WorldWideScience

Sample records for proving ground jpg

  1. Depleted uranium risk assessment for Jefferson Proving Ground using data from environmental monitoring and site characterization. Final report

    International Nuclear Information System (INIS)

    Ebinger, M.H.; Hansen, W.R.

    1996-10-01

    This report documents the third risk assessment completed for the depleted uranium (DU) munitions testing range at Jefferson Proving Ground (JPG), Indiana, for the U.S. Army Test and Evaluation command. Jefferson Proving Ground was closed in 1995 under the Base Realignment and Closure Act and the testing mission was moved to Yuma Proving Ground. As part of the closure of JPG, assessments of potential adverse health effects to humans and the ecosystem were conducted. This report integrates recent information obtained from site characterization surveys at JPG with environmental monitoring data collected from 1983 through 1994 during DU testing. Three exposure scenarios were evaluated for potential adverse effects to human health: an occasional use scenario and two farming scenarios. Human exposure was minimal from occasional use, but significant risk were predicted from the farming scenarios when contaminated groundwater was used by site occupants. The human health risk assessments do not consider the significant risk posed by accidents with unexploded ordnance. Exposures of white-tailed deer to DU were also estimated in this study, and exposure rates result in no significant increase in either toxicological or radiological risks. The results of this study indicate that remediation of the DU impact area would not substantially reduce already low risks to humans and the ecosystem, and that managed access to JPG is a reasonable model for future land use options

  2. Modeling exposure to depleted uranium in support of decommissioning at Jefferson Proving Ground, Indiana

    Energy Technology Data Exchange (ETDEWEB)

    Ebinger, M.H. [Los Alamos National Lab., NM (United States); Oxenburg, T.P. [Army Test and Evaluation Command, Aberdeen Proving Ground, MD (United States)

    1997-02-01

    Jefferson Proving Ground was used by the US Army Test and Evaluation Command for testing of depleted uranium munitions and closed in 1995 under the Base Realignment and Closure Act. As part of the closure of JPG, assessments of potential adverse health effects to humans and the ecosystem were conducted. This paper integrates recent information obtained from site characterization surveys at JPG with environmental monitoring data collected from 1983 through 1994 during DU testing. Three exposure scenarios were evaluated for potential adverse effects to human health: an occasional use scenario and two farming scenarios. Human exposure was minimal from occasional use, but significant risk were predicted from the farming scenarios when contaminated groundwater was used by site occupants. The human health risk assessments do not consider the significant risk posed by accidents with unexploded ordnance. Exposures of white-tailed deer to DU were also estimated in this study, and exposure rates result in no significant increase in either toxicological or radiological risks. The results of this study indicate that remediation of the DU impact area would not substantially reduce already low risks to humans and the ecosystem, and that managed access to JPG is a reasonable model for future land use options.

  3. Depleted uranium human health risk assessment, Jefferson Proving Ground, Indiana

    International Nuclear Information System (INIS)

    Ebinger, M.H.; Hansen, W.R.

    1994-01-01

    The risk to human health from fragments of depleted uranium (DU) at Jefferson Proving Ground (JPG) was estimated using two types of ecosystem pathway models. A steady-state, model of the JPG area was developed to examine the effects of DU in soils, water, and vegetation on deer that were hunted and consumed by humans. The RESRAD code was also used to estimate the effects of farming the impact area and consuming the products derived from the farm. The steady-state model showed that minimal doses to humans are expected from consumption of deer that inhabit the impact area. Median values for doses to humans range from about 1 mrem (±2.4) to 0.04 mrem (±0.13) and translate to less than 1 x 10 -6 detriments (excess cancers) in the population. Monte Carlo simulation of the steady-state model was used to derive the probability distributions from which the median values were drawn. Sensitivity analyses of the steady-state model showed that the amount of DU in airborne dust and, therefore, the amount of DU on the vegetation surface, controlled the amount of DU ingested by deer and by humans. Human doses from the RESRAD estimates ranged from less than 1 mrem/y to about 6.5 mrem/y in a hunting scenario and subsistence fanning scenario, respectively. The human doses exceeded the 100 mrem/y dose limit when drinking water for the farming scenario was obtained from the on-site aquifer that was presumably contaminated with DU. The two farming scenarios were unrealistic land uses because the additional risk to humans due to unexploded ordnance in the impact area was not figured into the risk estimate. The doses estimated with RESRAD translated to less than 1 x 10 -6 detriments to about 1 x 10 -3 detriments. The higher risks were associated only with the farming scenario in which drinking water was obtained on-site

  4. Unexploded ordnance issues at Aberdeen Proving Ground: Background information

    Energy Technology Data Exchange (ETDEWEB)

    Rosenblatt, D.H.

    1996-11-01

    This document summarizes currently available information about the presence and significance of unexploded ordnance (UXO) in the two main areas of Aberdeen Proving Ground: Aberdeen Area and Edgewood Area. Known UXO in the land ranges of the Aberdeen Area consists entirely of conventional munitions. The Edgewood Area contains, in addition to conventional munitions, a significant quantity of chemical-munition UXO, which is reflected in the presence of chemical agent decomposition products in Edgewood Area ground-water samples. It may be concluded from current information that the UXO at Aberdeen Proving Ground has not adversely affected the environment through release of toxic substances to the public domain, especially not by water pathways, and is not likely to do so in the near future. Nevertheless, modest but periodic monitoring of groundwater and nearby surface waters would be a prudent policy.

  5. Renewable Energy Opportunties at Dugway Proving Ground, Utah

    Energy Technology Data Exchange (ETDEWEB)

    Orrell, Alice C.; Kora, Angela R.; Russo, Bryan J.; Horner, Jacob A.; Williamson, Jennifer L.; Weimar, Mark R.; Gorrissen, Willy J.; Nesse, Ronald J.; Dixon, Douglas R.

    2010-05-31

    This document provides an overview of renewable resource potential at Dugway Proving Ground, based primarily upon analysis of secondary data sources supplemented with limited on-site evaluations. This effort focuses on grid-connected generation of electricity from renewable energy sources and ground source heat pumps (GSHPs). The effort was funded by the U.S. Army Installation Management Command (IMCOM) as follow-on to the 2005 Department of Defense (DoD) Renewables Assessment.

  6. Preparing for Mars: The Evolvable Mars Campaign 'Proving Ground' Approach

    Science.gov (United States)

    Bobskill, Marianne R.; Lupisella, Mark L.; Mueller, Rob P.; Sibille, Laurent; Vangen, Scott; Williams-Byrd, Julie

    2015-01-01

    As the National Aeronautics and Space Administration (NASA) prepares to extend human presence beyond Low Earth Orbit, we are in the early stages of planning missions within the framework of an Evolvable Mars Campaign. Initial missions would be conducted in near-Earth cis-lunar space and would eventually culminate in extended duration crewed missions on the surface of Mars. To enable such exploration missions, critical technologies and capabilities must be identified, developed, and tested. NASA has followed a principled approach to identify critical capabilities and a "Proving Ground" approach is emerging to address testing needs. The Proving Ground is a period subsequent to current International Space Station activities wherein exploration-enabling capabilities and technologies are developed and the foundation is laid for sustained human presence in space. The Proving Ground domain essentially includes missions beyond Low Earth Orbit that will provide increasing mission capability while reducing technical risks. Proving Ground missions also provide valuable experience with deep space operations and support the transition from "Earth-dependence" to "Earth-independence" required for sustainable space exploration. A Technology Development Assessment Team identified a suite of critical technologies needed to support the cadence of exploration missions. Discussions among mission planners, vehicle developers, subject-matter-experts, and technologists were used to identify a minimum but sufficient set of required technologies and capabilities. Within System Maturation Teams, known challenges were identified and expressed as specific performance gaps in critical capabilities, which were then refined and activities required to close these critical gaps were identified. Analysis was performed to identify test and demonstration opportunities for critical technical capabilities across the Proving Ground spectrum of missions. This suite of critical capabilities is expected to

  7. Evaluation of depleted uranium in the environment at Aberdeen Proving Grounds, Maryland and Yuma Proving Grounds, Arizona. Final report

    International Nuclear Information System (INIS)

    Kennedy, P.L.; Clements, W.H.; Myers, O.B.; Bestgen, H.T.; Jenkins, D.G.

    1995-01-01

    This report represents an evaluation of depleted uranium (DU) introduced into the environment at the Aberdeen Proving Grounds (APG), Maryland and Yuma Proving Grounds (YPG) Arizona. This was a cooperative project between the Environmental Sciences and Statistical Analyses Groups at LANL and with the Department of Fishery and Wildlife Biology at Colorado State University. The project represents a unique approach to assessing the environmental impact of DU in two dissimilar ecosystems. Ecological exposure models were created for each ecosystem and sensitivity/uncertainty analyses were conducted to identify exposure pathways which were most influential in the fate and transport of DU in the environment. Research included field sampling, field exposure experiment, and laboratory experiments. The first section addresses DU at the APG site. Chapter topics include bioenergetics-based food web model; field exposure experiments; bioconcentration by phytoplankton and the toxicity of U to zooplankton; physical processes governing the desorption of uranium from sediment to water; transfer of uranium from sediment to benthic invertebrates; spead of adsorpion by benthic invertebrates; uptake of uranium by fish. The final section of the report addresses DU at the YPG site. Chapters include the following information: Du transport processes and pathway model; field studies of performance of exposure model; uptake and elimination rates for kangaroo rates; chemical toxicity in kangaroo rat kidneys

  8. Evaluation of depleted uranium in the environment at Aberdeen Proving Grounds, Maryland and Yuma Proving Grounds, Arizona. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Kennedy, P.L.; Clements, W.H.; Myers, O.B.; Bestgen, H.T.; Jenkins, D.G. [Colorado State Univ., Fort Collins, CO (United States). Dept. of Fishery and Wildlife Biology

    1995-01-01

    This report represents an evaluation of depleted uranium (DU) introduced into the environment at the Aberdeen Proving Grounds (APG), Maryland and Yuma Proving Grounds (YPG) Arizona. This was a cooperative project between the Environmental Sciences and Statistical Analyses Groups at LANL and with the Department of Fishery and Wildlife Biology at Colorado State University. The project represents a unique approach to assessing the environmental impact of DU in two dissimilar ecosystems. Ecological exposure models were created for each ecosystem and sensitivity/uncertainty analyses were conducted to identify exposure pathways which were most influential in the fate and transport of DU in the environment. Research included field sampling, field exposure experiment, and laboratory experiments. The first section addresses DU at the APG site. Chapter topics include bioenergetics-based food web model; field exposure experiments; bioconcentration by phytoplankton and the toxicity of U to zooplankton; physical processes governing the desorption of uranium from sediment to water; transfer of uranium from sediment to benthic invertebrates; spead of adsorpion by benthic invertebrates; uptake of uranium by fish. The final section of the report addresses DU at the YPG site. Chapters include the following information: Du transport processes and pathway model; field studies of performance of exposure model; uptake and elimination rates for kangaroo rates; chemical toxicity in kangaroo rat kidneys.

  9. SPoRT's Participation in the GOES-R Proving Ground Activity

    Science.gov (United States)

    Jedlovec, Gary; Fuell, Kevin; Smith, Matthew; Stano, Geoffrey; Molthan, Andrew

    2011-01-01

    The next generation geostationary satellite, GOES-R, will carry two new instruments with unique atmospheric and surface observing capabilities, the Advanced Baseline Imager (ABI) and the Geostationary Lightning Mapper (GLM), to study short-term weather processes. The ABI will bring enhanced multispectral observing capabilities with frequent refresh rates for regional and full disk coverage to geostationary orbit to address many existing and new forecast challenges. The GLM will, for the first time, provide the continuous monitoring of total lightning flashes over a hemispherical region from space. NOAA established the GOES-R Proving Ground activity several years ago to demonstrate the new capabilities of these instruments and to prepare forecasters for their day one use. Proving Ground partners work closely with algorithm developers and the end user community to develop and transition proxy data sets representing GOES-R observing capabilities. This close collaboration helps to maximize refine algorithms leading to the delivery of a product that effectively address a forecast challenge. The NASA Short-term Prediction Research and Transition (SPoRT) program has been a participant in the NOAA GOES-R Proving Ground activity by developing and disseminating selected GOES-R proxy products to collaborating WFOs and National Centers. Established in 2002 to demonstrate the weather and forecasting application of real-time EOS measurements, the SPoRT program has grown to be an end-to-end research to operations activity focused on the use of advanced NASA modeling and data assimilation approaches, nowcasting techniques, and unique high-resolution multispectral data from EOS satellites to improve short-term weather forecasts on a regional and local scale. Participation in the Proving Ground activities extends SPoRT s activities and taps its experience and expertise in diagnostic weather analysis, short-term weather forecasting, and the transition of research and experimental

  10. Geophysics: Building E5481 decommissioning, Aberdeen Proving Ground

    International Nuclear Information System (INIS)

    Thompson, M.D.; McGinnis, M.G.; McGinnis, L.D.; Miller, S.F.

    1992-11-01

    Building E5481 is one of ten potentially contaminated sites in the Canal Creek and Westwood areas of the Edgewood section of Aberdeen Proving Ground examined by a geophysical team from Argonne National Laboratory in April and May of 1992. Noninvasive geophysical surveys, including magnetics, electrical resistivity, and ground-penetrating radar, were conducted around the perimeter of the building to guide a sampling program prior to decommissioning and dismantling. The building is located on the northern margin of a landfill that was sited in a wetland. The large number of magnetic sources surrounding the building are believed to be contained in construction fill that had been used to raise the grade. The smaller anomalies, for the most part, are not imaged with ground radar or by electrical profiling. A conductive zone trending northwest to southeast across the site is spatially related to an old roadbed. Higher resistivity areas in the northeast and east are probably representive of background values. Three high-amplitude, positive, rectangular magnetic anomalies have unknown sources. The features do not have equivalent electrical signatures, nor are they seen with radar imaging

  11. Geophysics: Building E5476 decommissiong, Aberdeen Proving Ground

    International Nuclear Information System (INIS)

    Miller, S.F.; Thompson, M.D.; McGinnis, M.G.; McGinnis, L.D.

    1992-11-01

    Building E5476 was one of ten potentially contaminated sites in the Canal Creek and Westwood areas of the Edgewood section of Aberdeen Proving Ground examined by a geophysical team from Argonne National Laboratory in April and May of 1992. Noninvasive geophysical surveys, including magnetics, electrical resistivity, and ground-penetrating radar, were conducted around the perimeter of the building to guide a sampling program prior to decommissioning and dismantling. The large number of magnetic sources surrounding the building are believed to be contained in construction fill. The smaller anomalies, for the most part, were not imaged with ground radar or by electrical profiling. Large magnetic anomalies near the southwest comer of the building are due to aboveground standpipes and steel-reinforced concrete. Two high-resistivity areas, one projecting northeast from the building and another south of the original structure, may indicate the presence of organic pore fluids in the subsurface. A conductive lineament protruding from the south wall that is enclosed by the southem, high-resistivity feature is not associated with an equivalent magnetic anomaly. Magnetic and electrical anomalies south of the old landfill boundary are probably not associated with the building. The boundary is marked by a band of magnetic anomalies and a conductive zone trending northwest to southeast. The cause of high resistivities in a semicircular area in the southwest comer, within the landfill area, is unexplained

  12. Geophysics: Building E5375 decommissioning, Aberdeen Proving Ground

    International Nuclear Information System (INIS)

    McGinnis, M.G.; McGinnis, L.D.; Miller, S.F.; Thompson, M.D.

    1992-08-01

    Building E5375 was one of ten potentially contaminated sites in the Canal Creek area of the Edgewood section of Aberdeen Proving Ground examined by a geophysical team from Argonne National Laboratory in April and May 1992. Noninvasive geophysical surveys, including magnetics, electrical resistivity, and ground-penetrating radar (GPR), were conducted around the perimeter of the building to guide a sampling program prior to decommissioning and dismantling. Several anomalies wear, noted: (1) An underground storage tank located 25 ft east of Building E5375 was identified with magnetic, resistivity, and GPR profiling. (2) A three-point resistivity anomaly, 12 ft east of the northeast comer of Building E5374 (which borders Building E5375) and 5 ft south of the area surveyed with the magnetometer, may be caused by another underground storage tank. (3) A 2,500-gamma magnetic anomaly near the northeast corner of the site has no equivalent resistivity anomaly, although disruption in GPR reflectors was observed. (4) A one-point magnetic anomaly was located at the northeast comer, but its source cannot be resolved. A chaotic reflective zone to the east represents the radar signature of Building E5375 construction fill

  13. Ecological survey of M-Field, Edgewood Area Aberdeen Proving Ground, Maryland

    Energy Technology Data Exchange (ETDEWEB)

    Downs, J.L.; Eberhardt, L.E.; Fitzner, R.E.; Rogers, L.E.

    1991-12-01

    An ecological survey was conducted on M-Field, at the Edgewood Area, Aberdeen Proving Ground, Maryland. M-Field is used routinely to test army smokes and obscurants, including brass flakes, carbon fibers, and fog oils. The field has been used for testing purposes for the past 40 years, but little documented history is available. Under current environmental regulations, the test field must be assessed periodically to document the presence or potential use of the area by threatened and endangered species. The M-Field area is approximately 370 acres and is part of the US Army's Edgewood Area at Aberdeen Proving Ground in Harford County, Maryland. The grass-covered field is primarily lowlands with elevations from about 1.0 to 8 m above sea level, and several buildings and structures are present on the field. The ecological assessment of M-Field was conducted in three stages, beginning with a preliminary site visit in May to assess sampling requirements. Two field site visits were made June 3--7, and August 12--15, 1991, to identify the biota existing on the site. Data were gathered on vegetation, small mammals, invertebrates, birds, large mammals, amphibians, and reptiles.

  14. Ecological survey of M-Field, Edgewood Area Aberdeen Proving Ground, Maryland

    Energy Technology Data Exchange (ETDEWEB)

    Downs, J.L.; Eberhardt, L.E.; Fitzner, R.E.; Rogers, L.E.

    1991-12-01

    An ecological survey was conducted on M-Field, at the Edgewood Area, Aberdeen Proving Ground, Maryland. M-Field is used routinely to test army smokes and obscurants, including brass flakes, carbon fibers, and fog oils. The field has been used for testing purposes for the past 40 years, but little documented history is available. Under current environmental regulations, the test field must be assessed periodically to document the presence or potential use of the area by threatened and endangered species. The M-Field area is approximately 370 acres and is part of the US Army`s Edgewood Area at Aberdeen Proving Ground in Harford County, Maryland. The grass-covered field is primarily lowlands with elevations from about 1.0 to 8 m above sea level, and several buildings and structures are present on the field. The ecological assessment of M-Field was conducted in three stages, beginning with a preliminary site visit in May to assess sampling requirements. Two field site visits were made June 3--7, and August 12--15, 1991, to identify the biota existing on the site. Data were gathered on vegetation, small mammals, invertebrates, birds, large mammals, amphibians, and reptiles.

  15. Research Objectives for Human Missions in the Proving Ground of Cis-Lunar Space

    Science.gov (United States)

    Spann, James; Niles, Paul; Eppler, Dean; Kennedy, Kriss; Lewis, Ruthan; Sullivan, Thomas

    2016-07-01

    Introduction: This talk will introduce the preliminary findings in support of NASA's Future Capabilities Team. In support of the ongoing studies conducted by NASA's Future Capabilities Team, we are tasked with collecting re-search objectives for the Proving Ground activities. The objectives could include but are certainly not limited to: demonstrating crew well being and performance over long duration missions, characterizing lunar volatiles, Earth monitoring, near Earth object search and identification, support of a far-side radio telescope, and measuring impact of deep space environment on biological systems. Beginning in as early as 2023, crewed missions beyond low Earth orbit will be enabled by the new capabilities of the SLS and Orion vehicles. This will initiate the "Proving Ground" phase of human exploration with Mars as an ultimate destination. The primary goal of the Proving Ground is to demonstrate the capability of suitably long dura-tion spaceflight without need of continuous support from Earth, i.e. become Earth Independent. A major component of the Proving Ground phase is to conduct research activities aimed at accomplishing major objectives selected from a wide variety of disciplines including but not limited to: Astronomy, Heliophysics, Fun-damental Physics, Planetary Science, Earth Science, Human Systems, Fundamental Space Biology, Microgravity, and In Situ Resource Utilization. Mapping and prioritizing the most important objectives from these disciplines will provide a strong foundation for establishing the architecture to be utilized in the Proving Ground. Possible Architectures: Activities and objectives will be accomplished during the Proving Ground phase using a deep space habitat. This habitat will potentially be accompanied by a power/propulsion bus capable of moving the habitat to accomplish different objectives within cis-lunar space. This architecture can also potentially support stag-ing of robotic and tele-robotic assets as well as

  16. An Archeological Overview and Management Plan for the Dugway Proving Ground.

    Science.gov (United States)

    1984-03-29

    niches, particulary the lacustrine environment of the Great Basin (Baumhoff and Heizer 1965, Butler 1978, Heizer and Krieger 1956, Heizer and Harper...power that would capture the animals souls, rendering them docile and stupid (Steward 1970:34). Other large game was present, but were not numerous...uni versity. Baum, Bernard. 1947. Dugway Proving Ground. Aberdeen: U.S. Army Chemical Corps.* Bailmhoff, W.A. and R.F. Heizer . 1965. Postglacial

  17. GOES-R Proving Ground Activities at the NASA Short-Term Prediction Research and Transition (SPoRT) Center

    Science.gov (United States)

    Molthan, Andrew

    2011-01-01

    SPoRT is actively involved in GOES-R Proving Ground activities in a number of ways: (1) Applying the paradigm of product development, user training, and interaction to foster interaction with end users at NOAA forecast offices national centers. (2) Providing unique capabilities in collaboration with other GOES-R Proving Ground partners (a) Hybrid GOES-MODIS imagery (b) Pseudo-GLM via regional lightning mapping arrays (c) Developing new RGB imagery from EUMETSAT guidelines

  18. NASA SPoRT GOES-R Proving Ground Activities

    Science.gov (United States)

    Stano, Geoffrey T.; Fuell, Kevin K.; Jedloec, Gary J.

    2010-01-01

    The NASA Short-term Prediction Research and Transition (SPoRT) program is a partner with the GOES-R Proving Ground (PG) helping prepare forecasters understand the unique products to come from the GOES-R instrument suite. SPoRT is working collaboratively with other members of the GOES-R PG team and Algorithm Working Group (AWG) scientists to develop and disseminate a suite of proxy products that address specific forecast problems for the WFOs, Regional and National Support Centers, and other NOAA users. These products draw on SPoRT s expertise with the transition and evaluation of products into operations from the MODIS instrument and the North Alabama Lightning Mapping Array (NALMA). The MODIS instrument serves as an excellent proxy for the Advanced Baseline Imager (ABI) that will be aboard GOES-R. SPoRT has transitioned and evaluated several multi-channel MODIS products. The true and false color products are being used in natural hazard detection by several SPoRT partners to provide better observation of land features, such as fires, smoke plumes, and snow cover. Additionally, many of SPoRT s partners are coastal offices and already benefit from the MODIS sea surface temperature composite. This, along with other surface feature observations will be developed into ABI proxy products for diagnostic use in the forecast process as well as assimilation into forecast models. In addition to the MODIS instrument, the NALMA has proven very valuable to WFOs with access to these total lightning data. These data provide situational awareness and enhanced warning decision making to improve lead times for severe thunderstorm and tornado warnings. One effort by SPoRT scientists includes a lightning threat product to create short-term model forecasts of lightning activity. Additionally, SPoRT is working with the AWG to create GLM proxy data from several of the ground based total lightning networks, such as the NALMA. The evaluation will focus on the vastly improved spatial

  19. The GOES-R Proving Ground: 2012 Update

    Science.gov (United States)

    Gurka, J.; Goodman, S. J.; Schmit, T.; Demaria, M.; Mostek, A.; Siewert, C.; Reed, B.

    2011-12-01

    The Geostationary Operational Environmental Satellite (GOES)-R will provide a great leap forward in observing capabilities, but will also offer a significant challenge to ensure that users are ready to exploit the vast improvements in spatial, spectral, and temporal resolutions. To ensure user readiness, forecasters and other users must have access to prototype advanced products well before launch, and have the opportunity to provide feedback to product developers and computing and communications managers. The operational assessment is critical to ensure that the end products and NOAA's computing and communications systems truly meet their needs in a rapidly evolving environment. The GOES-R Proving Ground (PG) engages the National Weather Service (NWS) forecast, watch and warning community and other agency users in pre-operational demonstrations of select products with GOES-R attributes (enhanced spectral, spatial, and temporal resolution). In the PG, developers and forecasters test and apply algorithms for new GOES-R satellite data and products using proxy and simulated data sets, including observations from current and future satellite instruments (MODIS, AIRS, IASI, SEVIRI, NAST-I, NPP/VIIRS/CrIS, LIS), lightning networks, and computer simulated products. The complete list of products to be evaluated in 2012 will be determined after evaluating results from experiments in 2011 at the NWS' Storm Prediction Center, National Hurricane Center, Aviation Weather Center, Ocean Prediction Center, Hydrometeorological Prediction Center, and from the six NWS regions. In 2012 and beyond, the PG will test and validate data processing and distribution systems and the applications of these products in operational settings. Additionally developers and forecasters will test and apply display techniques and decision aid tools in operational environments. The PG is both a recipient and a source of training. Training materials are developed using various distance training tools in

  20. Depleted uranium risk assessment at Aberdeen Proving Ground

    International Nuclear Information System (INIS)

    Ebinger, M.H.; Myers, O.B.; Kennedy, P.L.; Clements, W.H.

    1993-01-01

    The Environmental Science Group at Los Alamos and the Test and Evaluation Command (TECOM) are assessing the risk of depleted uranium (DU) testing at Aberdeen Proving Ground (APG). Conceptual and mathematical models of DU transfer through the APG ecosystem have been developed in order to show the mechanisms by which DU migrates or remains unavailable to different flora and fauna and to humans. The models incorporate actual rates of DU transfer between different ecosystem components as much as possible. Availability of data on DU transport through different pathways is scarce and constrains some of the transfer rates that can be used. Estimates of transfer rates were derived from literature sources and used in the mass-transfer models when actual transfer rates were unavailable. Objectives for this risk assessment are (1) to assess if DU transports away from impact areas; (2) to estimate how much, if any, DU migrates into Chesapeake Bay; (3) to determine if there are appreciable risks to the ecosystems due to DU testing; (4) to estimate the risk to human health as a result of DU testing

  1. Initial building investigations at Aberdeen Proving Ground, Maryland: Objectives and methodology

    Energy Technology Data Exchange (ETDEWEB)

    Brubaker, K.L.; Dougherty, J.M.; McGinnis, L.D.

    1994-12-01

    As part of an environmental-contamination source-definition program at Aberdeen Proving Ground, detailed internal and external inspections of 23 potentially contaminated buildings are being conducted to describe and characterize the state of each building as it currently exists and to identify areas potentially contaminated with toxic or other hazardous substances. In addition, a detailed geophysical investigation is being conducted in the vicinity of each target building to locate and identify subsurface structures, associated with former building operations, that are potential sources of contamination. This report describes the objectives of the initial building inspections, including the geophysical investigations, and discusses the methodology that has been developed to achieve these objectives.

  2. JPSS Preparations at the Satellite Proving Ground for Marine, Precipitation, and Satellite Analysis

    Science.gov (United States)

    Folmer, Michael J.; Berndt, E.; Clark, J.; Orrison, A.; Kibler, J.; Sienkiewicz, J.; Nelson, J.; Goldberg, M.; Sjoberg, W.

    2016-01-01

    The ocean prediction center at the national hurricane center's tropical analysis and forecast Branch, the Weather Prediction center and the Satellite analysis branch of NESDIS make up the Satellite Proving Ground for Marine, Precipitation and Satellite Analysis. These centers had early exposure to JPSS products using the S-NPP Satellite that was launched in 2011. Forecasters continue to evaluate new products in anticipation for the launch of JPSS-1 sometime in 2017.

  3. Environmental geophysics at J-Field, Aberdeen Proving Ground, Maryland

    Energy Technology Data Exchange (ETDEWEB)

    Daudt, C.R.; McGinnis, L.D.; Miller, S.F.; Thompson, M.D.

    1994-11-01

    Geophysical data collected at J-Field, Aberdeen Proving Ground, Maryland, were used in the characterization of the natural hydrogeologic framework of the J-Field area and in the identification of buried disturbances (trenches and other evidences of contamination). Seismic refraction and reflection data and electrical resistivity data have aided in the characterization of the leaky confining unit at the base of the surficial aquifer (designated Unit B of the Tertiary Talbot Formation). Excellent reflectors have been observed for both upper and lower surfaces of Unit B that correspond to stratigraphic units observed in boreholes and on gamma logs. Elevation maps of both surfaces and an isopach map of Unit B, created from reflection data at the toxic burning pits site, show a thickening of Unit B to the east. Abnormally low seismic compressional-wave velocities suggest that Unit B consists of gassy sediments whose gases are not being flushed by upward or downward moving groundwater. The presence of gases suggests that Unit B serves as an efficient aquitard that should not be penetrated by drilling or other activities. Electromagnetic, total-intensity magnetic, and ground-penetrating radar surveys have aided in delineating the limits of two buried trenches, the VX burning pit and the liquid smoke disposal pit, both located at the toxic burning pits site. The techniques have also aided in determining the extent of several other disturbed areas where soils and materials were pushed out of disposal pits during trenching activities. Surveys conducted from the Prototype Building west to the Gunpowder River did not reveal any buried trenches.

  4. Contamination of ground water, surface water, and soil, and evaluation of selected ground-water pumping alternatives in the Canal Creek area of Aberdeen Proving Ground, Maryland

    Science.gov (United States)

    Lorah, Michelle M.; Clark, Jeffrey S.

    1996-01-01

    Chemical manufacturing, munitions filling, and other military-support activities have resulted in the contamination of ground water, surface water, and soil in the Canal Creek area of Aberdeen Proving Ground, Maryland. Chlorinated volatile organic compounds, including 1,1,2,2-tetrachloroethane and trichloroethylene, are widespread ground-water contaminants in two aquifers that are composed of unconsolidated sand and gravel. Distribution and fate of chlorinated organic compounds in the ground water has been affected by the movement and dissolution of solvents in their dense immiscible phase and by microbial degradation under anaerobic conditions. Detection of volatile organic contaminants in adjacent surface water indicates that shallow contaminated ground water discharges to surface water. Semivolatile organic compounds, especially polycyclic aromatic hydrocarbons, are the most prevalent organic contaminants in soils. Various trace elements, such as arsenic, cadmium, lead, and zinc, were found in elevated concentrations in ground water, surface water, and soil. Simulations with a ground-water-flow model and particle tracker postprocessor show that, without remedial pumpage, the contaminants will eventually migrate to Canal Creek and Gunpowder River. Simulations indicate that remedial pumpage of 2.0 million gallons per day from existing wells is needed to capture all particles originating in the contaminant plumes. Simulated pumpage from offsite wells screened in a lower confined aquifer does not affect the flow of contaminated ground water in the Canal Creek area.

  5. Potential Cislunar and Interplanetary Proving Ground Excursion Trajectory Concepts

    Science.gov (United States)

    McGuire, Melissa L.; Strange, Nathan J.; Burke, Laura M.; MacDonald, Mark A.; McElrath, Timothy P.; Landau, Damon F.; Lantoine, Gregory; Hack, Kurt J.; Lopez, Pedro

    2016-01-01

    NASA has been investigating potential translunar excursion concepts to take place in the 2020s that would be used to test and demonstrate long duration life support and other systems needed for eventual Mars missions in the 2030s. These potential trajectory concepts could be conducted in the proving ground, a region of cislunar and near-Earth interplanetary space where international space agencies could cooperate to develop the technologies needed for interplanetary spaceflight. Enabled by high power Solar Electric Propulsion (SEP) technologies, the excursion trajectory concepts studied are grouped into three classes of increasing distance from the Earth and increasing technical difficulty: the first class of excursion trajectory concepts would represent a 90-120 day round trip trajectory with abort to Earth options throughout the entire length, the second class would be a 180-210 day round trip trajectory with periods in which aborts would not be available, and the third would be a 300-400 day round trip trajectory without aborts for most of the length of the trip. This paper provides a top-level summary of the trajectory and mission design of representative example missions of these three classes of excursion trajectory concepts.

  6. Remedial investigation report for J-Field, Aberdeen Proving Ground, Maryland. Volume 3: Ecological risk assessment

    Energy Technology Data Exchange (ETDEWEB)

    Hlohowskyj, I.; Hayse, J.; Kuperman, R.; Van Lonkhuyzen, R.

    2000-02-25

    The Environmental Management Division of the U.S. Army Aberdeen Proving Ground (APG), Maryland, is conducting a remedial investigation (RI) and feasibility study (FS) of the J-Field area at APG, pursuant to the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA), as amended. As part of that activity, Argonne National Laboratory (ANL) conducted an ecological risk assessment (ERA) of the J-Field site. This report presents the results of that assessment.

  7. Remedial investigation report for J-Field, Aberdeen Proving Ground, Maryland. Volume 3: Ecological risk assessment

    International Nuclear Information System (INIS)

    Hlohowskyj, I.; Hayse, J.; Kuperman, R.; Van Lonkhuyzen, R.

    2000-01-01

    The Environmental Management Division of the U.S. Army Aberdeen Proving Ground (APG), Maryland, is conducting a remedial investigation (RI) and feasibility study (FS) of the J-Field area at APG, pursuant to the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA), as amended. As part of that activity, Argonne National Laboratory (ANL) conducted an ecological risk assessment (ERA) of the J-Field site. This report presents the results of that assessment

  8. Environmental geophysics at the Southern Bush River Peninsula, Aberdeen Proving Ground, Maryland

    Energy Technology Data Exchange (ETDEWEB)

    Davies, B.E.; Miller, S.F.; McGinnis, L.D. [and others

    1995-05-01

    Geophysical studies have been conducted at five sites in the southern Bush River Peninsula in the Edgewood Area of Aberdeen Proving Ground, Maryland. The goals of the studies were to identify areas containing buried metallic objects and to provide diagnostic signatures of the hydrogeologic framework of the site. These studies indicate that, during the Pleistocene Epoch, alternating stands of high and low sea level resulted in a complex pattern of channel-fill deposits. Paleochannels of various sizes and orientations have been mapped throughout the study area by means of ground-penetrating radar and EM-31 techniques. The EM-31 paleochannel signatures are represented onshore either by conductivity highs or lows, depending on the depths and facies of the fill sequences. A companion study shows the features as conductivity highs where they extend offshore. This erosional and depositional system is environmentally significant because of the role it plays in the shallow groundwater flow regime beneath the site. Magnetic and electromagnetic anomalies outline surficial and buried debris throughout the areas surveyed. On the basis of geophysical measurements, large-scale (i.e., tens of feet) landfilling has not been found in the southern Bush River Peninsula, though smaller-scale dumping of metallic debris and/or munitions cannot be ruled out.

  9. Interim progress report -- geophysics: Decommissioning of Buildings E5974 and E5978, Aberdeen Proving Ground

    International Nuclear Information System (INIS)

    McGinnis, M.G.; McGinnis, L.D.; Miller, S.F.; Thompson, M.D.

    1992-11-01

    Buildings E5974 and E5978, located near the mouth of Canal Creek, were among 10 potentially contaminated sites in the Westwood and Canal Creek areas of the Edgewood section of Aberdeen Proving Ground examined by a geophysical team from Argonne National Laboratory in April and May of 1992. Noninvasive geophysical surveys, including the complementary technologies of magnetics, electrical resistivity, and ground-penetrating radar, were conducted around the perimeters of the buildings to guide a sampling program prior to decommissioning and dismantling. The magnetic anomalies and the electrically conductive areas around these buildings have a spatial relationship similar to that observed in low-lying sites in the Canal Creek area; they are probably associated with construction fill. Electrically conductive terrain is dominant on the eastern side of the site, and resistive terrain predominates on the west. The smaller magnetic anomalies are not imaged with ground radar or by electrical profiling. The high resistivities in the northwest quadrant are believed to be caused by a natural sand lens. The causes of three magnetic anomalies in the high-resistivity area are unidentified, but they are probably anthropogenic

  10. JPSS Proving Ground Activities with NASA's Short-term Prediction Research and Transition (SPoRT) Center

    Science.gov (United States)

    Schultz, L. A.; Smith, M. R.; Fuell, K.; Stano, G. T.; LeRoy, A.; Berndt, E.

    2015-12-01

    Instruments aboard the Joint Polar Satellite System (JPSS) series of satellites will provide imagery and other data sets relevant to operational weather forecasts. To prepare current and future weather forecasters in application of these data sets, Proving Ground activities have been established that demonstrate future JPSS capabilities through use of similar sensors aboard NASA's Terra and Aqua satellites, and the S-NPP mission. As part of these efforts, NASA's Short-term Prediction Research and Transition (SPoRT) Center in Huntsville, Alabama partners with near real-time providers of S-NPP products (e.g., NASA, UW/CIMSS, UAF/GINA, etc.) to demonstrate future capabilities of JPSS. This includes training materials and product distribution of multi-spectral false color composites of the visible, near-infrared, and infrared bands of MODIS and VIIRS. These are designed to highlight phenomena of interest to help forecasters digest the multispectral data provided by the VIIRS sensor. In addition, forecasters have been trained on the use of the VIIRS day-night band, which provides imagery of moonlit clouds, surface, and lights emitted by human activities. Hyperspectral information from the S-NPP/CrIS instrument provides thermodynamic profiles that aid in the detection of extremely cold air aloft, helping to map specific aviation hazards at high latitudes. Hyperspectral data also support the estimation of ozone concentration, which can highlight the presence of much drier stratospheric air, and map its interaction with mid-latitude or tropical cyclones to improve predictions of their strengthening or decay. Proving Ground activities are reviewed, including training materials and methods that have been provided to forecasters, and forecaster feedback on these products that has been acquired through formal, detailed assessment of their applicability to a given forecast threat or task. Future opportunities for collaborations around the delivery of training are proposed

  11. Long-term ground-water monitoring program and performance-evaluation plan for the extraction system at the former Nike Missile Battery Site, Aberdeen Proving Ground, Maryland

    Science.gov (United States)

    Senus, Michael P.; Tenbus, Frederick J.

    2000-01-01

    This report presents lithologic and ground-water-quality data collected during April and May 2000 in the remote areas of the tidal wetland of West Branch Canal Creek, Aberdeen Proving Ground, Maryland. Contamination of the Canal Creek aquifer with volatile organic compounds has been documented in previous investigations of the area. This study was conducted to investigate areas that were previously inaccessible because of deep mud and shallow water, and to support ongoing investigations of the fate and transport of volatile organic compounds in the Canal Creek aquifer. A unique vibracore drill rig mounted on a hovercraft was used for drilling and ground-water sampling. Continuous cores of the wetland sediment and of the Canal Creek aquifer were collected at five sites. Attempts to sample ground water were made by use of a continuous profiler at 12 sites, without well installation, at a total of 81 depths within the aquifer. Of those 81 attempts, only 34 sampling depths produced enough water to collect samples. Ground-water samples from two sites had the highest concentrations of volatile organic compounds?with total volatile organic compound concentrations in the upper part of the aquifer ranging from about 15,000 to 50,000 micrograms per liter. Ground-water samples from five sites had much lower total volatile organic compound concentrations (95 to 2,100 micrograms per liter), whereas two sites were essentially not contaminated, with total volatile organic compound concentrations less than or equal to 5 micrograms per liter.

  12. Characterization of Preferential Ground-Water Seepage From a Chlorinated Hydrocarbon-Contaminated Aquifer to West Branch Canal Creek, Aberdeen Proving Ground, Maryland, 2002-04

    Science.gov (United States)

    Majcher, Emily H.; Phelan, Daniel J.; Lorah, Michelle M.; McGinty, Angela L.

