinated with the Ni(II ion through the two N atoms. Moreover, the N-acetylglycine behaves as a bidentate ligand which is coordinated with the Mn(II, Ni(II and Pb(II ions through the N atom and the terminal carboxyl oxygen atom. The magnetic and spectral data indicate the tetrahedral geometry for Mn(II complex, irregular tetrahedral geometry for Pb(II complex and octahedral geometry for Ni(II complex. The X-ray single crystal diffraction method was used to confirm a centrosymmetric dinuclear Cd(II complex as each two metal ions are linked by a pair of thiocyanate N = S bridge. Two 2-methylbenzimidazole N-atom donors and one terminal thiocyanate N atom complete a highly distorted square pyramid geometry around the Cd atom. Besides, different cell types were used to determine the inhibitory effect of Mn(II, Ni(II, Cd(II and Pb(II complexes on cell growth using MTT assay. Cd(II complex showed cytotoxic effect on various types of cancer cell lines with different EC50 values.

  17. DNA methyltransferase inhibitor CDA-II inhibits myogenic differentiation

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Zirong [State Key Laboratory of Ophthalmology, Zhongshan Ophthalmic Center, Sun Yat-Sen University, Guangzhou 510060 (China); Department of Molecular Genetics and Microbiology, Shands Cancer Center, University of Florida, Gainesville, FL 32610 (United States); Jin, Guorong [State Key Laboratory of Ophthalmology, Zhongshan Ophthalmic Center, Sun Yat-Sen University, Guangzhou 510060 (China); Lin, Shuibin [Department of Molecular Genetics and Microbiology, Shands Cancer Center, University of Florida, Gainesville, FL 32610 (United States); Lin, Xiumei [Department of Hematology, Guangzhou First Municipal People' s Hospital, Guangzhou 510180 (China); Gu, Yumei [Department of Molecular Genetics and Microbiology, Shands Cancer Center, University of Florida, Gainesville, FL 32610 (United States); Zhu, Yujuan; Hu, Chengbin; Zhang, Qingjiong [State Key Laboratory of Ophthalmology, Zhongshan Ophthalmic Center, Sun Yat-Sen University, Guangzhou 510060 (China); Wu, Lizi [Department of Molecular Genetics and Microbiology, Shands Cancer Center, University of Florida, Gainesville, FL 32610 (United States); Shen, Huangxuan, E-mail: [State Key Laboratory of Ophthalmology, Zhongshan Ophthalmic Center, Sun Yat-Sen University, Guangzhou 510060 (China)


    Highlights: Black-Right-Pointing-Pointer CDA-II inhibits myogenic differentiation in a dose-dependent manner. Black-Right-Pointing-Pointer CDA-II repressed expression of muscle transcription factors and structural proteins. Black-Right-Pointing-Pointer CDA-II inhibited proliferation and migration of C2C12 myoblasts. -- Abstract: CDA-II (cell differentiation agent II), isolated from healthy human urine, is a DNA methyltransferase inhibitor. Previous studies indicated that CDA-II played important roles in the regulation of cell growth and certain differentiation processes. However, it has not been determined whether CDA-II affects skeletal myogenesis. In this study, we investigated effects of CDA-II treatment on skeletal muscle progenitor cell differentiation, migration and proliferation. We found that CDA-II blocked differentiation of murine myoblasts C2C12 in a dose-dependent manner. CDA-II repressed expression of muscle transcription factors, such as Myogenin and Mef2c, and structural proteins, such as myosin heavy chain (Myh3), light chain (Mylpf) and MCK. Moreover, CDA-II inhibited C1C12 cell migration and proliferation. Thus, our data provide the first evidence that CDA-II inhibits growth and differentiation of muscle progenitor cells, suggesting that the use of CDA-II might affect skeletal muscle functions.