    2007-01-01

    Wetlands act as natural transition zones between ground water and surface water, characterized by the complex interdependency of hydrology, chemical and physical properties, and biotic effects. Although field and laboratory demonstrations have shown efficient natural attenuation processes in the non-seep wetland areas and stream bottom sediments of West Branch Canal Creek, chlorinated volatile organic compounds are present in a freshwater tidal creek at Aberdeen Proving Ground, Maryland. Volatile organic compound concentrations in surface water indicate that in some areas of the wetland, preferential flow paths or seeps allow transport of organic compounds from the contaminated sand aquifer to the overlying surface water without undergoing natural attenuation. From 2002 through 2004, the U.S. Geological Survey, in cooperation with the Environmental Conservation and Restoration Division of the U.S. Army Garrison, Aberdeen Proving Ground, characterized preferential ground-water seepage as part of an ongoing investigation of contaminant distribution and natural attenuation processes in wetlands at this site. Seep areas were discrete and spatially consistent during thermal infrared surveys in 2002, 2003, and 2004 throughout West Branch Canal Creek wetlands. In these seep areas, temperature measurements in shallow pore water and sediment more closely resembled those in ground water than those in nearby surface water. Generally, pore water in seep areas contaminated with chlorinated volatile organic compounds had lower methane and greater volatile organic compound concentrations than pore water in non-seep wetland sediments. The volatile organic compounds detected in shallow pore water in seeps were spatially similar to the dominant volatile organic compounds in the underlying Canal Creek aquifer, with both parent and anaerobic daughter compounds detected. Seep locations characterized as focused seeps contained the highest concentrations of chlorinated parent compounds

  13. Contamination source review for Building E2370, Edgewood Area, Aberdeen Proving Ground, Maryland

    Energy Technology Data Exchange (ETDEWEB)

    O`Reilly, D.P.; Glennon, M.A.; Draugelis, A.K.; Rueda, J.; Zimmerman, R.E.

    1995-09-01

    The US Army Aberdeen Proving Ground (APG) commissioned Argonne National Laboratory (ANL) to conduct a contamination source review to identify and define areas of toxic or hazardous contaminants and to assess the physical condition and accessibility of APG buildings. The information obtained from this review may be used to assist the US Army in planning for the future use or disposition of the buildings. The contamination source review consisted of the following tasks: historical records search, physical inspection, photographic documentation, and geophysical investigation. This report provides the results of the contamination source review for Building E2370. Many of the APG facilities constructed between 1917 and the 1960s are no longer used because of obsolescence and their poor state of repair. Because many of these buildings were used for research, development, testing, and/or pilot-scale production of chemical warfare agents and other military substances, the potential exists for portions of the buildings to be contaminated with these substances, their degradation products, and other laboratory or industrial chemicals. These buildings and associated structures or appurtenances may contribute to environmental concerns at APG.

  14. Contamination source review for Building E3236, Edgewood Area, Aberdeen Proving Ground, Maryland

    Energy Technology Data Exchange (ETDEWEB)

    Zellmer, S.D.; Smits, M.P.; Draugelis, A.K.; Glennon, M.A.; Rueda, J.; Zimmerman, R.E.

    1995-09-01

    The US Army Aberdeen Proving Ground (APG) commissioned Argonne National Laboratory (ANL) to conduct a contamination source review to identify and define areas of toxic or hazardous contaminants and to assess the physical condition and accessibility of APG buildings. The information obtained from the review may be used to assist the US Army in planning for the future use or disposition of the buildings. The contamination source review consisted of the following tasks: historical records search, physical inspection, photographic documentation, geophysical investigation, and review of available records regarding underground storage tanks associated with each building. This report provides the results of the contamination source review for Building E3236. Many of the APG facilities constructed between 1917 and the 1960s are no longer used because of obsolescence and their poor state of repair. Because many of these buildings were used for research, development, testing, and/or pilot- scale production of chemical warfare agents and other military substances, the potential exists for portions of the buildings to be contaminated with these substances, their degradation products, and other laboratory or industrial chemicals. These buildings and associated structures or appurtenances may contribute to environmental concerns at APG.

  15. Potential health impacts from range fires at Aberdeen Proving Ground, Maryland

    International Nuclear Information System (INIS)

    Willians, G.P.; Hermes, A.M.; Policastro, A.J.; Hartmann, H.M.; Tomasko, D.

    1998-03-01

    This study uses atmospheric dispersion computer models to evaluate the potential for human health impacts from exposure to contaminants that could be dispersed by fires on the testing ranges at Aberdeen Proving Ground, Maryland. It was designed as a screening study and does not estimate actual human health risks. Considered are five contaminants possibly present in the soil and vegetation from past human activities at APG--lead, arsenic, trichloroethylene (TCE), depleted uranium (DU), and dichlorodiphenyltrichloroethane (DDT); and two chemical warfare agents that could be released from unexploded ordnance rounds heated in a range fire--mustard and phosgene. For comparison, dispersion of two naturally occurring compounds that could be released by burning of uncontaminated vegetation--vinyl acetate and 2-furaldehyde--is also examined. Data from previous studies on soil contamination at APG are used in conjunction with conservative estimates about plant uptake of contaminants, atmospheric conditions, and size and frequency of range fires at APG to estimate dispersion and possible human exposure. The results are compared with US Environmental Protection Agency action levels. The comparisons indicate that for all of the anthropogenic contaminants except arsenic and mustard, exposure levels would be at least an order of magnitude lower than the corresponding action levels. Because of the compoundingly conservative nature of the assumptions made, they conclude that the potential for significant human health risks from range fires is low. The authors recommend that future efforts be directed at fire management and control, rather than at conducting additional studies to more accurately estimate actual human health risk from range fires

  16. Potential health impacts from range fires at Aberdeen Proving Ground, Maryland.

    Energy Technology Data Exchange (ETDEWEB)

    Willians, G.P.; Hermes, A.M.; Policastro, A.J.; Hartmann, H.M.; Tomasko, D.

    1998-03-01

    This study uses atmospheric dispersion computer models to evaluate the potential for human health impacts from exposure to contaminants that could be dispersed by fires on the testing ranges at Aberdeen Proving Ground, Maryland. It was designed as a screening study and does not estimate actual human health risks. Considered are five contaminants possibly present in the soil and vegetation from past human activities at APG--lead, arsenic, trichloroethylene (TCE), depleted uranium (DU), and dichlorodiphenyltrichloroethane (DDT); and two chemical warfare agents that could be released from unexploded ordnance rounds heated in a range fire--mustard and phosgene. For comparison, dispersion of two naturally occurring compounds that could be released by burning of uncontaminated vegetation--vinyl acetate and 2-furaldehyde--is also examined. Data from previous studies on soil contamination at APG are used in conjunction with conservative estimates about plant uptake of contaminants, atmospheric conditions, and size and frequency of range fires at APG to estimate dispersion and possible human exposure. The results are compared with US Environmental Protection Agency action levels. The comparisons indicate that for all of the anthropogenic contaminants except arsenic and mustard, exposure levels would be at least an order of magnitude lower than the corresponding action levels. Because of the compoundingly conservative nature of the assumptions made, they conclude that the potential for significant human health risks from range fires is low. The authors recommend that future efforts be directed at fire management and control, rather than at conducting additional studies to more accurately estimate actual human health risk from range fires.

  17. Long-term fate of depleted uranium at Aberdeen and Yuma Proving Grounds: Human health and ecological risk assessments

    Energy Technology Data Exchange (ETDEWEB)

    Ebinger, M.H.; Beckman, R.J.; Myers, O.B. [Los Alamos National Lab., NM (United States); Kennedy, P.L.; Clements, W.; Bestgen, H.T. [Colorado State Univ., Ft. Collins, CO (United States). Dept. of Fishery and Wildlife Biology

    1996-09-01

    The purpose of this study was to evaluate the immediate and long-term consequences of depleted uranium (DU) in the environment at Aberdeen Proving Ground (APG) and Yuma Proving Ground (YPG) for the Test and Evaluation Command (TECOM) of the US Army. Specifically, we examined the potential for adverse radiological and toxicological effects to humans and ecosystems caused by exposure to DU at both installations. We developed contaminant transport models of aquatic and terrestrial ecosystems at APG and terrestrial ecosystems at YPG to assess potential adverse effects from DU exposure. Sensitivity and uncertainty analyses of the initial models showed the portions of the models that most influenced predicted DU concentrations, and the results of the sensitivity analyses were fundamental tools in designing field sampling campaigns at both installations. Results of uranium (U) isotope analyses of field samples provided data to evaluate the source of U in the environment and the toxicological and radiological doses to different ecosystem components and to humans. Probabilistic doses were estimated from the field data, and DU was identified in several components of the food chain at APG and YPG. Dose estimates from APG data indicated that U or DU uptake was insufficient to cause adverse toxicological or radiological effects. Dose estimates from YPG data indicated that U or DU uptake is insufficient to cause radiological effects in ecosystem components or in humans, but toxicological effects in small mammals (e.g., kangaroo rats and pocket mice) may occur from U or DU ingestion. The results of this study were used to modify environmental radiation monitoring plans at APG and YPG to ensure collection of adequate data for ongoing ecological and human health risk assessments.

  18. Long-term fate of depleted uranium at Aberdeen and Yuma Proving Grounds: Human health and ecological risk assessments

    International Nuclear Information System (INIS)

    Ebinger, M.H.; Beckman, R.J.; Myers, O.B.; Kennedy, P.L.; Clements, W.; Bestgen, H.T.

    1996-09-01

    The purpose of this study was to evaluate the immediate and long-term consequences of depleted uranium (DU) in the environment at Aberdeen Proving Ground (APG) and Yuma Proving Ground (YPG) for the Test and Evaluation Command (TECOM) of the US Army. Specifically, we examined the potential for adverse radiological and toxicological effects to humans and ecosystems caused by exposure to DU at both installations. We developed contaminant transport models of aquatic and terrestrial ecosystems at APG and terrestrial ecosystems at YPG to assess potential adverse effects from DU exposure. Sensitivity and uncertainty analyses of the initial models showed the portions of the models that most influenced predicted DU concentrations, and the results of the sensitivity analyses were fundamental tools in designing field sampling campaigns at both installations. Results of uranium (U) isotope analyses of field samples provided data to evaluate the source of U in the environment and the toxicological and radiological doses to different ecosystem components and to humans. Probabilistic doses were estimated from the field data, and DU was identified in several components of the food chain at APG and YPG. Dose estimates from APG data indicated that U or DU uptake was insufficient to cause adverse toxicological or radiological effects. Dose estimates from YPG data indicated that U or DU uptake is insufficient to cause radiological effects in ecosystem components or in humans, but toxicological effects in small mammals (e.g., kangaroo rats and pocket mice) may occur from U or DU ingestion. The results of this study were used to modify environmental radiation monitoring plans at APG and YPG to ensure collection of adequate data for ongoing ecological and human health risk assessments

  19. Remediation application strategies for depleted uranium contaminated soils at the US Army Yuma Proving Ground

    International Nuclear Information System (INIS)

    Vandel, D.S.; Medina, S.M.; Weidner, J.R.

    1994-03-01

    The US Army Yuma Proving Ground (YPG), located in the southwest portion of Arizona conducts firing of projectiles into the Gunpoint (GP-20) firing range. The penetrators are composed of titanium and DU. The purpose of this project was to determine feasible cleanup technologies and disposal alternatives for the cleanup of the depleted uranium (DU) contaminated soils at YPG. The project was split up into several tasks that include (a) collecting and analyzing samples representative of the GP-20 soils, (b) evaluating the data results, (c) conducting a literature search of existing proven technologies for soil remediation, and (0) making final recommendations for implementation of this technology to the site. As a result of this study, several alternatives for the separation, treatment, and disposal procedures are identified that would result in meeting the cleanup levels defined by the Nuclear Regulatory Commission for unrestricted use of soils and would result in a significant cost savings over the life of the firing range

  20. Hydrogeologic and chemical data for the O-Field area, Aberdeen Proving Ground, Maryland

    International Nuclear Information System (INIS)

    Nemoff, P.R.; Vroblesky, D.A.

    1989-01-01

    O-Field, located at the Edgewood area of Aberdeen Proving Ground, Maryland, was periodically used for disposal of munitions, waste chemicals, and chemical-warfare agents from World War II through the 1950's. This report includes various physical, geologic, chemical, and hydrologic data obtained from well-core, groundwater, surface water, and bottom-sediment sampling sites at and near the O-Field disposal area. The data are presented in tables and hydrographs. Three site-location maps are also included. Well-core data include lithologic logs for 11 well-cluster sites, grain-size distributions, various chemical characteristics, and confining unit characteristics. Groundwater data include groundwater chemistry, method blanks for volatile organic carbon, available data on volatile and base/neutral organics, and compilation of corresponding method blanks, chemical-warfare agents, explosive-related products, radionuclides, herbicides, and groundwater levels. Surface-water data include field-measured characteristics; concentrations of various inorganic constituents including arsenic; selected organic constituents with method blanks; detection limits of organics; and a compilation of information on corresponding acids, volatiles, and semivolatiles; and method blanks corresponding to acids, volatiles, and semivolatiles. A set of 15 water-level hydrographs for the period March 1986 through September 1987 also is included in the report. 3 refs., 18 figs., 24 tabs

  1. Ecological risk assessment of depleted uranium in the environment at Aberdeen Proving Ground

    International Nuclear Information System (INIS)

    Clements, W.H.; Kennedy, P.L.; Myers, O.B.

    1993-01-01

    A preliminary ecological risk assessment was conducted to evaluate the effects of depleted uranium (DU) in the Aberdeen Proving Ground (APG) ecosystem and its potential for human health effects. An ecological risk assessment of DU should include the processes of hazard identification, dose-response assessment, exposure assessment, and risk characterization. Ecological risk assessments also should explicitly examine risks incurred by nonhuman as well as human populations, because risk assessments based only on human health do not always protect other species. To begin to assess the potential ecological risk of DU release to the environment we modeled DU transport through the principal components of the aquatic ecosystem at APG. We focused on the APG aquatic system because of the close proximity of the Chesapeake Bay and concerns about potential impacts on this ecosystem. Our objective in using a model to estimate environmental fate of DU is to ultimately reduce the uncertainty about predicted ecological risks due to DU from APG. The model functions to summarize information on the structure and functional properties of the APG aquatic system, to provide an exposure assessment by estimating the fate of DU in the environment, and to evaluate the sources of uncertainty about DU transport

  2. Proceedings of the Scientific Conference on Obscuration and Aerosol Research Held in Aberdeen Proving Ground, Maryland on 17-21 June 1985.

    Science.gov (United States)

    1986-07-01

    Chem. Engrs., 32, 35 (1954). 9. Littman, H., Vukovic , D.V., Zdansk, F.K., and Grabavtit, Z.B., Can. J . Chem. Eng., 54, 33 (1976). 10. Morgan, M.H...COMMAND Aberdeen Proving Ground, Maryland 21010-5423 DISTRIBUTIONSTATEMENW A, Approvod iapublic releaB6~ s11 "’ftbui U o ited’ ^ J .. Di scl aimer The...PARTICLE COMPOSITION R. G. Keesee and A. W. Castleman, Jr ........ ........................ .13 NUCLEATION AND PARTICLE GROWTH " S. G. Kim and J . R

  3. Demonstration of the Military Ecological Risk Assessment Framework (MERAF): Apache Longbow - Hell Missile Test at Yuma Proving Ground

    Energy Technology Data Exchange (ETDEWEB)

    Efroymson, R.A.

    2002-05-09

    This ecological risk assessment for a testing program at Yuma Proving Ground, Arizona, is a demonstration of the Military Ecological Risk Assessment Framework (MERAF; Suter et al. 2001). The demonstration is intended to illustrate how risk assessment guidance concerning-generic military training and testing activities and guidance concerning a specific type of activity (e.g., low-altitude aircraft overflights) may be implemented at a military installation. MERAF was developed with funding from the Strategic Research and Development Program (SERDP) of the Department of Defense. Novel aspects of MERAF include: (1) the assessment of risks from physical stressors using an ecological risk assessment framework, (2) the consideration of contingent or indirect effects of stressors (e.g., population-level effects that are derived from habitat or hydrological changes), (3) the integration of risks associated with different component activities or stressors, (4) the emphasis on quantitative risk estimates and estimates of uncertainty, and (5) the modularity of design, permitting components of the framework to be used in various military risk assessments that include similar activities. The particular subject of this report is the assessment of ecological risks associated with a testing program at Cibola Range of Yuma Proving Ground, Arizona. The program involves an Apache Longbow helicopter firing Hellfire missiles at moving targets, i.e., M60-A1 tanks. Thus, the three component activities of the Apache-Hellfire test were: (1) helicopter overflight, (2) missile firing, and (3) tracked vehicle movement. The demonstration was limited, to two ecological endpoint entities (i.e., potentially susceptible and valued populations or communities): woody desert wash communities and mule deer populations. The core assessment area is composed of about 126 km{sup 2} between the Chocolate and Middle Mountains. The core time of the program is a three-week period, including fourteen days of

  4. Demonstration of the Military Ecological Risk Assessment Framework (MERAF): Apache Longbow - Hell Missile Test at Yuma Proving Ground

    International Nuclear Information System (INIS)

    Efroymson, R.A.

    2002-01-01

    This ecological risk assessment for a testing program at Yuma Proving Ground, Arizona, is a demonstration of the Military Ecological Risk Assessment Framework (MERAF; Suter et al. 2001). The demonstration is intended to illustrate how risk assessment guidance concerning-generic military training and testing activities and guidance concerning a specific type of activity (e.g., low-altitude aircraft overflights) may be implemented at a military installation. MERAF was developed with funding from the Strategic Research and Development Program (SERDP) of the Department of Defense. Novel aspects of MERAF include: (1) the assessment of risks from physical stressors using an ecological risk assessment framework, (2) the consideration of contingent or indirect effects of stressors (e.g., population-level effects that are derived from habitat or hydrological changes), (3) the integration of risks associated with different component activities or stressors, (4) the emphasis on quantitative risk estimates and estimates of uncertainty, and (5) the modularity of design, permitting components of the framework to be used in various military risk assessments that include similar activities. The particular subject of this report is the assessment of ecological risks associated with a testing program at Cibola Range of Yuma Proving Ground, Arizona. The program involves an Apache Longbow helicopter firing Hellfire missiles at moving targets, i.e., M60-A1 tanks. Thus, the three component activities of the Apache-Hellfire test were: (1) helicopter overflight, (2) missile firing, and (3) tracked vehicle movement. The demonstration was limited, to two ecological endpoint entities (i.e., potentially susceptible and valued populations or communities): woody desert wash communities and mule deer populations. The core assessment area is composed of about 126 km 2 between the Chocolate and Middle Mountains. The core time of the program is a three-week period, including fourteen days of

  5. In situ analysis of soil at an open burning/open detonation disposal facility: J-Field, Aberdeen Proving Ground, Maryland

    International Nuclear Information System (INIS)

    Martino, L.; Cho, E.; Wrobel, J.

    1994-01-01

    Investigators have used a field-portable X-Ray Fluorescence (XRF) Analyzer to screen soils for a suite of metals indicative of the open burning and open detonation (OB/OD) activities that occurred at the J-Field site at Aberdeen Proving Ground, Maryland. The field XRF results were incorporated into a multiphase investigation of contaminants at the Toxic Burning Pits Area of Concern at J-Field. The authors determined that the field-portable XRF unit used for the study and the general concept of field XRF screening are invaluable tools for investigating an OB/OD site where intrusive sampling techniques could present unacceptable hazards to site workers

  6. Review of analytical results from the proposed agent disposal facility site, Aberdeen Proving Ground

    Energy Technology Data Exchange (ETDEWEB)

    Brubaker, K.L.; Reed, L.L.; Myers, S.W.; Shepard, L.T.; Sydelko, T.G.

    1997-09-01

    Argonne National Laboratory reviewed the analytical results from 57 composite soil samples collected in the Bush River area of Aberdeen Proving Ground, Maryland. A suite of 16 analytical tests involving 11 different SW-846 methods was used to detect a wide range of organic and inorganic contaminants. One method (BTEX) was considered redundant, and two {open_quotes}single-number{close_quotes} methods (TPH and TOX) were found to lack the required specificity to yield unambiguous results, especially in a preliminary investigation. Volatile analytes detected at the site include 1, 1,2,2-tetrachloroethane, trichloroethylene, and tetrachloroethylene, all of which probably represent residual site contamination from past activities. Other volatile analytes detected include toluene, tridecane, methylene chloride, and trichlorofluoromethane. These compounds are probably not associated with site contamination but likely represent cross-contamination or, in the case of tridecane, a naturally occurring material. Semivolatile analytes detected include three different phthalates and low part-per-billion amounts of the pesticide DDT and its degradation product DDE. The pesticide could represent residual site contamination from past activities, and the phthalates are likely due, in part, to cross-contamination during sample handling. A number of high-molecular-weight hydrocarbons and hydrocarbon derivatives were detected and were probably naturally occurring compounds. 4 refs., 1 fig., 8 tabs.

  7. Remedial investigation report for J-Field, Aberdeen Proving Ground, Maryland. Volume 1: Remedial investigation results

    International Nuclear Information System (INIS)

    Yuen, C. R.; Martino, L. E.; Biang, R. P.; Chang, Y. S.; Dolak, D.; Van Lonkhuyzen, R. A.; Patton, T. L.; Prasad, S.; Quinn, J.; Rosenblatt, D. H.; Vercellone, J.; Wang, Y. Y.

    2000-01-01

    This report presents the results of the remedial investigation (RI) conducted at J-Field in the Edgewood Area of Aberdeen Proving Ground (APG), a U.S. Army installation located in Harford County, Maryland. Since 1917, activities in the Edgewood Area have included the development, manufacture, and testing of chemical agents and munitions and the subsequent destruction of these materials at J-Field by open burning and open detonation. These activities have raised concerns about environmental contamination at J-Field. This RI was conducted by the Environmental Conservation and Restoration Division, Directorate of Safety, Health and Environmental Division of APG, pursuant to requirements outlined under the Comprehensive Environmental Response, Compensation, and Liability Act, as amended (CERCLA). The RI was accomplished according to the procedures developed by the U.S. Environmental Protection Agency (EPA 1988). The RI provides a comprehensive evaluation of the site conditions, nature of contaminants present, extent of contamination, potential release mechanisms and migration pathways, affected populations, and risks to human health and the environment. This information will be used as the basis for the design and implementation of remedial actions to be performed during the remedial action phase, which will follow the feasibility study (FS) for J-Field

  8. Remedial investigation report for J-Field, Aberdeen Proving Ground, Maryland. Volume 1: Remedial investigation results

    Energy Technology Data Exchange (ETDEWEB)

    Yuen, C. R.; Martino, L. E.; Biang, R. P.; Chang, Y. S.; Dolak, D.; Van Lonkhuyzen, R. A.; Patton, T. L.; Prasad, S.; Quinn, J.; Rosenblatt, D. H.; Vercellone, J.; Wang, Y. Y.

    2000-03-14

    This report presents the results of the remedial investigation (RI) conducted at J-Field in the Edgewood Area of Aberdeen Proving Ground (APG), a U.S. Army installation located in Harford County, Maryland. Since 1917, activities in the Edgewood Area have included the development, manufacture, and testing of chemical agents and munitions and the subsequent destruction of these materials at J-Field by open burning and open detonation. These activities have raised concerns about environmental contamination at J-Field. This RI was conducted by the Environmental Conservation and Restoration Division, Directorate of Safety, Health and Environmental Division of APG, pursuant to requirements outlined under the Comprehensive Environmental Response, Compensation, and Liability Act, as amended (CERCLA). The RI was accomplished according to the procedures developed by the U.S. Environmental Protection Agency (EPA 1988). The RI provides a comprehensive evaluation of the site conditions, nature of contaminants present, extent of contamination, potential release mechanisms and migration pathways, affected populations, and risks to human health and the environment. This information will be used as the basis for the design and implementation of remedial actions to be performed during the remedial action phase, which will follow the feasibility study (FS) for J-Field.

  9. Historical wildlife dynamics on Dugway Proving Ground: population and disease trends in jack rabbits over two decades. [Lepus californicus

    Energy Technology Data Exchange (ETDEWEB)

    Eberhardt, L.E.; Van Voris, P.

    1986-08-01

    In an effort to determine whether US Army activities on the Dugway Proving Ground (DPG) have had an impact on resident wildlife, intensive studies have been conducted on the biology and ecology of the black-tailed jack rabbit (Lepus californicus) since 1965. in addition, the incidence of endemic diseases in several species of resident wildlife on the DPG have been studied from the late 1950s through the mid-1970s. The objectives of this report are to: (1) compile and summarize the jack rabbit data and some of the disease information that is presently contained only in annual reports; (2) compare the DPG jack rabbit data to data available on other jack rabbit populations; and (3) analyze the data for unusual or unexplained fluctuations in population densities or in incidence of disease.

  10. The Apache Longbow-Hellfire Missile Test at Yuma Proving Ground: Ecological Risk Assessment for Missile Firing

    International Nuclear Information System (INIS)

    Jones, Daniel Steven; Efroymson, Rebecca Ann; Hargrove, William Walter; Suter, Glenn; Pater, Larry

    2008-01-01

    A multiple stressor risk assessment was conducted at Yuma Proving Ground, Arizona, as a demonstration of the Military Ecological Risk Assessment Framework. The focus was a testing program at Cibola Range, which involved an Apache Longbow helicopter firing Hellfire missiles at moving targets, M60-A1 tanks. This paper describes the ecological risk assessment for the missile launch and detonation. The primary stressor associated with this activity was sound. Other minor stressors included the detonation impact, shrapnel, and fire. Exposure to desert mule deer (Odocoileus hemionus crooki) was quantified using the Army sound contour program BNOISE2, as well as distances from the explosion to deer. Few effects data were available from related studies. Exposure-response models for the characterization of effects consisted of human 'disturbance' and hearing damage thresholds in units of C-weighted decibels (sound exposure level) and a distance-based No Observed Adverse Effects Level for moose and cannonfire. The risk characterization used a weight-of-evidence approach and concluded that risk to mule deer behavior from the missile firing was likely for a negligible number of deer, but that no risk to mule deer abundance and reproduction is expected

  11. JPSS Preparations at the Satellite Proving Ground for Marine, Precipitation, and Satellite Analysis

    Science.gov (United States)

    Folmer, M. J.; Berndt, E.; Clark, J.; Orrison, A.; Kibler, J.; Sienkiewicz, J. M.; Nelson, J. A., Jr.; Goldberg, M.

    2016-12-01

    The National Oceanic and Atmospheric Administration (NOAA) Satellite Proving Ground (PG) for Marine, Precipitation, and Satellite Analysis (MPS) has been demonstrating and evaluating Suomi National Polar-orbiting Partnership (S-NPP) products along with other polar-orbiting satellite platforms in preparation for the Joint Polar Satellite System - 1 (JPSS-1) launch in March 2017. The first S-NPP imagery was made available to the MPS PG during the evolution of Hurricane Sandy in October 2012 and has since been popular in operations. Since this event the MPS PG Satellite Liaison has been working with forecasters on ways to integrate single-channel and multispectral imagery from the Visible Infrared Imaging Radiometer Suite (VIIRS), the Moderate Resolution Imaging Spectroradiometer (MODIS), and the Advanced Very High Resolution Radiometer (AVHRR)into operations to complement numerical weather prediction and geostationary satellite savvy National Weather Service (NWS) National Centers. Additional unique products have been introduced to operations to address specific forecast challenges, including the Cooperative Institute for Research in the Atmosphere (CIRA) Layered Precipitable Water, the National Environmental Satellite, Data, and Information Service (NESDIS) Snowfall Rate product, NOAA Unique Combined Atmospheric Processing System (NUCAPS) Soundings, ozone products from the Atmospheric Infrared Sounder (AIRS), Cross-track Infrared Sounder/Advanced Technology Microwave Sounder (CrIS/ATMS), and Infrared Atmospheric Sounding Interferometer (IASI). In addition, new satellite domains have been created to provide forecasters at the NWS Ocean Prediction Center and Weather Prediction Center with better quality imagery at high latitudes. This has led to research projects that are addressing forecast challenges such as tropical to extratropical transition and explosive cyclogenesis. This presentation will provide examples of how the MPS PG has been introducing and integrating

  12. NOAA's Joint Polar Satellite System's (JPSS) Proving Ground and Risk Reduction (PGRR) Program - Bringing JPSS Science into Support of Key NOAA Missions!

    Science.gov (United States)

    Sjoberg, W.; McWilliams, G.

    2017-12-01

    This presentation will focus on the continuity of the NOAA Joint Polar Satellite System (JPSS) Program's Proving Ground and Risk Reduction (PGRR) and key activities of the PGRR Initiatives. The PGRR Program was established in 2012, following the launch of the Suomi National Polar Partnership (SNPP) satellite. The JPSS Program Office has used two PGRR Project Proposals to establish an effective approach to managing its science and algorithm teams in order to focus on key NOAA missions. The presenter will provide details of the Initiatives and the processes used by the initiatives that have proven so successful. Details of the new 2017 PGRR Call-for-Proposals and the status of project selections will be discussed.

  13. Environmental geophysics: Buildings E5485, E5487, and E5489 decommissioning - the open-quotes Ghost Townclose quotes complex, Aberdeen Proving Ground, Maryland

    International Nuclear Information System (INIS)

    McGinnis, L.D.; Thompson, M.D.; Miller, S.F.

    1994-06-01

    Buildings E5485, E5487, and E5489, referred to informally as the open-quotes Ghost Townclose quotes complex, are potentially contaminated sites in the Edgewood section of Aberdeen Proving Ground. Noninvasive geophysical surveys, including magnetics, EM-31, EM-61, and ground-penetrating radar, were conducted to assist a sampling and monitoring program prior to decommissioning and dismantling of the buildings. The buildings are located on a marginal wetland bordering the west branch of Canal Creek. The dominant geophysical signature in the open-quotes Ghost Town close quotes complex is a pattern of northeast-southwest and northwest-southeast anomalies that appear to be associated with a trench/pipe/sewer system, documented by the presence of a manhole. Combinations of anomalies suggest that line sources include nonmetallic and ferromagnetic materials in trenches. On the basis of anomaly associations, the sewer lines probably rest in a trench, back-filled with conductive, amphibolitic, crushed rock. Where the sewer lines connect manholes or junctions with other lines, ferromagnetic materials are present. Isolated, unidentified magnetic anomalies litter the area around Building E5487, particularly to the north. Three small magnetic sources are located east of Building E5487

  14. Environmental radiation monitoring plan for depleted uranium and beryllium areas, Yuma Proving Ground

    International Nuclear Information System (INIS)

    Ebinger, M.H.; Hansen, W.R.

    1994-01-01

    This Environmental Radiation Monitoring Plan (ERM) discusses sampling soils, vegetation, and biota for depleted uranium (DU) and beryllium (Be) at Yuma Proving Ground (YPG). The existing ERM plan was used and modified to more adequately assess the potential of DU and Be migration through the YPG ecosystem. The potential pathways for DU and Be migration are discussed and include soil to vegetation, soil to animals, vegetation to animals, animals to animals, and animals to man. Sample collection will show DU deposition and will be used to estimate DU migration. The number of samples from each area varies and depends on if the firing range of interest is currently used for DU testing (GP 17A) or if the range is not used currently for DU testing (GP 20). Twenty to thirty-five individual mammals or lizards will be sampled from each transect. Air samples and samples of dust in the air fall will be collected in three locations in the active ranges. Thirty to forty-five sediment samples will be collected from different locations in the arroys near the impact areas. DU and Be sampling in the Hard Impact and Soft Impact areas changed only slightly from the existing ERM. The modifications are changes in sample locations, addition of two sediment transport locations, addition of vegetation samples, mammal samples, and air sampling from three to five positions on the impact areas. Analysis of samples for DU or total U by inductively-coupled mass spectroscopy (ICP/MS), cc spectroscopy, neutron activation analysis (NAA), and kinetic phosphorimetric analysis (KPA) are discussed, and analysis for Be by ICP/MS are recommended. Acquiring total U (no isotope data) from a large number of samples and analysis of those samples with relatively high total U concentrations results in fewer isotopic identifications but more information on U distribution. From previous studies, total U concentrations greater than about 3 times natural background are usually DU by isotopic confirmation

  15. Generator, mechanical, smoke: For dual-purpose unit, XM56, Yuma Proving Ground, Yuma, Arizona

    Energy Technology Data Exchange (ETDEWEB)

    Driver, C.J.; Ligotke, M.W.; Moore, E.B. Jr. (Pacific Northwest Lab., Richland, WA (United States)); Bowers, J.F. (Dugway Proving Ground, UT (United States))

    1991-10-01

    The US Army Chemical Research, Development and Engineering Center (CRDEC) is planning to perform a field test of the XM56 smoke generator at the US Army Yuma Proving Ground (YPG), Arizona. The XM56, enabling the use of fog oil in combination with other materials, such as graphite flakes, is part of an effort to improve the efficiency of smoke generation and to extend the effectiveness of the resulting obscurant cloud to include the infrared spectrum. The plan field operation includes a road test and concurrent smoke- generation trials. Three M1037 vehicles with operation XM56 generators will be road-tested for 100 h. Smoke will be generated for 30 min from a single stationary XM56 four times during the road test, resulting in a total of 120 min of smoke generation. The total aerial release of obscurant materials during this test is expected to be 556 kg (1,220 lb) of fog oil and 547 kg (1,200 lb) of graphite flakes. This environmental assessment has evaluated the consequences of the proposed action. Air concentrations and surface deposition levels were estimated using an atmospheric dispersion model. Degradation of fog oil and incorporation of graphite in the soil column will limit the residual impacts of the planned action. No significant impacts to air, water, and soil quality are anticipated. risks to the environment posed by the proposed action were determined to be minimal or below levels previously found to pose measurable impacts. Cultural resources are present on YPG and have been identified in adjacent areas; therefore, off-road activities should be preceded by a cultural resource survey. A Finding of No Significant Impact is recommended. 61 refs., 1 fig.

  16. Focused feasibility study for surface soil at the main pits and pushout area, J-field toxic burning pits area, Aberdeen Proving Ground, Maryland

    Energy Technology Data Exchange (ETDEWEB)

    Patton, T.; Benioff, P.; Biang, C.; Butler, J. [and others

    1996-06-01

    The Environmental Management Division of Aberdeen Proving Ground (APG), Maryland, is conducting a remedial investigation and feasibility study of the J-Field area at APG pursuant to the Comprehensive Environmental Response, Compensation, and Liability Act, as amended (CERCLA). J-Field is located within the Edgewood Area of APG in Harford County, Maryland. Since World War II, activities in the Edgewood Area have included the development, manufacture, testing, and destruction of chemical agents and munitions. These materials were destroyed at J-Field by open burning/open detonation. Portions of J-Field continue to be used for the detonation and disposal of unexploded ordnance (UXO) by open burning/open detonation under authority of the Resource Conservation and Recovery Act.

  17. Yet Another Puzzle of Ground

    NARCIS (Netherlands)

    Korbmacher, J.

    2015-01-01

    We show that any predicational theory of partial ground that extends a standard theory of syntax and that proves some commonly accepted principles for partial ground is inconsistent. We suggest a way to obtain a consistent predicational theory of ground.

  18. X-ray fluorescence investigation of heavy-metal contamination on metal surfaces in the Pilot Plant Complex, Aberdeen Proving Ground, Maryland

    Energy Technology Data Exchange (ETDEWEB)

    Brubaker, K.L.; Draugelis, A.K.; Schneider, J.F.; Billmark, K.A.; Zimmerman, R.E.

    1995-07-01

    A field program using a portable x-ray fluorescence (XRF) instrument was carried out to obtain data on loadings of RCRA-regulated heavy metals in paint on metal surfaces within the Pilot Plant Complex at Aberdeen Proving Ground, Maryland. Measured loadings of heavy metals were sufficiently small that they do not present problems for either human exposure or the disposition of building demolition rubble. An attempt to develop an external calibration of the XRF instrument for cadmium, chromium, and lead was unsuccessful. Significant substrate effects were observed for cadmium and chromium; for accurate results for these elements, it appears necessary to calibrate by using a sample of the actual metal substrate on which the paint is located. No substrate effects were observed for lead, but the use of lead L-shell x-ray emission lines in the instrument mode utilized in this study appears to result in a significant underestimate of the lead loading due to self-absorption of these emissions.

  19. Seismic proving test of BWR primary loop recirculation system

    International Nuclear Information System (INIS)

    Sato, H.; Shigeta, M.; Karasawa, Y.

    1987-01-01

    The seismic proving test of BWR Primary Loop Recirculation system is the second test to use the large-scale, high-performance vibration table of Tadotsu Engineering Laboratory. The purpose of this test is to prove the seismic reliability of the primary loop recirculation system (PLR), one of the most important safety components in the BWR nuclear plants, and also to confirm the adequacy of seismic analysis method used in the current seismic design. To achieve the purpose, the test was conducted under conditions and scale as near as possible to actual systems. The strength proving test was carried out with the test model mounted on the vibration table in consideration of basic design earthquake ground motions and other conditions to confirm the soundness of structure and the strength against earthquakes. Detailed analysis and analytic evaluation of the data obtained from the test was conducted to confirm the adequacy of the seismic analysis method and earthquake response analysis method used in the current seismic design. Then, on the basis of the results obtained, the seismic safety and reliability of BWR primary loop recirculation of the actual plants was fully evaluated

  20. CERN 50th Anniversary Official Celebration : one of the high moments of the day the signing of the golden book by the national delegations

    CERN Multimedia

    Patrice Loiez

    2004-01-01

    Russian Federation, Minister of Education and Science (0410049_03.jpg, 0410049_04.jpg) United States of America (0410049_05.jpg, 0410049_07.jpg) Israel, Ambassador, Permanent representative to the UN and other International Organisations in Geneva (0410049_09.jpg, 0410049_11.jpg) Japan, Advisor to the Minister of MEXT and Former Minister of MEXT (0410049_12.jpg, 0410049_15.jpg) Belgium, Ambassador in Geneva (0410049_16.jpg, 0410049_19.jpg)Greece, H.E. Mr. Dimitris Avramopoulos, Minister of Tourism (0410049_20.jpg, 0410049_22.jpg)Portugal, M. Pedro de Sampaio Nunes, Secretary of State for Science and Innovation (0410049_28.jpg, 0410049_30.jpg)Finland, H. E. Mr Mauri Pekkarinen, Minister of Trade and Industry (0410049_32.jpg, 0410049_33.jpg)

  1. CERN 50th Anniversary Official Celebration : one of the high moments of the day the signing of the golden book by the national delegations

    CERN Multimedia

    Michel Blanc

    2004-01-01

    Russian Federation, Minister of Education and Science (0410050_01.jpg, 0410050_02.jpg) United States of America (0410050_03.jpg, 0410050_04.jpg, 0410050_05.jpg) Israel, Ambassador, Permanent representative to the UN and other International Organisations in Geneva (0410050_06.jpg, 0410050_07.jpg) Japan, Advisor to the Minister of MEXT and Former Minister of MEXT (0410050_08.jpg, 0410050_09.jpg) Belgium, Ambassador in Geneva (0410050_11.jpg, 0410050_12.jpg)Greece, H.E. Mr. Dimitris Avramopoulos, Minister of Tourism (0410050_14.jpg, 0410050_15.jpg)Portugal, M. Pedro de Sampaio Nunes, Secretary of State for Science and Innovation (0410050_19.jpg)Finland, H. E. Mr Mauri Pekkarinen, Minister of Trade and Industry (0410050_20.jpg)

  2. An optimized groundwater extraction system for the toxic burning pits area of J-Field, Aberdeen Proving Ground, Maryland

    Energy Technology Data Exchange (ETDEWEB)

    Quinn, J.J.; Johnson, R.L.; Patton, T.L.; Martino, L.E.

    1996-06-01

    Testing and disposal of chemical warfare agents, munitions, and industrial chemicals at the J-Field area of the Aberdeen Proving Ground (APG) have resulted in contamination of soil and groundwater. The discharge of contaminated groundwater to on-site marshes and adjacent estuaries poses a potential risk to ecological receptors. The Toxic Burning Pits (TBP) area is of special concern because of its disposal history. This report describes a groundwater modeling study conducted at J-Field that focused on the TBP area. The goal of this modeling effort was optimization of the groundwater extraction system at the TBP area by applying linear programming techniques. Initially, the flow field in the J-Field vicinity was characterized with a three-dimensional model that uses existing data and several numerical techniques. A user-specified border was set near the marsh and used as a constraint boundary in two modeled remediation scenarios: containment of the groundwater and containment of groundwater with an impermeable cap installed over the TBP area. In both cases, the objective was to extract the minimum amount of water necessary while satisfying the constraints. The smallest number of wells necessary was then determined for each case. This optimization approach provided two benefits: cost savings, in that the water to be treated and the well installation costs were minimized, and minimization of remediation impacts on the ecology of the marsh.