  18. New molecule in the etiology of schizophrenia: urotensin II. (United States)

    Bulbul, Feridun; Alpak, Gokay; Unal, Ahmet; Copoglu, Umit Sertan; Orkmez, Mustafa; Virit, Osman; Tarkcıoglu, Mehmet; Savas, Haluk A


    Urotensin II (U-II) is a cyclic peptide that was first isolated from the caudal neurosecretory system of goby fish. U-II receptors were detected in the vascular endothelium, brain and kidney cortex. Urotensin is by far the most powerful vasoconstrictor identified. U-II molecules were previously isolated from the brain of rats and were shown to have an impact on rat behavior. The aim of the present study was to measure the level of U-II molecule in schizophrenia patients and to investigate whether the U-II level is associated with the etiology of schizophrenia. Forty schizophrenia patients who were followed at Gaziantep University Faculty of Medicine Department of Psychiatry Psychotic Disorders Unit and 40 healthy volunteers were enrolled in this study. Blood samples were taken from the antecubital vein after 12-h fasting. U-II level was measured on ELISA. The U-II level in schizophrenia patients was significantly higher than in the control group. U-II level was not different with regard to gender in either group. U-II level was not different between subgroups of schizophrenia. No significant correlation was found between U-II level, Positive and Negative Syndrome Scale and Clinical Global Impression-Severity scale scores. U-II level was higher in schizophrenia patients, indicating that U-II level may be related to the etiology of the disease. © 2013 The Authors. Psychiatry and Clinical Neurosciences © 2013 Japanese Society of Psychiatry and Neurology.

  19. Regiones H II alrededor de estrellas WR (United States)

    Giménez Benitez, S.; Niemela, V.

    En base a observaciones espectroscópicas en el rango óptico, obtenidas en el CASLEO, se estudian las condiciones físicas de tres regiones H II alrededor de estrellas WR: N76 en el entorno de Ab7, en la Nube Menor de Magallanes, N79 alrededor de Br 2, en la Nube Mayor de Magallanes y G2.4+1.4 alrededor de WR 102, en nuestra Galaxia. Estas regiones presentan una alta ionización. Se observa la línea nebular de HeII en 4686 Å . Utilizando líneas nebulares de diagnóstico, se derivan los valores de la densidad y la temperatura electrónica, así como también las abundancias de algunos de los elementos químicos nebulares.

  20. Inert doublet model and LEP II limits (United States)

    Lundström, Erik; Gustafsson, Michael; Edsjö, Joakim


    The inert doublet model is a minimal extension of the standard model introducing an additional SU(2) doublet with new scalar particles that could be produced at accelerators. While there exists no LEP II analysis dedicated for these inert scalars, the absence of a signal within searches for supersymmetric neutralinos can be used to constrain the inert doublet model. This translation however requires some care because of the different properties of the inert scalars and the neutralinos. We investigate what restrictions an existing DELPHI Collaboration study of neutralino pair production can put on the inert scalars and discuss the result in connection with dark matter. We find that although an important part of the inert doublet model parameter space can be excluded by the LEP II data, the lightest inert particle still constitutes a valid dark matter candidate.

  1. A strategy for nonextraction Class II treatment. (United States)

    Gianelly, A A


    Class II nonextraction treatment, which commonly includes distal movement of the maxillary molars to correct the molar relationship, most often can be successful when treatment is started in the late-mixed dentition stage of development. At least two factors contribute to this success. One is that the molars can be distalized routinely at this age. The second is that the "E" space is available and can be used either to help correct the molar relationship or to resolve any crowding that may exist. This article describes and illustrates the treatment of a late mixed-dentition patient with this type of Class II nonextraction treatment that includes distal movement of the maxillary molars with a 100 g NiTi coil system and the maintenance of the "E" space with a lip bumper.

  2. The Belle II VXD production database

    Energy Technology Data Exchange (ETDEWEB)

    Valentan, Manfred; Ritter, Martin [Max-Planck-Institut fuer Physik, Muenchen (Germany); Wuerkner, Benedikt; Leitl, Bernhard [Institut fuer Hochenergiephysik, Wien (Austria); Pilo, Federico [Istituto Nazionale di Fisica Nucleare, Pisa (Italy); Collaboration: Belle II-Collaboration


    The construction and commissioning of the Belle II Vertex Detector (VXD) is a huge endeavor involving a large number of valuable components. Both subsystems PXD (Pixel Detector) and SVD (Silicon Vertex Detector) deploy a large number of sensors, readout electronic parts and mechanical elements. These items are scattered around the world at many institutes, where they are built, measured and assembled. One has to keep track of measurement configurations and results, know at any time the location of the sensors, their processing state, quality, where they end up in an assembly, and who is responsible. These requirements call for a flexible and extensive database which is able to reflect the processes in the laboratories and the logistics between the institutes. This talk introduces the database requirements of a physics experiment using the PXD construction workflow as a showcase, and presents an overview of the database ''HephyDb'', which is used by the groups constructing the Belle II VXD.