  3. Ground states of quantum spin systems

    International Nuclear Information System (INIS)

    Bratteli, Ola; Kishimoto, Akitaka; Robinson, D.W.

    1978-07-01

    The authors prove that ground states of quantum spin systems are characterized by a principle of minimum local energy and that translationally invariant ground states are characterized by the principle of minimum energy per unit volume

  4. Work plan for conducting an ecological risk assessment at J-Field, Aberdeen Proving Ground, Maryland

    Energy Technology Data Exchange (ETDEWEB)

    Hlohowskyj, I.; Hayse, J.; Kuperman, R. [Argonne National Lab., IL (United States). Environmental Assessment Div.] [and others

    1995-03-01

    The Environmental Management Division of Aberdeen Proving Ground (APG), Maryland, is conducting a remedial investigation and feasibility study (RI/FS) of the J-Field area at APG pursuant to the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA), as amended. J-Field is within the Edgewood Area of APG in Harford County, Maryland, and activities at the Edgewood Area since World War II have included the development, manufacture, testing, and destruction of chemical agents and munitions. The J-Field site was used to destroy chemical agents and munitions by open burning and open detonation. This work plan presents the approach proposed to conduct an ecological risk assessment (ERA) as part of the RI/FS program at J-Field. This work plan identifies the locations and types of field studies proposed for each area of concern (AOC), the laboratory studies proposed to evaluate toxicity of media, and the methodology to be used in estimating doses to ecological receptors and discusses the approach that will be used to estimate and evaluate ecological risks at J-Field. Eight AOCs have been identified at J-Field, and the proposed ERA is designed to evaluate the potential for adverse impacts to ecological receptors from contaminated media at each AOC, as well as over the entire J-Field site. The proposed ERA approach consists of three major phases, incorporating field and laboratory studies as well as modeling. Phase 1 includes biotic surveys of the aquatic and terrestrial habitats, biological tissue sampling and analysis, and media toxicity testing at each AOC and appropriate reference locations. Phase 2 includes definitive toxicity testing of media from areas of known or suspected contamination or of media for which the Phase 1 results indicate toxicity or adverse ecological effects. In Phase 3, the uptake models initially developed in Phase 2 will be finalized, and contaminant dose to each receptor from all complete pathways will be estimated.

  5. Nuclear Bombs and Coral: Guam Coral Core Reveals Operation-Specific Radiocarbon Signals from the Pacific Proving Grounds

    Science.gov (United States)

    Andrews, A. H.

    2016-12-01

    Radiocarbon (14C) analyses on a coral core extracted from the western Central Pacific (Guam) has revealed a series of early peaks in the marine bomb 14C record. The typical marine bomb 14C signal, one that is phase lagged and attenuated relative to atmospheric bomb 14C, is present in the coral core and is consistent with other North Pacific records. However, 14C levels that are well above what can be explained by air-sea diffusion alone punctuate this pattern. This anomaly has been demonstrated to a limited extent in other coral cores of the Indo-Pacific region, but is unmatched relative to the magnitude and temporal resolution recorded in the Guam coral core. Other records have shown an early Δ14C rise on the order of 40-50‰ above pre-bomb levels, with a subsequent decline before continuing the gradual Δ14C rise that is indicative of air-sea diffusion of 14CO2. The Guam coral Δ14C record provided three strong pulses in 1954-55, 1956-57, and 1958-59 that are superimposed on the pre-bomb to initial Δ14C rise from atmospheric bomb 14C. Each of these peaks can be directly linked to testing of thermonuclear devices in the Pacific Proving Grounds at Eniwetok and Bikini Atoll of the Marshall Islands. The measurable lag in reaching Guam can be tied to ocean surface currents and can be traced to other regional Δ14C records from corals, providing a transport timeline to places as distant as the Indonesian throughflow, Okinawa and Palmyra.

  6. The Apache Longbow-Hellfire Missile Test at Yuma Proving Ground: Introduction and Problem Formulation for a Multiple Stressor Risk Assessment

    International Nuclear Information System (INIS)

    Efroymson, Rebecca Ann; Peterson, Mark J.; Jones, Daniel Steven; Suter, Glenn

    2008-01-01

    An ecological risk assessment was conducted at Yuma Proving Ground, Arizona, as a demonstration of the Military Ecological Risk Assessment Framework (MERAF). The focus of the assessment was a testing program at Cibola Range, which involved an Apache Longbow helicopter firing Hellfire missiles at moving targets, i.e., M60-A1 tanks. The problem formulation for the assessment included conceptual models for three component activities of the test, helicopter overflight, missile firing, and tracked vehicle movement, and two ecological endpoint entities, woody desert wash communities and desert mule deer (Odocoileus hemionus crooki) populations. An activity-specific risk assessment framework was available to provide guidance for assessing risks associated with aircraft overflights. Key environmental features of the study area include barren desert pavement and tree-lined desert washes. The primary stressors associated with helicopter overflights were sound and the view of the aircraft. The primary stressor associated with Hellfire missile firing was sound. The principal stressor associated with tracked vehicle movement was soil disturbance, and a resulting, secondary stressor was hydrological change. Water loss to washes and wash vegetation was expected to result from increased ponding, infiltration and/or evaporation associated with disturbances to desert pavement. A plan for estimating integrated risks from the three military activities was included in the problem formulation

  7. Graphene ground states

    Science.gov (United States)

    Friedrich, Manuel; Stefanelli, Ulisse

    2018-06-01

    Graphene is locally two-dimensional but not flat. Nanoscale ripples appear in suspended samples and rolling up often occurs when boundaries are not fixed. We address this variety of graphene geometries by classifying all ground-state deformations of the hexagonal lattice with respect to configurational energies including two- and three-body terms. As a consequence, we prove that all ground-state deformations are either periodic in one direction, as in the case of ripples, or rolled up, as in the case of nanotubes.

  8. Personnel and Vehicle Data Collection at Aberdeen Proving Ground (APG) and its Distribution for Research

    Science.gov (United States)

    2015-10-01

    28 Magnetometer Applied Physics Model 1540-digital 3-axis fluxgate 5 Amplifiers Alligator Technologies USBPGF-S1 programmable instrumentation...Acoustic, Seismic, magnetic, footstep, vehicle, magnetometer , geophone, unattended ground sensor (UGS) 16. SECURITY CLASSIFICATION OF: 17. LIMITATION

  9. Hydrogeology and chemical quality of water and soil at Carroll Island, Aberdeen Proving Ground, Maryland

    Science.gov (United States)

    Tenbus, F.J.; Phillips, S.W.

    1996-01-01

    Carroll Island was used for open-air testing of chemical warfare agents from the late 1940's until 1971. Testing and disposal activities weresuspected of causing environmental contamination at 16 sites on the island. The hydrogeology and chemical quality of ground water, surface water, and soil at these sites were investigated with borehole logs, environmental samples, water-level measurements, and hydrologic tests. A surficial aquifer, upper confining unit, and upper confined aquifer were defined. Ground water in the surficial aquifer generally flows from the east-central part of the island toward the surface-water bodies, butgradient reversals caused by evapotranspiration can occur during dry seasons. In the confined aquifer, hydraulic gradients are low, and hydraulic head is affected by tidal loading and by seasonal pumpage from the west. Inorganic chemistry in the aquifers is affected by brackish-water intrusion from gradient reversals and by dissolution ofcarboniferous shell material in the confining unit.The concentrations of most inorganic constituents probably resulted from natural processes, but some concentrations exceeded Federal water-quality regulations and criteria. Organic compounds were detected in water and soil samples at maximum concentrations of 138 micrograms per liter (thiodiglycol in surface water) and 12 micrograms per gram (octadecanoic acid in soil).Concentrations of organic compounds in ground water exceeded Federal drinking-water regulations at two sites. The organic compounds that weredetected in environmental samples were variously attributed to natural processes, laboratory or field- sampling contamination, fallout from industrial air pollution, and historical military activities.

  10. SPoRT Participation in the GOES-R and JPSS Proving Grounds

    Science.gov (United States)

    Jedlovec, Gary; Fuell, Kevin; Smith, Matthew

    2013-01-01

    For the last several years, the NASA Short-term Prediction Research and Transition (SPoRT) project at has been working with the various algorithm working groups and science teams to demonstrate the utility of future operational sensors for GOES-R and the suite of instruments for the JPSS observing platforms. For GOES-R, imagery and products have been developed from polar-orbiting sensors such as MODIS and geostationary observations from SEVIRI, simulated imagery, enhanced products derived from existing GOES satellites, and data from ground-based observing systems to generate pseudo or proxy products for the ABI and GLM instruments. The suite of products include GOES-POES basic and RGB hybrid imagery, total lightning flash products, quantitative precipitation estimates, and convective initiation products. SPoRT is using imagery and products from VIIRS, CrIS, ATMS, and OMPS to show the utility of data and products from their operational counterparts on JPSS. The products include VIIRS imagery in swath form, the GOES-POES hybrid, a suite of RGB products including the air mass RGB using water vapor and ozone channels from CrIS, and several DNB products. Over a dozen SPoRT collaborative WFOs and several National Centers are involved in an intensive evaluation of the operational utility of these products.

  11. Remedial investigation sampling and analysis plan for J-Field, Aberdeen Proving Ground, Maryland. Volume 1: Field Sampling Plan

    Energy Technology Data Exchange (ETDEWEB)

    Benioff, P.; Biang, R.; Dolak, D.; Dunn, C.; Martino, L.; Patton, T.; Wang, Y.; Yuen, C.

    1995-03-01

    The Environmental Management Division (EMD) of Aberdeen Proving Ground (APG), Maryland, is conducting a remedial investigation and feasibility study (RI/FS) of the J-Field area at APG pursuant to the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA), as amended. J-Field is within the Edgewood Area of APG in Harford County, Maryland (Figure 1. 1). Since World War II activities in the Edgewood Area have included the development, manufacture, testing, and destruction of chemical agents and munitions. These materials were destroyed at J-Field by open burning and open detonation (OB/OD). Considerable archival information about J-Field exists as a result of efforts by APG staff to characterize the hazards associated with the site. Contamination of J-Field was first detected during an environmental survey of the Edgewood Area conducted in 1977 and 1978 by the US Army Toxic and Hazardous Materials Agency (USATHAMA) (predecessor to the US Army Environmental Center [AEC]). As part of a subsequent USATHAMA -environmental survey, 11 wells were installed and sampled at J-Field. Contamination at J-Field was also detected during a munitions disposal survey conducted by Princeton Aqua Science in 1983. The Princeton Aqua Science investigation involved the installation and sampling of nine wells and the collection and analysis of surficial and deep composite soil samples. In 1986, a Resource Conservation and Recovery Act (RCRA) permit (MD3-21-002-1355) requiring a basewide RCRA Facility Assessment (RFA) and a hydrogeologic assessment of J-Field was issued by the US Environmental Protection Agency (EPA). In 1987, the US Geological Survey (USGS) began a two-phased hydrogeologic assessment in data were collected to model, groundwater flow at J-Field. Soil gas investigations were conducted, several well clusters were installed, a groundwater flow model was developed, and groundwater and surface water monitoring programs were established that continue today.

  12. Meeting on Solute/Solvent Interactions Held in Aberdeen Proving Ground, Maryland on May 29-30, 1991

    Science.gov (United States)

    1992-01-01

    the magnitudes of the nuclear charges and therefore cannot be assumed to indicate relative reactivities toward nucleophiles. There is accordingly no...APPENDIX 3 ORGANIZATIONS OF AUTHORS IN THESE PROCEEDINGS Central Michigan University 49 Instituto de Quimica Fisica 33 La Sierra University, Riverside 71...Aberdeen Proving Gd, MD Joxe-Luis Abbud Christopher Cramer Instituto de Quimica Fisica SMCCR-RSP-C "Rocasolano" U.S. Army Chemical RD&E Center Conajo

  13. Divide and conquer method for proving gaps of frustration free Hamiltonians

    DEFF Research Database (Denmark)

    Kastoryano, Michael J.; Lucia, Angelo

    2018-01-01

    Providing system-size independent lower bounds on the spectral gap of local Hamiltonian is in general a hard problem. For the case of finite-range, frustration free Hamiltonians on a spin lattice of arbitrary dimension, we show that a property of the ground state space is sufficient to obtain...... such a bound. We furthermore show that such a condition is necessary and equivalent to a constant spectral gap. Thanks to this equivalence, we can prove that for gapless models in any dimension, the spectral gap on regions of diameter $n$ is at most $o\\left(\\frac{\\log(n)^{2+\\epsilon}}{n}\\right)$ for any...... positive $\\epsilon$....

  14. Response characteristics of reactor building on weathered soft rock ground

    International Nuclear Information System (INIS)

    Hirata, Kazuta; Tochigi, Hitoshi

    1991-01-01

    The purpose of this study is to investigate the seismic stability of nuclear power plants on layered soft bedrock grounds, focusing on the seismic response of reactor buildings. In this case, the soft bedrock grounds refer to the weathered soft bedrocks with several tens meter thickness overlaying hard bedrocks. Under this condition, there are two subjects regarding the estimation of the seismic response of reactor buildings. One is the estimation of the seismic response of surface ground, and another is the estimation of soil-structure interaction characteristics for the structures embedded in the layered grounds with low impedandce ratio between the surface ground and the bedrock. Paying attention to these subjects, many cases of seismic response analysis were carried out, and the following facts were clarified. In the soft rock grounds overlaying hard bedrocks, it was proved that the response acceleration was larger than the case of uniform hard bedrocks. A simplified sway and rocking model was proposed to consider soil-structure interaction. It was proved that the response of reactor buildings was small when the effect of embedment was considered. (K.I.)

  15. Ground collectors for heat pumps; Grondcollectoren voor warmtepompen

    Energy Technology Data Exchange (ETDEWEB)

    Van Krevel, A. [Techneco, Leidschendam (Netherlands)

    1999-10-01

    The dimensioning and cost optimisation of a closed vertical ground collector system has been studied. The so-called Earth Energy Designer (EED) computer software, specially developed for the calculations involved in such systems, proved to be a particularly useful tool. The most significant findings from the first part of the study, 'Heat extraction from the ground', are presented and some common misconceptions about ground collector systems are clarified. 2 refs.

  16. Work plan for focused feasibility study of the toxic burning pits area at J-Field, Aberdeen Proving Ground, Maryland

    Energy Technology Data Exchange (ETDEWEB)

    Biang, C.; Benioff, P.; Martino, L.; Patton, T.

    1995-03-01

    The Environmental Management Division (EMD) of Aberdeen Proving Ground (APG), Maryland, is conducting a remedial investigation and feasibility study (RI/FS) of the J-Field area at APG pursuant to the Comprehensive Environmental Response, Compensation, and Liability Act, as amended (CERCIA). J-Field is within the Edgewood Area of APG in Harford County, Maryland. Since World War II, activities in the Edgewood Area have included the development, manufacture, testing, and destruction of chemical agents and munitions. These materials were destroyed at J-Field by open burning and open detonation (OB/OD). Considerable archival information about J-Field exists as a result of efforts by APG staff to characterize the hazards associated with the site. Contamination of J-Field was first detected during an environmental survey of the Edgewood Area conducted in 1977 and 1978 by the US Army Toxic and Hazardous Materials Agency (USATHAMA)(predecessor to the US Army Environmental Center). As part of a subsequent USATHAMA environmental survey, 11 wells were installed and sampled at J-Field. Contamination at J-Field was also detected during a munitions disposal survey conducted by Princeton Aqua Science in 1983. The Princeton Aqua Science investigation involved the installation and sampling of nine wells and the collection and analysis of surficial and deep composite soil samples. In 1986, a Resource Conservation and Recovery Act (RCRA) permit (MD3-21-0021355) requiring a basewide RCRA Facility Assessment (RFA) and a hydrogeologic assessment of J-Field was issued by the US Environmental Protection Agency (EPA). In 1987, the US Geological Survey (USGS) began a two-phased hydrogeologic assessment in which data were collected to model groundwater flow at J-Field. Soil gas investigations were conducted, several well clusters were installed, a groundwater flow model was developed, and groundwater and surface water monitoring programs were established that continue today-

  17. Concepts and procedures required for successful reduction of tensor magnetic gradiometer data obtained from an unexploded ordnance detection demonstration at Yuma Proving Grounds, Arizona

    Science.gov (United States)

    Bracken, Robert E.; Brown, Philip J.

    2006-01-01

    On March 12, 2003, data were gathered at Yuma Proving Grounds, in Arizona, using a Tensor Magnetic Gradiometer System (TMGS). This report shows how these data were processed and explains concepts required for successful TMGS data reduction. Important concepts discussed include extreme attitudinal sensitivity of vector measurements, low attitudinal sensitivity of gradient measurements, leakage of the common-mode field into gradient measurements, consequences of thermal drift, and effects of field curvature. Spatial-data collection procedures and a spin-calibration method are addressed. Discussions of data-reduction procedures include tracking of axial data by mathematically matching transfer functions among the axes, derivation and application of calibration coefficients, calculation of sensor-pair gradients, thermal-drift corrections, and gradient collocation. For presentation, the magnetic tensor at each data station is converted to a scalar quantity, the I2 tensor invariant, which is easily found by calculating the determinant of the tensor. At important processing junctures, the determinants for all stations in the mapped area are shown in shaded relief map-view. Final processed results are compared to a mathematical model to show the validity of the assumptions made during processing and the reasonableness of the ultimate answer obtained.

  18. Symbolic logic and mechanical theorem proving

    CERN Document Server

    Chang, Chin-Liang

    1969-01-01

    This book contains an introduction to symbolic logic and a thorough discussion of mechanical theorem proving and its applications. The book consists of three major parts. Chapters 2 and 3 constitute an introduction to symbolic logic. Chapters 4-9 introduce several techniques in mechanical theorem proving, and Chapters 10 an 11 show how theorem proving can be applied to various areas such as question answering, problem solving, program analysis, and program synthesis.

  19. Short-time variations of the ground water level

    International Nuclear Information System (INIS)

    Nilsson, Lars Y.

    1977-09-01

    Investigations have demonstrated that the ground water level of aquifers in the Swedish bedrock shows shorttime variations without changing their water content. The ground water level is among other things affected by regular tidal movements occuring in the ''solid'' crust of the earth variations in the atmospheric pressure strong earthquakes occuring in different parts of the world These effects proves that the system of fissures in the bedrock are not stable and that the ground water flow is influenced by both water- and airfilled fissures

  20. Proving productivity in infinite data structures

    NARCIS (Netherlands)

    Zantema, H.; Raffelsieper, M.; Lynch, C.

    2010-01-01

    For a general class of infinite data structures including streams, binary trees, and the combination of finite and infinite lists, we investigate the notion of productivity. This generalizes stream productivity. We develop a general technique to prove productivity based on proving context-sensitive

  1. Proving relations between modular graph functions

    International Nuclear Information System (INIS)

    Basu, Anirban

    2016-01-01

    We consider modular graph functions that arise in the low energy expansion of the four graviton amplitude in type II string theory. The vertices of these graphs are the positions of insertions of vertex operators on the toroidal worldsheet, while the links are the scalar Green functions connecting the vertices. Graphs with four and five links satisfy several non-trivial relations, which have been proved recently. We prove these relations by using elementary properties of Green functions and the details of the graphs. We also prove a relation between modular graph functions with six links. (paper)

  2. The Apache Longbow-Hellfire Missile Test at Yuma Proving Ground: Ecological Risk Assessment for Tracked Vehicle Movement across Desert Pavement

    International Nuclear Information System (INIS)

    Peterson, Mark J; Efroymson, Rebecca Ann; Hargrove, William Walter

    2008-01-01

    A multiple stressor risk assessment was conducted at Yuma Proving Ground, Arizona, as a demonstration of the Military Ecological Risk Assessment Framework. The focus was a testing program at Cibola Range, which involved an Apache Longbow helicopter firing Hellfire missiles at moving targets, M60-A1 tanks. This paper describes the ecological risk assessment for the tracked vehicle movement component of the testing program. The principal stressor associated with tracked vehicle movement was soil disturbance, and a resulting, secondary stressor was hydrological change. Water loss to washes and wash vegetation was expected to result from increased infiltration and/or evaporation associated with disturbances to desert pavement. The simulated exposure of wash vegetation to water loss was quantified using estimates of exposed land area from a digital ortho quarter quad aerial photo and field observations, a 30 30 m digital elevation model, the flow accumulation feature of ESRI ArcInfo, and a two-step process in which runoff was estimated from direct precipitation to a land area and from water that flowed from upgradient to a land area. In all simulated scenarios, absolute water loss decreased with distance from the disturbance, downgradient in the washes; however, percentage water loss was greatest in land areas immediately downgradient of a disturbance. Potential effects on growth and survival of wash trees were quantified by using an empirical relationship derived from a local unpublished study of water infiltration rates. The risk characterization concluded that neither risk to wash vegetation growth or survival nor risk to mule deer abundance and reproduction was expected. The risk characterization was negative for both the incremental risk of the test program and the combination of the test and pretest disturbances

  3. Radioactive waste disposal into the ground

    International Nuclear Information System (INIS)

    1965-01-01

    Disposal into ground has sometimes proved to be an expedient and simple method. Where ground disposal has become an established practice, the sites have so far been limited to those remote from population centres; but in other respects, such as in climate and soil conditions, their characteristics vary widely. Experience gained at these sites has illustrated the variety of problems in radioactive waste migration and the resulting pollution and environmental radiation levels that may reasonably be anticipated at other sites, whether remote from population centres or otherwise.

  4. Design and Performance of an Enhanced Bioremediation Pilot Test in a Tidal Wetland Seep, West Branch Canal Creek, Aberdeen Proving Ground, Maryland

    Science.gov (United States)

    Majcher, Emily H.; Lorah, Michelle M.; Phelan, Daniel J.; McGinty, Angela L.

    2009-01-01

    Because of a lack of available in situ remediation methods for sensitive wetland environments where contaminated groundwater discharges, the U.S. Geological Survey, in cooperation with the U.S. Army Garrison, Aberdeen Proving Ground, Maryland, conceived, designed, and pilot tested a permeable reactive mat that can be placed horizontally at the groundwater/surface-water interface. Development of the reactive mat was part of an enhanced bioremediation study in a tidal wetland area along West Branch Canal Creek at Aberdeen Proving Ground, where localized areas of preferential discharge (seeps) transport groundwater contaminated with carbon tetrachloride, chloroform, tetrachloroethene, trichloroethene, and 1,1,2,2-tetrachloroethane from the Canal Creek aquifer to land surface. The reactive mat consisted of a mixture of commercially available organic- and nutrient-rich peat and compost that was bioaugmented with a dechlorinating microbial consortium, WBC-2, developed for this study. Due to elevated chlorinated methane concentrations in the pilot test site, a layer of zero-valent iron mixed with the peat and compost was added at the base of the reactive mat to promote simultaneous abiotic and biotic degradation. The reactive mat for the pilot test area was designed to optimize chlorinated volatile organic compound degradation efficiency without altering the geotechnical and hydraulic characteristics, or creating undesirable water quality in the surrounding wetland area, which is referred to in this report as achieving geotechnical, hydraulic, and water-quality compatibility. Optimization of degradation efficiency was achieved through the selection of a sustainable organic reactive matrix, electron donor, and bioaugmentation method. Consideration of geotechnical compatibility through design calculations of bearing capacity, settlement, and geotextile selection showed that a 2- to 3-feet tolerable thickness of the mat was possible, with 0.17 feet settlement predicted for

  5. Ground State Structure of a Coupled 2-Fermion System in Supersymmetric Quantum Mechanics

    Science.gov (United States)

    Finster, Felix

    1997-05-01

    We prove the uniqueness of the ground state for a supersymmetric quantum mechanical system of two fermions and two bosons, which is closely related to theN=1 WZ-model. The proof is constructive and gives detailed information on what the ground state looks like

  6. Geotechnics - the key to ground water protection

    DEFF Research Database (Denmark)

    Baumann, Jens; Foged, Niels; Jørgensen, Peter

    2000-01-01

    During the past 5 to 10 years research into ground water protection has proved that fractures in clay till may increase the hydraulic conductivity and herby the vulnerability of the ground water considerably. However, research has not identified a non-expensive and efficient method to map...... the fracture conditions of the various clay tills. Tests performed at the Danish Geotechnical Institute with large undisturbed columns of clay till show that there is a relation between the strength of the clay till and the hydraulic conductivity. Geotechnical methods may therefore be the key to determine...

  7. Automated theorem proving theory and practice

    CERN Document Server

    Newborn, Monty

    2001-01-01

    As the 21st century begins, the power of our magical new tool and partner, the computer, is increasing at an astonishing rate. Computers that perform billions of operations per second are now commonplace. Multiprocessors with thousands of little computers - relatively little! -can now carry out parallel computations and solve problems in seconds that only a few years ago took days or months. Chess-playing programs are on an even footing with the world's best players. IBM's Deep Blue defeated world champion Garry Kasparov in a match several years ago. Increasingly computers are expected to be more intelligent, to reason, to be able to draw conclusions from given facts, or abstractly, to prove theorems-the subject of this book. Specifically, this book is about two theorem-proving programs, THEO and HERBY. The first four chapters contain introductory material about automated theorem proving and the two programs. This includes material on the language used to express theorems, predicate calculus, and the rules of...

  8. Theorem Proving In Higher Order Logics

    Science.gov (United States)

    Carreno, Victor A. (Editor); Munoz, Cesar A.; Tahar, Sofiene

    2002-01-01

    The TPHOLs International Conference serves as a venue for the presentation of work in theorem proving in higher-order logics and related areas in deduction, formal specification, software and hardware verification, and other applications. Fourteen papers were submitted to Track B (Work in Progress), which are included in this volume. Authors of Track B papers gave short introductory talks that were followed by an open poster session. The FCM 2002 Workshop aimed to bring together researchers working on the formalisation of continuous mathematics in theorem proving systems with those needing such libraries for their applications. Many of the major higher order theorem proving systems now have a formalisation of the real numbers and various levels of real analysis support. This work is of interest in a number of application areas, such as formal methods development for hardware and software application and computer supported mathematics. The FCM 2002 consisted of three papers, presented by their authors at the workshop venue, and one invited talk.

  9. The U.S. Army Occupational and Environmental Medicine Residency at Aberdeen Proving Ground, Maryland: 1960-1996.

    Science.gov (United States)

    Gaydos, Joel C; Mallon, Timothy M; Rice, William A

    2016-11-01

    Reorganization of the Army and critical assessment of Army Graduate Medical Education programs prompted the Occupational and Environmental Medicine (OEM) Consultant to the Army Surgeon General to initiate a review of current Army OEM residency training. Available information indicated the Army OEM residency at Aberdeen Proving Ground, MD, was the first and longest operating Army OEM residency. Describing this residency was identified as the first step in the review, with the objectives of determining why the residency was started and sustained and its relevance to the needs of the Army. Records possibly related to the residency were reviewed, starting with 1954 since certification of physicians as Occupation Medicine specialists began in 1955. Interviews were conducted with selected physicians who had strong affiliations with the Army residency and the practice of Army OEM. The Army OEM residency began in 1960 and closed in 1996 with the transfer of Army OEM residency training to the Uniformed Services University of the Health Sciences, Bethesda, MD. Over 36 years, 47 uniformed residency graduates were identified; 44 were from the Army. Forty graduated between 1982 and 1996. The OEM residency was part of a dynamic cycle. Uniformed OEM leaders identified the knowledge and skills required of military OEM physicians and where these people should be stationed in the global Army. Rotations at military sites to acquire the needed knowledge and skills were integrated into the residency. Residency graduates were assigned to positions where they were needed. Having uniformed residents and preceptors facilitated the development of trust with military leaders and access to areas where OEM physician skills and knowledge could have a positive impact. Early reports indicated the residency was important in recruiting and retaining OEM physicians, with emphasis placed on supporting the Army industrial base. The late 1970s into the 1990s was a more dynamic period. There was

  10. Ground state structure of a coupled 2-fermion system in supersymmetric quantum mechanics

    International Nuclear Information System (INIS)

    Finster, F.

    1997-01-01

    We prove the uniqueness of the ground state for a supersymmetric quantum mechanical system of two fermions and two bosons, which is closely related to the N=1 WZ-model. The proof is constructive and gives detailed information on what the ground state looks like. copyright 1997 Academic Press, Inc

  11. Vehicle Test Facilities at Aberdeen Proving Ground

    Science.gov (United States)

    1981-07-06

    warehouse and rough terrain forklifts. Two 5-ton-capacity manual chain hoists at the rear of the table regulate its slope from 0 to 40 percent. The overall...Capacity at 24-Inch Load Center. 5. TOP/ HTP 2-2-608, Braking, Wheeled Vehicles, 15 Jav.&ry 1971. 6. TOP 2-2-603, Vehicle Fuel Consumption, 1 November 1977. A-1 r -. ’,’

  12. Historic Building Inventory, Aberdeen Proving Ground, Maryland

    Science.gov (United States)

    1982-01-01

    installation into compliance with the National Historic Preservation Act of i9bo ana its amendments, and related federal laws and regulations. To this ena, the...century. OLD BALTIMORE The first formal authorization for the establishment of a Court House was the 1674 Act of Assembly for the construction of a Court...official recorded meeting at the Court House was in 1692, at which Thomas Heath, innkeeper , filed suit for expenses incurreo by tne Justices at the 1687

  13. Evaluation of permeability of compacted bentonite ground considering heterogeneity by geostatistics

    International Nuclear Information System (INIS)

    Tanaka, Yukihisa; Nakamura, Kunihiko; Kudo, Kohji; Hironaga, Michihiko; Nakagami, Motonori; Niwase, Kazuhito; Komatsu, Shin-ichi

    2007-01-01

    The permeability of the bentonite ground as an engineered barrier is possibly designed to the value which is lower than that determined in terms of required performance because of heterogeneous distribution of permeability in the ground, which might be considerable when the ground is created by the compaction method. The effect of heterogeneity in the ground on the permeability of the bentonite ground should be evaluated by overall permeability of the ground, whereas in practice, the effect is evaluated by the distribution of permeability in the ground. Thus, in this study, overall permeability of the bentonite ground is evaluated from the permeability of the bentonite ground is evaluated from the permeability distribution determined using the geostatistical method with the dry density data as well as permeability data of the undisturbed sample recovered from the bentonite ground. Consequently, it was proved through this study that possibility of overestimation of permeability of the bentonite ground can be reduced if the overall permeability is used. (author)

  14. Models and Techniques for Proving Data Structure Lower Bounds

    DEFF Research Database (Denmark)

    Larsen, Kasper Green

    In this dissertation, we present a number of new techniques and tools for proving lower bounds on the operational time of data structures. These techniques provide new lines of attack for proving lower bounds in both the cell probe model, the group model, the pointer machine model and the I...... bound of tutq = (lgd􀀀1 n). For ball range searching, we get a lower bound of tutq = (n1􀀀1=d). The highest previous lower bound proved in the group model does not exceed ((lg n= lg lg n)2) on the maximum of tu and tq. Finally, we present a new technique for proving lower bounds....../O-model. In all cases, we push the frontiers further by proving lower bounds higher than what could possibly be proved using previously known techniques. For the cell probe model, our results have the following consequences: The rst (lg n) query time lower bound for linear space static data structures...

  15. Proving termination of logic programs with delay declarations

    NARCIS (Netherlands)

    E. Marchiori; F. Teusink (Frank)

    1996-01-01

    textabstractIn this paper we propose a method for proving termination of logic programs with delay declarations. The method is based on the notion of recurrent logic program, which is used to prove programs terminating wrt an arbitrary selection rule. Most importantly, we use the notion of bound

  16. Proving Non-Deterministic Computations in Agda

    Directory of Open Access Journals (Sweden)

    Sergio Antoy

    2017-01-01

    Full Text Available We investigate proving properties of Curry programs using Agda. First, we address the functional correctness of Curry functions that, apart from some syntactic and semantic differences, are in the intersection of the two languages. Second, we use Agda to model non-deterministic functions with two distinct and competitive approaches incorporating the non-determinism. The first approach eliminates non-determinism by considering the set of all non-deterministic values produced by an application. The second approach encodes every non-deterministic choice that the application could perform. We consider our initial experiment a success. Although proving properties of programs is a notoriously difficult task, the functional logic paradigm does not seem to add any significant layer of difficulty or complexity to the task.

  17. New and improved methods for monitoring air quality and the terrestrial environment: Applications at Aberdeen Proving Ground-Edgewood area. Annual report, 1 April--14 November 1997

    Energy Technology Data Exchange (ETDEWEB)

    Bromenshenk, J.J.; Smith, G.C.

    1998-03-01

    Honey bees (Apis mellifera L.) have been shown to be multi-media monitors of chemical exposures and resultant effects. This five-year project has developed an automated system to assess in real-time colony behavioral responses to stressors, both anthropogenic and natural, including inclement weather. Field trials at the Aberdeen Proving Ground-Edgewood included the Old O Field and J field landfills, the Canal Creek and Bush River areas, and a Churchville, MD reference site. Preliminary results show varying concentrations of bioavailable inorganic elements and chlorinated hydrocarbons in bee colonies from all Maryland sites. Industrial solvents in the air inside beehives exhibited the greatest between site differences, with the highest levels occurring in hives near landfills at Old O Field, J Field, and at some sites in the Bush River and Canal Creek areas. Compared to 1996, the 1997 levels of solvents in Old O Field hives decreased by an order of magnitude, and colony performance significantly improved, probably as a consequence of capping the landfill. Recent chemical monitoring accomplishments include development of a new apparatus to quantitatively calibrate TD/GC/MS analysis, a QA/QC assessment of factors that limit the precision of these analyses, and confirmation of transport of aqueous contaminants into the hive. Real-time effects monitoring advances include development of an extensive array of software tools for automated data display, inspection, and numerical analysis and the ability to deliver data from remote locations in real time through Internet or Intranet connections.

  18. 20 CFR 219.23 - Evidence to prove death.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence to prove death. 219.23 Section 219... EVIDENCE REQUIRED FOR PAYMENT Evidence of Age and Death § 219.23 Evidence to prove death. (a) Preferred evidence of death. The best evidence of a person's death is— (1) A certified copy of or extract from the...

  19. The application of GPS time information in the telemetry ground station

    International Nuclear Information System (INIS)

    Zhang Songtao; Zhang Yusong; Sun Xiurui

    2001-01-01

    GPS time information is a kind of practicable information resource that can be shared all over the world. Now it is the most accurate wireless time information. The major of this paper is the application information of GPS time information in telemetry. The main point introduces how to make use of the GPS time information to produce GPS-IRIG-B time code for proving ground and how to send time information to related equipment in telemetry ground station

  20. Remedial investigation sampling and analysis plan for J-Field, Aberdeen Proving Ground, Maryland: Volume 2, Quality Assurance Project Plan

    Energy Technology Data Exchange (ETDEWEB)

    Prasad, S.; Martino, L.; Patton, T.

    1995-03-01

    J-Field encompasses about 460 acres at the southern end of the Gunpowder Neck Peninsula in the Edgewood Area of APG (Figure 2.1). Since World War II, the Edgewood Area of APG has been used to develop, manufacture, test, and destroy chemical agents and munitions. These materials were destroyed at J-Field by open burning and open detonation (OB/OD). For the purposes of this project, J-Field has been divided into eight geographic areas or facilities that are designated as areas of concern (AOCs): the Toxic Burning Pits (TBP), the White Phosphorus Burning Pits (WPP), the Riot Control Burning Pit (RCP), the Robins Point Demolition Ground (RPDG), the Robins Point Tower Site (RPTS), the South Beach Demolition Ground (SBDG), the South Beach Trench (SBT), and the Prototype Building (PB). The scope of this project is to conduct a remedial investigation/feasibility study (RI/FS) and ecological risk assessment to evaluate the impacts of past disposal activities at the J-Field site. Sampling for the RI will be carried out in three stages (I, II, and III) as detailed in the FSP. A phased approach will be used for the J-Field ecological risk assessment (ERA).

  1. Elliptic curves and primality proving

    Science.gov (United States)

    Atkin, A. O. L.; Morain, F.

    1993-07-01

    The aim of this paper is to describe the theory and implementation of the Elliptic Curve Primality Proving algorithm. Problema, numeros primos a compositis dignoscendi, hosque in factores suos primos resolvendi, ad gravissima ac utilissima totius arithmeticae pertinere, et geometrarum tum veterum tum recentiorum industriam ac sagacitatem occupavisse, tam notum est, ut de hac re copiose loqui superfluum foret.

  2. Approximating the ground state of gapped quantum spin systems

    Energy Technology Data Exchange (ETDEWEB)

    Michalakis, Spyridon [Los Alamos National Laboratory; Hamza, Eman [NON LANL; Nachtergaele, Bruno [NON LANL; Sims, Robert [NON LANL

    2009-01-01

    We consider quantum spin systems defined on finite sets V equipped with a metric. In typical examples, V is a large, but finite subset of Z{sup d}. For finite range Hamiltonians with uniformly bounded interaction terms and a unique, gapped ground state, we demonstrate a locality property of the corresponding ground state projector. In such systems, this ground state projector can be approximated by the product of observables with quantifiable supports. In fact, given any subset {chi} {contained_in} V the ground state projector can be approximated by the product of two projections, one supported on {chi} and one supported on {chi}{sup c}, and a bounded observable supported on a boundary region in such a way that as the boundary region increases, the approximation becomes better. Such an approximation was useful in proving an area law in one dimension, and this result corresponds to a multi-dimensional analogue.

  3. Temporal variation of uranium in ground water with conductivity

    International Nuclear Information System (INIS)

    Pulhani, Vandana; Chaudhury, Moushumi D.; Jha, S.K.; Tripathi, R.M.

    2015-01-01

    The concentration of uranium in drinking water sources is a matter of health concern since it has been proved to be chemo-toxic to humans. Uranium being a more soluble actinide is also very mobile in the environment. The effect of water quality parameters and their co-relation to uranium content in the water is an interesting study to understand and predict its behavior in ground water and subsequently to judge the hazard posed. Hence studies on spatial and temporal variation of uranium concentration with electrical conductivity, pH, total dissolved solids and salinity in ground water was carried out. (author)

  4. Seismic proving test of PWR reactor containment vessel

    International Nuclear Information System (INIS)

    Akiyama, H.; Yoshikawa, T.; Tokumaru, Y.

    1987-01-01

    The seismic reliability proving tests of nuclear power plant facilities are carried out by Nuclear Power Engineering Test Center (NUPEC), using the large-scale, high-performance vibration of Tadotsu Engineering Laboratory, and sponsored by the Ministry of International Trade and Industry (MITI). In 1982, the seismic reliability proving test of PWR containment vessel started using the test component of reduced scale 1/3.7 and the test component proved to have structural soundness against earthquakes. Subsequently, the detailed analysis and evaluation of these test results were carried out, and the analysis methods for evaluating strength against earthquakes were established. Whereupon, the seismic analysis and evaluation on the actual containment vessel were performed by these analysis methods, and the safety and reliability of the PWR reactor containment vessel were confirmed

  5. Preservice Mathematics Teachers' Metaphorical Perceptions towards Proof and Proving

    Science.gov (United States)

    Ersen, Zeynep Bahar

    2016-01-01

    Since mathematical proof and proving are in the center of mathematics; preservice mathematics teachers' perceptions against these concepts have a great importance. Therefore, the study aimed to determine preservice mathematics teachers' perceptions towards proof and proving through metaphors. The participants consisted of 192 preservice…

  6. Proving test on the reliability for nuclear valves

    International Nuclear Information System (INIS)

    Kajiyama, Yasuo; Tashiro, Hisao; Uga, Takeo; Maeda, Shunichi.

    1986-01-01

    Since valves are the most common components, they could be the most frequent causes of troubles in nuclear power plants. This proving test, therefore, has an important meaning to examine and verify the reliability of various valves under simulating conditions of abnormal and transient operations of the nuclear power plant. The test was performed mainly for the various types and pressure ratings of valves which were used in the primary and secondary systems in BWR and PWR nuclear power plants and which had major operating or safety related functions in those nuclear power plants. The results of the proving test, confirmed for more than four years, showed relatively favourable performance of the tested valves. It is concluded that performances of valves including operability, seat sealing and structural integrity were proved under the thermal cycling, vibration and pipe reaction load conditions. Operating functions during and after accident such as loss of coolant accident were satisfactory. From these results, it was considered that the purpose of this proving test was satisfactorily fulfilled. Several data accumulated by the test would be useful to get better reliability if it was evaluated with the actually experienced data of valves in the nuclear power plants. (Nogami, K.)