  3. [Mania associated with Usher syndrome type II]. (United States)

    Praharaj, Samir Kumar; Acharya, Mahima; Sarvanan, Arul; Kongasseri, Sreejayan; Behere, Rishikesh V; Sharma, P S V N


    Usher syndrome (or Hallgren syndrome) is an autosomal recessive genetic disorder characterized by sensorineural deafness, retinitis pigmentosa, and variable vestibular deficit; Usher syndrome type II is the most common form. Various neuropsychiatric disorders have been reported to occur in those with Usher syndrome, including schizophrenia-like disorder, atypical psychosis, recurrent depressive illness, neurotic disorder, and mental retardation; however, bipolar disorder is not common in those with Usher syndrome. Herein we describe a 30-year-old male with Usher syndrome type II that developed features indicative of a probable manic episode. The patient had complete remission of symptoms in response to treatment with olanzapine 20 mg d-1. In persons with dual sensory impairment there are inherent problems with assessment and diagnosis is difficult due to their limited communication abilities. The diagnosis of Usher syndrome depends heavily on behavioral observation and disturbances in vegetative functions.

  4. trans-Dichloridotetrapyrazineruthenium(II dichloromethane disolvate

    Directory of Open Access Journals (Sweden)

    Vladimir N. Nesterov


    Full Text Available In the title compound, [RuCl2(C4H4N24]·2CH2Cl2, the RuII atom occupies a position of 222 symmetry and the C atom of the solvent molecule occupies a site with twofold symmetry. The RuII atom has a slightly distorted octahedral geometry. The pyrazine rings are propeller-like and rotated 45.1 (1° from the RuN4 plane. In the crystal, the complex and solvent molecules are bridged by weak C—H...N hydrogen bonds along the c axis. Weak intermolecular C—H...Cl contacts link the complexes in the ab plane, forming a network.

  5. The Bionic Clicker Mark I & II. (United States)

    Magee, Elliott G; Ourselin, S; Nikitichev, Daniil; Vercauteren, T; Vanhoestenberghe, Anne


    In this manuscript, we present two 'Bionic Clicker' systems, the first designed to demonstrate electromyography (EMG) based control systems for educational purposes and the second for research purposes. EMG based control systems pick up electrical signals generated by muscle activation and use these as inputs for controllers. EMG controllers are widely used in prosthetics to control limbs. The Mark I (MK I) clicker allows the wearer to change the slide of a presentation by raising their index finger. It is built around a microcontroller and a bio-signals shield. It generated a lot of interest from both the public and research community. The Mark II (MK II) device presented here was designed to be a cheaper, sleeker, and more customizable system that can be easily modified and directly transmit EMG data. It is built using a wireless capable microcontroller and a muscle sensor.

  6. AstroNet-II International Final Conference

    CERN Document Server

    Masdemont, Josep


    These are the proceedings of the "AstroNet-II International Final Conference". This conference was one of the last milestones of the Marie-Curie Research Training Network on Astrodynamics "AstroNet-II", that has been funded by the European Commission under the Seventh Framework Programme. The aim of the conference, and thus this book, is to communicate work on astrodynamics problems to an international and specialised audience. The results are presented by both members of the network and invited specialists. The topics include: trajectory design and control, attitude control, structural flexibility of spacecraft and formation flying. The book addresses a readership across the traditional boundaries between mathematics, engineering and industry by offering an interdisciplinary and multisectorial overview of the field.

  7. Scalar dark matter with type II seesaw

    Directory of Open Access Journals (Sweden)

    Arnab Dasgupta


    Full Text Available We study the possibility of generating tiny neutrino mass through a combination of type I and type II seesaw mechanism within the framework of an abelian extension of standard model. The model also provides a naturally stable dark matter candidate in terms of the lightest neutral component of a scalar doublet. We compute the relic abundance of such a dark matter candidate and also point out how the strength of type II seesaw term can affect the relic abundance of dark matter. Such a model which connects neutrino mass and dark matter abundance has the potential of being verified or ruled out in the ongoing neutrino, dark matter, as well as accelerator experiments.

  8. TRUPACT-II 157 Examination Report

    Energy Technology Data Exchange (ETDEWEB)

    Barry H. O& #39; Brien; Jeffrey M. Lacy; Kip E. Archibald


    This report presents the results of examination and recovery activities performed on the TRUPACT-II 157 shipping container. The container was part of a contact-handled transuranic waste shipment being transported on a truck to the Waste Isolation Pilot Plant in New Mexico when an accident occurred. Although the transport vehicle sustained only minor damage, airborne transuranic contamination was detected in air samples extracted from inside TRUPACT-II 157 at the Waste Isolation Pilot Plant. Consequently, the shipping container was rejected, resealed, and returned to the Idaho National Engineering and Environmental Laboratory where the payload was disassembled, examined, and recovered for subsequent reshipment to the Waste Isolation Pilot Plant. This report documents the results of those activities.

  9. [N-(2-Hydroxyethylethylenediamine]oxalatocopper(II

    Directory of Open Access Journals (Sweden)

    Hümeyra Paşaoğlu


    Full Text Available In the title mononuclear copper(II compound, [Cu(C2O4(C4H12N2O], the CuII ion has a slightly distorted square-pyramidal geometry, with a tridentate N-(2-hydroxyethylethylenediamine (HydEt-en and a bidentate oxalate (ox ligand. The N atoms of the HydEt-en ligand and the O atoms of ox ligand form the basal plane, while the O atom of the ethanol group of the HydEt-en ligand is located in the axial position. The complex molecules participate in a supramolecular assembly through N—H...O and O—H...O hydrogen bonds between HydEt-en and ox ligands.

  10. International Literature Review on WHODAS II (World Health Organization Disability Assessment Schedule II

    Directory of Open Access Journals (Sweden)

    Federici, Stefano


    Full Text Available This review is a critical analysis regarding the study and utilization of the World Health Organization Disability Assessment Schedule II (WHODAS II as a basis for establishing specific criteria for evaluating relevant international scientific literature.The WHODAS II is an instrument developed by the World Health Organisation in order to assess behavioural limitations and restrictions related to an individual’s participation, independent from a medical diagnosis. This instrument was developed by the WHO’s Assessment, Classification and Epidemiology Group within the framework of the WHO/NIH Joint Project on Assessment and Classification of Disablements. To ascertain the international dissemination level of for WHODAS II’s utilization and, at the same time, analyse the studies regarding the psychometric validation of the WHODAS II translation and adaptation in other languages and geographical contests. Particularly, our goal is to highlight which psychometric features have been investigated, focusing on the factorial structure, the reliability, and the validity of this instrument. International literature was researched through the main data bases of indexed scientific production: the Cambridge Scientific Abstracts – CSA, PubMed, and Google Scholar, from 1990 through to December 2008.The following search terms were used:“whodas”, in the field query, plus “title” and “abstract”.The WHODAS II has been used in 54 studies, of which 51 articles are published in international journals, 2 conference abstracts, and one dissertation abstract. Nevertheless, only 7 articles are published in journals and conference proceedings regarding disability and rehabilitation. Others have been published in medical and psychiatric journals, with the aim of indentifying comorbidity correlations in clinical diagnosis concerning patients with mental illness. Just 8 out of 51 articles have studied the psychometric properties of the WHODAS II. The

  11. The upgraded KLM detector at Belle II (United States)

    Piilonen, Leo; Belle Collaboration, II


    We describe the KLM (KLong-Muon) detector for the Belle II detector at the SuperKEKB accelerator located at KEK in Tsukuba, Japan. The endcap RPC (Resistive Plate Chamber) detectors used for Belle have been entirely replaced with a scintillator-based system readout out with Si PMTs. The inner two layers of the barrel have also been replaced. The readout using ``oscilloscope on a chip''-based readout electronics will be discussed, as well as expected physics performance.