  7. Responsibility for proving and defining in abstract algebra class

    Science.gov (United States)

    Fukawa-Connelly, Timothy

    2016-07-01

    There is considerable variety in inquiry-oriented instruction, but what is common is that students assume roles in mathematical activity that in a traditional, lecture-based class are either assumed by the teacher (or text) or are not visible at all in traditional math classrooms. This paper is a case study of the teaching of an inquiry-based undergraduate abstract algebra course. In particular, gives a theoretical account of the defining and proving processes. The study examines the intellectual responsibility for the processes of defining and proving that the professor devolved to the students. While the professor wanted the students to engage in all aspects of defining and proving, he was only successful at devolving responsibility for certain aspects and much more successful at devolving responsibility for proving than conjecturing or defining. This study suggests that even a well-intentioned instructor may not be able to devolve responsibility to students for some aspects of mathematical practice without using a research-based curriculum or further professional development.

  8. Edgewood Area - Aberdeen Proving Ground Five-Year Review

    Science.gov (United States)

    2008-10-01

    CLUSTER 3L IP 1995 2007 EACC3M-A WASTEWATER TREATMENT AREA-CLUSTER 3M IP 2007 EACC3M-B B-FIELD DECON- DETOX INCINERATOR-CL 3M RCRA ES-23 EXHIBIT 2...Surface debris removed and placed in plastic-lined wooden boxes, shipped to decon/ detox facility, and thermally treated for final disposal. 7.3.5

  9. Geometric inequalities methods of proving

    CERN Document Server

    Sedrakyan, Hayk

    2017-01-01

    This unique collection of new and classical problems provides full coverage of geometric inequalities. Many of the 1,000 exercises are presented with detailed author-prepared-solutions, developing creativity and an arsenal of new approaches for solving mathematical problems. This book can serve teachers, high-school students, and mathematical competitors. It may also be used as supplemental reading, providing readers with new and classical methods for proving geometric inequalities. .

  10. Simulation Analysis of Helicopter Ground Resonance Nonlinear Dynamics

    Science.gov (United States)

    Zhu, Yan; Lu, Yu-hui; Ling, Ai-min

    2017-07-01

    In order to accurately predict the dynamic instability of helicopter ground resonance, a modeling and simulation method of helicopter ground resonance considering nonlinear dynamic characteristics of components (rotor lead-lag damper, landing gear wheel and absorber) is presented. The numerical integral method is used to calculate the transient responses of the body and rotor, simulating some disturbance. To obtain quantitative instabilities, Fast Fourier Transform (FFT) is conducted to estimate the modal frequencies, and the mobile rectangular window method is employed in the predictions of the modal damping in terms of the response time history. Simulation results show that ground resonance simulation test can exactly lead up the blade lead-lag regressing mode frequency, and the modal damping obtained according to attenuation curves are close to the test results. The simulation test results are in accordance with the actual accident situation, and prove the correctness of the simulation method. This analysis method used for ground resonance simulation test can give out the results according with real helicopter engineering tests.

  11. Reasoning and Proving Opportunities in Textbooks: A Comparative Analysis

    Science.gov (United States)

    Hong, Dae S.; Choi, Kyong Mi

    2018-01-01

    In this study, we analyzed and compared reasoning and proving opportunities in geometry lessons from American standard-based textbooks and Korean textbooks to understand how these textbooks provide student opportunities to engage in reasoning and proving activities. Overall, around 40% of exercise problems in Core Plus Mathematics Project (CPMP)…

  12. A New Approach for Proving or Generating Combinatorial Identities

    Science.gov (United States)

    Gonzalez, Luis

    2010-01-01

    A new method for proving, in an immediate way, many combinatorial identities is presented. The method is based on a simple recursive combinatorial formula involving n + 1 arbitrary real parameters. Moreover, this formula enables one not only to prove, but also generate many different combinatorial identities (not being required to know them "a…

  13. Generic Example Proving Criteria for All

    Science.gov (United States)

    Yopp, David; Ely, Rob; Johnson­-Leung, Jennifer

    2015-01-01

    We review literature that discusses generic example proving and highlight ambiguities that pervade our research community's discourse about generic example arguments. We distinguish between pedagogical advice for choosing good examples that can serve as generic examples when teaching and advice for developing generic example arguments. We provide…

  14. SARS – Koch´Postulates proved.

    Indian Academy of Sciences (India)

    SARS – Koch´Postulates proved. Novel coronavirus identified from fluids of patients. Virus cultured in Vero cell line. Sera of patients have antibodies to virus. Cultured virus produces disease in Macaque monkeys. -produces specific immune response; -isolated virus is SARS CoV; -pathology similar to human.

  15. The Earth is Flat, and I Can Prove It!

    Science.gov (United States)

    Klinger, Art

    1998-01-01

    Describes an educational program that asks students to attempt to prove that the earth is spherical and that it rotates. Presents tips to pique student interest and charts related to sensing the spin, nonrotation notions, flat earth fallacies, evidence that the earth is spherical and rotates, and the role of watersheds in proving that the earth…

  16. Consistent interactive segmentation of pulmonary ground glass nodules identified in CT studies

    Science.gov (United States)

    Zhang, Li; Fang, Ming; Naidich, David P.; Novak, Carol L.

    2004-05-01

    Ground glass nodules (GGNs) have proved especially problematic in lung cancer diagnosis, as despite frequently being malignant they characteristically have extremely slow rates of growth. This problem is further magnified by the small size of many of these lesions now being routinely detected following the introduction of multislice CT scanners capable of acquiring contiguous high resolution 1 to 1.25 mm sections throughout the thorax in a single breathhold period. Although segmentation of solid nodules can be used clinically to determine volume doubling times quantitatively, reliable methods for segmentation of pure ground glass nodules have yet to be introduced. Our purpose is to evaluate a newly developed computer-based segmentation method for rapid and reproducible measurements of pure ground glass nodules. 23 pure or mixed ground glass nodules were identified in a total of 8 patients by a radiologist and subsequently segmented by our computer-based method using Markov random field and shape analysis. The computer-based segmentation was initialized by a click point. Methodological consistency was assessed using the overlap ratio between 3 segmentations initialized by 3 different click points for each nodule. The 95% confidence interval on the mean of the overlap ratios proved to be [0.984, 0.998]. The computer-based method failed on two nodules that were difficult to segment even manually either due to especially low contrast or markedly irregular margins. While achieving consistent manual segmentation of ground glass nodules has proven problematic most often due to indistinct boundaries and interobserver variability, our proposed method introduces a powerful new tool for obtaining reproducible quantitative measurements of these lesions. It is our intention to further document the value of this approach with a still larger set of ground glass nodules.

  17. Pengembangan Perangkat Pembelajaran Geometri Ruang dengan Model Proving Theorem

    Directory of Open Access Journals (Sweden)

    Bambang Eko Susilo

    2016-03-01

    Full Text Available Kemampuan berpikir kritis dan kreatif mahasiswa masih lemah. Hal ini ditemukan pada mahasiswa yang mengambil mata kuliah Geometri Ruang yaitu dalam membuktikan soal-soal pembuktian (problem to proof. Mahasiswa masih menyelesaikan secara algoritmik atau prosedural sehingga diperlukan pengembangan perangkat pembelajaran Geometri Ruang berbasis kompetensi dan konservasi dengan model Proving Theorem. Dalam penelitian ini perangkat perkuliahan yang dikembangkan yaitu Silabus, Satuan Acara Perkuliahan (SAP, Kontrak Perkuliahan, Media Pembelajaran, Bahan Ajar, Tes UTS dan UAS serta Angket Karakter Konservasi telah dilaksanakan dengan baik dengan kriteria (1 validasi perangkat pembelajaran mata kuliah Geometri ruang berbasis kompetensi dan konservasi dengan model proving theorem berkategori baik dan layak digunakan dan (2 keterlaksanaan RPP pada pembelajaran yang dikembangkan secara keseluruhan berkategori baik.Critical and creative thinking abilities of students still weak. It is found in students who take Space Geometry subjects that is in solving problems to to prove. Students still finish in algorithmic or procedural so that the required the development of Space Geometry learning tools based on competency and conservation with Proving Theorem models. This is a research development which refers to the 4-D models that have been modified for the Space Geometry learning tools, second semester academic year 2014/2015. Instruments used include validation sheet, learning tools and character assessment questionnaire. In this research, the learning tools are developed, namely Syllabus, Lesson Plan, Lecture Contract, Learning Media, Teaching Material, Tests, and Character Conservation Questionnaire had been properly implemented with the criteria (1 validation of Space Geometry learning tools based on competency and conservation with Proving Theorem models categorized good and feasible to use, and (2 the implementation of Lesson Plan on learning categorized

  18. Airflow resistivity instrument for in situ measurement on the earth's ground surface

    Science.gov (United States)

    Zuckerwar, A. J.

    1983-01-01

    An airflow resistivity instrument features a novel specimen holder, especially designed for in situ measurement on the earth's ground surface. This capability eliminates the disadvantages of prior intrusive instruments, which necessitate the removal of a test specimen from the ground. A prototype instrument can measure airflow resistivities in the range 10-5000 cgs rayl/cm, at specimen depths up to 15.24 cm (6 in.), and at differential pressures up to 2490.8 dyn sq cm (1 in. H2O) across the specimen. Because of the close relationship between flow resistivity and acoustic impedance, this instrument should prove useful in acoustical studies of the earth's ground surface. Results of airflow resistivity measurements on an uncultivated grass field for varying values of moisture content are presented.

  19. Overcoming the Obstacle of Poor Knowledge in Proving Geometry Tasks

    Directory of Open Access Journals (Sweden)

    Zlatan Magajna

    2013-12-01

    Full Text Available Proving in school geometry is not just about validating the truth of a claim. In the school setting, the main function of the proof is to convince someone that a claim is true by providing an explanation. Students consider proving to be difficult; in fact, they find the very concept of proof demanding. Proving a claim in planar geometry involves several processes, the most salient being visual observation and deductive argumentation. These two processes are interwoven, but often poor observation hinders deductive argumentation. In the present article, we consider the possibility of overcoming the obstacle of a student’s poor observation by making use of computer-aided observation with appropriate software. We present the results of two small-scale research projects, both of which indicate that students are able to work out considerably more deductions if computer-aided observation is used. Not all students use computer-aided observation effectively in proving tasks: some find an exhaustive computer-provided list of properties confusing and are not able to choose the properties that are relevant to the task.

  20. On proving syntactic properties of CPS programs

    DEFF Research Database (Denmark)

    Danvy, Olivier; Dzafic, Belmina; Pfenning, Frank

    1999-01-01

    Higher-order program transformations raise new challenges for proving properties of their output, since they resist traditional, first-order proof techniques. In this work, we consider (1) the “one-pass” continuation-passing style (CPS) transformation, which is second-order, and (2) the occurrences...

  1. Exchange of moisture between atmosphere and ground regarding tritium transfer

    International Nuclear Information System (INIS)

    Bunnenberg, C.

    1980-09-01

    Two measuring equipment have been developed in the framework of this study which fulfill important conditions to avoid microclimatic interferences during measurement by using site-specific ground samples and embedding these in the ground surface. The beta-absorption lysimeter allows the detection of a minimum deposit height of 0.001 mm in a 1 mm sample layer. The conductivity moisture probe is to measure the moisture diffusion within the first 80 mm of the upper ground with a vertical spacial resolution of 2 mm. It is possible to measure a minimum water content increase of 0.02 wt% per 2 mm ground layer using this probe. The influences of single microclimatic parameter on condensation and evaporation were investigated and a transport equation was developed. Investigations in the Negev proved the application ability of the measuring equipment. The application of the transport equation showed very good agreement with the measured values. When the ground surface starts to cool in the afternoon, there is a countercurrent moisture transport from the atmosphere and the deeper ground layers which lead to a higher water content in the upper ground layer. At about 50 mm depth there is an overlapping layer of the two moisture flows which remains almost constant over the 24 h cycle. This exchange zone of atmospheric humidity and ground water must be paid great attention with regard to HTO transfer. (orig./HP) [de

  2. Artillery localization using networked wireless ground sensors

    Science.gov (United States)

    Swanson, David C.

    2002-08-01

    This paper presents the results of an installation of four acoustic/seismic ground sensors built using COTS computers and networking gear and operating on a continuous basis at Yuma Proving Grounds, Arizona. A description of the design can be found as well, which is essentially a Windows 2000 PC with 24-bit data acquisition, GPS timing, and environmental sensors for wind and temperature. A 4-element square acoustic array 1.8m on a side can be used to detect the time and angle of arrival of the muzzle blast and the impact explosion. A 3-component geophone allows the seismic wave direction to be estimated. The 8th channel of the 24-bit data acquisition system has a 1-pulse-per-second time signal from the GPS. This allows acoustic/seismic 'snapshots' to be coherently related from multiple disconnected ground sensor nodes. COTS 2.4 GHz frequency hopping radios (802.11 standard) are used with either omni or yagi antennas depending on the location on the range. Localization of the artillery or impact can be done by using the time and angle of arrival of the waves at 2 or more ground sensor locations. However, this straightforward analysis can be significantly complicated by weather and wind noise and is also the subject of another research contract. This work will present a general description of the COTS ground sensor installation, show example data autonomously collected including agent-based atmospheric data, and share some of the lessons learned from operating a Windows 2000 based system continuously outdoors.

  3. Exact ground-state correlation functions of an atomic-molecular Bose–Einstein condensate model

    Science.gov (United States)

    Links, Jon; Shen, Yibing

    2018-05-01

    We study the ground-state properties of an atomic-molecular Bose–Einstein condensate model through an exact Bethe Ansatz solution. For a certain range of parameter choices, we prove that the ground-state Bethe roots lie on the positive real-axis. We then use a continuum limit approach to obtain a singular integral equation characterising the distribution of these Bethe roots. Solving this equation leads to an analytic expression for the ground-state energy. The form of the expression is consistent with the existence of a line of quantum phase transitions, which has been identified in earlier studies. This line demarcates a molecular phase from a mixed phase. Certain correlation functions, which characterise these phases, are then obtained through the Hellmann–Feynman theorem.

  4. A Cyber Proving Ground: The Search for Cyber Genius

    Science.gov (United States)

    2010-01-01

    attractive to a variety of participants would need to em- brace cutting-edge, “massively multiplayer online role-playing game” ( MMORPG ) tech- nology with...Alfonso.indd 64 1/27/10 1:30:59 PM Spring 2010 | 65 Views & Analyses developing a viable CPG on par with the MMORPG World of Warcraft or the virtual...Most  MMORPGs , like World of Warcraft, have  rules against botting since it gives certain players an  unfair advantage over others, particularly in

  5. Demonstration of MPV Sensor at Yuma Proving Ground, AZ

    Science.gov (United States)

    2011-06-01

    test plot in Ashland, OR, where magnetic soils have shown to have a significant effect on EMI sensors ( Pasion et al., 2008). The recorded signal...sensors was also investigated during that survey as part of SERDP MM-1573 (PI: Len Pasion , Sky Research). The MPV offers possibilities to defeat...of magnetic soils (Lhomme et al., 2008; Pasion et al., 2008). The MPV response due to sensor motion and topography over magnetic soil is predicable

  6. Adding Theoretical Grounding to Grounded Theory: Toward Multi-Grounded Theory

    OpenAIRE

    Göran Goldkuhl; Stefan Cronholm

    2010-01-01

    The purpose of this paper is to challenge some of the cornerstones of the grounded theory approach and propose an extended and alternative approach for data analysis and theory development, which the authors call multi-grounded theory (MGT). A multi-grounded theory is not only empirically grounded; it is also grounded in other ways. Three different grounding processes are acknowledged: theoretical, empirical, and internal grounding. The authors go beyond the pure inductivist approach in GT an...

  7. Classic Grounded Theory to Analyse Secondary Data: Reality and Reflections

    Directory of Open Access Journals (Sweden)

    Lorraine Andrews

    2012-06-01

    Full Text Available This paper draws on the experiences of two researchers and discusses how they conducted a secondary data analysis using classic grounded theory. The aim of the primary study was to explore first-time parents’ postnatal educational needs. A subset of the data from the primary study (eight transcripts from interviews with fathers was used for the secondary data analysis. The objectives of the secondary data analysis were to identify the challenges of using classic grounded theory with secondary data and to explore whether the re-analysis of primary data using a different methodology would yield a different outcome. Through the process of re-analysis a tentative theory emerged on ‘developing competency as a father’. Challenges encountered during this re-analysis included the small dataset, the pre-framed data, and limited ability for theoretical sampling. This re-analysis proved to be a very useful learning tool for author 1(LA, who was a novice with classic grounded theory.

  8. Proving the correctness of unfold/fold program transformations using bisimulation

    DEFF Research Database (Denmark)

    Hamilton, Geoff W.; Jones, Neil

    2011-01-01

    by a labelled transition system whose bisimilarity relation is a congruence that coincides with contextual equivalence. Labelled transition systems are well-suited to represent global program behaviour. On the other hand, unfold/fold program transformations use generalization and folding, and neither is easy......This paper shows that a bisimulation approach can be used to prove the correctness of unfold/fold program transformation algorithms. As an illustration, we show how our approach can be use to prove the correctness of positive supercompilation (due to Sørensen et al). Traditional program equivalence...... to describe contextually, due to use of non-local information. We show that weak bisimulation on labelled transition systems gives an elegant framework to prove contextual equivalence of original and transformed programs. One reason is that folds can be seen in the context of corresponding unfolds....

  9. INERTIAL TECHNOLOGIES IN SYSTEMS FOR STABILIZATION OF GROUND VEHICLES EQUIPMENT

    Directory of Open Access Journals (Sweden)

    Olha Sushchenko

    2016-12-01

    Full Text Available Purpose: The vibratory inertial technology is a recent modern inertial technology. It represents the most perspective approach to design of inertial sensors, which can be used in stabilization and tracking systems operated on vehicles of the wide class. The purpose of the research is to consider advantages of this technology in comparison with laser and fiber-optic ones. Operation of the inertial sensors on the ground vehicles requires some improvement of the Coriolis vibratory gyroscope with the goal to simplify information processing, increase reliability, and compensate bias. Methods: Improvement of the Coriolis vibratory gyroscope includes introducing of the phase detector and additional excitation unit. The possibility to use the improved Coriolis vibratory gyroscope in the stabilization systems operated on the ground vehicles is shown by means of analysis of gyroscope output signal. To prove efficiency of the Coriolis vibratory gyroscope in stabilization system the simulation technique is used. Results: The scheme of the improved Coriolis vibratory gyroscope including the phase detector and additional excitation unit is developed and analyzed. The way to compensate bias is determined. Simulation of the stabilization system with the improved Coriolis vibratory gyroscope is carried out. Expressions for the output signals of the improved Coriolis vibratory gyroscope are derived. The error of the output signal is estimated and the possibility to use the modified Coriolis vibratory gyroscope in stabilization systems is proved. The results of stabilization system simulation are given. Their analysis is carried out. Conclusions: The represented results prove efficiency of the proposed technical decisions. They can be useful for design of stabilization platform with instrumental equipment operated on moving vehicles of the wide class.

  10. Dry Stream Reaches in Carbonate Terranes: Surface Indicators of Ground-Water Reservoirs

    Science.gov (United States)

    Brahana, J.V.; Hollyday, E.F.

    1988-01-01

    In areas where dry stream reaches occur, subsurface drainage successfully competes with surface drainage, and sheet-like dissolution openings have developed parallel to bedding creating the ground-water reservoir. Union Hollow in south-central Tennessee is the setting for a case study that illustrates the application of the dry stream reach technique. In this technique, dry stream reach identification is based on two types of readily acquired information: remotely sensed black and white infrared aerial photography; and surface reconnaissance of stream channel characteristics. Test drilling in Union Hollow subsequent to identification of the dry reach proved that a localized ground-water reservoir was present.

  11. A conception of ecological providing ground

    International Nuclear Information System (INIS)

    Miroshkina, S.

    1995-01-01

    Full text: Ecological proving ground is a multifunctional intersectoral and interterritorial complex. The proving ground is created to organize the work of the Regional System of Ecological Safety, its structure and elements, and their unification and conversion into national system. It's also created for the working out of some questions of technical policy and normative-legal regulation in the field of ecology. The main task is the elaboration of mechanisms for the co-operation of the legislative executive bodies and their regional structure in the process of creation adoption and working of the Complex Regional System of Ecological Safety. The directions of polygon's activity: 1. Sanitary-epidemic protection of population. 2. Radiational Safety. 3. Chemical Safety. 4. Monitoring of Ecological situation and normalization of the environment. 4.1. Control of contamination of the waters. 4.2. Control of contamination of the air. 4.3. Ecological monitoring of soil. 4.4. State and protection of flora and fauna. 5. Ecologically pure agricultural production on the territory of the polygon. 5.1. Radiational and chemical control of agricultural areas and production. 5.2. Production of pure products. 6. The creation of normative, legal, informational, methodical and metrological supply of polygon's activity. 7. Optimization of the models of ecological situation. 8. Ecological informational-educational activity. The choice of territory for the polygon is based on the following statements: the intensity of ecological situation; the topography of the environment; the density of population; the availability of scientific base; the intensity of social movements. Some experience, that would allow to improve existing ecological legislation and spread some tried methods of supply of ecological safety on the territory of Russia, will be gained as a result. (author)

  12. On proving syntactic properties of CPS programs

    DEFF Research Database (Denmark)

    Danvy, Olivier; Dzafic, Belmina; Pfenning, Frank

    1999-01-01

    Higher-order program transformations raise new challenges for proving properties of their output, since they resist traditional, first-order proof techniques. In this work, we consider (1) the “one-pass” continuation-passing style (CPS) transformation, which is second-order, and (2) the occurrences...... of parameters of continuations in its output. To this end, we specify the one-pass CPS transformation relationally and we use the proof technique of logical relations....

  13. Ecological Aspects of Condition of Ground Deposits in Shershnevsky Reservoir

    Science.gov (United States)

    Arkanova, I. A.; Denisov, S. E.; Knutarev, D. Yu

    2017-11-01

    The article considers the aspects of the condition of ground deposits influencing the operating conditions of the water intake facilities in the Shershnevsky reservoir being the only source of the utility and drinking water supply in Chelyabinsk. The object of the research is a section near the Sosnovskie intake stations of the Shershnevsky reservoir. Based on the hydrometric surveys of the studied section and using the Kriging method and the Surfer suite, we calculated the volume of ground deposits. As a result of the analyses, the authors have proved that ground deposits in the studied section have a technology-related nature which is connected with the annual growth of the volume of ground deposits which is inadmissible in the operating conditions of the pump stations of water intake facilities whereas ground deposits will fully block the intake windows of pump stations. In case the bed area of the Shershnevsky reservoir is not timely treated, the ground deposits here will complicate the operation of the pump stations which will result in a technological problem of the treatment facilities operation up to a transfer of the pump station premises to other territories less exposed to the deposits. The treatment of the Shershnevsky reservoir from the ground deposits accumulated in the course of time will help to considerably increase its actual capacity, which will allow one to increase water circulation paths and to improve the water quality indices. In its turn, the water quality improvement will decrease the supply of suspended solids into the water intake facilities and cut the reagent costs in the course of the treatment water works operation.

  14. Monitoring of arched sched ground layer

    International Nuclear Information System (INIS)

    Listjak, M.; Slaninka, A.; Rau, L.; Pajersky, P.

    2015-01-01

    Arched Shed was a part of controlled area of NPP A1 site in Jaslovske Bohunice (Slovakia). It had been used for temporary storage of loose radioactive waste (RAW) which has been characterized within the BIDSF project C13, Characterisation of Loose Radioactive Waste'. Stored RAW has been treated and sorted within the project ',Realization of the 2 nd stage of Decommissioning Project of NPP A1'. Area of Arched Shed represents approximately 270 m 2 (45 m x 6 m). Ground layer of the AS consists mostly of soil with solid elements (stones and gravel). The aim of monitoring was to remove the contaminated soil up to 1 m below ground level. Requirement for detail monitoring of the Arched Shed ground layer resulted from conclusions of the BIDSF project C13 which has proved that massic activity 137 Cs of soil was up to few thousands Bq·kg -1 in underground layer. Dominant easy to measure radionuclide in the soil is 137 Cs which has been used as a key radionuclide for methodology of in-situ soil monitoring. Following methods has been applied during characterization: dose rate survey, sampling from defined ground layer followed by laboratory gamma spectrometry analysis by the accredited testing laboratory of radiation dosimetry VUJE (S-219) and in-situ scintillation gamma spectrometry by 1.5''x1.5'' LaBr detector. Massic activity of the remaining soil (not excavated) comply the criteria for free release into the environment (Government Regulation of Slovak Republic 345/2006 Coll.). Area was filled up by non-contaminated soil up to the ground level of surroundings. Afterward the area was covered with geotextile and concrete panels and nowadays it is ready for further usage within the NPP A1 decommissioning project as a place for treatment, conditioning and disposal of contaminated soil and concrete. (authors)

  15. Using grounded theory to create a substantive theory of promoting schoolchildren's mental health.

    Science.gov (United States)

    Puolakka, Kristiina; Haapasalo-Pesu, Kirsi-Maria; Kiikkala, Irma; Astedt-Kurki, Päivi; Paavilainen, Eija

    2013-01-01

    To discuss the creation of a substantive theory using grounded theory. This article provides an example of generating theory from a study of mental health promotion at a high school in Finland. Grounded theory is a method for creating explanatory theory. It is a valuable tool for health professionals when studying phenomena that affect patients' health, offering a deeper understanding of nursing methods and knowledge. Interviews with school employees, students and parents, and verbal responses to the 'school wellbeing profile survey', as well as working group memos related to the development activities. Participating children were aged between 12 and 15. The analysis was conducted by applying the grounded theory method and involved open coding of the material, constant comparison, axial coding and selective coding after identifying the core category. The analysis produced concepts about mental health promotion in school and assumptions about relationships. Grounded theory proved to be an effective means of eliciting people's viewpoints on mental health promotion. The personal views of different parties make it easier to identify an action applicable to practice.

  16. TFTR grounding scheme and ground-monitor system

    International Nuclear Information System (INIS)

    Viola, M.

    1983-01-01

    The Tokamak Fusion Test Reactor (TFTR) grounding system utilizes a single-point ground. It is located directly under the machine, at the basement floor level, and is tied to the building perimeter ground. Wired to this single-point ground, via individual 500 MCM insulated cables, are: the vacuum vessel; four toroidal field coil cases/inner support structure quadrants; umbrella structure halves; the substructure ring girder; radial beams and columns; and the diagnostic systems. Prior to the first machine operation, a ground-loop removal program was initiated. It required insulation of all hangers and supports (within a 35-foot radius of the center of the machine) of the various piping, conduits, cable trays, and ventilation systems. A special ground-monitor system was designed and installed. It actively monitors each of the individual machine grounds to insure that there are no inadvertent ground loops within the machine structure or its ground and that the machine grounds are intact prior to each pulse. The TFTR grounding system has proven to be a very manageable system and one that is easy to maintain

  17. 2D XXZ model ground state properties using an analytic Lanczos expansion

    International Nuclear Information System (INIS)

    Witte, N.S.; Hollenberg, L.C.L.; Weihong Zheng

    1997-01-01

    A formalism was developed for calculating arbitrary expectation values for any extensive lattice Hamiltonian system using a new analytic Lanczos expansion, or plaquette expansion, and a recently proved exact theorem for ground state energies. The ground state energy, staggered magnetisation and the excited state gap of the 2D anisotropic antiferromagnetic Heisenberg Model are then calculated using this expansion for a range of anisotropy parameters and compared to other moment based techniques, such as the t-expansion, and spin-wave theory and series expansion methods. It was found that far from the isotropic point all moment methods give essentially very similar results, but near the isotopic point the plaquette expansion is generally better than the others. 20 refs., 6 tabs

  18. Classificació de proves no paramètriques. Com aplicar-les en SPSS

    Directory of Open Access Journals (Sweden)

    Vanesa Berlanga-Silvente

    2012-07-01

    Full Text Available Les proves no paramètriques engloben una sèrie de proves estadístiques, que tenen com a denominador comú l'absència de assumpcions sobre la llei de probabilitat que segueix la població de la qual ha estat extreta la mostra. Per aquesta raó és comú referir-s'hi com a proves de distribució lliure. A l'article es descriuen i treballen les proves no paramètriques ressaltant el seu fonament i les indicacions per al seu ús quan es tracta d'una sola mostra (Chi-quadrat, de dues mostres amb dades independents (U de Mann-Whitney, de dues mostres amb dades relacionades (T de Wilcoxon, de diverses mostres amb dades independents (H de Kruskal-Wallis i de diverses mostres amb dades relacionades (Friedman.

  19. Theorem Proving in Intel Hardware Design

    Science.gov (United States)

    O'Leary, John

    2009-01-01

    For the past decade, a framework combining model checking (symbolic trajectory evaluation) and higher-order logic theorem proving has been in production use at Intel. Our tools and methodology have been used to formally verify execution cluster functionality (including floating-point operations) for a number of Intel products, including the Pentium(Registered TradeMark)4 and Core(TradeMark)i7 processors. Hardware verification in 2009 is much more challenging than it was in 1999 - today s CPU chip designs contain many processor cores and significant firmware content. This talk will attempt to distill the lessons learned over the past ten years, discuss how they apply to today s problems, outline some future directions.

  20. Pacific Proving Grounds radioisotope imprint in the Philippine Sea sediments

    DEFF Research Database (Denmark)

    Pittauer, Daniela; Roos, Per; Qiao, Jixin

    2018-01-01

    Radionuclide concentrations were studied in sediment cores taken at the continental slope of the Philippine Sea off Mindanao Island in the equatorial Western Pacific. High resolution deposition records of anthropogenic radionuclides were collected at this site. Excess 210Pb together with excess 2...

  1. Mathematics Education as a Proving-Ground for Information-Processing Theories.

    Science.gov (United States)

    Greer, Brian, Ed.; Verschaffel, Lieven, Ed.

    1990-01-01

    Five papers discuss the current and potential contributions of information-processing theory to our understanding of mathematical thinking as those contributions affect the practice of mathematics education. It is concluded that information-processing theories need to be supplemented in various ways to more adequately reflect the complexity of…

  2. Deterministic ground motion modelling at Russe, NE Bulgaria, associated to the Vrancea intermediate-depth earthquakes

    CERN Document Server

    Kouteva, M; Paskaleva, I; Romanelli, F

    2003-01-01

    An analytical deterministic technique, based on the detailed knowledge of the seismic source process and of the propagation of seismic waves, has been applied to generate synthetic seismic signals at Russe, NE Bulgaria, associated to the strongest intermediate-depth Vrancea earthquakes, which occurred during the last century (1940, 1977, 1986 and 1990). The obtained results show that all ground motion components contribute significantly to the seismic loading and that the seismic source parameters influence the shape and the amplitude of the seismic signal. The approach we used proves that realistic seismic input (also at remote distances) can be constructed via waveform modelling, considering all the possible factors influencing the ground motion.

  3. Formalizing and proving a typing result for security protocols in Isabelle/HOL

    DEFF Research Database (Denmark)

    Hess, Andreas Viktor; Modersheim, Sebastian

    2017-01-01

    or the positive output of a verification tool. However several of these works have used a typed model, where the intruder is restricted to "well-typed" attacks. There also have been several works that show that this is actually not a restriction for a large class of protocols, but all these results so far...... are again pen-and-paper proofs. In this work we present a formalization of such a typing result in Isabelle/HOL. We formalize a constraint-based approach that is used in the proof argument of such typing results, and prove its soundness, completeness and termination. We then formalize and prove the typing...... result itself in Isabelle. Finally, to illustrate the real-world feasibility, we prove that the standard Transport Layer Security (TLS) handshake satisfies the main condition of the typing result....

  4. IHSI [Induction Heating Stress Improvement] proves its worth

    International Nuclear Information System (INIS)

    Froehlich, C.H.; Cofie, N.G.; Sheffield, J.R.

    1988-01-01

    Based upon the wealth of experimental test data, extensive and successful in-plant application, and the decreasing cost of applying the process, IHSI is proving itself an important part of overall IGSCC mitigation programmes. Work is ongoing on the development of new temperature sensing systems, more efficient equipment immobilization/demobilization hardware configurations, and craft support management practices to further enhance the cost-effectiveness of IHSI. (author)

  5. Uniqueness of non-linear ground states for fractional Laplacians in R

    DEFF Research Database (Denmark)

    Frank, Rupert L.; Lenzmann, Enno

    2013-01-01

    We prove uniqueness of ground state solutions Q = Q(|x|) ≥ 0 of the non-linear equation (−Δ)sQ+Q−Qα+1=0inR,where 0 fractional Laplacian in one dimension. In particular, we answer affirmatively an open question...... recently raised by Kenig–Martel–Robbiano and we generalize (by completely different techniques) the specific uniqueness result obtained by Amick and Toland for s=12 and α = 1 in [5] for the Benjamin–Ono equation. As a technical key result in this paper, we show that the associated linearized operator L...... + = (−Δ) s +1−(α+1)Q α is non-degenerate; i.e., its kernel satisfies ker L + = span{Q′}. This result about L + proves a spectral assumption, which plays a central role for the stability of solitary waves and blowup analysis for non-linear dispersive PDEs with fractional Laplacians, such as the generalized...

  6. Triviality of the ground-state metastate in long-range Ising spin glasses in one dimension

    Science.gov (United States)

    Read, N.

    2018-01-01

    We consider the one-dimensional model of a spin glass with independent Gaussian-distributed random interactions, which have mean zero and variance 1/|i -j | 2 σ, between the spins at sites i and j for all i ≠j . It is known that, for σ >1 , there is no phase transition at any nonzero temperature in this model. We prove rigorously that, for σ >3 /2 , any translation-covariant Newman-Stein metastate for the ground states (i.e., the frequencies with which distinct ground states are observed in finite-size samples in the limit of infinite size, for given disorder) is trivial and unique. In other words, for given disorder and asymptotically at large sizes, the same ground state, or its global spin flip, is obtained (almost) always. The proof consists of two parts: One is a theorem (based on one by Newman and Stein for short-range two-dimensional models), valid for all σ >1 , that establishes triviality under a convergence hypothesis on something similar to the energies of domain walls and the other (based on older results for the one-dimensional model) establishes that the hypothesis is true for σ >3 /2 . In addition, we derive heuristic scaling arguments and rigorous exponent inequalities which tend to support the validity of the hypothesis under broader conditions. The constructions of various metastates are extended to all values σ >1 /2 . Triviality of the metastate in bond-diluted power-law models for σ >1 is proved directly.

  7. Lab Streaming Layer Enabled Myo Data Collection Software User Manual

    Science.gov (United States)

    2017-06-07

    SECURITY CLASSIFICATION OF: 17. LIMITATION OF ABSTRACT UU 18. NUMBER OF PAGES 32 19a. NAME OF RESPONSIBLE PERSON...www.tumsenahopayga.com/ wp-content/uploads/2015/12/Myo- By-Thalmic-Labs-Gesture-Sensor-Controller-Armbad-For-iPhone- Android -Mac-and-PC.jpg...uploads/2015/12/Myo-By-Thalmic-Labs- Gesture-Sensor-Controller-Armbad-For-iPhone- Android -Mac-and-PC.jpg) LSL is an open source system for transmitting

  8. Achieving World Class: An Independent Review of the Design Plans for the Walter Reed National Military Medical Center and the Fort Belvoir Community Hospital

    Science.gov (United States)

    2009-05-01

    There was an attempt to provide oversight , foster inclusion and develop an integrated healthcare delivery system within the current Service cultures...IT in the NCR. The “J6 JPG provides oversight of IM/IT initiatives for the Joint Operating Area (JOA).” (Rowland, 2009) Membership for the JPG...lateral violence; 3) supporting professional development; and 4) offering services such as child and elder care programs, telecommuting , flexible work

  9. Complex biological testing of ground water quality in the area of sewage settler filtration fields of JSC 'Almaty Kanty'

    International Nuclear Information System (INIS)

    Vetrinskaya, N.I.; Goldobina, E.A.; Kosmukhambetov, A.R.; Kulikova, O.V.; Kozlova, N.V.; Ismailova, Zh.B.

    2001-01-01

    Results are given on the ground water ecological quality estimation of operating survey boreholes of JSC 'Almaty Kanty' industrial enterprise filtration fields using different methods of biological testing. Proved that various biological objects reacted differently onto the toxins present in the water. Concealment of toxic effect was performed at short-period testing at several testing objects (stimulation). Revealed during long period tests, that ground water from all the boreholes surveyed is not ecologically clean and pure, and can bring damage for ecosystem of water reservoirs adjacent and sources of drinking water if migration happens. (author)

  10. Ground state solutions for Choquard type equations with a singular potential

    Directory of Open Access Journals (Sweden)

    Tao Wang

    2017-02-01

    Full Text Available This article concerns the Choquard type equation $$ -\\Delta u+V(xu=\\Big(\\int_{\\mathbb{R}^N}\\frac{|u(y|^p}{|x-y|^{N-\\alpha}}dy\\Big |u|^{p-2}u,\\quad x\\in \\mathbb{R}^N, $$ where $N\\geq3$, $\\alpha\\in ((N-4_+,N$, $2\\leq p <(N+\\alpha/(N-2$ and V(x is a possibly singular potential and may be unbounded below. Applying a variant of the Lions' concentration-compactness principle, we prove the existence of ground state solution of the above equations.

  11. Deterministic ground motion modelling at Russe, NE Bulgaria, associated to the Vrancea intermediate-depth earthquakes

    International Nuclear Information System (INIS)

    Kouteva, M.; Paskaleva, I.; Panza, G.F.; Romanelli, F.

    2003-06-01

    An analytical deterministic technique, based on the detailed knowledge of the seismic source process and of the propagation of seismic waves, has been applied to generate synthetic seismic signals at Russe, NE Bulgaria, associated to the strongest intermediate-depth Vrancea earthquakes, which occurred during the last century (1940, 1977, 1986 and 1990). The obtained results show that all ground motion components contribute significantly to the seismic loading and that the seismic source parameters influence the shape and the amplitude of the seismic signal. The approach we used proves that realistic seismic input (also at remote distances) can be constructed via waveform modelling, considering all the possible factors influencing the ground motion. (author)

  12. Microstrip linear phase low pass filter based on defected ground structures for partial response modulation

    DEFF Research Database (Denmark)

    Cimoli, Bruno; Johansen, Tom Keinicke; Olmos, Juan Jose Vegas

    2018-01-01

    We report a high performance linear phase low pass filter (LPF) designed for partial response (PR) modulations. For the implementation, we adopted microstrip technology and a variant of the standard stepped‐impedance technique. Defected ground structures (DGS) are used for increasing the characte......We report a high performance linear phase low pass filter (LPF) designed for partial response (PR) modulations. For the implementation, we adopted microstrip technology and a variant of the standard stepped‐impedance technique. Defected ground structures (DGS) are used for increasing...... the characteristic impedance of transmission lines. Experimental results prove that the proposed filter can successfully modulate a non‐return‐to‐zero (NRZ) signal into a five levels PR one....

  13. DEA (data envelopment analysis)-assisted supporting measures for ground coupled heat pumps implementing in Italy: A case study

    International Nuclear Information System (INIS)

    Longo, L.; Colantoni, A.; Castellucci, S.; Carlini, M.; Vecchione, L.; Savuto, E.; Pallozzi, V.; Di Carlo, A.; Bocci, E.; Moneti, M.; Cocchi, S.; Boubaker, K.

    2015-01-01

    Nowadays, the increasing of the energy consumption is producing serious global warming issues. Mainly most of greenhouse gas emissions in developed countries come from building equipments. In this context, GCHPs (ground coupled heat pumps) are candidate solution as air conditioning systems in buildings due to their higher efficiency compared to conventional devices. Actually, ground coupled heat pump systems are widely, recognized among the most efficient and comfortable used systems. Nevertheless, economic efficiency of the ground coupled heat pumps has to be proved. In this study, DEA (data envelopment analyses) method is applied to a real case in Italy. - Highlights: • Original investigation in terms of energy demands in buildings. • Gathering conjoint classical and scientific analyses. • Presenting original DEA (data envelopment analysis) economic optimization scheme analyses. • Outlining economical feasibility of an efficient low enthalpy-geothermal plant with GCHP (ground coupled heat pump) exchangers.

  14. Unicorns do exist: a tutorial on "proving" the null hypothesis.

    Science.gov (United States)

    Streiner, David L

    2003-12-01

    Introductory statistics classes teach us that we can never prove the null hypothesis; all we can do is reject or fail to reject it. However, there are times when it is necessary to try to prove the nonexistence of a difference between groups. This most often happens within the context of comparing a new treatment against an established one and showing that the new intervention is not inferior to the standard. This article first outlines the logic of "noninferiority" testing by differentiating between the null hypothesis (that which we are trying to nullify) and the "nill" hypothesis (there is no difference), reversing the role of the null and alternate hypotheses, and defining an interval within which groups are said to be equivalent. We then work through an example and show how to calculate sample sizes for noninferiority studies.

  15. On the problem of proving the existence of ''charmed'' particles

    International Nuclear Information System (INIS)

    Tyapkin, A.A.

    1975-01-01

    In order to search for ''charmed'' particles a possibility of performing an experiment is discussed in which one could observe a new particle and prove a necessity of introducting for this particle a new quantum number conserved in strong interactions

  16. Communication grounding facility

    International Nuclear Information System (INIS)

    Lee, Gye Seong

    1998-06-01

    It is about communication grounding facility, which is made up twelve chapters. It includes general grounding with purpose, materials thermal insulating material, construction of grounding, super strength grounding method, grounding facility with grounding way and building of insulating, switched grounding with No. 1A and LCR, grounding facility of transmission line, wireless facility grounding, grounding facility in wireless base station, grounding of power facility, grounding low-tenton interior power wire, communication facility of railroad, install of arrester in apartment and house, install of arrester on introduction and earth conductivity and measurement with introduction and grounding resistance.

  17. Is the energy density of the ground state of the sine-Gordon model unbounded from below for β2 > 8π?

    International Nuclear Information System (INIS)

    Faber, M; Ivanov, A N

    2003-01-01

    We discuss Coleman's theorem concerning the energy density of the ground state of the sine-Gordon model proved in Coleman S (1975 Phys. Rev. D 11 2088). According to this theorem the energy density of the ground state of the sine-Gordon model should be unbounded from below for coupling constants β 2 > 8π. The consequence of this theorem would be the non-existence of the quantum ground state of the sine-Gordon model for β 2 > 8π. We show that the energy density of the ground state in the sine-Gordon model is bounded from below even for β 2 > 8π. This result is discussed in relation to Coleman's theorem (Coleman S 1973 Commun. Math. Phys. 31 259), particle mass spectra and soliton-soliton scattering in the sine-Gordon model

  18. Valutazione economica dello studio PROVE-IT

    Directory of Open Access Journals (Sweden)

    Lorenzo G. Mantovani

    2007-10-01

    Full Text Available Introduction: the PROVE-IT (“Intensive versus moderate lipid lowering with statins after acute coronary syndromes” was a comparison of pravastatin 40 mg/die versus atorvastatin 80 mg/die in patients with an acute coronary syndrome (ACS. Aim: our aim was to investigate the economic consequence of high dose of atorvastatin vs usual-dose of pravastatin in Italian patients with a history of acute coronary syndrome. Methods: the analysis is conducted on the basis of clinical outcomes of the PROVE-IT study. We conducted a cost-effectiveness analysis, comparing high dose of atorvastatin (80 mg/die versus usual-dose of pravastatin (40 mg/die in the perspective of the Italian National Health Service. We identified and quantified medical costs: drug costs according to the Italian National Therapeutic Formulary and hospitalizations were quantified based on the Italian National Health Service tariffs (2006. Effects were measured in terms of mortality and morbidity reduction (number of deaths, life years gained and frequency of hospitalizations. We considered an observation period of 24 months. The costs borne after the first 12 months were discounted using an annual rate of 3%. We conducted one and multi-way sensitivity analyses on unit cost and effectiveness. We also conducted a threshold analysis. Results: the cost of pravastatin or atorvastatin therapy over the 2 years period amounted to approximately 1.3 millions euro and 870,000 euro per 1,000 patients respectively. Atorvastatin was more efficacious compared to pravastatin and the overall cost of care per 1,000 patients over 24 months of follow-up was estimated at 3.2 millions euro in the pravastatin and 2.5 millions euro in the atorvastatin group, resulting into a cost saving of about 700,000 euro that is 27% of total costs occurred in the pravastatin group. Discussion: this study demonstrates that high does atorvastatin treatment leads to a reduction of direct costs for the National Health System

  19. Ground Pollution Science

    International Nuclear Information System (INIS)

    Oh, Jong Min; Bae, Jae Geun

    1997-08-01

    This book deals with ground pollution science and soil science, classification of soil and fundamentals, ground pollution and human, ground pollution and organic matter, ground pollution and city environment, environmental problems of the earth and ground pollution, soil pollution and development of geological features of the ground, ground pollution and landfill of waste, case of measurement of ground pollution.

  20. Study of the unknown hemisphere of mercury by ground-based astronomical facilities

    Science.gov (United States)

    Ksanfomality, L. V.

    2011-08-01

    The short exposure method proved to be very productive in ground-based observations of Mercury. Telescopic observations with short exposures, together with computer codes for the processing of data arrays of many thousands of original electronic photos, make it possible to improve the resolution of images from ground-based instruments to almost the diffraction limit. The resulting composite images are comparable with images from spacecrafts approaching from a distance of about 1 million km. This paper presents images of the hemisphere of Mercury in longitude sectors 90°-180°W, 215°-350°W, and 50°-90°W, including, among others, areas not covered by spacecraft cameras. For the first time a giant S basin was discovered in the sector of longitudes 250°-290°W, which is the largest formation of this type on terrestrial planets. Mercury has a strong phase effects. As a result, the view of the surface changes completely with the change in the planetary phase. But the choice of the phase in the study using spacecrafts is limited by orbital characteristics of the mission. Thus, ground-based observations of the planet provide a valuable support.

  1. Searching for fixed point combinators by using automated theorem proving: A preliminary report

    International Nuclear Information System (INIS)

    Wos, L.; McCune, W.

    1988-09-01

    In this report, we establish that the use of an automated theorem- proving program to study deep questions from mathematics and logic is indeed an excellent move. Among such problems, we focus mainly on that concerning the construction of fixed point combinators---a problem considered by logicians to be significant and difficult to solve, and often computationally intensive and arduous. To be a fixed point combinator, Θ must satisfy the equation Θx = x(Θx) for all combinators x. The specific questions on which we focus most heavily ask, for each chosen set of combinators, whether a fixed point combinator can be constructed from the members of that set. For answering questions of this type, we present a new, sound, and efficient method, called the kernel method, which can be applied quite easily by hand and very easily by an automated theorem-proving program. For the application of the kernel method by a theorem-proving program, we illustrate the vital role that is played by both paramodulation and demodulation---two of the powerful features frequently offered by an automated theorem-proving program for treating equality as if it is ''understood.'' We also state a conjecture that, if proved, establishes the completeness of the kernel method. From what we can ascertain, this method---which relies on the introduced concepts of kernel and superkernel---offers the first systematic approach for searching for fixed point combinators. We successfully apply the new kernel method to various sets of combinators and, for the set consisting of the combinators B and W, construct an infinite set of fixed point combinators such that no two of the combinators are equal even in the presence of extensionality---a law that asserts that two combinators are equal if they behave the same. 18 refs

  2. Searching for fixed point combinators by using automated theorem proving: A preliminary report

    Energy Technology Data Exchange (ETDEWEB)

    Wos, L.; McCune, W.

    1988-09-01

    In this report, we establish that the use of an automated theorem- proving program to study deep questions from mathematics and logic is indeed an excellent move. Among such problems, we focus mainly on that concerning the construction of fixed point combinators---a problem considered by logicians to be significant and difficult to solve, and often computationally intensive and arduous. To be a fixed point combinator, THETA must satisfy the equation THETAx = x(THETAx) for all combinators x. The specific questions on which we focus most heavily ask, for each chosen set of combinators, whether a fixed point combinator can be constructed from the members of that set. For answering questions of this type, we present a new, sound, and efficient method, called the kernel method, which can be applied quite easily by hand and very easily by an automated theorem-proving program. For the application of the kernel method by a theorem-proving program, we illustrate the vital role that is played by both paramodulation and demodulation---two of the powerful features frequently offered by an automated theorem-proving program for treating equality as if it is ''understood.'' We also state a conjecture that, if proved, establishes the completeness of the kernel method. From what we can ascertain, this method---which relies on the introduced concepts of kernel and superkernel---offers the first systematic approach for searching for fixed point combinators. We successfully apply the new kernel method to various sets of combinators and, for the set consisting of the combinators B and W, construct an infinite set of fixed point combinators such that no two of the combinators are equal even in the presence of extensionality---a law that asserts that two combinators are equal if they behave the same. 18 refs.

  3. Historic American Landscapes Survey: Arco Naval Proving Ground (Idaho National Laboratory)

    Energy Technology Data Exchange (ETDEWEB)

    Olson, Christina [Idaho National Lab. (INL), Idaho Falls, ID (United States); Holmer, Marie [Idaho National Lab. (INL), Idaho Falls, ID (United States); Gilbert, Hollie [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-07-01

    Based on historical evaluations in 1993 and 1997, historians determined that the then-remaining Arco NPG structures were significant to the nation’s history through their association with World War II . Through ensuing discussions with the SHPO, it was further determined that the infrastructure and associated landscape were also significant. According to provisions of INL’s Cultural Resource Management Plan (CRMP) as legitimized through a 2004 Programmatic Agreement between DOE-ID, the Idaho State Historic Preservation Office (SHPO), and Advisory Council on Historic Preservation (ACHP) historians identified the World War II structures as DOE “Signature Properties”. As defined by DOE-HQ, Signature Properties “denote its [DOE’s] most historically important properties across the complex…and/or those properties that are viewed as having tourism potential.” The INL is a secure site and the INL land and structures are not accessible to the public and, therefore have no “tourism potential”. Although DOE-ID actively sought other uses for the vacant, unused buildings, none were identified and the buildings present safety and health concerns. A condition assessment found lead based paint, asbestos, rodent infestation/droppings, small animal carcasses, mold, and, in CF-633, areas of radiological contamination. In early 2013, DOE-ID notified the Idaho SHPO, ACHP, and, as required by the INL CRMP and PA, DOE-Headquarters Federal Preservation Officer, of their intent to demolish the vacant buildings (CF-606, CF-607, CF-613, CF-632, and CF-633). The proposed “end-state” of the buildings will be either grass and/or gravel pads. Through the NHPA Section 106 consultation process, measures to mitigate the adverse impacts of demolition were determined and agreed to through a Memorandum of Agreement (MOA) between DOE-ID, SHPO, and ACHP. The measures include the development and installation of interpretive signs to be placed at a publicly accessible location, retention of original components of CF-633, and completion of this HALS standard format report. Buildings, infrastructure, and features that are not scheduled for removal are documented here as well as properties that are scheduled for removal and the overall Arco NPG landscape. The Arco NPG, located in the remote high-desert of eastern Idaho aided in the defense and eventual ally victory in the Pacific Theater of World War II, in addition to revising national standards for the safe storage and transport of conventional ordnance.

  4. Light nuclei: an experimental proving ground for the microscopic cluster model

    International Nuclear Information System (INIS)

    Brown, R.E.

    1978-01-01

    A selected review is given of comparisons of experimental data for low-mass nuclear systems with results of calculations using microscopic cluster models. Stress is on the mass-4, -7, and -8 systems. Topics include influence of components of the nucleon-nucleon force, some consequences of the Pauli principle, effects of the Coulomb-exchange interaction, specific distortion, absorption in elastic scattering, and future needs and directions. Some as yet unpublished results are presented

  5. Remedial Investigation Work Plan for J-Field, Aberdeen Proving Ground, Maryland

    Energy Technology Data Exchange (ETDEWEB)

    Benioff, P.; Biang, R.; Dolak, D.; Dunn, C.; Haffenden, R.; Martino, L.; Patton, T.; Wang, Y.; Yuen, C.

    1995-03-01

    The purpose of an RI/FS is to characterize the nature and extent of the risks posed by contaminants present at a site and to develop and evaluate options for remedial actions. The overall objective of the RI is to provide a comprehensive evaluation of site conditions, types and quantities of contaminants present, release mechanisms and migration pathways, target populations, and risks to human health and the environment. The information developed during the RI provides the basis for the design and implementation of remedial actions during the FS. The purpose of this RI Work Plan is to define the tasks that will direct the remedial investigation of the J-Field site at APG.

  6. The in-pile proving test for fuel assembly of Qinshan nuclear power plant

    International Nuclear Information System (INIS)

    Chen Dianshan; Zhang Shucheng; Kang Rixin; Wang Huarong; Chen Guanghan

    1989-10-01

    The in-pile proving test for fuel assembly of Qinshan nuclear power plant had been conducted in the experimental loop of HWRR at IAE (Institute of Atomic Energy) in Beijing, China, from January 1985 to December 1986. Average burnup of 27000 MWd/tU and peak burnup of 34000 MWd/tU of fuel rod had already been reached. The basic status of the experiment are described, emphasis is placed on the discussion of proving test parameters and analysis of experiment results

  7. “Deliberate distortion of facts” and the problem of proving bias:

    African Journals Online (AJOL)

    user

    informed observer would reasonably perceive bias on the part of the officer .... represent an excellent illustration of what an Australian Chief Justice once .... the appellants prove that the Justice of Appeal who had no financial or other.

  8. Proving test on the performance of a Multiple-Excitation Simulator

    International Nuclear Information System (INIS)

    Fujita, Katsuhisa; Ito, Tomohiro; Kojima, Nobuyuki; Sasaki, Yoichi; Abe, Hiroshi; Kuroda, Katsuhiko

    1995-01-01

    Seismic excitation test on large scale piping systems is scheduled to be carried out by the Nuclear power Engineering Corporation (NUPEC) using the large-scale, high-performance vibration table at the Tadotsu Engineering Laboratory, under the sponsorship of the Ministry of International Trade and Industry (MITI). In the test, the piping systems simulate the main steam piping system and the main feed water piping system in the nuclear power plants. In this study, a fundamental test was carried out to prove the performance of the Multiple Excitation Simulator which consists of the hydraulic actuator and the control system. An L-shaped piping system and a hydraulic actuator were installed on the shaking table. Acceleration and displacement generated by the actuator were measured. The performance of the actuator and the control system was discussed comparing the measured values and the target values on the time histories and the response spectrum of the acceleration. As a result, it was proved that the actuator and the control system have good performance and will be applicable to the verification test

  9. Grounded theory.

    Science.gov (United States)

    Harris, Tina

    2015-04-29

    Grounded theory is a popular research approach in health care and the social sciences. This article provides a description of grounded theory methodology and its key components, using examples from published studies to demonstrate practical application. It aims to demystify grounded theory for novice nurse researchers, by explaining what it is, when to use it, why they would want to use it and how to use it. It should enable nurse researchers to decide if grounded theory is an appropriate approach for their research, and to determine the quality of any grounded theory research they read.

  10. Ground cross-modal impedance as a tool for analyzing ground/plate interaction and ground wave propagation.

    Science.gov (United States)

    Grau, L; Laulagnet, B

    2015-05-01

    An analytical approach is investigated to model ground-plate interaction based on modal decomposition and the two-dimensional Fourier transform. A finite rectangular plate subjected to flexural vibration is coupled with the ground and modeled with the Kirchhoff hypothesis. A Navier equation represents the stratified ground, assumed infinite in the x- and y-directions and free at the top surface. To obtain an analytical solution, modal decomposition is applied to the structure and a Fourier Transform is applied to the ground. The result is a new tool for analyzing ground-plate interaction to resolve this problem: ground cross-modal impedance. It allows quantifying the added-stiffness, added-mass, and added-damping from the ground to the structure. Similarity with the parallel acoustic problem is highlighted. A comparison between the theory and the experiment shows good matching. Finally, specific cases are investigated, notably the influence of layer depth on plate vibration.

  11. Proving the AGT relation for N f = 0, 1, 2 antifundamentals

    Science.gov (United States)

    Hadasz, Leszek; Jaskólski, Zbigniew; Suchanek, Paulina

    2010-06-01

    Using recursive relations satisfied by Nekrasov partition functions and by irregular conformal blocks we prove the AGT correspondence in the case of mathcal{N} = 2 superconformal SU(2) quiver gauge theories with N f = 0, 1, 2 antifundamental hypermultiplets.

  12. Competition-strength-dependent ground suppression in figure-ground perception.

    Science.gov (United States)

    Salvagio, Elizabeth; Cacciamani, Laura; Peterson, Mary A

    2012-07-01

    Figure-ground segregation is modeled as inhibitory competition between objects that might be perceived on opposite sides of borders. The winner is the figure; the loser is suppressed, and its location is perceived as shapeless ground. Evidence of ground suppression would support inhibitory competition models and would contribute to explaining why grounds are shapeless near borders shared with figures, yet such evidence is scarce. We manipulated whether competition from potential objects on the ground side of figures was high (i.e., portions of familiar objects were potentially present there) or low (novel objects were potentially present). We predicted that greater competition would produce more ground suppression. The results of two experiments in which suppression was assessed via judgments of the orientation of target bars confirmed this prediction; a third experiment showed that ground suppression is short-lived. Our findings support inhibitory competition models of figure assignment, in particular, and models of visual perception entailing feedback, in general.

  13. Regional analysis of ground and above-ground climate

    Science.gov (United States)

    1981-12-01

    The regional suitability of underground construction as a climate control technique is discussed with reference to (1) a bioclimatic analysis of long term weather data for 29 locations in the United States to determine appropriate above ground climate control techniques, (2) a data base of synthesized ground temperatures for the coterminous United States, and (3) monthly dew point ground temperature comparisons for identifying the relative likelihood of condensation from one region to another. It is concluded that the suitability of Earth tempering as a practice and of specific Earth sheltered design stereotypes varies geographically; while the subsurface almost always provides a thermal advantage on its own terms when compared to above ground climatic data, it can, nonetheless, compromise the effectiveness of other, regionally more important climate control techniques. Reviews of above and below ground climate mapping schemes related to human comfort and architectural design, and detailed description of a theoretical model of ground temperature, heat flow, and heat storage in the ground are included. Strategies of passive climate control are presented in a discussion of the building bioclimatic analysis procedure which has been applied in a computer analysis of 30 years of weather data for each of 20 locations in the United States.

  14. Regional analysis of ground and above-ground climate

    Energy Technology Data Exchange (ETDEWEB)

    1981-12-01

    The regional suitability of underground construction as a climate control technique is discussed with reference to (1) a bioclimatic analysis of long-term weather data for 29 locations in the United States to determine appropriate above ground climate control techniques, (2) a data base of synthesized ground temperatures for the coterminous United States, and (3) monthly dew point ground temperature comparisons for identifying the relative likelihood of condensation from one region to another. It is concluded that the suitability of earth tempering as a practice and of specific earth-sheltered design stereotypes varies geographically; while the subsurface almost always provides a thermal advantage on its own terms when compared to above ground climatic data, it can, nonetheless, compromise the effectiveness of other, regionally more important climate control techniques. Also contained in the report are reviews of above and below ground climate mapping schemes related to human comfort and architectural design, and detailed description of a theoretical model of ground temperature, heat flow, and heat storage in the ground. Strategies of passive climate control are presented in a discussion of the building bioclimatic analysis procedure which has been applied in a computer analysis of 30 years of weather data for each of 29 locations in the United States.

  15. Ground water '89

    International Nuclear Information System (INIS)

    1989-01-01

    The proceedings of the 5th biennial symposium of the Ground Water Division of the Geological Society of South Africa are presented. The theme of the symposium was ground water and mining. Papers were presented on the following topics: ground water resources; ground water contamination; chemical analyses of ground water and mining and its influece on ground water. Separate abstracts were prepared for 5 of the papers presented. The remaining papers were considered outside the subject scope of INIS

  16. Logic for computer science foundations of automatic theorem proving

    CERN Document Server

    Gallier, Jean H

    2015-01-01

    This advanced text for undergraduate and graduate students introduces mathematical logic with an emphasis on proof theory and procedures for algorithmic construction of formal proofs. The self-contained treatment is also useful for computer scientists and mathematically inclined readers interested in the formalization of proofs and basics of automatic theorem proving. Topics include propositional logic and its resolution, first-order logic, Gentzen's cut elimination theorem and applications, and Gentzen's sharpened Hauptsatz and Herbrand's theorem. Additional subjects include resolution in fir

  17. E-squared nine do-it-yourself energy experiments that prove your thoughts create your reality

    CERN Document Server

    Grout, Pam

    2013-01-01

    E-Squared is a lab manual with simple experiments to prove once and for all that there really is a good, loving, totally hip force in the universe. Rather than take it on faith, you are invited to conduct ten 48-hour experiments to prove each of the principles in this book. Yes, you read that right. It says prove. The experiments, each of which can be conducted with absolutely no money and very little time expenditure, demonstrate that spiritual principles are as dependable as gravity, as consistent as Newton's 2nd law of motion. For years, you've been hoping and praying that spiritual principles are true. Now, you can know.

  18. Using eternity variables to specify and prove a serializable database interface

    NARCIS (Netherlands)

    Hesselink, Wim H.

    Eternity variables are introduced to specify and verify serializability of transactions of a distributed database. Eternity variables are a new kind of auxiliary variables. They do not occur in the implementation but are used in specification and verification. Elsewhere it has been proved that

  19. Automatically Proving Termination and Memory Safety for Programs with Pointer Arithmetic

    DEFF Research Database (Denmark)

    Ströder, Thomas; Giesl, Jürgen; Brockschmidt, Marc

    2017-01-01

    While automated verification of imperative programs has been studied intensively, proving termination of programs with explicit pointer arithmetic fully automatically was still an open problem. To close this gap, we introduce a novel abstract domain that can track allocated memory in detail. We use...

  20. Technical report on the Piping Reliability Proving Tests at the Japan Atomic Energy Research Institute

    International Nuclear Information System (INIS)

    1993-05-01

    Japan Atomic Energy Research Institute (JAERI) conducts Piping Reliability Proving Tests from 1975 to 1992 based upon the contracts between JAERI and Science and Technology Agency of Japan (STA) under the auspices of the special account law for electric power development promotion. The purpose of these tests are to prove the structural reliability of the primary cooling piping constituting a part of the pressure boundary in the light water reactor power plants. The tests with large experimental facilities had ended already in 1990. Presently piping reliability analysis by the probabilistic fracture mechanics method is being done. Until now annual reports concerning the proving tests were produced and submitted to STA, whereas this report summarizes the test results done during these 16 years. Objectives of the piping reliability proving tests are to prove that the primary piping of the light water reactor (1) be reliable throughout the service period, (2) have no possibility of rupture, (3) bring no detrimental influence on the surrounding instrumentations or equipments near the break location even if it ruptured suddenly. To attain these objectives (i) pipe fatigue tests, (ii) unstable pipe fracture tests, (iii) pipe rupture tests and also the analyses by computer codes were done. After carrying out these tests, it is verified that the piping is reliable throughout the service period. The authors of this report are T. Isozaki, K. Shibata, S. Ueda, R. Kurihara, K. Onizawa and A. Kohsaka. The parts they wrote are shown in contents. (author)

  1. 76 FR 50771 - Submission for Review: RI 25-37, Evidence To Prove Dependency of a Child, 3206-0206

    Science.gov (United States)

    2011-08-16

    ... OFFICE OF PERSONNEL MANAGEMENT Submission for Review: RI 25-37, Evidence To Prove Dependency of a...) 3206-0206, Evidence to Prove Dependency of a Child. As required by the Paperwork Reduction Act of 1995... or faxed to (202) 395-6974. SUPPLEMENTARY INFORMATION: Evidence to Prove Dependency of a Child is...

  2. Origin of choriocarcinoma in previous molar pregnancy proved by DNA analysis

    International Nuclear Information System (INIS)

    Vojtassak, J.; Repiska, V.; Konecna, B.; Zajac, V.; Korbel, M.; Danihel, L.

    1996-01-01

    A 17-year old woman had in a short time period (seven months) a very exciting reproduction history. Molar pregnancy in December 1993, choriocarcinoma in January 1994 and induced abortion in June 1994. DNA analysis proved the origin of the choriocarcinoma in the previous molar pregnancy. (author)

  3. Ground roll attenuation using a curvelet-SVD filter: a case study from the west of Iran

    International Nuclear Information System (INIS)

    Boustani, Bahareh; Javaherian, Abdorahim; Mortazavi, Seyed Ahmad; Torabi, Siyavash

    2013-01-01

    data, quantitative and qualitative assessments using f-k, average amplitude and power spectra proved that the curvelet-SVD filter attenuated ground roll better than either the adaptive curvelet or the ASVD. On the other hand, an ASVD filter damages reflections, while the curvelet-SVD does not. (paper)

  4. Ground water in Creek County, Oklahoma

    Science.gov (United States)

    Cady, Richard Carlysle

    1937-01-01

    Creek County has been designated as a problem area by the Land Use Planning Section of the Resettlement Administration. Some of the earliest oil fields to brought into production were situated in and near this county, and new fields have been opened from time to time during the ensuing years. The production of the newer fields, however, has not kept pace with the exhaustion of the older fields, and the county now presents an excellent picture of the problems involved in adjusting a population to lands that are nearly depleted of their mineral wealth. Values of land have been greatly depressed; tax collection is far in arrears; tenancy is widespread; and in addition more people will apparently be forced to depend on the income from agriculture than the land seems capable of supporting. The county as a whole is at best indifferently suitable for general farming. The Land Use planning Section proposes to study the present and seemingly immanent maladjustments of population to the resources of the land, and make recommendations for their correction. The writer was detailed to the Land Use Planning Section of Region VIII for the purposes of making studies of ground water problems in the region. In Creek County two investigations were made. In September, 1936, the writer spent about ten days investigating the availability of ground water for the irrigation of garden crops during drouths. If it proved feasible to do this generally throughout the county, the Land Use Planning Section might be able to encourage this practice. The second investigation made by the writer was in regard to the extent to which ground water supplies have been damaged by oil well brines. He was in county for four days late in January 1937, and again in March, 1937. During part of the second field trip he was accompanied by R.M. Dixon, sanitary engineer of the Water Utilization Unit of the Resettlement Administration. (available as photostat copy only)

  5. PROVE Surface albedo of Jornada Experimental Range, New Mexico, 1997

    Data.gov (United States)

    National Aeronautics and Space Administration — The objective of this study was to determine the spatial variations in field measurements of broadband albedo as related to the ground cover and under a range of...

  6. Mathematical Understanding and Proving Abilities: Experiment With Undergraduate Student By Using Modified Moore Learning Approach

    Directory of Open Access Journals (Sweden)

    Rippi Maya

    2011-07-01

    Full Text Available This paper reports findings of  a  post test experimental control group design conducted to investigate the role of modified Moore learning approach  on improving students’ mathematical understanding and proving abilities. Subject of study were 56 undergradute students of one state university in Bandung, who took advanced abstract algebra course. Instrument of study were a set test of mathematical understanding ability, a set test of mathematical proving ability, and a set of students’ opinion scale on modified Moore learning approach. Data were analyzed by using two path ANOVA. The study found that proof construction process was more difficult than mathematical understanding  task  for all students, and students still posed some difficulties on constructing mathematical proof task.  The study also found there were not differences  between students’  abilities on mathematical understanding and on proving abilities of  the both classes, and both abilities were classified as mediocre. However, in modified Moore learning approach class there were more students who got above average grades on mathematical understanding than those of conventional class. Moreover, students performed positive  opinion toward  modified Moore learning approach. They  were  active in questioning and solving problems, and in explaining their works in front of class as well, while students of conventional teaching prefered to listen to lecturer’s explanation. The study also found that there was no interaction between learning approach and students’ prior mathematics ability on mathematical understanding and proving abilities,  but  there were  quite strong  association between students’ mathematical understanding and proving abilities.Keywords:  modified Moore learning approach, mathematical understanding ability, mathematical proving ability. DOI: http://dx.doi.org/10.22342/jme.2.2.751.231-250

  7. Proof and Proving: Logic, Impasses, and the Relationship to Problem Solving

    Science.gov (United States)

    Savic, Milos

    2012-01-01

    Becoming a skillful prover is critical for success in advanced undergraduate and graduate mathematics courses. In this dissertation, I report my investigations of proof and the proving process in three separate studies. In the first study, I examined the amount of logic used in student-constructed proofs to help in the design of…

  8. Centrifugal stretching along the ground state band of 168Hf

    International Nuclear Information System (INIS)

    Costin, A.; Pietralla, N.; Reese, M.; Moeller, O.; Ai, H.; Casten, R. F.; Heinz, A.; McCutchan, E. A.; Meyer, D. A.; Qian, J.; Werner, V.; Dusling, K.; Fitzpatrick, C. R.; Guerdal, G.; Petkov, P.; Rainovski, G.

    2009-01-01

    The lifetimes of the J π =4 + , 6 + , 8 + , and 10 + levels along the ground state band in 168 Hf were measured by means of the recoil distance Doppler shift (RDDS) method using the New Yale Plunger Device (NYPD) and the SPEEDY detection array at Wright Nuclear Structure Laboratory of Yale University. Excited states in 168 Hf were populated using the 124 Sn( 48 Ti,4n) fusion evaporation reaction. The new lifetime values are sufficiently precise to clearly prove the increase of quadrupole deformation as a function of angular momentum in the deformed nucleus 168 Hf. The data agree with the predictions from the geometrical confined β-soft (CBS) rotor model that involves centrifugal stretching in a soft potential

  9. Status of the Correlation Process of the V-HAB Simulation with Ground Tests and ISS Telemetry Data

    Science.gov (United States)

    Ploetner, P.; Roth, C.; Zhukov, A.; Czupalla, M.; Anderson, M.; Ewert, M.

    2013-01-01

    The Virtual Habitat (V-HAB) is a dynamic Life Support System (LSS) simulation, created for investigation of future human spaceflight missions. It provides the capability to optimize LSS during early design phases. The focal point of the paper is the correlation and validation of V-HAB against ground test and flight data. In order to utilize V-HAB to design an Environmental Control and Life Support System (ECLSS) it is important to know the accuracy of simulations, strengths and weaknesses. Therefore, simulations of real systems are essential. The modeling of the International Space Station (ISS) ECLSS in terms of single technologies as well as an integrated system and correlation against ground and flight test data is described. The results of the simulations make it possible to prove the approach taken by V-HAB.

  10. 76 FR 22938 - Submission for Review: RI 25-37, Evidence To Prove Dependency of a Child

    Science.gov (United States)

    2011-04-25

    ... OFFICE OF PERSONNEL MANAGEMENT Submission for Review: RI 25-37, Evidence To Prove Dependency of a..., Evidence to Prove Dependency of a Child. As required by the Paperwork Reduction Act of 1995 (Pub. L. 104-13... Dependency of a Child, is designed to collect sufficient information for the Office of Personnel Management...

  11. Formal Analysis of Soft Errors using Theorem Proving

    Directory of Open Access Journals (Sweden)

    Sofiène Tahar

    2013-07-01

    Full Text Available Modeling and analysis of soft errors in electronic circuits has traditionally been done using computer simulations. Computer simulations cannot guarantee correctness of analysis because they utilize approximate real number representations and pseudo random numbers in the analysis and thus are not well suited for analyzing safety-critical applications. In this paper, we present a higher-order logic theorem proving based method for modeling and analysis of soft errors in electronic circuits. Our developed infrastructure includes formalized continuous random variable pairs, their Cumulative Distribution Function (CDF properties and independent standard uniform and Gaussian random variables. We illustrate the usefulness of our approach by modeling and analyzing soft errors in commonly used dynamic random access memory sense amplifier circuits.

  12. The Relationship between an Emerging Grounded Theory and the Existing Literature: Four phases for consideration

    Directory of Open Access Journals (Sweden)

    Vivian B. Martin, Ph.D.

    2006-06-01

    Full Text Available The relationship between grounded theory researchers and the existing literature has become a red herring that even confuses some grounded theorists who have completed a study. Antoinette McCallin’s essay does a commendable job outlining the realities of the research terrain that make proceeding without some exposure to the literature unlikely and ill-advised in most situations. When embarking on my dissertation, I needed to know enough about the literature, both substantive and methodological, to argue for the use of classic grounded theory as opposed to many other choices within my field; yet my study benefited from the necessary tensions between the emerging grounded theory and the existing literature. In this brief essay I propose that the relationship between the existing literature and a developing grounded theory project goes through four discernible phases:noncommittal, comparative, integrative, and, if the analyst can push, a transcendent phase in which the theory is not simply one of a number of theories of a kind within the discipline’s literature. I explain the phases to make more explicit the under-recognized subversive potential of grounded theory to push pass disciplinary boundaries by broadening the ‘relevant’ literature. Barney Glaser has often admonished grounded theory researchers to put off the literature to avoid wasting time and energy with literature that may prove irrelevant. I have not found such literature to be irrelevant as much as limited, and in some cases restricted by what a particular discipline defines as the appropriate literature. Therefore, the question of what literature offers possibilities for literature review and comparisons that would allow for richer knowledge generation. I return to this matter toward the end of the essay.

  13. Traditional behaviour and fidelity to caribou calving grounds by barren-ground caribou

    Directory of Open Access Journals (Sweden)

    Anne Gunn

    1986-06-01

    Full Text Available Evidence for the fidelity of female barren-ground caribou (Rangifer tarandus spp. of each herd to specific calving grounds is convincing. Involvement of learned behaviour in the annual return of those cows to the same calving grounds implies such actions are a form of «traditional» behaviour. Even wide variations in population size have not yet knowingly led to marked changes in size or location of calving grounds or prolonged abandonment of established ones. Rarely is the adoption of new calving grounds reported and emigration to another herd's calving ground or interchange between calving grounds has not yet been unequivocally documented. The calving experience of individual caribou and environmental pressures may modify the cow's use patterns of her calving grounds. The current definition of herds based on traditional calving grounds may require modification, if increasing caribou numbers result in changes in traditions. However, current data do not contradict either the fidelity to traditional calving grounds or the concept of herd identity based on that fidelity.

  14. The influence of a vertical ground heat exchanger length on the electricity consumption of the heat pumps

    Energy Technology Data Exchange (ETDEWEB)

    Michopoulos, A.; Kyriakis, N. [Process Equipment Design Laboratory, Mechanical Engineer Department, Aristotle University of Thessaloniki (AUTh), P.O. Box 487, 541 24 Thessaloniki (Greece)

    2010-07-15

    The use of heat pumps combined with vertical ground heat exchangers for heating and cooling of buildings, has significantly gained popularity in recent years. The design method for these systems, as it is proposed by ASHRAE, is taking into account the maximum thermal and cooling loads of the building, the thermophysical properties of the soil at the area of installation and a minimum Coefficient of Performance (COP) of the heat pumps. This approach usually results in larger than needed length of the ground heat exchanger, thus increasing the installation cost. A new analytical simulation tool, capable to determine the required ground heat exchanger length has been developed at the Process Equipment Design Laboratory (PEDL) of the AUTh. It models the function of the system as a whole over long time periods, e.g. 20 years, using as input parameters the thermal and cooling loads of the building, the thermophysical properties of the borehole and the characteristic curves of the heat pumps. The results include the electricity consumption of the heat pumps and the heat absorbed from or rejected to the ground. The aim of this paper is to describe the developed simulation algorithm and present the results of such a simulation in a case study. It is proved that the total required length of the ground heat exchanger is less than that calculated using the common numerical method. (author)

  15. Ground State Solutions for a Class of Fractional Differential Equations with Dirichlet Boundary Value Condition

    Directory of Open Access Journals (Sweden)

    Zhigang Hu

    2014-01-01

    Full Text Available In this paper, we apply the method of the Nehari manifold to study the fractional differential equation (d/dt((1/2 0Dt-β(u′(t+(1/2 tDT-β(u′(t=  f(t,u(t, a.e. t∈[0,T], and u0=uT=0, where  0Dt-β, tDT-β are the left and right Riemann-Liouville fractional integrals of order 0≤β<1, respectively. We prove the existence of a ground state solution of the boundary value problem.

  16. Ground-water elements of in situ leach mining of uranium. Final report

    International Nuclear Information System (INIS)

    Thompson, W.E.; Swarzenski, W.V.; Warner, D.L.; Rouse, G.E.; Carrington, O.F.; Pyrih, R.Z.

    1978-07-01

    This report provides methods to collect data and evaluates impacts concerning ground-water elements of production-scale leach mining of uranium. Two overlapping networks of monitor wells are designed to collect premining hydrogeologic and baseline water-quality data and to detect excursions of leaching fluids. The pre-mining data collection network consists of 24 wells completed into the ore-zone aquifer and the water-bearing units above and below it. The excursion-monitor network utilizes two rings of wells encircling the ore body and other wells strategically placed into other water-bearing units. The lateral excursion detection system is keyed to changes in water levels whereas the vertical excursion detection system is keyed to changes in water quality. Several ground-water restoration methods are evaluated. Mechanical and chemical restoration methods can significantly remove most introduced and mobilized chemicals. Natural geochemical mechanisms should be capable of causing water-quality improvement. Several water-quality constituents, i.e., ammonia, chloride, sulfate, may not be greatly affected by restoration efforts. Most mining and restoration activities should not greatly affect the availability or usefulness of ground water unless uncontrolled withdrawals from many sources occur. Disposal of leach mining wastes may prove a greater threat to the environment than the mining. Natural conditions and/or current state and Federal regulations limit the types of disposal methods that may be used

  17. Proving Test on the Reliability for Reactor Containment Vessel

    International Nuclear Information System (INIS)

    Takumi, K.; Nonaka, A.

    1988-01-01

    NUPEC (Nuclear Power Engineering Test Center) has started an eight-year project of Proving Test on the Reliability for Reactor Containment Vessel since June 1987. The objective of this project is to confirm the integrity of containment vessels under severe accident conditions. This paper shows the outline of this project. The test Items are (1) Hydrogen mixing and distribution test, (2) Hydrogen burning test, (3) Iodine trapping characteristics test, and (4) Structural behavior test. Based on the test results, computer codes are verified and as the results of analysis and evaluation by the computer codes, containment integrity is to be confirmed

  18. On proving confluence modulo equivalence for Constraint Handling Rules

    DEFF Research Database (Denmark)

    Christiansen, Henning; Kirkeby, Maja Hanne

    2017-01-01

    -logical built-in predicates such as var/1 and incomplete ones such as is/2, that are ignored in previous work on confluence. To this end, a new operational semantics for CHR is developed which includes such predicates. In addition, this semantics differs from earlier approaches by its simplicity without loss......Previous results on proving confluence for Constraint Handling Rules are extended in two ways in order to allow a larger and more realistic class of CHR programs to be considered confluent. Firstly, we introduce the relaxed notion of confluence modulo equivalence into the context of CHR: while...

  19. PROVE Land Cover and Leaf Area of Jornada Experimental Range, New Mexico, 1997

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: Field measurement of shrubland ecological properties is important for both site monitoring and validation of remote-sensing information. During the PROVE...

  20. PROVE Land Cover and Leaf Area of Jornada Experimental Range, New Mexico, 1997

    Data.gov (United States)

    National Aeronautics and Space Administration — Field measurement of shrubland ecological properties is important for both site monitoring and validation of remote-sensing information. During the PROVE exercise on...