  12. Solubility Products of M(II) - Carbonates

    Energy Technology Data Exchange (ETDEWEB)

    Grauer, Rolf; Berner, Urs [ed.


    Many solubility data for M(II) carbonates commonly compiled in tables are contradictory and sometimes obviously wrong. The quality of such data has been evaluated based on the original publications and reliable solubility constants have been selected for the carbonates of Mn, Fe, Co, Ni, Cu, Zn, Cd and Pb with the help of cross-comparisons. (author) translated from a PSI internal report written in German in 1994 (TM-44-94-05). 5 figs., 1 tab., 68 refs.

  13. Sandia Mark II X-Ray System

    Energy Technology Data Exchange (ETDEWEB)

    Morrison, L.W.


    The Sandia Mark II X-Ray System was designed and developed to provide an intense source of mononergetic, ultra-soft x rays with energies between 0.282 and 1.486 keV. The x-ray tube design is similar to one developed by B.L. Henke and incorporates modifications made by Tom Ellsberry. An operations manual section is incorporated to help the experimenter/operator.


    NARCIS (Netherlands)



    A novel class of mono- and di-meric chromium(II) amides has been prepared and characterized. Reaction of [CrCl2(thf)2] (thf = tetrahydrofuran) with 2 equivalents of M(NR2) (R = C6H11, Pr(i), Ph, or phenothiazinyl; M = Li or Na) allowed the formation of the homoleptic amides [{Cr(mu-NR2)(NR2)}2] (R =

  15. Terminal hemimyelocystocele associated with Chiari II malformation

    Directory of Open Access Journals (Sweden)

    Umamaheswara Reddy V.


    Full Text Available Terminal myelocystocele (TMC results from failure of embryonic CSF to drain outside the neural tube creating CSF reservoir within a dorsal meningocele. Association of Chiari II malformation with diastematomyelia and myelocystocele is extremely rare. Myelocystoceles do not have neural tissue so they have good prognosis after treatment, however when associated with hydromelia and Chiari malformation they present with neurological deficits. We present details of a 2 year old female who presented to us with this rare anomaly.

  16. Youth Attitude Tracking Study II, Fall 1983. (United States)


    considered along with civilian employment. The notion expressed in - econometric research is that when youth unemployment in the civilian sector is high...young people will find military Service relatively more attractive. Conversely, when youth unemployment is low, young people are more likely to . join...AD-Ri5@ 428 YOUTH ATTITUDE TRACKING STUDY II FALL 1983(U) RESEARCH 1/4 TRIANGLE INST RESEARCH TRIANGLE PARK NC M E MARSDEN 1983 DA98-83-C-8172

  17. Plasma wakefield acceleration experiments at FACET II (United States)

    Joshi, C.; Adli, E.; An, W.; Clayton, C. E.; Corde, S.; Gessner, S.; Hogan, M. J.; Litos, M.; Lu, W.; Marsh, K. A.; Mori, W. B.; Vafaei-Najafabadi, N.; O’shea, B.; Xu, Xinlu; White, G.; Yakimenko, V.


    During the past two decades of research, the ultra-relativistic beam-driven plasma wakefield accelerator (PWFA) concept has achieved many significant milestones. These include the demonstration of ultra-high gradient acceleration of electrons over meter-scale plasma accelerator structures, efficient acceleration of a narrow energy spread electron bunch at high-gradients, positron acceleration using wakes in uniform plasmas and in hollow plasma channels, and demonstrating that highly nonlinear wakes in the ‘blow-out regime’ have the electric field structure necessary for preserving the emittance of the accelerating bunch. A new 10 GeV electron beam facility, Facilities for Accelerator Science and Experimental Test (FACET) II, is currently under construction at SLAC National Accelerator Laboratory for the next generation of PWFA research and development. The FACET II beams will enable the simultaneous demonstration of substantial energy gain of a small emittance electron bunch while demonstrating an efficient transfer of energy from the drive to the trailing bunch. In this paper we first describe the capabilities of the FACET II facility. We then describe a series of PWFA experiments supported by numerical and particle-in-cell simulations designed to demonstrate plasma wake generation where the drive beam is nearly depleted of its energy, high efficiency acceleration of the trailing bunch while doubling its energy and ultimately, quantifying the emittance growth in a single stage of a PWFA that has optimally designed matching sections. We then briefly discuss other FACET II plasma-based experiments including in situ positron generation and acceleration, and several schemes that are promising for generating sub-micron emittance bunches that will ultimately be needed for both an early application of a PWFA and for a plasma-based future linear collider.