  1. A study on uranium metallogenetic prospects of ground water oxidation zone type in the lower cretaceous, north Shanganning basin

    International Nuclear Information System (INIS)

    Wang Jinping

    2000-01-01

    Lower Cretaceous is developed well in the north part of Shanganning basin. The area was widely uplifting vertically after their deposited. Based on the features of lithology, lithophase and Neotectonic forms, two main periods of oxidation-erosion of K2-E1 and N1-present can be distinguished. During these two periods, large scale horizontal oxidation were occurred. It is significant that the ground water oxidation related to the uranium mineralization and has been proved by the field investigation and the data of γ-logging in drill hole for oil. Meanwhile, according to the hydrodynamic features of present Shanganning plateau type artesian basin, it seems that uranium mineralization main related to the ground water oxidation the upper parts of the Lower Cretaceous

  2. Grounded understanding of abstract concepts: The case of STEM learning.

    Science.gov (United States)

    Hayes, Justin C; Kraemer, David J M

    2017-01-01

    Characterizing the neural implementation of abstract conceptual representations has long been a contentious topic in cognitive science. At the heart of the debate is whether the "sensorimotor" machinery of the brain plays a central role in representing concepts, or whether the involvement of these perceptual and motor regions is merely peripheral or epiphenomenal. The domain of science, technology, engineering, and mathematics (STEM) learning provides an important proving ground for sensorimotor (or grounded) theories of cognition, as concepts in science and engineering courses are often taught through laboratory-based and other hands-on methodologies. In this review of the literature, we examine evidence suggesting that sensorimotor processes strengthen learning associated with the abstract concepts central to STEM pedagogy. After considering how contemporary theories have defined abstraction in the context of semantic knowledge, we propose our own explanation for how body-centered information, as computed in sensorimotor brain regions and visuomotor association cortex, can form a useful foundation upon which to build an understanding of abstract scientific concepts, such as mechanical force. Drawing from theories in cognitive neuroscience, we then explore models elucidating the neural mechanisms involved in grounding intangible concepts, including Hebbian learning, predictive coding, and neuronal recycling. Empirical data on STEM learning through hands-on instruction are considered in light of these neural models. We conclude the review by proposing three distinct ways in which the field of cognitive neuroscience can contribute to STEM learning by bolstering our understanding of how the brain instantiates abstract concepts in an embodied fashion.

  3. On the role of the ground state Tb(3)/acetylacetone complex in sensitized emission of Tb(3) in ethanol solution

    International Nuclear Information System (INIS)

    Lis, S.; Elbanowski, M.; Marciniak, B.

    1989-01-01

    The Tb(3)-acetylacetone system in ethanol solution has been studied by spectroscopic methods. The formation of a Tb(3)/acetylacetone (1:1) complex in the ground state has been proved and its stability constant determined, K = (0,97 ± 0,06).10 4 dm 3 mol -1 . The role of this complex in the spectrofluorimetric determination of Ln(3) ions in the presence of acetylacetone has been discussed. (Authors)

  4. Positive ground state solutions to Schrodinger-Poisson systems with a negative non-local term

    Directory of Open Access Journals (Sweden)

    Yan-Ping Gao

    2015-04-01

    Full Text Available In this article, we study the Schrodinger-Poisson system $$\\displaylines{ -\\Delta u+u-\\lambda K(x\\phi(xu=a(x|u|^{p-1}u, \\quad x\\in\\mathbb{R}^3, \\cr -\\Delta\\phi=K(xu^{2},\\quad x\\in\\mathbb{R}^3, }$$ with $p\\in(1,5$. Assume that $a:\\mathbb{R}^3\\to \\mathbb{R^{+}}$ and $K:\\mathbb{R}^3\\to \\mathbb{R^{+}}$ are nonnegative functions and satisfy suitable assumptions, but not requiring any symmetry property on them, we prove the existence of a positive ground state solution resolved by the variational methods.

  5. Proving termination of graph transformation systems using weighted type graphs over semirings

    NARCIS (Netherlands)

    Bruggink, H.J.S.; König, B.; Nolte, D.; Zantema, H.; Parisi-Presicce, F.; Westfechtel, B.

    2015-01-01

    We introduce techniques for proving uniform termination of graph transformation systems, based on matrix interpretations for string rewriting. We generalize this technique by adapting it to graph rewriting instead of string rewriting and by generalizing to ordered semirings. In this way we obtain a

  6. Human genetics after the bomb: Archives, clinics, proving grounds and board rooms.

    Science.gov (United States)

    Lindee, Susan

    2016-02-01

    In this paper I track the history of post-1945 human genetics and genomics emphasizing the importance of ideas about risk to the scientific study and medical management of human heredity. Drawing on my own scholarship as it is refracted through important new work by other scholars both junior and senior, I explore how radiation risk and then later disease risk mattered to the development of genetics and genomics, particularly in the United States. In this context I excavate one of the central ironies of post-war human genetics: while studies of DNA as the origin and cause of diseases have been lavishly supported by public institutions and private investment around the world, the day-to-day labor of intensive clinical innovation has played a far more important role in the actual human experience of genetic disease and genetic risk for affected families. This has implications for the archival record, where clinical interactions are less readily accessible to historians. This paper then suggests that modern genomics grew out of radiation risk; that it was and remains a risk assessment science; that it is temporally embedded as a form of both prediction and historical reconstruction; and that it has become a big business focused more on risk and prediction (which can be readily marketed) than on effective clinical intervention. Copyright © 2015 Elsevier Ltd. All rights reserved.

  7. [Cytogenetic effects in Koeleria gracilis Pers. populations from the Semipalatinsk proving ground].

    Science.gov (United States)

    Geras'kin, S A; Mozolin, E M; Dikarev, V G; Udalova, A A; Dikareva, N S; Spiridonov, S I; Teten'kin, V L

    2009-01-01

    The proliferative activity and the frequency of cytogenetic disturbances in apical meristem of coleoptile sprouts at germination of seeds collected from crested hairgrass populations inhabiting contrast in level of radioactive contamination sites of the Semipalatinsk test site (Kazakhstan) are studied. Sampling of biological material and soil was carrying out during three years (2005-2007). The absorbed dose to critical organs of crested hairgrass vary depending on a site from 2.8 up to 262.2 mGy/year. A sognificant correlation between the frequency of cytogenetic disturbances in apical meristem and dose absorbed in crested hairgrass critical organs is found. Devere aberrations such as single and double bridges make the main contribution to spectrum of structural mutations as well as lagging chromosomes. In spite of the fact that the crested hairgrass populations have occupied the sites with a high level of radioactive contamination for a long time, the data analysis fails to reveal radio-adaptation effect.

  8. Civilian Talent Management: A Proposed Approach for the Aberdeen Proving Ground Workforce

    Science.gov (United States)

    2010-04-01

    in the critical skills necessary for effective oversight . For example, over the past 10 years, the Department’s contractual obligations have nearly...managers—to conduct effective oversight (Department of Defense Quadrennial Defense Review Report, February 10, 2010, p. 76). This was also a key concern...policy so that older workers will not feel compelled to retire as soon as they are eligible. Concepts such as flextime, part-time, telecommuting , and

  9. Users manual on database of the Piping Reliability Proving Tests at the Japan Atomic Energy Research Institute

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-09-01

    Japan Atomic Energy Research Institute(JAERI) conducted Piping Reliability Proving Tests from 1975 to 1992 based upon the contracts between JAERI and Science and Technology Agency of Japan under the auspices of the special account law for electric power development promotion. The purposes of those tests are to prove the structural reliability of the primary cooling piping constituting a part of the pressure boundary in the water reactor power plants. The tests with large experimental facilities had ended already in 1990. After that piping reliability analysis by the probabilistic method followed until 1992. This report describes the users manual on databases about the test results using the large experimental facilities. Objectives of the piping reliability proving tests are to prove that the primary piping of the water reactor (1) be reliable throughout the service period, (2) have no possibility of rupture, (3) bring no detrimental influence on the surrounding instrumentations or equipments near the break location. The research activities using large scale piping test facilities are described. The present report does the database about the test results pairing the former report. With these two reports, all the feature of Piping Reliability Proving Tests is made clear. Briefings of the tests are described also written in Japanese or English. (author)

  10. Source, propagation and site effects: impact on mapping strong ground motion in Bucharest area

    International Nuclear Information System (INIS)

    Radulian, R.; Kuznetsov, I.; Panza, G.F.

    2004-01-01

    Achievements in the framework of the NATO SfP project 972266 focused on the impact of Vrancea earthquakes on the security of Bucharest urban area are presented. The problem of Bucharest city security to Vrancea earthquakes is discussed in terms of numerical modelling of seismic motion and intermediate term earthquake prediction. A hybrid numerical scheme developed by Faeh et al. (1990; 1993) for frequencies up to 1 Hz is applied for the realistic modelling of the seismic ground motion in Bucharest. The method combines the modal summation for the 1D bedrock model and the finite differences for the 2D local structure model. All the factors controlling the ground motion at the site are considered: source, propagation and site effects, respectively. The input data includes the recent records provided by the digital accelerometer network developed within the Romanian-German CRC461 cooperation programme and CALIXTO'99, VRANCEA'99, VRANCEA2001 experiments. The numerical simulation proves to be a powerful tool in mapping the strong ground motion for realistic structures, reproducing acceptably from engineering point of view the observations. A new model of the Vrancea earthquake scaling is obtained and implications for the determination of the seismic motion parameters are analyzed. The role of the focal mechanism and attenuation properties upon the amplitude and spectral content of the ground motion are outlined. CN algorithm is applied for predicting Vrancea earthquakes. Finally, implications for the disaster management strategy are discussed. (authors)

  11. Examining a link between SPEs and ground level radiation

    Science.gov (United States)

    Overholt, Andrew

    2015-01-01

    Researchers have previously found a correlation between solar proton events (SPEs) and congenital malformations (CMs). A similar correlation has also been found between long term solar variability and CMs. We examine the ionizing radiation dose from these events as well as the largest events on record to determine whether these events are capable of producing these effects. We show that the total ionizing radiation dose (consisting of neutrons and muons) at ground level is insufficient for production of the observed increases in CM rate under the current paradigm regarding ionizing radiation from muons and neutrons. Current research on the subject shows that our assumptions regarding muonic ionizing radiation may be underestimating their biologic effect. We recommend further experimentation regarding the radiation dose due to muons, as this may prove to be a more substantial contribution to our radiation environment than previously assumed.

  12. A Review of Ground Target Detection and Classification Techniques in Forward Scattering Radars

    Directory of Open Access Journals (Sweden)

    M. E. A. Kanona

    2018-06-01

    Full Text Available This paper presents a review of target detection and classification in forward scattering radar (FSR which is a special state of bistatic radars, designed to detect and track moving targets in the narrow region along the transmitter-receiver base line. FSR has advantages and incredible features over other types of radar configurations. All previous studies proved that FSR can be used as an alternative system for ground target detection and classification. The radar and FSR fundamentals were addressed and classification algorithms and techniques were debated. On the other hand, the current and future applications and the limitations of FSR were discussed.

  13. Case report 486: Spondyloepiphyseal dysplasia tarda (SDT) (presumptively proved)

    International Nuclear Information System (INIS)

    Brown, D.D.; Childress, M.H.

    1988-01-01

    A 51 year old man with severe degenerative joint disease, short stature, barrel chest deformity, platyspondyly, a narrow pelvis, small iliac bones, dysplastic femoral heads and necks, notching of the patellae and flattening of the femoral intercondylar notches has been described as an example of Spondyloepiphyseal dysplasia tarda SDT. The entity was discussed in detail. The notching of the patellae has not been reported in association with SDT to the authors' knowledge. Characteristic features of SDT allow it to be differentiated from other arthropathies and dysplasias and these distinctions have been emphasized in the discussion. The diagnosis in this case can only be considered presumptively proved. (orig./MG)

  14. GROUNDED THEORY METHODOLOGY and GROUNDED THEORY RESEARCH in TURKEY

    OpenAIRE

    ARIK, Ferhat; ARIK, Işıl Avşar

    2016-01-01

    This research discusses the historical development of the Grounded Theory Methodology, which is one of the qualitative research method, its transformation over time and how it is used as a methodology in Turkey. The Grounded Theory which was founded by Strauss and Glaser, is a qualitative methodology based on inductive logic to discover theories in contrast with the deductive understanding which is based on testing an existing theory in sociology. It is possible to examine the Grounded Theory...

  15. ESTIMATION OF THE INFLUENCE OF FARM INFRASTRUCTURE ON THE POLLUTION OF GROUND WATER

    Directory of Open Access Journals (Sweden)

    Tadeusz Durkowski

    2016-02-01

    Full Text Available In farm areas, evacuations of animal excrements (manure, liquid manure, slurry and domestic sewage are most dangerous for pure groundwater . For betterment sanitary condition villages and pure waters in their area will be a necessity of right infrastructure and good condition (sewers, water treatments and proper animal excrements management. Research conducted in 2001–2011 in six farms located in the area of a few villages in the basin of Miedwie lake. Researches points were placed (piezometer and wells in the area of these farms. High concentration of NH4+, NO3- and PO43- were found in a ground water which are exposed to contact inflow of pollutant from farms areas, and sources which are occurred in outlying from the source of pollutants. Also water from a farm wells, which are periodically used, manifested the presence of large chemical elements concentration, especially NO3- and PO43-, what proves a constant inflow of pollutants. For monitoring ground water in samples we marked the concentration of NH4+, NO3- i PO43- and pH.

  16. ESTIMATION OF THE INFLUENCE OF FARM INFRASTRUCTURE ON THE POLLUTION OF GROUND WATER

    Directory of Open Access Journals (Sweden)

    Tadeusz Durkowski

    2015-11-01

    Full Text Available In farm areas, evacuations of animal excrements (manure, liquid manure, slurry and domestic sewage are most dangerous for pure groundwater. For betterment sanitary condition villages and pure waters in their area will be necessity of right infrastructure and good condition (canalization, water treatments and proper animal excrements management. Researches conducted in 2001–2011 years in six farms located in the area of a few villages in the basin of Miedwie lake. Researches points were put (piezometer and wells in the area of these farms. High concentration of NH4+, NO3- and PO43- were found in ground water which is exposed to contact inflow of pollutant from farms areas, and sources which are occurred in outlying from a source of pollutants. Also water from a farm wells, which are periodically used, showed the presence of large concentrations of chemical elements especially NO3- and PO43- what proves constant inflow of pollutants. For monitoring ground water we marked concentration of NH4+, NO3- i PO43- and pH in the samples.

  17. The installation of a multiport ground-water sampling system in the 300 Area

    International Nuclear Information System (INIS)

    Gilmore, T.J.

    1989-06-01

    In 1988, the Pacific Northwest Laboratory installed a multiport groundwater sampling system in well 399-1-20, drilled north of the 300 Area on the Hanford Site in southwestern Washington State. The purpose of installing the multiport system is to evaluate methods of determining the vertical distribution of contaminants and hydraulic heads in ground water. Well 399-1-20 is adjacent to a cluster of four Resource Conservation and Recovery Act (RCRA) ground-water monitoring wells. This proximity makes it possible to compare sampling intervals and head measurements between the multiport system and the RCRA monitoring wells. Drilling and installation of the multiport system took 42 working days. Six sampling ports were installed in the upper unconfined aquifer at depths of approximately 120, 103, 86, 74, 56, and 44 feet. The locations of the sampling ports were determined by the hydrogeology of the area and the screened intervals of adjacent ground-water monitoring wells. The system was installed by backfilling sand around the sampling ports and isolating the ports with bentonite seals. The method proved adequate. For future installation, however, development and evaluation of an alternative method is recommended. In the alternative method suggested, the multiport system would be placed inside a cased and screened well, using packers to isolate the sampling zones. 4 refs., 8 figs., 1 tab

  18. Com aplicar les proves paramètriques bivariades t de Student i ANOVA en SPSS. Cas pràctic

    Directory of Open Access Journals (Sweden)

    María-José Rubio-Hurtado

    2012-07-01

    Full Text Available Les proves paramètriques són un tipus de proves de significació estadística que quantifiquen l'associació o independència entre una variable quantitativa i una categòrica. Les proves paramètriques són exigents amb certs requisits previs per a la seva aplicació: la distribució Normal de la variable quantitativa en els grups que es comparen, l'homogeneïtat de variàncies en les poblacions de les quals procedeixen els grups i una n mostral no inferior a 30. El seu no compliment comporta la necessitat de recórrer a proves estadístiques no paramètriques. Les proves paramètriques es classifiquen en dos: prova t (per a una mostra o per a dues mostres relacionades o independents i prova ANOVA (per a més de dues mostres independents.

  19. Grounding-Induced Sectional Forces and Residual Strength of Grounded Ship Hulls

    DEFF Research Database (Denmark)

    Paik, Jeom Kee; Pedersen, Preben Terndrup

    1996-01-01

    The aim of the present study is to determine the sectional forces induced by ship grounding and also to assess the residual strength of groundedship hulls. An analytical approach is used to estimate the grounding-induced sectional forces of ships. The extent and location of structural damage due...... to grounding is defined based on the ABS Safe Hull guide. The residual strength of damaged hulls is calculated by using a simple analytical formula. The method is applied to residual strength assessment of a damaged double hull tanker of 38,400 dwt due to grounding....

  20. Constructivist Grounded Theory?

    Directory of Open Access Journals (Sweden)

    Barney G. Glaser, PhD, Hon. PhD

    2012-06-01

    Full Text Available AbstractI refer to and use as scholarly inspiration Charmaz’s excellent article on constructivist grounded theory as a tool of getting to the fundamental issues on why grounded theory is not constructivist. I show that constructivist data, if it exists at all, is a very, very small part of the data that grounded theory uses.

  1. A Hybrid Approach to Proving Memory Reference Monotonicity

    KAUST Repository

    Oancea, Cosmin E.

    2013-01-01

    Array references indexed by non-linear expressions or subscript arrays represent a major obstacle to compiler analysis and to automatic parallelization. Most previous proposed solutions either enhance the static analysis repertoire to recognize more patterns, to infer array-value properties, and to refine the mathematical support, or apply expensive run time analysis of memory reference traces to disambiguate these accesses. This paper presents an automated solution based on static construction of access summaries, in which the reference non-linearity problem can be solved for a large number of reference patterns by extracting arbitrarily-shaped predicates that can (in)validate the reference monotonicity property and thus (dis)prove loop independence. Experiments on six benchmarks show that our general technique for dynamic validation of the monotonicity property can cover a large class of codes, incurs minimal run-time overhead and obtains good speedups. © 2013 Springer-Verlag.

  2. Main: 2AAK [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available Molecule: Ubiquitin Conjugating Enzyme; Chain: Null; Synonym: Ubc1; Engineered: Yes Ubiquitin Conjugation 6....TPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMYSESKREYNRRVRDVVEQSWTAD arabi_2AAK.jpg ...

  3. Ground water and energy

    Energy Technology Data Exchange (ETDEWEB)

    1980-11-01

    This national workshop on ground water and energy was conceived by the US Department of Energy's Office of Environmental Assessments. Generally, OEA needed to know what data are available on ground water, what information is still needed, and how DOE can best utilize what has already been learned. The workshop focussed on three areas: (1) ground water supply; (2) conflicts and barriers to ground water use; and (3) alternatives or solutions to the various issues relating to ground water. (ACR)

  4. Rigour and grounded theory.

    Science.gov (United States)

    Cooney, Adeline

    2011-01-01

    This paper explores ways to enhance and demonstrate rigour in a grounded theory study. Grounded theory is sometimes criticised for a lack of rigour. Beck (1993) identified credibility, auditability and fittingness as the main standards of rigour for qualitative research methods. These criteria were evaluated for applicability to a Straussian grounded theory study and expanded or refocused where necessary. The author uses a Straussian grounded theory study (Cooney, In press) to examine how the revised criteria can be applied when conducting a grounded theory study. Strauss and Corbin (1998b) criteria for judging the adequacy of a grounded theory were examined in the context of the wider literature examining rigour in qualitative research studies in general and grounded theory studies in particular. A literature search for 'rigour' and 'grounded theory' was carried out to support this analysis. Criteria are suggested for enhancing and demonstrating the rigour of a Straussian grounded theory study. These include: cross-checking emerging concepts against participants' meanings, asking experts if the theory 'fit' their experiences, and recording detailed memos outlining all analytical and sampling decisions. IMPLICATIONS FOR RESEARCH PRACTICE: The criteria identified have been expressed as questions to enable novice researchers to audit the extent to which they are demonstrating rigour when writing up their studies. However, it should not be forgotten that rigour is built into the grounded theory method through the inductive-deductive cycle of theory generation. Care in applying the grounded theory methodology correctly is the single most important factor in ensuring rigour.

  5. Grounding of SNS Accelerator Structure

    CERN Document Server

    Holik, Paul S

    2005-01-01

    Description of site general grounding network. RF grounding network enhancement underneath the klystron gallery building. Grounding network of the Ring Systems with ground breaks in the Ring Tunnel. Grounding and Bonding of R&D accelerator equipment. SNS Building lightning protection.

  6. Reasoning by analogy as an aid to heuristic theorem proving.

    Science.gov (United States)

    Kling, R. E.

    1972-01-01

    When heuristic problem-solving programs are faced with large data bases that contain numbers of facts far in excess of those needed to solve any particular problem, their performance rapidly deteriorates. In this paper, the correspondence between a new unsolved problem and a previously solved analogous problem is computed and invoked to tailor large data bases to manageable sizes. This paper outlines the design of an algorithm for generating and exploiting analogies between theorems posed to a resolution-logic system. These algorithms are believed to be the first computationally feasible development of reasoning by analogy to be applied to heuristic theorem proving.

  7. Jung's equation of the ground of being with the ground of psyche.

    Science.gov (United States)

    Dourley, John

    2011-09-01

    The paper amplifies Jung's psychology of ground associated with the culmination of the alchemical process in the unus mundus. It argues that Jung and Dorn identify the experience of the ground with the experience of divinity as the common originary source of individual and totality. It notes the monistic and pantheistic implications of the experience and goes on to amplify the experience through Eckhart's mediaeval mysticism of ground and Paul Tillich's modern philosophical/theological understanding of ground. It concludes that the Jung/Dorn psychological understanding of ground supersedes monotheistic consciousness. Their vision supports the emergence of a societal myth based on the identification of the ground as the source of all divinities and faith in them. This source currently urges a mythic consciousness that would surpass its past and current concretions and so alleviate the threat that monotheistic consciousness in any domain now poses to human survival. © 2011, The Society of Analytical Psychology.

  8. Non-degenerated Ground States and Low-degenerated Excited States in the Antiferromagnetic Ising Model on Triangulations

    Science.gov (United States)

    Jiménez, Andrea

    2014-02-01

    We study the unexpected asymptotic behavior of the degeneracy of the first few energy levels in the antiferromagnetic Ising model on triangulations of closed Riemann surfaces. There are strong mathematical and physical reasons to expect that the number of ground states (i.e., degeneracy) of the antiferromagnetic Ising model on the triangulations of a fixed closed Riemann surface is exponential in the number of vertices. In the set of plane triangulations, the degeneracy equals the number of perfect matchings of the geometric duals, and thus it is exponential by a recent result of Chudnovsky and Seymour. From the physics point of view, antiferromagnetic triangulations are geometrically frustrated systems, and in such systems exponential degeneracy is predicted. We present results that contradict these predictions. We prove that for each closed Riemann surface S of positive genus, there are sequences of triangulations of S with exactly one ground state. One possible explanation of this phenomenon is that exponential degeneracy would be found in the excited states with energy close to the ground state energy. However, as our second result, we show the existence of a sequence of triangulations of a closed Riemann surface of genus 10 with exactly one ground state such that the degeneracy of each of the 1st, 2nd, 3rd and 4th excited energy levels belongs to O( n), O( n 2), O( n 3) and O( n 4), respectively.

  9. Ground Water in the Anchorage Area, Alaska--Meeting the Challenges of Ground-Water Sustainability

    Science.gov (United States)

    Moran, Edward H.; Galloway, Devin L.

    2006-01-01

    Ground water is an important component of Anchorage's water supply. During the 1970s and early 80s when ground water extracted from aquifers near Ship Creek was the principal source of supply, area-wide declines in ground-water levels resulted in near record low streamflows in Ship Creek. Since the importation of Eklutna Lake water in the late 1980s, ground-water use has been reduced and ground water has contributed 14-30 percent of the annual supply. As Anchorage grows, given the current constraints on the Eklutna Lake water availability, the increasing demand for water could place an increasing reliance on local ground-water resources. The sustainability of Anchorage's ground-water resources challenges stakeholders to develop a comprehensive water-resources management strategy.

  10. Identifying natural and anthropogenically-induced geohazards from satellite ground motion and geospatial data: Stoke-on-Trent, UK

    Science.gov (United States)

    Jordan, Hannah; Cigna, Francesca; Bateson, Luke

    2017-12-01

    identify especially rapid ground motion. As a consequence the supporting geospatial data proved especially useful for the identification of landslides and some areas of ground dissolution. The mapped areas of instability are also compared with modelled potential geohazards (the BGS GeoSure dataset).

  11. [Introduction to grounded theory].

    Science.gov (United States)

    Wang, Shou-Yu; Windsor, Carol; Yates, Patsy

    2012-02-01

    Grounded theory, first developed by Glaser and Strauss in the 1960s, was introduced into nursing education as a distinct research methodology in the 1970s. The theory is grounded in a critique of the dominant contemporary approach to social inquiry, which imposed "enduring" theoretical propositions onto study data. Rather than starting from a set theoretical framework, grounded theory relies on researchers distinguishing meaningful constructs from generated data and then identifying an appropriate theory. Grounded theory is thus particularly useful in investigating complex issues and behaviours not previously addressed and concepts and relationships in particular populations or places that are still undeveloped or weakly connected. Grounded theory data analysis processes include open, axial and selective coding levels. The purpose of this article was to explore the grounded theory research process and provide an initial understanding of this methodology.

  12. Parkinson's Disease Videos

    Medline Plus

    Full Text Available ... Spouse About Sexual Dysfunction? Attachment: consultation.jpg OHSU - Therapeutic Approaches for PD: Depression, Anxiety & Psychosis CareMAP: Travel and Transportation: Part 2 ...

  13. The Grounded Theory Bookshelf

    Directory of Open Access Journals (Sweden)

    Dr. Alvita Nathaniel, DSN, APRN, BC

    2005-06-01

    Full Text Available The Grounded Theory Perspective III: Theoretical Coding, Barney G. Glaser (Sociology Press, 2005. Not intended for a beginner, this book further defi nes, describes, and explicates the classic grounded theory (GT method. Perspective III lays out various facets of theoretical coding as Glaser meticulously distinguishes classic GT from other subsequent methods. Developed many years after Glaser’s classic GT, these methods, particularly as described by Strauss and Corbin, adopt the grounded theory name and engender ongoing confusion about the very premises of grounded theory. Glaser distinguishes between classic GT and the adscititious methods in his writings, referring to remodeled grounded theory and its offshoots as Qualitative Data Analysis (QDA models.

  14. Stochastic ground motion simulation

    Science.gov (United States)

    Rezaeian, Sanaz; Xiaodan, Sun; Beer, Michael; Kougioumtzoglou, Ioannis A.; Patelli, Edoardo; Siu-Kui Au, Ivan

    2014-01-01

    Strong earthquake ground motion records are fundamental in engineering applications. Ground motion time series are used in response-history dynamic analysis of structural or geotechnical systems. In such analysis, the validity of predicted responses depends on the validity of the input excitations. Ground motion records are also used to develop ground motion prediction equations(GMPEs) for intensity measures such as spectral accelerations that are used in response-spectrum dynamic analysis. Despite the thousands of available strong ground motion records, there remains a shortage of records for large-magnitude earthquakes at short distances or in specific regions, as well as records that sample specific combinations of source, path, and site characteristics.

  15. Communication, concepts and grounding

    NARCIS (Netherlands)

    van der Velde, Frank; van der Velde, F.

    2015-01-01

    This article discusses the relation between communication and conceptual grounding. In the brain, neurons, circuits and brain areas are involved in the representation of a concept, grounding it in perception and action. In terms of grounding we can distinguish between communication within the brain

  16. Main: 1W0I [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available Synonym: 3-Ketoacyl-Acyl Carrier Protein Synthase, Mitochondrial Beta-Ketoacyl-Acyl Carrier Protein Synthase; Chai...VIVLEEYEHAKRRGAKIYAELCGYGMSGDAHHITQPPEDGKGAVLAMTRALRQSGLCPNQIDYVNAHATSTPIGDAVEARAI...KTVFSEHATSGTLAFSSTKGATGHLLGAAGAVEAIFSILAIHHGVAPMTLNVKNPDPIFDKRFMPLTTSKKMLVRTAMSNSFGFGGTNASLLFASI arabi_1W0I.jpg ...

  17. The ground based plan

    International Nuclear Information System (INIS)

    1989-01-01

    The paper presents a report of ''The Ground Based Plan'' of the United Kingdom Science and Engineering Research Council. The ground based plan is a plan for research in astronomy and planetary science by ground based techniques. The contents of the report contains a description of:- the scientific objectives and technical requirements (the basis for the Plan), the present organisation and funding for the ground based programme, the Plan, the main scientific features and the further objectives of the Plan. (U.K.)

  18. Visit of His Excellency Mr Juan Martabit, Ambassador, Permanent Representative of Chile to the United Nations Office in Geneva and other international organisations in Switzerland.

    CERN Multimedia

    Maximilien Brice

    2005-01-01

    Secretary-General; Mrs Juan Martabit. 0502017_07.jpg His Excellency Mr Juan Martabit, Ambassador,Permanent Representative of Chile to the United Nations Office in Geneva and other international organisations in Switzerland visiting the ATLAS building site. From left to right: Prof. Giora Mikenberg, ATLAS Collaboration; Mr Maximilian Metzger, Secretary-General and His Excellency Mr Juan Martabit. 0502017_08.jpg His Excellency Mr Juan Martabit, Ambassador,Permanent Representative of Chile to the United Nations Office in Geneva and other international organisations in Switzerland visiting the ATLAS cavern. From left to right: From left to right: Prof. Giora Mikenberg, ATLAS Collaboration; Mr Maximilian Metzger, Secretary-General; His Excellency Mr Juan Martabit and Mrs Juan Martabit.

  19. Robowell: An automated process for monitoring ground water quality using established sampling protocols

    Science.gov (United States)

    Granato, G.E.; Smith, K.P.

    1999-01-01

    Robowell is an automated process for monitoring selected ground water quality properties and constituents by pumping a well or multilevel sampler. Robowell was developed and tested to provide a cost-effective monitoring system that meets protocols expected for manual sampling. The process uses commercially available electronics, instrumentation, and hardware, so it can be configured to monitor ground water quality using the equipment, purge protocol, and monitoring well design most appropriate for the monitoring site and the contaminants of interest. A Robowell prototype was installed on a sewage treatment plant infiltration bed that overlies a well-studied unconfined sand and gravel aquifer at the Massachusetts Military Reservation, Cape Cod, Massachusetts, during a time when two distinct plumes of constituents were released. The prototype was operated from May 10 to November 13, 1996, and quality-assurance/quality-control measurements demonstrated that the data obtained by the automated method was equivalent to data obtained by manual sampling methods using the same sampling protocols. Water level, specific conductance, pH, water temperature, dissolved oxygen, and dissolved ammonium were monitored by the prototype as the wells were purged according to U.S Geological Survey (USGS) ground water sampling protocols. Remote access to the data record, via phone modem communications, indicated the arrival of each plume over a few days and the subsequent geochemical reactions over the following weeks. Real-time availability of the monitoring record provided the information needed to initiate manual sampling efforts in response to changes in measured ground water quality, which proved the method and characterized the screened portion of the plume in detail through time. The methods and the case study described are presented to document the process for future use.

  20. Main: 1QRR [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available Molecule: Sulfolipid Biosynthesis (Sqd1) Protein; Chain: A; Engineered: Yes Isomerase A.M.Mulichak, M.J.Thei...IASIHDRISRWKALTGKSIELYVGDICDFEFLAESFKSFEPDSVVHFGEQRSAPYSMIDRSRAVYTQHNNVIGTLNVLFAIKEFGEECHLVKLGTMGEYGTPNIDIEE...LNRFCVQAAVGHPLTVYGKGGQTRGYLDIRDTVQCVEIAIANPAKAGEFRVFNQFTEQFSVNELASLVTKAGSKLGLDVKKMTVPNPRVEAEEHYYNAKHTKLMELGLEPHYLSDSLLDSLLNFAVQFKDRVDTKQIMPSVSWKKIGVKTKSMTT arabi_1QRR.jpg ...

  1. Operation UPSHOT-KNOTHOLE. Operational Summary, Nevada Proving Grounds, 1 March - 9 June 1953

    Science.gov (United States)

    1982-08-01

    Office was superseded by a group of information representatives from the AEC, the FODA ., and the DOD under the direction of Mfr. Morse S&l31 bury, =E...tests designed for statistical analysis of effects. (5) Tactical coznznications systemax. (6) FOL installations. (7) Field madical installations...involved in the operation. The Silas Mason Company was the contractor responsible for drawing up the route line chart and installing the timing lines and

  2. Electrochemical stabilization of clayey ground

    Science.gov (United States)

    Rzhanitzin, B.A.; Sokoloff, V.P.

    1947-01-01

    Recently developed new methods of stabilization of weak grounds (e.g. the silicate treatment) are based on injection of chemical solutions into the ground. Such methods are applicable accordingly only to the kinds of ground that have the coefficient of filtration higher than 2 meters per 24 hours and permit penetration of the chemical solutions under pressure. This limit, however, as it is shown by our experience in construction, excludes a numerous and an important class of grounds, stabilization of which is indispensable in many instances. For example, digging of trenches and pits in clayey, silty, or sandy ground shows that all these types act like typical "floaters" (sluds? -S) in the presence of the ground water pressure. There were several instances in the canalization of the city of Moskow where the laying of trenches below the ground water level has led to extreme difficulties with clayey and silty ground. Similar examples could be cited in mining, engineering hydrology, and railroad construction. For these reasons, the development of methods of stabilizing such difficult types of ground has become an urgent problem of our day. In 1936, the author began his investigations, at the ground Stabilization Laboratory of VODGEO Institute, with direct electrical current as the means of stabilization of grounds. Experiments had shown that a large number of clayey types, following passage of direct electrical current, undergoes a transformation of its physico-chemical properties. It was established that the (apparent -S) density of the ground is substantially increased in consequence of the application of direct electrical current. The ground loses also its capacity to swell and to soften in water. Later, after a more detailed study of the physico-chemical mechanism of the electrical stabilization, it became possible to develop the method so as to make it applicable to sandy and silty as well as to clayey ground. By this time (1941, S.), the method has already been

  3. Above‐ground woody carbon sequestration measured from tree rings is coherent with net ecosystem productivity at five eddy‐covariance sites

    DEFF Research Database (Denmark)

    Babst, Flurin; Bouriaud, Olivier; Papale, Dario

    2014-01-01

    Attempts to combine biometric and eddy‐covariance (EC) quantifications of carbon allocation to different storage pools in forests have been inconsistent and variably successful in the past. We assessed above‐ground biomass changes at five long‐term EC forest stations based on tree‐ring width...... and wood density measurements, together with multiple allometric models. Measurements were validated with site‐specific biomass estimates and compared with the sum of monthly CO2 fluxes between 1997 and 2009. Biometric measurements and seasonal net ecosystem productivity (NEP) proved largely compatible...

  4. a Test to Prove Cloud Whitening THEORY!

    Science.gov (United States)

    Buttram, J. W.

    2011-12-01

    Climate science researchers believe our planet can possibly tolerate twice the present carbon dioxide levels with no upwards temperature change, IF we could increase the amount of energy reflected back out into space by about 2.0%. (c)Cloudtec basically alters a blend of seawater and applies heat derived from magma to it at a temperature exceeding 2,000 degrees F. The interaction of seawater and magma displaces the oxygen, causing the volume of water to vaporize and expand over 4,000 times - transforming billions of tons of seawater into thousands of cubic miles of white, maritime, stratocumulus clouds to reflect the incident Sun's rays back out into space. A 6 month test to prove Cloud Whitening Theory will cost 6 million dollars. (No profit added.) This study will enable everyone on the planet with a computer the transparency to use satellite imagery and check out for themselves - if and when Cloud Whitening is occurring. If Cloud Whitening Theory is validated, (c)Cloudtec's innovation can strategically create the clouds we need to reflect the Sun's rays back out into space and help neutralize the projected 3.6 degrees F rise in temperature. Based on reasonable calculations of anthropogenic global warming: this one move alone would be comparable to slashing global carbon dioxide emissions by over 60% over the next 40 years.

  5. The Secret Prover : Proving Possession of Arbitrary Files While not Giving Them Away

    NARCIS (Netherlands)

    Teepe, Wouter

    2005-01-01

    The Secret Prover is a Java application which allows a user (A) to prove to another user (B), that A possesses a file. If B also possesses this file B will get convinced, and if B does not possess this file B will gain no information on (the contents of) this file. This is the first implementation

  6. Ground truth methods for optical cross-section modeling of biological aerosols

    Science.gov (United States)

    Kalter, J.; Thrush, E.; Santarpia, J.; Chaudhry, Z.; Gilberry, J.; Brown, D. M.; Brown, A.; Carter, C. C.

    2011-05-01

    Light detection and ranging (LIDAR) systems have demonstrated some capability to meet the needs of a fastresponse standoff biological detection method for simulants in open air conditions. These systems are designed to exploit various cloud signatures, such as differential elastic backscatter, fluorescence, and depolarization in order to detect biological warfare agents (BWAs). However, because the release of BWAs in open air is forbidden, methods must be developed to predict candidate system performance against real agents. In support of such efforts, the Johns Hopkins University Applied Physics Lab (JHU/APL) has developed a modeling approach to predict the optical properties of agent materials from relatively simple, Biosafety Level 3-compatible bench top measurements. JHU/APL has fielded new ground truth instruments (in addition to standard particle sizers, such as the Aerodynamic particle sizer (APS) or GRIMM aerosol monitor (GRIMM)) to more thoroughly characterize the simulant aerosols released in recent field tests at Dugway Proving Ground (DPG). These instruments include the Scanning Mobility Particle Sizer (SMPS), the Ultraviolet Aerodynamic Particle Sizer (UVAPS), and the Aspect Aerosol Size and Shape Analyser (Aspect). The SMPS was employed as a means of measuring smallparticle concentrations for more accurate Mie scattering simulations; the UVAPS, which measures size-resolved fluorescence intensity, was employed as a path toward fluorescence cross section modeling; and the Aspect, which measures particle shape, was employed as a path towards depolarization modeling.

  7. Research on Visualization of Ground Laser Radar Data Based on Osg

    Science.gov (United States)

    Huang, H.; Hu, C.; Zhang, F.; Xue, H.

    2018-04-01

    Three-dimensional (3D) laser scanning is a new advanced technology integrating light, machine, electricity, and computer technologies. It can conduct 3D scanning to the whole shape and form of space objects with high precision. With this technology, you can directly collect the point cloud data of a ground object and create the structure of it for rendering. People use excellent 3D rendering engine to optimize and display the 3D model in order to meet the higher requirements of real time realism rendering and the complexity of the scene. OpenSceneGraph (OSG) is an open source 3D graphics engine. Compared with the current mainstream 3D rendering engine, OSG is practical, economical, and easy to expand. Therefore, OSG is widely used in the fields of virtual simulation, virtual reality, science and engineering visualization. In this paper, a dynamic and interactive ground LiDAR data visualization platform is constructed based on the OSG and the cross-platform C++ application development framework Qt. In view of the point cloud data of .txt format and the triangulation network data file of .obj format, the functions of 3D laser point cloud and triangulation network data display are realized. It is proved by experiments that the platform is of strong practical value as it is easy to operate and provides good interaction.

  8. RESEARCH ON VISUALIZATION OF GROUND LASER RADAR DATA BASED ON OSG

    Directory of Open Access Journals (Sweden)

    H. Huang

    2018-04-01

    Full Text Available Three-dimensional (3D laser scanning is a new advanced technology integrating light, machine, electricity, and computer technologies. It can conduct 3D scanning to the whole shape and form of space objects with high precision. With this technology, you can directly collect the point cloud data of a ground object and create the structure of it for rendering. People use excellent 3D rendering engine to optimize and display the 3D model in order to meet the higher requirements of real time realism rendering and the complexity of the scene. OpenSceneGraph (OSG is an open source 3D graphics engine. Compared with the current mainstream 3D rendering engine, OSG is practical, economical, and easy to expand. Therefore, OSG is widely used in the fields of virtual simulation, virtual reality, science and engineering visualization. In this paper, a dynamic and interactive ground LiDAR data visualization platform is constructed based on the OSG and the cross-platform C++ application development framework Qt. In view of the point cloud data of .txt format and the triangulation network data file of .obj format, the functions of 3D laser point cloud and triangulation network data display are realized. It is proved by experiments that the platform is of strong practical value as it is easy to operate and provides good interaction.

  9. Impact of cooking, proving, and baking on the (poly)phenol content of wild blueberry.

    Science.gov (United States)

    Rodriguez-Mateos, Ana; Cifuentes-Gomez, Tania; George, Trevor W; Spencer, Jeremy P E

    2014-05-07

    Accumulating evidence suggests that diets rich in (poly)phenols may have positive effects on human health. Currently there is limited information regarding the effects of processing on the (poly)phenolic content of berries, in particular in processes related to the baking industry. This study investigated the impact of cooking, proving, and baking on the anthocyanin, procyanidin, flavonol, and phenolic acid contents of wild blueberry using HPLC with UV and fluorescence detection. Anthocyanin levels decreased during cooking, proving, and baking, whereas no significant changes were observed for total procyanidins. However, lower molecular weight procyanidins increased and high molecular weight oligomers decreased during the process. Quercetin and ferulic and caffeic acid levels remained constant, whereas increases were found for chlorogenic acid. Due to their possible health benefits, a better understanding of the impact of processing is important to maximize the retention of these phytochemicals in berry-containing products.

  10. Conceptualizing reasoning-and-proving opportunities in textbook expositions : Cases from secondary calculus

    OpenAIRE

    Bergwall, Andreas

    2017-01-01

    Several recent textbook studies focus on opportunities to learn reasoning-and-proving. They typically investigate the extent to which justifications are general proofs and what opportunities exist for learning important elements of mathematical reasoning. In this paper, I discuss how a particular analytical framework for this might be refined. Based on an in-depth analysis of certain textbook passages in upper secondary calculus textbooks, I make an account for analytical issues encountered d...

  11. The effects of GeoGebra software on pre-service mathematics teachers' attitudes and views toward proof and proving

    Science.gov (United States)

    Zengin, Yılmaz

    2017-11-01

    The purpose of this study is to determine the effect of GeoGebra software on pre-service mathematics teachers' attitudes towards proof and proving and to determine pre-service teachers' pre- and post-views regarding proof. The study lasted nine weeks and the participants of the study consisted of 24 pre-service mathematics teachers. The study used the 'Attitude Scale Towards Proof and Proving' and an open-ended questionnaire that were administered before and after the intervention as data collection tools. Paired samples t-test analysis was used for the analysis of quantitative data and content and descriptive analyses were utilized for the analysis of qualitative data. As a result of the data analysis, it was determined that GeoGebra software was an effective tool in increasing pre-service teachers' attitudes towards proof and proving.

  12. 30 CFR 75.803 - Fail safe ground check circuits on high-voltage resistance grounded systems.

    Science.gov (United States)

    2010-07-01

    ... High-Voltage Distribution § 75.803 Fail safe ground check circuits on high-voltage resistance grounded systems. [Statutory Provisions] On and after September 30, 1970, high-voltage, resistance grounded systems... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Fail safe ground check circuits on high-voltage...

  13. Ground rubber: Sorption media for ground water containing benzene and O-xylene

    International Nuclear Information System (INIS)

    Kershaw, D.S.; Pamukcu, S.

    1997-01-01

    The purpose of the current study is to examine the ability of ground rubber to sorb benzene and O-xylene from water contained with aromatic hydrocarbons. The study consisted of running both batch and packed bed column tests to determine the sorption capacity, the required sorption equilibration time, and the flow through utilization efficiency of ground rubber under various contact times when exposed to water contaminated with various amounts of benzene or O-xylene. Initial batch test results indicate that ground rubber can attain equilibrium sorption capacities up to 1.3 or 8.2 mg of benzene or O-xylene, respectively, per gram of tire rubber at solution equilibrium concentrations of 10 mg/L. Packed bed column tests indicate that ground tire rubber has on the average a 40% utilization rate when a hydraulic residence time of 15 min is used. Possible future uses of round rubber as a sorption media could include, but are not limited to, the use of ground rubber as an aggregate in slurry cutoff walls that are in contact with petroleum products. Ground rubber could also be used as a sorption media in pump-and-treat methodologies or as a sorption media in in-situ reactive permeable barriers

  14. Main: 1JB9 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1JB9 トウモロコシ Corn Zea mays L. Ferredoxin-Nadp Reductase Precursor Zea Mays Molecule:...SLLYDEEFTSYLKQYPDNFRYDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVAERRGESWDQKLAQLKKNKQWHVEVY corn_1JB9.jpg ...

  15. Transitions in midwestern ground water law

    International Nuclear Information System (INIS)

    Bowman, J.A.; Clark, G.R.

    1989-01-01

    The evolution of ground-water law in eight states in the Midwest (Illinois, Indiana, Iowa, Michigan, Minnesota, Missouri, Ohio, and Wisconsin) is examined, and a review of transitions in ground-water doctrines is presented. Two underlying themes in changing ground-water management are communicated. First, ground-water law is evolving from private property rules of capture based on the absolute ownership doctrines to rules requiring conservation and sharing of ground water as a public resource. Second, in both courts and state legislatures, a proactive role of ground-water management is emerging, again, with an emphasis on sharing. Both of these trends are apparent in the Midwest. In the last decade midwestern states have (1) seen significant shifts in court decisions on ground-water use with greater recognition of the reciprocal or mutually dependent nature of ground-water rights, and (2) seen increased legislative development of comprehensive ground-water management statutes that emphasize the reciprocal liabilities of ground-water use. These trends are examined and ground-water management programs discussed for eight states in the Midwest

  16. Integration between ground based and satellite SAR data in landslide mapping: The San Fratello case study

    Science.gov (United States)

    Bardi, Federica; Frodella, William; Ciampalini, Andrea; Bianchini, Silvia; Del Ventisette, Chiara; Gigli, Giovanni; Fanti, Riccardo; Moretti, Sandro; Basile, Giuseppe; Casagli, Nicola

    2014-10-01

    The potential use of the integration of PSI (Persistent Scatterer Interferometry) and GB-InSAR (Ground-based Synthetic Aperture Radar Interferometry) for landslide hazard mitigation was evaluated for mapping and monitoring activities of the San Fratello landslide (Sicily, Italy). Intense and exceptional rainfall events are the main factors that triggered several slope movements in the study area, which is susceptible to landslides, because of its steep slopes and silty-clayey sedimentary cover. In the last three centuries, the town of San Fratello was affected by three large landslides, developed in different periods: the oldest one occurred in 1754, damaging the northeastern sector of the town; in 1922 a large landslide completely destroyed a wide area in the western hillside of the town. In this paper, the attention is focussed on the most recent landslide that occurred on 14 February 2010: in this case, the phenomenon produced the failure of a large sector of the eastern hillside, causing severe damages to buildings and infrastructures. In particular, several slow-moving rotational and translational slides occurred in the area, making it suitable to monitor ground instability through different InSAR techniques. PS-InSAR™ (permanent scatterers SAR interferometry) techniques, using ERS-1/ERS-2, ENVISAT, RADARSAT-1, and COSMO-SkyMed SAR images, were applied to analyze ground displacements during pre- and post-event phases. Moreover, during the post-event phase in March 2010, a GB-InSAR system, able to acquire data continuously every 14 min, was installed collecting ground displacement maps for a period of about three years, until March 2013. Through the integration of space-borne and ground-based data sets, ground deformation velocity maps were obtained, providing a more accurate delimitation of the February 2010 landslide boundary, with respect to the carried out traditional geomorphological field survey. The integration of GB-InSAR and PSI techniques proved to

  17. The Grounded Theory Bookshelf

    Directory of Open Access Journals (Sweden)

    Vivian B. Martin, Ph.D.

    2005-03-01

    Full Text Available Bookshelf will provide critical reviews and perspectives on books on theory and methodology of interest to grounded theory. This issue includes a review of Heaton’s Reworking Qualitative Data, of special interest for some of its references to grounded theory as a secondary analysis tool; and Goulding’s Grounded Theory: A practical guide for management, business, and market researchers, a book that attempts to explicate the method and presents a grounded theory study that falls a little short of the mark of a fully elaborated theory.Reworking Qualitative Data, Janet Heaton (Sage, 2004. Paperback, 176 pages, $29.95. Hardcover also available.

  18. Rice husk ash with high carbon content proves favourable for soil stabilization

    NARCIS (Netherlands)

    Pham, P.V.; van der Star, WRL; van Paassen, L.A.; Ye, G.

    2015-01-01

    Rice husk ash is a promising pozzolanic material produced from rice husk burning and has significant potential a sustainable replacement for cement in construction and ground improvement applications. In this study the effect of burning conditions on the ash reactivity and its potential for soil

  19. Grounded theory in music therapy research.

    Science.gov (United States)

    O'Callaghan, Clare

    2012-01-01

    Grounded theory is one of the most common methodologies used in constructivist (qualitative) music therapy research. Researchers use the term "grounded theory" when denoting varying research designs and theoretical outcomes. This may be challenging for novice researchers when considering whether grounded theory is appropriate for their research phenomena. This paper examines grounded theory within music therapy research. Grounded theory is briefly described, including some of its "contested" ideas. A literature search was conducted using the descriptor "music therapy and grounded theory" in Pubmed, CINAHL PsychlNFO, SCOPUS, ERIC (CSA), Web of Science databases, and a music therapy monograph series. A descriptive analysis was performed on the uncovered studies to examine researched phenomena, grounded theory methods used, and how findings were presented, Thirty music therapy research projects were found in refereed journals and monographs from 1993 to "in press." The Strauss and Corbin approach to grounded theory dominates the field. Descriptors to signify grounded theory components in the studies greatly varied. Researchers have used partial or complete grounded theory methods to examine clients', family members', staff, music therapy "overhearers," music therapists', and students' experiences, as well as music therapy creative products and professional views, issues, and literature. Seven grounded theories were offered. It is suggested that grounded theory researchers clarify what and who inspired their design, why partial grounded theory methods were used (when relevant), and their ontology. By elucidating assumptions underpinning the data collection, analysis, and findings' contribution, researchers will continue to improve music therapy research using grounded theory methods.

  20. Assessment of Soil, Surface-Water, and Ground-Water Contamination at Selected Sites at J-Field, Aberdeen Proving Ground, Maryland

    National Research Council Canada - National Science Library

    Phelan, Daniel

    1998-01-01

    .... From shortly after World War II into the 1970's, chemical-warfare agents, high-explosive munitions, and industrial chemicals were tested and disposed of at J-Field by open-pit burning and by high-explosive demolition...

  1. The effect of herbal formula PROVE 1 and Stevia levels in diets on diet utilization of growing pigs

    Directory of Open Access Journals (Sweden)

    Kooprasert, S.

    2007-05-01

    Full Text Available The objective of this experiment was to study the effect of 0.2% antibiotic (ascomix-s®, one kilogram of which contains lincomycin hydrochloride 44 g and sulfamethazine 110 g or 0.25% herbal formulaPROVE 1, combined with five levels of Stevia supplementation in the diets on digestibility of pigs. Two factors; 1 type of drug (0.2% antibiotic and 0.25% herbal formula PROVE 1 and 2 five Stevia levels (0,0.2, 0.4, 0.6 and 0.8% were investigated and 10 dietary treatments were used in this study. Ten related growing crossbred (Large White x Landrace barrow pigs (30±1.5 kg body weight were raised in individualmetabolism cages for three collecting periods (30, 40 and 50 kg body weight, each pig was fed one experimental diet throughout the collecting period.The results showed that pigs fed diet with either 0.2% antibiotic or 0.25% herbal formula PROVE 1 had similar digestibility of diet, crude protein (CP, fiber, ash and nitrogen free extract (NFE (89.01 vs 87.83,94.96 vs 94.23, 60.73 vs 59.03, 61.22 vs 60.44 and 93.28 vs 92.03%, respectively. Negligible differences were observed between 0 and 0.4% Stevia supplementation in diet, but levels showed better digestibility than the other levels of Stevia supplementation, and the diet with 0.4% Stevia supplementation had the highestdigestibility of diet, CP, fiber, ash and NFE (91.04, 96.43, 69.48, 70.47 and 94.07%, respectively. The diet with antibiotic combined with 0.4% Stevia had digestibility of diet, CP, fat and fiber better than the otherlevels of Stevia supplementation, especially digestibility of ash, which was significantly higher than that of diet with 0.2% Stevia, but not significantly different from the other levels of Stevia supplementation. A partof herbal formula PROVE1 combined with 0% Stevia had the highest digestibility of ash (72.90%, significantly higher than the other levels of Stevia supplementation, except the diet with herbal formula PROVE 1combined with 0.4% Stevia supplementation

  2. Characterisation of Ground Thermal and Thermo-Mechanical Behaviour for Shallow Geothermal Energy Applications

    DEFF Research Database (Denmark)

    Vieira, Ana; Alberdi-Pagola, Maria; Christodoulides, Paul

    2017-01-01

    Increasing use of the ground as a thermal reservoir is expected in the near future. Shallow geothermal energy (SGE) systems have proved to be sustainable alternative solutions for buildings and infrastructure conditioning in many areas across the globe in the past decades. Recently novel solutions......-hydro-mechanical behaviour of soil is introduced and discussed. These coupled processes are important for confirming the structural integrity of energy geostructures, but routine methods for parameter determination are still lacking (Energies). Keywords: shallow geothermal systems; soil thermal behaviour; laboratory testing......, including energy geostructures, where SGE systems are coupled with foundation heat exchangers, have also been developed. The performance of these systems is dependent on a series of factors, among which the thermal properties of the soil play a major role. The purpose of this paper is to present...

  3. Communication, concepts and grounding.

    Science.gov (United States)

    van der Velde, Frank

    2015-02-01

    This article discusses the relation between communication and conceptual grounding. In the brain, neurons, circuits and brain areas are involved in the representation of a concept, grounding it in perception and action. In terms of grounding we can distinguish between communication within the brain and communication between humans or between humans and machines. In the first form of communication, a concept is activated by sensory input. Due to grounding, the information provided by this communication is not just determined by the sensory input but also by the outgoing connection structure of the conceptual representation, which is based on previous experiences and actions. The second form of communication, that between humans or between humans and machines, is influenced by the first form. In particular, a more successful interpersonal communication might require forms of situated cognition and interaction in which the entire representations of grounded concepts are involved. Copyright © 2014 Elsevier Ltd. All rights reserved.

  4. Safety objectives for next generation reactors: proving their achievement

    International Nuclear Information System (INIS)

    Tanguy, P.Y.

    1996-01-01

    Assuming that there is a consensus between regulatory bodies and nuclear operating organizations on safety objectives for future plants, how are we going to demonstrate that they have been achieved, with a reasonable certainty? Right from the beginning, I would like to underline the importance of convincing the public that high level safety objectives will be effectively achieved in future nuclear power plants. The mere fulfillment of administrative requirements might not be sufficient to obtain public acceptance. One has to take into account the changes that have occurred in the public preception of nuclear risks in the wake of the Chernobyl accident. Today public opinion rules out the possibility not only that such a catastrophic accident could recur, but also that any accident with detrimental health consequences off-site could occur. The nuclear industry has to reflect this concern in its safety demonstration, independently of proving the achievement of technical safety goals. The public opinion issue will be readdressed at the end of this paper. (orig.)

  5. Why prove it again? alternative proofs in mathematical practice

    CERN Document Server

    Dawson, Jr , John W

    2015-01-01

    This monograph considers several well-known mathematical theorems and asks the question, “Why prove it again?” while examining alternative proofs.   It  explores the different rationales mathematicians may have for pursuing and presenting new proofs of previously established results, as well as how they judge whether two proofs of a given result are different.  While a number of books have examined alternative proofs of individual theorems, this is the first that presents comparative case studies of other methods for a variety of different theorems. The author begins by laying out the criteria for distinguishing among proofs and enumerates reasons why new proofs have, for so long, played a prominent role in mathematical practice.  He then outlines various purposes that alternative proofs may serve.  Each chapter that follows provides a detailed case study of alternative proofs for particular theorems, including the Pythagorean Theorem, the Fundamental Theorem of Arithmetic, Desargues’ Theorem, the...

  6. Ground-water travel time

    International Nuclear Information System (INIS)

    Bentley, H.; Grisak, G.

    1985-01-01

    The Containment and Isolation Working Group considered issues related to the postclosure behavior of repositories in crystalline rock. This working group was further divided into subgroups to consider the progress since the 1978 GAIN Symposium and identify research needs in the individual areas of regional ground-water flow, ground-water travel time, fractional release, and cumulative release. The analysis and findings of the Ground-Water Travel Time Subgroup are presented

  7. Regional ground-water system

    International Nuclear Information System (INIS)

    Long, J.

    1985-01-01

    The Containment and Isolation Working Group considered issues related to the postclosure behavior of repositories in crystalline rock. This working group was further divided into subgroups to consider the progress since the 1978 GAIN Symposium and identify research needs in the individual areas of regional ground-water flow, ground-water travel time, fractional release, and cumulative release. The analysis and findings of the Ground-Water Regime Subgroup are presented

  8. Integration of a satellite ground support system based on analysis of the satellite ground support domain

    Science.gov (United States)

    Pendley, R. D.; Scheidker, E. J.; Levitt, D. S.; Myers, C. R.; Werking, R. D.

    1994-11-01

    This analysis defines a complete set of ground support functions based on those practiced in real space flight operations during the on-orbit phase of a mission. These functions are mapped against ground support functions currently in use by NASA and DOD. Software components to provide these functions can be hosted on RISC-based work stations and integrated to provide a modular, integrated ground support system. Such modular systems can be configured to provide as much ground support functionality as desired. This approach to ground systems has been widely proposed and prototyped both by government institutions and commercial vendors. The combined set of ground support functions we describe can be used as a standard to evaluate candidate ground systems. This approach has also been used to develop a prototype of a modular, loosely-integrated ground support system, which is discussed briefly. A crucial benefit to a potential user is that all the components are flight-qualified, thus giving high confidence in their accuracy and reliability.

  9. SLG(Single-Line-to-Ground Fault Location in NUGS(Neutral Un-effectively Grounded System

    Directory of Open Access Journals (Sweden)

    Zhang Wenhai

    2018-01-01

    Full Text Available This paper reviews the SLG(Single-Line-to-Ground fault location methods in NUGS(Neutral Un-effectively Grounded System, including ungrounded system, resonant grounded system and high-resistance grounded system which are widely used in Northern Europe and China. This type of fault is hard to detect and location because fault current is the sum of capacitance current of the system which is always small(about tens of amperes. The characteristics of SLG fault in NUGS and the fault location methods are introduced in the paper.

  10. A Mixed Prediction Model of Ground Subsidence for Civil Infrastructures on Soft Ground

    Directory of Open Access Journals (Sweden)

    Kiyoshi Kobayashi

    2012-01-01

    Full Text Available The estimation of ground subsidence processes is an important subject for the asset management of civil infrastructures on soft ground, such as airport facilities. In the planning and design stage, there exist many uncertainties in geotechnical conditions, and it is impossible to estimate the ground subsidence process by deterministic methods. In this paper, the sets of sample paths designating ground subsidence processes are generated by use of a one-dimensional consolidation model incorporating inhomogeneous ground subsidence. Given the sample paths, the mixed subsidence model is presented to describe the probabilistic structure behind the sample paths. The mixed model can be updated by the Bayesian methods based upon the newly obtained monitoring data. Concretely speaking, in order to estimate the updating models, Markov Chain Monte Calro method, which is the frontier technique in Bayesian statistics, is applied. Through a case study, this paper discussed the applicability of the proposed method and illustrated its possible application and future works.

  11. Ground penetrating radar system and method for detecting an object on or below a ground surface

    NARCIS (Netherlands)

    De Jongth, R.; Yarovoy, A.; Schukin, A.

    2001-01-01

    Ground penetrating radar system for detecting objects (17) on or below a ground surface (18), comprising at least one transmit antenna (13) having a first foot print (14) at the ground surface, at least one receive antenna (15) having a second foot print (16) at the ground surface, and processing

  12. Electrical Ground System Design of PEFP

    International Nuclear Information System (INIS)

    Mun, Kyeong Jun; Jeon, Gye Po; Park, Sung Sik; Min, Yi Sub; Nam, Jung Min; Cho, Jang Hyung; Kim, Jun Yeon

    2010-01-01

    Since host site host site was selected Gyeong-ju city in January, 2006. we need design revision of Proton Accelerator research center to reflect on host site characteristics and several conditions. In this paper, electrical grounding and lightning protection design scheme is introduced. In electrical grounding system design of PEFP, we classified electrical facilities into 4 groups; equipment grounding (type A), instrument grounding (Type A), high frequency instrument grounding (Type C) and lightning arrestor grounding (Type D). Lightning protection system is designed in all buildings of proton accelerator research center of PEFP, including switchyard

  13. Electrical Ground System Design of PEFP

    Energy Technology Data Exchange (ETDEWEB)

    Mun, Kyeong Jun; Jeon, Gye Po; Park, Sung Sik; Min, Yi Sub; Nam, Jung Min; Cho, Jang Hyung; Kim, Jun Yeon [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2010-10-15

    Since host site host site was selected Gyeong-ju city in January, 2006. we need design revision of Proton Accelerator research center to reflect on host site characteristics and several conditions. In this paper, electrical grounding and lightning protection design scheme is introduced. In electrical grounding system design of PEFP, we classified electrical facilities into 4 groups; equipment grounding (type A), instrument grounding (Type A), high frequency instrument grounding (Type C) and lightning arrestor grounding (Type D). Lightning protection system is designed in all buildings of proton accelerator research center of PEFP, including switchyard

  14. Ground water and earthquakes

    Energy Technology Data Exchange (ETDEWEB)

    Ts' ai, T H

    1977-11-01

    Chinese folk wisdom has long seen a relationship between ground water and earthquakes. Before an earthquake there is often an unusual change in the ground water level and volume of flow. Changes in the amount of particulate matter in ground water as well as changes in color, bubbling, gas emission, and noises and geysers are also often observed before earthquakes. Analysis of these features can help predict earthquakes. Other factors unrelated to earthquakes can cause some of these changes, too. As a first step it is necessary to find sites which are sensitive to changes in ground stress to be used as sensor points for predicting earthquakes. The necessary features are described. Recording of seismic waves of earthquake aftershocks is also an important part of earthquake predictions.

  15. On LHCb muon MWPC grounding

    CERN Document Server

    Kashchuk, A

    2006-01-01

    My goal is to study how a big MWPC system, in particular the LHCb muon system, can be protected against unstable operation and multiple spurious hits, produced by incorrect or imperfect grounding in the severe EM environment of the LHCb experiment. A mechanism of penetration of parasitic current from the ground loop to the input of the front-end amplifier is discussed. A new model of the detector cell as the electrical bridge is considered. As shown, unbalance of the bridge makes detector to be sensitive to the noise in ground loop. Resonances in ground loop are specified. Tests of multiple-point and single-point grounding conceptions made on mock-up are presented.

  16. Exogenous spatial attention influences figure-ground assignment.

    Science.gov (United States)

    Vecera, Shaun P; Flevaris, Anastasia V; Filapek, Joseph C

    2004-01-01

    In a hierarchical stage account of vision, figure-ground assignment is thought to be completed before the operation of focal spatial attention. Results of previous studies have supported this account by showing that unpredictive, exogenous spatial precues do not influence figure-ground assignment, although voluntary attention can influence figure-ground assignment. However, in these studies, attention was not summoned directly to a region in a figure-ground display. In three experiments, we addressed the relationship between figure-ground assignment and visuospatial attention. In Experiment 1, we replicated the finding that exogenous precues do not influence figure-ground assignment when they direct attention outside of a figure-ground stimulus. In Experiment 2, we demonstrated that exogenous attention can influence figure-ground assignment if it is directed to one of the regions in a figure-ground stimulus. In Experiment 3, we demonstrated that exogenous attention can influence figure-ground assignment in displays that contain a Gestalt figure-ground cue; this result suggests that figure-ground processes are not entirely completed prior to the operation of focal spatial attention. Exogenous spatial attention acts as a cue for figure-ground assignment and can affect the outcome of figure-ground processes.

  17. Main: 1WEO [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available tic Subunit Name=Irx3; Synonyms=T10b6_80; Arabidopsis Thaliana Molecule: Cellulose Synthase, Catalytic Subunit (Irx3); Chai...GDKEHLMSEMNFEKTFGQSSIFVTSTLMEEGGVPPSSSPAVLLKEAIHVISCGYEDKTEWGTELGWIYGSITEDILTGFKMHCRGWRSIYCMPKRPAFKGSAPINLSD...RLNQVLRWALGSVEIFFSRHSPLWYGYKGGKLKWLERFAYANTTIYPFTSIPLLAYCILPAICLLTDKFIMPPISTFASLFFISLFMSIIVTGILELRWSGVSIEEWW...RNEQFWVIGGISAHLFAVVQGLLKILAGIDTNFTVTSKATDDDDFGELYAFKWTTLLIPPTTVLIINIVGVVAGISDAINNGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVIWSVLLASIFSLLWVRIDPFVLKTKGPDTSKCGINC arabi_1WEO.jpg ...

  18. Transverse Myelitis Association

    Science.gov (United States)

    ... INSPIRATION What is Anti-Myelin Oligodendrocyte Glycoprotein (MOG)? https://myelitis.org/wp-content/uploads/2015/05/blog_research.jpg 999 1500 The TMA https://myelitis.org/wp-content/uploads/2015/06/TMA- ...

  19. Ground-motion prediction from tremor

    Science.gov (United States)

    Baltay, Annemarie S.; Beroza, Gregory C.

    2013-01-01

    The widespread occurrence of tremor, coupled with its frequency content and location, provides an exceptional opportunity to test and improve strong ground-motion attenuation relations for subduction zones. We characterize the amplitude of thousands of individual 5 min tremor events in Cascadia during three episodic tremor and slip events to constrain the distance decay of peak ground acceleration (PGA) and peak ground velocity (PGV). We determine the anelastic attenuation parameter for ground-motion prediction equations (GMPEs) to a distance of 150 km, which is sufficient to place important constraints on ground-motion decay. Tremor PGA and PGV show a distance decay that is similar to subduction-zone-specific GMPEs developed from both data and simulations; however, the massive amount of data present in the tremor observations should allow us to refine distance-amplitude attenuation relationships for use in hazard maps, and to search for regional variations and intrasubduction zone differences in ground-motion attenuation.

  20. MICROSTRUCTURE, MINERALOGY AND PHYSICAL PROPERTIES OF GROUND FLY ASH BASED GEOPOLYMERS

    Directory of Open Access Journals (Sweden)

    Ferenc Madai

    2015-03-01

    Full Text Available This paper is focused on the utilization of deposited fly ash as a main component of geopolymer. After determination of particle size distribution, moisture content, real and bulk density and specific surface area of the raw fly ash, mechanical activation was performed by laboratory scale ball mill. This step is introduced for improving the reactivity of raw material. Then test specimens were produced by geopoliomerisation using a caustic spent liquor (NaOH. Compressive strength was determined on cilindrical specimens. Finally, samples of the ground fly ash based geopolymer specimens were analyzed by X-ray diffraction, optical and scanning electron microscopy. Results prove that geopolymer production with proper strength from the investigated F-type deposited fly ash is possible. The uniaxial compressive strength of obtained composites strongly depends on the fineness of the ground fly ash. XRD results show that comparing the crystalline components for different geopolymer samples, zeolite-A appears and its amount increases gradually from 0T sample till 30T and then decreases for 60T sample. The same trend holds for sodalite type structure phases, however its amount is much lower than for zeolite-A. SEM+EDS investigation revealed that Na-content is elevated in the interstitial fine-grained matrix, especially for the 30T sample when highest strength was observed. Si and Al are abundant mainly in anhedral and spherical grains and in rarely occurring grains resembling some crystal shape.

  1. Ground Control System Description Document

    International Nuclear Information System (INIS)

    Eric Loros

    2001-01-01

    The Ground Control System contributes to the safe construction and operation of the subsurface facility, including accesses and waste emplacement drifts, by maintaining the configuration and stability of the openings during construction, development, emplacement, and caretaker modes for the duration of preclosure repository life. The Ground Control System consists of ground support structures installed within the subsurface excavated openings, any reinforcement made to the rock surrounding the opening, and inverts if designed as an integral part of the system. The Ground Control System maintains stability for the range of geologic conditions expected at the repository and for all expected loading conditions, including in situ rock, construction, operation, thermal, and seismic loads. The system maintains the size and geometry of operating envelopes for all openings, including alcoves, accesses, and emplacement drifts. The system provides for the installation and operation of sensors and equipment for any required inspection and monitoring. In addition, the Ground Control System provides protection against rockfall for all subsurface personnel, equipment, and the engineered barrier system, including the waste package during the preclosure period. The Ground Control System uses materials that are sufficiently maintainable and that retain the necessary engineering properties for the anticipated conditions of the preclosure service life. These materials are also compatible with postclosure waste isolation performance requirements of the repository. The Ground Control System interfaces with the Subsurface Facility System for operating envelopes, drift orientation, and excavated opening dimensions, Emplacement Drift System for material compatibility, Monitored Geologic Repository Operations Monitoring and Control System for ground control instrument readings, Waste Emplacement/Retrieval System to support waste emplacement operations, and the Subsurface Excavation System

  2. Transonic and supersonic ground effect aerodynamics

    Science.gov (United States)

    Doig, G.

    2014-08-01

    A review of recent and historical work in the field of transonic and supersonic ground effect aerodynamics has been conducted, focussing on applied research on wings and aircraft, present and future ground transportation, projectiles, rocket sleds and other related bodies which travel in close ground proximity in the compressible regime. Methods for ground testing are described and evaluated, noting that wind tunnel testing is best performed with a symmetry model in the absence of a moving ground; sled or rail testing is ultimately preferable, though considerably more expensive. Findings are reported on shock-related ground influence on aerodynamic forces and moments in and accelerating through the transonic regime - where force reversals and the early onset of local supersonic flow is prevalent - as well as more predictable behaviours in fully supersonic to hypersonic ground effect flows.

  3. Ground reaction forces during level ground walking with body weight unloading

    Science.gov (United States)

    Barela, Ana M. F.; de Freitas, Paulo B.; Celestino, Melissa L.; Camargo, Marcela R.; Barela, José A.

    2014-01-01

    Background: Partial body weight support (BWS) systems have been broadly used with treadmills as a strategy for gait training of individuals with gait impairments. Considering that we usually walk on level ground and that BWS is achieved by altering the load on the plantar surface of the foot, it would be important to investigate some ground reaction force (GRF) parameters in healthy individuals walking on level ground with BWS to better implement rehabilitation protocols for individuals with gait impairments. Objective: To describe the effects of body weight unloading on GRF parameters as healthy young adults walked with BWS on level ground. Method: Eighteen healthy young adults (27±4 years old) walked on a walkway, with two force plates embedded in the middle of it, wearing a harness connected to a BWS system, with 0%, 15%, and 30% BWS. Vertical and horizontal peaks and vertical valley of GRF, weight acceptance and push-off rates, and impulse were calculated and compared across the three experimental conditions. Results: Overall, participants walked more slowly with the BWS system on level ground compared to their normal walking speed. As body weight unloading increased, the magnitude of the GRF forces decreased. Conversely, weight acceptance rate was similar among conditions. Conclusions: Different amounts of body weight unloading promote different outputs of GRF parameters, even with the same mean walk speed. The only parameter that was similar among the three experimental conditions was the weight acceptance rate. PMID:25590450

  4. Ground reaction forces during level ground walking with body weight unloading

    Directory of Open Access Journals (Sweden)

    Ana M. F. Barela

    2014-12-01

    Full Text Available Background: Partial body weight support (BWS systems have been broadly used with treadmills as a strategy for gait training of individuals with gait impairments. Considering that we usually walk on level ground and that BWS is achieved by altering the load on the plantar surface of the foot, it would be important to investigate some ground reaction force (GRF parameters in healthy individuals walking on level ground with BWS to better implement rehabilitation protocols for individuals with gait impairments. Objective: To describe the effects of body weight unloading on GRF parameters as healthy young adults walked with BWS on level ground. Method: Eighteen healthy young adults (27±4 years old walked on a walkway, with two force plates embedded in the middle of it, wearing a harness connected to a BWS system, with 0%, 15%, and 30% BWS. Vertical and horizontal peaks and vertical valley of GRF, weight acceptance and push-off rates, and impulse were calculated and compared across the three experimental conditions. Results: Overall, participants walked more slowly with the BWS system on level ground compared to their normal walking speed. As body weight unloading increased, the magnitude of the GRF forces decreased. Conversely, weight acceptance rate was similar among conditions. Conclusions: Different amounts of body weight unloading promote different outputs of GRF parameters, even with the same mean walk speed. The only parameter that was similar among the three experimental conditions was the weight acceptance rate.

  5. 14 CFR 417.109 - Ground safety.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Ground safety. 417.109 Section 417.109... TRANSPORTATION LICENSING LAUNCH SAFETY Launch Safety Responsibilities § 417.109 Ground safety. (a) Ground safety... 417.115(c), and subpart E of this part provide launch operator ground safety requirements. ...

  6. Eyes On the Ground: Year 2 Assessment.

    Energy Technology Data Exchange (ETDEWEB)

    Brost, Randolph; Little, Charles Q.; McDaniel, Michael; McLendon, William C.,; Wade, James Rokwel

    2018-03-01

    The goal of the Eyes On the Ground project is to develop tools to aid IAEA inspectors. Our original vision was to produce a tool that would take three-dimensional measurements of an unknown piece of equipment, construct a semantic representation of the measured object, and then use the resulting data to infer possible explanations of equipment function. We report our tests of a 3-d laser scanner to obtain 3-d point cloud data, and subsequent tests of software to convert the resulting point clouds into primitive geometric objects such as planes and cylinders. These tests successfully identified pipes of moderate diameter and planar surfaces, but also incurred significant noise. We also investigated the IAEA inspector task context, and learned that task constraints may present significant obstacles to using 3-d laser scanners. We further learned that equipment scale and enclosing cases may confound our original goal of equipment diagnosis. Meanwhile, we also surveyed the rapidly evolving field of 3-d measurement technology, and identified alternative sensor modalities that may prove more suitable for inspector use in a safeguards context. We conclude with a detailed discussion of lessons learned and the resulting implications for project goals. Approved for public release; further dissemination unlimited.

  7. Synthesis of High-Frequency Ground Motion Using Information Extracted from Low-Frequency Ground Motion

    Science.gov (United States)

    Iwaki, A.; Fujiwara, H.

    2012-12-01

    Broadband ground motion computations of scenario earthquakes are often based on hybrid methods that are the combinations of deterministic approach in lower frequency band and stochastic approach in higher frequency band. Typical computation methods for low-frequency and high-frequency (LF and HF, respectively) ground motions are the numerical simulations, such as finite-difference and finite-element methods based on three-dimensional velocity structure model, and the stochastic Green's function method, respectively. In such hybrid methods, LF and HF wave fields are generated through two different methods that are completely independent of each other, and are combined at the matching frequency. However, LF and HF wave fields are essentially not independent as long as they are from the same event. In this study, we focus on the relation among acceleration envelopes at different frequency bands, and attempt to synthesize HF ground motion using the information extracted from LF ground motion, aiming to propose a new method for broad-band strong motion prediction. Our study area is Kanto area, Japan. We use the K-NET and KiK-net surface acceleration data and compute RMS envelope at four frequency bands: 0.5-1.0 Hz, 1.0-2.0 Hz, 2.0-4.0 Hz, .0-8.0 Hz, and 8.0-16.0 Hz. Taking the ratio of the envelopes of adjacent bands, we find that the envelope ratios have stable shapes at each site. The empirical envelope-ratio characteristics are combined with low-frequency envelope of the target earthquake to synthesize HF ground motion. We have applied the method to M5-class earthquakes and a M7 target earthquake that occurred in the vicinity of Kanto area, and successfully reproduced the observed HF ground motion of the target earthquake. The method can be applied to a broad band ground motion simulation for a scenario earthquake by combining numerically-computed low-frequency (~1 Hz) ground motion with the empirical envelope ratio characteristics to generate broadband ground motion

  8. Electrical Subsurface Grounding Analysis

    International Nuclear Information System (INIS)

    J.M. Calle

    2000-01-01

    The purpose and objective of this analysis is to determine the present grounding requirements of the Exploratory Studies Facility (ESF) subsurface electrical system and to verify that the actual grounding system and devices satisfy the requirements

  9. A Continuous Family of Equilibria in Ferromagnetic Media are Ground States

    Science.gov (United States)

    Su, Xifeng; de la Llave, Rafael

    2017-09-01

    We show that a foliation of equilibria (a continuous family of equilibria whose graph covers all the configuration space) in ferromagnetic transitive models are ground states. The result we prove is very general, and it applies to models with long range and many-body interactions. As an application, we consider several models of networks of interacting particles including models of Frenkel-Kontorova type on Z^d and one-dimensional quasi-periodic media. The result above is an analogue of several results in the calculus of variations (fields of extremals) and in PDE's. Since the models we consider are discrete and long range, new proofs need to be given. We also note that the main hypothesis of our result (the existence of foliations of equilibria) is the conclusion (using KAM theory) of several recent papers. Hence, we obtain that the KAM solutions recently established are minimizers when the interaction is ferromagnetic and transitive (these concepts are defined later).

  10. Investigation of the Yeast and Mould Floras in Some Ground Spices

    Directory of Open Access Journals (Sweden)

    Aydın Vural

    2004-01-01

    Full Text Available In this study, yeast and mould floras of 60 spices samples that werecollected from different places of Diyarbakır have been investigated. Theyeast spices as Aspergillus flavus, A. fumigatus and A. niger and mouldspices as Candida tropicalis and C. albicans have been commonly isolatedfrom the spices samples.The ratios of yeast contamination in the samples of black pepper,cumin, allspice, ground hot red pepper, flaked pepper (red and flakedpepper (black, investigated in this study, have been found as % 70, % 80,% 90, % 90, % 60 and % 30 respectively. As a result of high amount ofyeast contamination in spices samples, it is thought that there is a high riskof aflatoxin presence.Using the good and hygienically producing techniques at the stages ofharvest, production, processing, storage and selling with decontaminationapplications as sterilization, microwave and irradiation become effectiveeither in to prove the microbiological quality of the spices and eliminatingof the probable aflatoxin risk due to highly yeast contamination.

  11. Research in advanced formal theorem-proving techniques. [design and implementation of computer languages

    Science.gov (United States)

    Raphael, B.; Fikes, R.; Waldinger, R.

    1973-01-01

    The results are summarised of a project aimed at the design and implementation of computer languages to aid in expressing problem solving procedures in several areas of artificial intelligence including automatic programming, theorem proving, and robot planning. The principal results of the project were the design and implementation of two complete systems, QA4 and QLISP, and their preliminary experimental use. The various applications of both QA4 and QLISP are given.

  12. The World of Virtual Exhibitions

    Directory of Open Access Journals (Sweden)

    Irena Eiselt

    2013-09-01

    Full Text Available EXTENDED ABSTRACTSpecial collections of the National and University Library (NUK hide a lot of items of precious value. The Slovenian cultural heritage is stored on paper or on other media as a part of the library’s Manuscripts, Incunabula and Rare Books Collection, Old Prints Collection, Maps and Pictorial Collection, Music Collection, Ephemera Collection, Serials Collection, and Slovenian Diaspora Publications Collection. Only a small part of the treasures is temporary revealed to the public on special exhibitions. The idea of virtual exhibitions of library treasures was born in 2005. The library aimed to exhibit precious items of special collections of high historical or artistic value. In 2008 the first two virtual exhibitions were created in-house offering access to the rich collections of old postcards of Ljubljana at the beginning of 20th century kept in the Maps and Pictorial Collection of NUK. They were soon followed by other virtual exhibitions. At the beginning they were organised in the same way as physical exhibitions, afterwards different programs were used for creation of special effects (for ex. 3D wall. About two years ago it was decided that the creation of virtual exhibitions will be simplified. Files of digitised and borndigital library materials in jpg format are imported to MS PowerPoint 2010. Each jpg file is now formatted by adding a frame, a description … to the slides which are saved as jpg files. The last step is the import of jpg files into Cooliris application used for NUK web exhibitions. In the paper the virtual exhibition design and creation, the technical point of view and criteria for the selection of exhibition content are explained following the example of the virtual exhibitions the Old Postcards of Ljubljana, Photo Ateliers in Slovenia, a collection of photographs Four Seasons by Fran Krašovec and photos of Post-Earthquake Ljubljana in 1895.