  18. NSLS-II RF Cryogenic System

    Energy Technology Data Exchange (ETDEWEB)

    Rose, J.; Dilgen, T.; Gash, B.; Gosman, J.; Mortazavi, P.; Papu, J.; Ravindranath, V.; Sikora, R.; Sitnikov, A.; Wilhelm, H.; Jia, Y.; Monroe, C.


    The National Synchrotron Light Source II is a 3 GeV X-ray user facility commissioned in 2014. A new helium refrigerator system has been installed and commissioned to support the superconducting RF cavities in the storage ring. Special care was taken to provide very stable helium and LN2 pressures and flow rates to minimize microphonics and thermal effects at the cavities. Details of the system design along with commissioning and early operations data will be presented.

  19. Der II. Hauptsatz der Wärmelehre (United States)

    Heintze, Joachim

    Wir haben in (4.44) den II. Hauptsatz als empirische Tatsache folgendermaßen formuliert: (i) Wärmeenergie geht von selbst nur von einem wärmeren Körper auf einen kälteren über, niemals in der umgekehrten Richtung. Nun werden wir beweisen, dass sich aus diesem Prinzip folgende äquivalente Formulierungen für den II. Hauptsatz ableiten lassen: (ii) Es ist unmöglich, ein Perpetuum mobile zweiter Art zu bauen, d. h. eine Maschine, die fortlaufend Wärmeenergie vollständig in mechanische Arbeit umsetzen kann. Eine Wärmekraftmaschine, die einen Kreisprozess mit der höchsten Temperatur Tw und der niedrigsten Temperatur Tk durchläuft, hat höchstens den Carnotschen Wirkungsgrad c = (Tw - Tk)/Tw. Wenn in der Maschine nur reversible Prozesse ablaufen, die gesamte Wärmezufuhr bei der Temperatur Tw erfolgt und ausschließlich bei der Temperatur Tw gekühlt wird, ist ihr Wirkungsgrad = C. Es gibt keine Wärmekraftmaschine, die eine bessere Ausnutzung der Wärmeenergie ermöglicht. (iv) In jedem thermodynamischen System existiert die Zustandsgröße Entropie, definiert durch ihr Differential dS = (dQrev)/T . Entropie kann erzeugt, aber nicht vernichtet werden. Bei Zustandsänderungen, die in einem abgeschlossenen System ablaufen, nimmt die Entropie entweder zu (irreversible Prozesse), oder sie bleibt konstant (reversible Prozesse). Im Anschluss an (iii) werden wir zur Definition der thermodynamischen Temperatur und bei der Diskussion von (iv) zu einem tieferen Verständnis der Entropie gelangen. Es zeigt sich, dass die Entropie das eigentliche Bindeglied zwischen Mechanik und Wärmelehre darstellt. Am Ende des Kapitels werden wir einige Anwendungen des II. Hauptsatzes betrachten.

  20. [(2-Morpholinoethyl(2-pyridylmethyleneamine]dithiocyanatozinc(II

    Directory of Open Access Journals (Sweden)

    Bang-Hong Cai


    Full Text Available The title compound, [Zn(NCS2(C12H17N3O], was prepared by the reaction of zinc acetate with pyridine-2-carbaldehyde, 2-morpholinoethylamine and ammonium thiocyanate in an ethanol solution. The ZnII atom is five coordinate with a distorted trigonal–bipyramidal geometry, coordinating with three N atoms of the Schiff base (2-morpholinoethyl(2-pyridylmethylideneamine and two N atoms from two thiocyanate ligands. The morpholine ring adopts a chair configuration.