  13. Simulation of ground-water flow and land subsidence in the Antelope Valley ground-water basin, California

    Science.gov (United States)

    Leighton, David A.; Phillips, Steven P.

    2003-01-01

    Antelope Valley, California, is a topographically closed basin in the western part of the Mojave Desert, about 50 miles northeast of Los Angeles. The Antelope Valley ground-water basin is about 940 square miles and is separated from the northern part of Antelope Valley by faults and low-lying hills. Prior to 1972, ground water provided more than 90 percent of the total water supply in the valley; since 1972, it has provided between 50 and 90 percent. Most ground-water pumping in the valley occurs in the Antelope Valley ground-water basin, which includes the rapidly growing cities of Lancaster and Palmdale. Ground-water-level declines of more than 200 feet in some parts of the ground-water basin have resulted in an increase in pumping lifts, reduced well efficiency, and land subsidence of more than 6 feet in some areas. Future urban growth and limits on the supply of imported water may continue to increase reliance on ground water. To better understand the ground-water flow system and to develop a tool to aid in effectively managing the water resources, a numerical model of ground-water flow and land subsidence in the Antelope Valley ground-water basin was developed using old and new geohydrologic information. The ground-water flow system consists of three aquifers: the upper, middle, and lower aquifers. The aquifers, which were identified on the basis of the hydrologic properties, age, and depth of the unconsolidated deposits, consist of gravel, sand, silt, and clay alluvial deposits and clay and silty clay lacustrine deposits. Prior to ground-water development in the valley, recharge was primarily the infiltration of runoff from the surrounding mountains. Ground water flowed from the recharge areas to discharge areas around the playas where it discharged either from the aquifer system as evapotranspiration or from springs. Partial barriers to horizontal ground-water flow, such as faults, have been identified in the ground-water basin. Water-level declines owing to

  14. Proving Continuity of Coinductive Global Bisimulation Distances: A Never Ending Story

    Directory of Open Access Journals (Sweden)

    David Romero-Hernández

    2015-12-01

    Full Text Available We have developed a notion of global bisimulation distance between processes which goes somehow beyond the notions of bisimulation distance already existing in the literature, mainly based on bisimulation games. Our proposal is based on the cost of transformations: how much we need to modify one of the compared processes to obtain the other. Our original definition only covered finite processes, but a coinductive approach allows us to extend it to cover infinite but finitary trees. After having shown many interesting properties of our distance, it was our intention to prove continuity with respect to projections, but unfortunately the issue remains open. Nonetheless, we have obtained several partial results that are presented in this paper.

  15. 30 CFR 77.803 - Fail safe ground check circuits on high-voltage resistance grounded systems.

    Science.gov (United States)

    2010-07-01

    ... circuits on high-voltage resistance grounded systems. On and after September 30, 1971, all high-voltage... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Fail safe ground check circuits on high-voltage resistance grounded systems. 77.803 Section 77.803 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION...

  16. A Study on the Improvement Effect and Field Applicability of the Deep Soft Ground by Ground Heating Method

    Directory of Open Access Journals (Sweden)

    Mincheol Park

    2018-05-01

    Full Text Available The soft ground in coastal areas should be treated when it needs to be used for the sustainably developed of urban or industrial complex constructions. The ground heating method for soft ground improvement was applied in Eastern Europe in the 1960s, but it was not widely used due to economic and environmental problems. The author developed a device for improving soft ground using an electric heating pipe. This paper investigates the improvement effect and field application of deep soft ground by the ground heating method using the electric heating pipe. Ground heating increases the temperature of the deep soft ground and increases the tip resistance of the static electronic piezo-cone penetration test. Additionally, the pressure of the pore water decreases because the pore water is evaporated due to the ground heating. As a result of the experiment, it was verified that there was an improvement in the effect of deep soft ground by the ground heating method. With ground heating for 96 h, the tip resistance was increased by 61% at a point 0.35 m horizontally away from the electric heat pipe, 22% at 0.97 m, and 2% at 1.31 m. As a result of the field test, it was found that there were no problems in the power supply of the diesel generator and the control panel. It was easy to install the electric heating pipes in the deep soft ground. However, due to boring, the ground was disturbed and water vapor was discharged through this gap. To minimize the discharge of water vapor, it is necessary to drive the electric heating pipe.

  17. Proven Innovations and New Initiatives in Ground System Development: Reducing Costs in the Ground System

    Science.gov (United States)

    Gunn, Jody M.

    2006-01-01

    The state-of-the-practice for engineering and development of Ground Systems has evolved significantly over the past half decade. Missions that challenge ground system developers with significantly reduced budgets in spite of requirements for greater and previously unimagined functionality are now the norm. Making the right trades early in the mission lifecycle is one of the key factors to minimizing ground system costs. The Mission Operations Strategic Leadership Team at the Jet Propulsion Laboratory has spent the last year collecting and working through successes and failures in ground systems for application to future missions.

  18. Ground-water sample collection and analysis plan for the ground-water surveillance project

    International Nuclear Information System (INIS)

    Bryce, R.W.; Evans, J.C.; Olsen, K.B.

    1991-12-01

    The Pacific Northwest Laboratory performs ground-water sampling activities at the US Department of Energy's (DOE's) Hanford Site in support of DOE's environmental surveillance responsibilities. The purpose of this document is to translate DOE's General Environmental Protection Program (DOE Order 5400.1) into a comprehensive ground-water sample collection and analysis plan for the Hanford Site. This sample collection and analysis plan sets forth the environmental surveillance objectives applicable to ground water, identifies the strategy for selecting sample collection locations, and lists the analyses to be performed to meet those objectives

  19. Error Analysis of Fast Moving Target Geo-location in Wide Area Surveillance Ground Moving Target Indication Mode

    Directory of Open Access Journals (Sweden)

    Zheng Shi-chao

    2013-12-01

    Full Text Available As an important mode in airborne radar systems, Wide Area Surveillance Ground Moving Target Indication (WAS-GMTI mode has the ability of monitoring a large area in a short time, and then the detected moving targets can be located quickly. However, in real environment, many factors introduce considerable errors into the location of moving targets. In this paper, a fast location method based on the characteristics of the moving targets in WAS-GMTI mode is utilized. And in order to improve the location performance, those factors that introduce location errors are analyzed and moving targets are relocated. Finally, the analysis of those factors is proved to be reasonable by simulation and real data experiments.

  20. Parkinson's Disease Videos

    Medline Plus

    Full Text Available ... Sexual Dysfunction? Attachment: consultation.jpg What Is the Relationship Between Depression and Parkinson's Disease? OHSU - Therapeutic Approaches for PD: Depression, Anxiety & Psychosis Parkinson’s Disease Psychosis: A Caregiver’s Story CareMAP: ...

  1. Performance Analysis of Slinky Horizontal Ground Heat Exchangers for a Ground Source Heat Pump System

    Directory of Open Access Journals (Sweden)

    Md. Hasan Ali

    2017-10-01

    Full Text Available This paper highlights the thermal performance of reclined (parallel to ground surface and standing (perpendicular to ground surface slinky horizontal ground heat exchangers (HGHEs with different water mass flow rates in the heating mode of continuous and intermittent operations. A copper tube with an outer surface protected with low-density polyethylene was selected as the tube material of the ground heat exchanger. Effects on ground temperature around the reclined slinky HGHE due to heat extraction and the effect of variation of ground temperatures on reclined HGHE performance are discussed. A higher heat exchange rate was experienced in standing HGHE than in reclined HGHE. The standing HGHE was affected by deeper ground temperature and also a greater amount of backfilled sand in standing HGHE (4.20 m3 than reclined HGHE (1.58 m3, which has higher thermal conductivity than site soil. For mass flow rate of 1 L/min with inlet water temperature 7 °C, the 4-day average heat extraction rates increased 45.3% and 127.3%, respectively, when the initial average ground temperatures at 1.5 m depth around reclined HGHE increased from 10.4 °C to 11.7 °C and 10.4 °C to 13.7 °C. In the case of intermittent operation, which boosted the thermal performance, a short time interval of intermittent operation is better than a long time interval of intermittent operation. Furthermore, from the viewpoint of power consumption by the circulating pump, the intermittent operation is more efficient than continuous operation.

  2. Characterisation of Ground Thermal and Thermo-Mechanical Behaviour for Shallow Geothermal Energy Applications

    Directory of Open Access Journals (Sweden)

    Ana Vieira

    2017-12-01

    Full Text Available Increasing use of the ground as a thermal reservoir is expected in the near future. Shallow geothermal energy (SGE systems have proved to be sustainable alternative solutions for buildings and infrastructure conditioning in many areas across the globe in the past decades. Recently novel solutions, including energy geostructures, where SGE systems are coupled with foundation heat exchangers, have also been developed. The performance of these systems is dependent on a series of factors, among which the thermal properties of the soil play a major role. The purpose of this paper is to present, in an integrated manner, the main methods and procedures to assess ground thermal properties for SGE systems and to carry out a critical review of the methods. In particular, laboratory testing through either steady-state or transient methods are discussed and a new synthesis comparing results for different techniques is presented. In situ testing including all variations of the thermal response test is presented in detail, including a first comparison between new and traditional approaches. The issue of different scales between laboratory and in situ measurements is then analysed in detail. Finally, the thermo-hydro-mechanical behaviour of soil is introduced and discussed. These coupled processes are important for confirming the structural integrity of energy geostructures, but routine methods for parameter determination are still lacking.

  3. 30 CFR 57.3360 - Ground support use.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Ground support use. 57.3360 Section 57.3360... and Support-Underground Only § 57.3360 Ground support use. Ground support shall be used where ground conditions, or mining experience in similar ground conditions in the mine, indicate that it is necessary...

  4. The quantum n-body problem in dimension d ⩾ n – 1: ground state

    Science.gov (United States)

    Miller, Willard, Jr.; Turbiner, Alexander V.; Escobar-Ruiz, M. A.

    2018-05-01

    We employ generalized Euler coordinates for the n body system in dimensional space, which consists of the centre-of-mass vector, relative (mutual) mass-independent distances r ij and angles as remaining coordinates. We prove that the kinetic energy of the quantum n-body problem for can be written as the sum of three terms: (i) kinetic energy of centre-of-mass, (ii) the second order differential operator which depends on relative distances alone and (iii) the differential operator which annihilates any angle-independent function. The operator has a large reflection symmetry group and in variables is an algebraic operator, which can be written in terms of generators of the hidden algebra . Thus, makes sense of the Hamiltonian of a quantum Euler–Arnold top in a constant magnetic field. It is conjectured that for any n, the similarity-transformed is the Laplace–Beltrami operator plus (effective) potential; thus, it describes a -dimensional quantum particle in curved space. This was verified for . After de-quantization the similarity-transformed becomes the Hamiltonian of the classical top with variable tensor of inertia in an external potential. This approach allows a reduction of the dn-dimensional spectral problem to a -dimensional spectral problem if the eigenfunctions depend only on relative distances. We prove that the ground state function of the n body problem depends on relative distances alone.

  5. Dugway Proving Ground: Closure Plan Module 2, for SWMUs 20, 164, 166 and 170

    Science.gov (United States)

    1997-07-01

    fighting, and/or singing. If the condition persists, a mask-like face, retropulsion or propulsion and a Parkinson -like syndrome develop (Mena et al...include pharyngitis, dysphagia , abdominal pain, nausea and vomiting, bloody diarrhea, and shock. Later swelling of the salivary glands, stomatitis

  6. Jefferson Proving Ground, South of the Firing Line Health and Safety Plan, Volume 4

    National Research Council Canada - National Science Library

    1992-01-01

    .... The purpose of this Site Health and Safety Plan (SHSP) is to assign SECD personnel health and safety responsibilities, to prescribe mandatory operating procedures, and to establish personal-protective-equipment (PPE...

  7. A hierarchical approach to ecological assessment of contaminated soils at Aberdeen Proving Ground, USA

    Energy Technology Data Exchange (ETDEWEB)

    Kuperman, R.G.

    1995-12-31

    Despite the expansion of environmental toxicology studies over the past decade, soil ecosystems have largely been ignored in ecotoxicological studies in the United States. The objective of this project was to develop and test the efficacy of a comprehensive methodology for assessing ecological impacts of soil contamination. A hierarchical approach that integrates biotic parameters and ecosystem processes was used to give insight into the mechanisms that lead to alterations in the structure and function of soil ecosystems in contaminated areas. This approach involved (1) a thorough survey of the soil biota to determine community structure, (2) laboratory and field tests on critical ecosystem processes, (3) toxicity trials, and (4) the use of spatial analyses to provide input to the decision-making, process. This methodology appears to, offer an efficient and potentially cost-saving tool for remedial investigations of contaminated sites.

  8. 78 FR 60238 - Proposed Modification and Establishment of Restricted Areas; Aberdeen Proving Ground, MD

    Science.gov (United States)

    2013-10-01

    ... regulatory, aeronautical, economic, environmental, and energy-related aspects of the proposal. Communications... two, has variable altitudes based on the time of day. R-4001A extends from the surface to unlimited...

  9. On Grounding of Fast Ships

    DEFF Research Database (Denmark)

    Simonsen, Bo Cerup; Pedersen, Preben Terndrup

    1997-01-01

    The paper deals with analysis of grounding of high-speed crafts. It is the purpose to present a comprehensive mathematical model for calculation of the overall dynamic ship response during grounding. This procedure is applied to derive the motions, the time varying sectional forces and the local...... loads during grounding on plane, sloping, sandy bottoms for six different designs of fast monohull ships made from steel, aluminium or GRP sandwich materials. The results show that the effect of the hull flexibility is to reduce the overall dynamic sectional loads on the hull girder. The considered...... numerical examples also indicate that, even with impact speeds of 40 knots against a 1:10 sloping bottom, the global strength of the hull girder is not exceeded by the grounding induced loads.For the local deformation of high-speed ship hulls at the point of contact with the ground, the paper presents...

  10. 20 CFR 416.1603 - How to prove you are a resident of the United States.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false How to prove you are a resident of the United States. 416.1603 Section 416.1603 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SUPPLEMENTAL... as— (1) Property, income, or other tax forms or receipts; (2) Utility bills, leases or rent payment...

  11. Digital Still Transect Images from the Hawaii Coral Reef Assessment and Monitoring Program (CRAMP): Data from 2004 (NODC Accession 0037908)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset consists of video transect images (JPG files) from CRAMP surveys taken in 2004 at 6 sites, some of which had multiple depths. Digital images are...

  12. 46 CFR 111.05-13 - Grounding connection.

    Science.gov (United States)

    2010-10-01

    ... Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING ELECTRIC SYSTEMS-GENERAL REQUIREMENTS Equipment Ground, Ground Detection, and Grounded Systems § 111.05-13 Grounding... power sources operating in parallel in the system. ...

  13. Using aetnanova to formally prove that the Davis-Putnam satisfiability test is correct

    Directory of Open Access Journals (Sweden)

    Eugenio G. Omodeo

    2008-05-01

    Full Text Available This paper reports on using the ÆtnaNova/Referee proof-verification system to formalize issues regarding the satisfiability of CNF-formulae of propositional logic. We specify an “archetype” version of the Davis-Putnam-Logemann-Loveland algorithm through the THEORY of recursive functions based on a well-founded relation, and prove it to be correct.Within the same framework, and by resorting to the Zorn lemma, we develop a straightforward proof of the compactness theorem.

  14. Using Simulated Ground Motions to Constrain Near-Source Ground Motion Prediction Equations in Areas Experiencing Induced Seismicity

    Science.gov (United States)

    Bydlon, S. A.; Dunham, E. M.

    2016-12-01

    Recent increases in seismic activity in historically quiescent areas such as Oklahoma, Texas, and Arkansas, including large, potentially induced events such as the 2011 Mw 5.6 Prague, OK, earthquake, have spurred the need for investigation into expected ground motions associated with these seismic sources. The neoteric nature of this seismicity increase corresponds to a scarcity of ground motion recordings within 50 km of earthquakes Mw 3.0 and greater, with increasing scarcity at larger magnitudes. Gathering additional near-source ground motion data will help better constraints on regional ground motion prediction equations (GMPEs) and will happen over time, but this leaves open the possibility of damaging earthquakes occurring before potential ground shaking and seismic hazard in these areas are properly understood. To aid the effort of constraining near-source GMPEs associated with induced seismicity, we integrate synthetic ground motion data from simulated earthquakes into the process. Using the dynamic rupture and seismic wave propagation code waveqlab3d, we perform verification and validation exercises intended to establish confidence in simulated ground motions for use in constraining GMPEs. We verify the accuracy of our ground motion simulator by performing the PEER/SCEC layer-over-halfspace comparison problem LOH.1 Validation exercises to ensure that we are synthesizing realistic ground motion data include comparisons to recorded ground motions for specific earthquakes in target areas of Oklahoma between Mw 3.0 and 4.0. Using a 3D velocity structure that includes a 1D structure with additional small-scale heterogeneity, the properties of which are based on well-log data from Oklahoma, we perform ground motion simulations of small (Mw 3.0 - 4.0) earthquakes using point moment tensor sources. We use the resulting synthetic ground motion data to develop GMPEs for small earthquakes in Oklahoma. Preliminary results indicate that ground motions can be amplified

  15. Modernization of the Cassini Ground System

    Science.gov (United States)

    Razo, Gus; Fujii, Tammy

    2014-01-01

    The Cassini Spacecraft and its ground system have been operational for over 16 years. Modernization presents several challenges due to the personnel, processes, and tools already invested and embedded into the current ground system structure. Every mission's ground system has its own unique complexities and challenges, involving various organizational units. As any mission from its inception to its execution, schedules are always tight. This forces GDS engineers to implement a working ground system that is not necessarily fully optimized. Ground system challenges increase as technology evolves and cyber threats become more sophisticated. Cassini's main challenges were due to its ground system existing before many security requirements were levied on the multi-mission tools and networks. This caused a domino effect on Cassini GDS tools that relied on outdated technological features. In the aerospace industry reliable and established technology is preferred over innovative yet less proven technology. Loss of data for a spacecraft mission can be catastrophic; therefore, there is a reluctance to make changes and updates to the ground system. Nevertheless, all missions and associated teams face the need to modernize their processes and tools. Systems development methods from well-known system analysis and design principles can be applied to many missions' ground systems. Modernization should always be considered, but should be done in such a way that it does not affect flexibility nor interfere with established practices. Cassini has accomplished a secure and efficient ground data system through periodic updates. The obstacles faced while performing the modernization of the Cassini ground system will be outlined, as well as the advantages and challenges that were encountered.

  16. Current status of ground source heat pumps and underground thermal energy storage in Europe

    Energy Technology Data Exchange (ETDEWEB)

    Sanner, B. [Justus Liebig University, Giessen (Germany). Institute of Applied Geosciences; Karytsas, C.; Mendrinos, D. [Center for Renewable Energy Sources, Pikermi (Greece); Rybach, L. [Geowatt AG, Zurich (Switzerland)

    2003-12-01

    Geothermal Heat Pumps, or Ground Coupled Heat Pumps (GCHP), are systems combining a heat pump with a ground heat exchanger (closed loop systems), or fed by ground water from a well (open loop systems). They use the earth as a heat source when operating in heating mode, with a fluid (usually water or a water-antifreeze mixture) as the medium that transfers the heat from the earth to the evaporator of the heat pump, thus utilising geothermal energy. In cooling mode, they use the earth as a heat sink. With Borehole Heat Exchangers (BHE), geothermal heat pumps can offer both heating and cooling at virtually any location, with great flexibility to meet any demands. More than 20 years of R and D focusing on BUE in Europe has resulted in a well-established concept of sustainability for this technology, as well as sound design and installation criteria. Recent developments are the Thermal Response Test, which allows in-situ-determination of ground thermal properties for design purposes, and thermally enhanced grouting materials to reduce borehole thermal resistance. For cooling purposes, but also for the storage of solar or waste heat, the concept of underground thermal energy storage (UTES) could prove successful. Systems can be either open (aquifer storage) or can use BHE (borehole storage). Whereas cold storage is already established on the market, heat storage, and, in particular, high temperature heat storage (> 50{sup o}C) is still in the demonstration phase. Despite the fact that geothermal heat pumps have been in use for over 50 years now (the first were in the USA), market penetration of this technology is still in its infancy, with fossil fuels dominating the space heating market and air-to-air heat pumps that of space cooling. In Germany, Switzerland, Austria, Sweden, Denmark, Norway, France and the USA, large numbers of geothermal heat pumps are already operational, and installation guidelines, quality control and contractor certification are now major issues

  17. Ground motion predictions

    Energy Technology Data Exchange (ETDEWEB)

    Loux, P C [Environmental Research Corporation, Alexandria, VA (United States)

    1969-07-01

    Nuclear generated ground motion is defined and then related to the physical parameters that cause it. Techniques employed for prediction of ground motion peak amplitude, frequency spectra and response spectra are explored, with initial emphasis on the analysis of data collected at the Nevada Test Site (NTS). NTS postshot measurements are compared with pre-shot predictions. Applicability of these techniques to new areas, for example, Plowshare sites, must be questioned. Fortunately, the Atomic Energy Commission is sponsoring complementary studies to improve prediction capabilities primarily in new locations outside the NTS region. Some of these are discussed in the light of anomalous seismic behavior, and comparisons are given showing theoretical versus experimental results. In conclusion, current ground motion prediction techniques are applied to events off the NTS. Predictions are compared with measurements for the event Faultless and for the Plowshare events, Gasbuggy, Cabriolet, and Buggy I. (author)

  18. Ground motion predictions

    International Nuclear Information System (INIS)

    Loux, P.C.

    1969-01-01

    Nuclear generated ground motion is defined and then related to the physical parameters that cause it. Techniques employed for prediction of ground motion peak amplitude, frequency spectra and response spectra are explored, with initial emphasis on the analysis of data collected at the Nevada Test Site (NTS). NTS postshot measurements are compared with pre-shot predictions. Applicability of these techniques to new areas, for example, Plowshare sites, must be questioned. Fortunately, the Atomic Energy Commission is sponsoring complementary studies to improve prediction capabilities primarily in new locations outside the NTS region. Some of these are discussed in the light of anomalous seismic behavior, and comparisons are given showing theoretical versus experimental results. In conclusion, current ground motion prediction techniques are applied to events off the NTS. Predictions are compared with measurements for the event Faultless and for the Plowshare events, Gasbuggy, Cabriolet, and Buggy I. (author)

  19. Thermal and antimicrobial properties of chitosan-nanocellulose films for extending shelf life of ground meat.

    Science.gov (United States)

    Dehnad, Danial; Mirzaei, Habibollah; Emam-Djomeh, Zahra; Jafari, Seid-Mahdi; Dadashi, Saeed

    2014-08-30

    Chitosan-nanocellulose biocomposites were prepared from chitosan having molecular weight of 600-800 kDa, nanocellulose with 20-50 nm diameters and various levels of 30, 60 and 90% (v/wCHT) for glycerol. Agitation and sonication were used to facilitate even dispersion of particles in the polymer matrix. The nanocomposites were examined by differential scanning calorimetry, X-ray diffraction and agar disc diffusion tests; finally, the film was applied on the surface of ground meat to evaluate its performance in real terms. Chitosan-nanocellulose nanocomposites showed high Tg range of 115-124°C and were able to keep their solid state until the temperature (Tm) range of 97-99°C. XRD photographs revealed that nanocellulose peak completely disappeared after their addition to chitosan context. Agar disc diffusion method proved that the nancomposite had inhibitory effects against both gram-positive (S. aureus) and gram-negative (E. coli and S. enteritidis) bacteria through its contact area. Application of chitosan-nanocellulose nanocomposite on the ground meat decreased lactic acid bacteria population compared with nylon packaged samples up to 1.3 and 3.1 logarithmic cycles at 3 and 25°C after 6 days of storage, respectively. Copyright © 2014 Elsevier Ltd. All rights reserved.

  20. The Development of Constructivist Grounded Theory

    OpenAIRE

    Jane Mills; Ann Bonner; Karen Francis

    2006-01-01

    Constructivist grounded theory is a popular method for research studies primarily in the disciplines of psychology, education, and nursing. In this article, the authors aim to locate the roots of constructivist grounded theory and then trace its development. They examine key grounded theory texts to discern their ontological and epistemological orientation. They find Strauss and Corbin's texts on grounded theory to possess a discernable thread of constructivism in their approach to inquiry. T...

  1. Ground and excited state properties of high performance anthocyanidin dyes-sensitized solar cells in the basic solutions

    Energy Technology Data Exchange (ETDEWEB)

    Prima, Eka Cahya [Advanced Functional Material Laboratory, Engineering Physics, Institut Teknologi Bandung (Indonesia); Computational Material Design and Quantum Engineering Laboratory, Engineering Physics, Institut Teknologi Bandung (Indonesia); International Program on Science Education, Universitas Pendidikan Indonesia (Indonesia); Yuliarto, Brian; Suyatman, E-mail: yatman@tf.itb.ac.id [Advanced Functional Material Laboratory, Engineering Physics, Institut Teknologi Bandung (Indonesia); Dipojono, Hermawan Kresno [Computational Material Design and Quantum Engineering Laboratory, Engineering Physics, Institut Teknologi Bandung (Indonesia)

    2015-09-30

    The aglycones of anthocyanidin dyes were previously reported to form carbinol pseudobase, cis-chalcone, and trans-chalcone due to the basic levels. The further investigations of ground and excited state properties of the dyes were characterized using density functional theory with PCM(UFF)/B3LYP/6-31+G(d,p) level in the basic solutions. However, to the best of our knowledge, the theoretical investigation of their potential photosensitizers has never been reported before. In this paper, the theoretical photovoltaic properties sensitized by dyes have been successfully investigated including the electron injections, the ground and excited state oxidation potentials, the estimated open circuit voltages, and the light harvesting efficiencies. The results prove that the electronic properties represented by dyes’ LUMO-HOMO levels will affect to the photovoltaic performances. Cis-chalcone dye is the best anthocyanidin aglycone dye with the electron injection spontaneity of −1.208 eV, the theoretical open circuit voltage of 1.781 V, and light harvesting efficiency of 56.55% due to the best HOMO-LUMO levels. Moreover, the ethanol solvent slightly contributes to the better cell performance than the water solvent dye because of the better oxidation potential stabilization in the ground state as well as in the excited state. These results are in good agreement with the known experimental report that the aglycones of anthocyanidin dyes in basic solvent are the high potential photosensitizers for dye-sensitized solar cell.

  2. Digital Still Transect Images from the Hawaii Coral Reef Assessment and Monitoring Program (CRAMP) Maui 2006 (NODC Accession 0039627)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset consists of digital still transect images (JPG files) from CRAMP surveys taken on Maui in 2006 at 8 sites, some of which had multiple depths. Surveys...

  3. Parkinson's Disease Videos

    Medline Plus

    Full Text Available ... About Sexual Dysfunction? Attachment: consultation.jpg Help is just a click away. The PD Library is an ... parkinson.org Press Room Ask a Doctor Sign In Privacy & Terms Contact Us Connect With Us: Press ...

  4. Parkinson's Disease Videos

    Medline Plus

    Full Text Available ... I Talk to My Physician or Spouse About Sexual Dysfunction? Attachment: consultation.jpg Betsaida Cruz, PT, Long ... 2 How Do PD and Its Treatment Affect Sexual Functioning? Help is just a click away. The ...

  5. Parkinson's Disease Videos

    Medline Plus

    Full Text Available ... Participacion” How Do PD and Its Treatment Affect Sexual Functioning? What to Expect Emotionally What Medications Help ... I Talk to My Physician or Spouse About Sexual Dysfunction? Attachment: consultation.jpg Help is just a ...

  6. Grounding Anger Management

    Directory of Open Access Journals (Sweden)

    Odis E. Simmons, PhD

    2017-06-01

    Full Text Available One of the things that drew me to grounded theory from the beginning was Glaser and Strauss’ assertion in The Discovery of Grounded Theory that it was useful as a “theoretical foothold” for practical applications (p. 268. From this, when I was a Ph.D student studying under Glaser and Strauss in the early 1970s, I devised a GT based approach to action I later came to call “grounded action.” In this short paper I’ll present a very brief sketch of an anger management program I developed in 1992, using grounded action. I began my research by attending a two-day anger management training workshop designed for training professionals in the most commonly used anger management model. Like other intervention programs I had seen, this model took a psychologizing and pathologizing approach to the issue. Following this, I sat through the full course of an anger management program that used this model, observing the reactions of the participants and the approach of the facilitator. Following each session I conducted open-ended interviews with most of the participants, either individually or in groups of two or three. I had also done previous research in counseling and social work contexts that turned out to be very relevant to an anger management program design.

  7. Nonlinear Schrodinger equation: A testing ground for the quantization of nonlinear waves

    International Nuclear Information System (INIS)

    Klein, A.; Krejs, F.

    1976-01-01

    Quantization of the nonlinear Schrodinger equation is carried out by the method due to Kerman and Klein. A viable procedure is inferred from the quantum interpretation of the classical (soliton) solution. The ground-state energy for a system with n particles is calculated to an accuracy which includes the first quantum correction to the semiclassical result. It is demonstrated that the exact answer can be obtained systematically only at the next level of approximation. For the calculation of the first quantum correction, the quantum theory of the stability of periodic orbits in field theory is developed and discussed. Since one is dealing with a finite many-body problem, the field theory can be written so that no infinite terms are encountered, but the Hamiltonian can also be artificially rearranged so as to destory this feature. For learning purposes the calculations are carried out with the various alternatives, and our methods prove capable of providing a uniform final result

  8. Motor sport in France: testing-ground for the world.

    Science.gov (United States)

    Cofaigh, Eamon O

    2011-01-01

    The birth of the automobile in the late nineteenth century was greeted with a mixture of awe, scepticism and sometimes even disdain from sections of the European public. In this article, the steps taken in France to pioneer and promote this new invention are examined. Unreliable and noisy, the early automobile owes a debt of gratitude to the French aristocracy who organised and codified motor racing in an effort to test these new inventions while at the same time introduce them to a wider public. City-to-city races demonstrated the potential of the automobile before the initiative of Gordon Bennett proved to be the catalyst for the birth of international motor sport as we recognise it today. Finally this article looks at the special connection between Le Mans and the automobile. Le Mans has, through its 24-hour race, maintained a strong link with the development of everyday automobile tourism and offers the enthusiast an alternative to the machines that reach incredible speeds on modern-day closed circuits. This article examines how French roads were veritable testing grounds for the earliest cars and how the public roads of Le Mans maintain the tradition to this day.

  9. Fractal geometry as a new approach for proving nanosimilarity: a reflection note.

    Science.gov (United States)

    Demetzos, Costas; Pippa, Natassa

    2015-04-10

    Nanosimilars are considered as new medicinal outcomes combining the generic drugs and the nanocarrier as an innovative excipient, in order to evaluate them as final products. They belong to the grey area - concerning the evaluation process - between generic drugs and biosimilar medicinal products. Generic drugs are well documented and a huge number of them are in market, replacing effectively the off-patent drugs. The scientific approach for releasing them to the market is based on bioequivalence studies, which are well documented and accepted by the regulatory agencies. On the other hand, the structural complexity of biological/biotechnology-derived products demands a new approach for the approval process taking into consideration that bioequivalence studies are not considered as sufficient as in generic drugs, and new clinical trials are needed to support their approval process of the product to the market. In proportion, due to technological complexity of nanomedicines, the approaches for proving the statistical identity or the similarity for generic and biosimilar products, respectively, with those of prototypes, are not considered as effective for nanosimilar products. The aim of this note is to propose a complementary approach which can provide realistic evidences concerning the nanosimilarity, based on fractal analysis. This approach is well fit with the structural complexity of nanomedicines and smooths the difficulties for proving the similarity between off-patent and nanosimilar products. Fractal analysis could be considered as the approach that completely characterizes the physicochemical/morphological characteristics of nanosimilar products and could be proposed as a start point for a deep discussion on nanosimilarity. Copyright © 2015 Elsevier B.V. All rights reserved.

  10. Ground-Water Availability in the United States

    Science.gov (United States)

    Reilly, Thomas E.; Dennehy, Kevin F.; Alley, William M.; Cunningham, William L.

    2008-01-01

    Ground water is among the Nation's most important natural resources. It provides half our drinking water and is essential to the vitality of agriculture and industry, as well as to the health of rivers, wetlands, and estuaries throughout the country. Large-scale development of ground-water resources with accompanying declines in ground-water levels and other effects of pumping has led to concerns about the future availability of ground water to meet domestic, agricultural, industrial, and environmental needs. The challenges in determining ground-water availability are many. This report examines what is known about the Nation's ground-water availability and outlines a program of study by the U.S. Geological Survey Ground-Water Resources Program to improve our understanding of ground-water availability in major aquifers across the Nation. The approach is designed to provide useful regional information for State and local agencies who manage ground-water resources, while providing the building blocks for a national assessment. The report is written for a wide audience interested or involved in the management, protection, and sustainable use of the Nation's water resources.

  11. Ground effect aerodynamics of racing cars

    OpenAIRE

    Zhang, Xin; Toet, Willem; Zerihan, Jonathan

    2006-01-01

    We review the progress made during the last thirty years on ground effect aerodynamics associated with race cars, in particular open wheel race cars. Ground effect aerodynamics of race cars is concerned with generating downforce, principally via low pressure on the surfaces nearest to the ground. The “ground effected” parts of an open wheeled car's aerodynamics are the most aerodynamically efficient and contribute less drag than that associated with, for example, an upper rear wing. Whilst dr...

  12. Pesticides in Ground Water

    DEFF Research Database (Denmark)

    Bjerg, Poul Løgstrup

    1996-01-01

    Review af: Jack E. Barbash & Elizabeth A. Resek (1996). Pesticides in Ground Water. Distribution trends and governing factors. Ann Arbor Press, Inc. Chelsea, Michigan. pp 588.......Review af: Jack E. Barbash & Elizabeth A. Resek (1996). Pesticides in Ground Water. Distribution trends and governing factors. Ann Arbor Press, Inc. Chelsea, Michigan. pp 588....

  13. The Building Blocks of Life Move from Ground to Tree to Animal and Back to Ground

    Science.gov (United States)

    Davidson, E. A.

    2015-12-01

    I generally use combinations of big words to describe my science, such as biogeochemistry, ecosystem ecology, nutrient cycling, stoichiometry, tropical deforestation, land-use change, agricultural intensification, eutrophication, greenhouse gas emissions, and sustainable development. I didn't expect to use any of these words, but I was surprised that I couldn't use some others that seem simple enough to me, such as farm, plant, soil, and forest. I landed on "building blocks" as my metaphor for the forms of carbon, nitrogen, phosphorus, and other elements that I study as they cycle through and among ecosystems. I study what makes trees and other kinds of life grow. We all know that they need the sun and that they take up water from the ground, but what else do trees need from the ground? What do animals that eat leaves and wood get from the trees? Just as we need building blocks to grow our bodies, trees and animals also need building blocks for growing their bodies. Trees get part of their building blocks from the ground and animals get theirs from what they eat. When animals poop and when leaves fall, some of their building blocks return to the ground. When they die, their building blocks also go back to the ground. I also study what happens to the ground, the water, and the air when we cut down trees, kill or shoo away the animals, and make fields to grow our food. Can we grow enough food and still keep the ground, water, and air clean? I think the answer is yes, but it will take better understanding of how all of those building blocks fit together and move around, from ground to tree to animal and back to ground.

  14. Study of borehole probing methods to improve the ground characterization

    Science.gov (United States)

    Naeimipour, Ali

    Collecting geological information allows for optimizing ground control measures in underground structures. This includes understanding of the joints and discontinuities and rock strength to develop rock mass classifications. An ideal approach to collect such information is through correlating the drilling data from the roofbolters to assess rock strength and void location and properties. The current instrumented roofbolters are capable of providing some information on these properties but not fully developed for accurate ground characterization. To enhance existing systems additional instrumentation and testing was conducted in laboratory and field conditions. However, to define the geology along the boreholes, the use of probing was deemed to be most efficient approach for locating joints and structures in the ground and evaluation of rock strength. Therefore, this research focuses on selection and evaluation of proper borehole probes that can offer a reliable assessment of rock mass structure and rock strength. In particular, attention was paid to borehole televiewer to characterize rock mass structures and joints and development of mechanical rock scratcher for determination of rock strength. Rock bolt boreholes are commonly drilled in the ribs and the roof of underground environments. They are often small (about 1.5 inches) and short (mostly 2-3 meter). Most of them are oriented upward and thus, mostly dry or perhaps wet but not filled with water. No suitable system is available for probing in such conditions to identify the voids/joints and specifically to measure rock strength for evaluation of rock mass and related optimization of ground support design. A preliminary scan of available borehole probes proved that the best options for evaluation of rock structure is through analysis of borehole images, captured by optical televiewers. Laboratory and field trials with showed that these systems can be used to facilitate measurement of the location, frequency and

  15. Seismic proving test of ultimate piping strength (current status of preliminary tests)

    International Nuclear Information System (INIS)

    Suzuki, K.; Namita, Y.; Abe, H.; Ichihashi, I.; Suzuki, K.; Ishiwata, M.; Fujiwaka, T.; Yokota, H.

    2001-01-01

    In 1998 Fiscal Year, the 6 year program of piping tests was initiated with the following objectives: i) to clarify the elasto-plastic response and ultimate strength of nuclear piping, ii) to ascertain the seismic safety margin of the current seismic design code for piping, and iii) to assess new allowable stress rules. In order to resolve extensive technical issues before proceeding on to the seismic proving test of a large-scale piping system, a series of preliminary tests of materials, piping components and simplified piping systems is intended. In this paper, the current status of the material tests and the piping component tests is reported. (author)

  16. Mapping the spatial pattern of temperate forest above ground biomass by integrating airborne lidar with Radarsat-2 imagery via geostatistical models

    Science.gov (United States)

    Li, Wang; Niu, Zheng; Gao, Shuai; Wang, Cheng

    2014-11-01

    Light Detection and Ranging (LiDAR) and Synthetic Aperture Radar (SAR) are two competitive active remote sensing techniques in forest above ground biomass estimation, which is important for forest management and global climate change study. This study aims to further explore their capabilities in temperate forest above ground biomass (AGB) estimation by emphasizing the spatial auto-correlation of variables obtained from these two remote sensing tools, which is a usually overlooked aspect in remote sensing applications to vegetation studies. Remote sensing variables including airborne LiDAR metrics, backscattering coefficient for different SAR polarizations and their ratio variables for Radarsat-2 imagery were calculated. First, simple linear regression models (SLR) was established between the field-estimated above ground biomass and the remote sensing variables. Pearson's correlation coefficient (R2) was used to find which LiDAR metric showed the most significant correlation with the regression residuals and could be selected as co-variable in regression co-kriging (RCoKrig). Second, regression co-kriging was conducted by choosing the regression residuals as dependent variable and the LiDAR metric (Hmean) with highest R2 as co-variable. Third, above ground biomass over the study area was estimated using SLR model and RCoKrig model, respectively. The results for these two models were validated using the same ground points. Results showed that both of these two methods achieved satisfactory prediction accuracy, while regression co-kriging showed the lower estimation error. It is proved that regression co-kriging model is feasible and effective in mapping the spatial pattern of AGB in the temperate forest using Radarsat-2 data calibrated by airborne LiDAR metrics.

  17. 7 CFR 65.160 - Ground chicken.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Ground chicken. 65.160 Section 65.160 Agriculture... OF BEEF, PORK, LAMB, CHICKEN, GOAT MEAT, PERISHABLE AGRICULTURAL COMMODITIES, MACADAMIA NUTS, PECANS, PEANUTS, AND GINSENG General Provisions Definitions § 65.160 Ground chicken. Ground chicken means...

  18. 33 CFR 183.415 - Grounding.

    Science.gov (United States)

    2010-07-01

    ... SAFETY BOATS AND ASSOCIATED EQUIPMENT Electrical Systems Manufacturer Requirements § 183.415 Grounding. If a boat has more than one gasoline engine, grounded cranking motor circuits must be connected to...

  19. Parkinson's Disease Videos

    Medline Plus

    Full Text Available ... to Know? Why Is Comprehensive Care or Team Approach Important? 2013 PSA Featuring Katie Couric What Are ... About Sexual Dysfunction? Attachment: consultation.jpg OHSU - Therapeutic Approaches for PD: Depression, Anxiety & Psychosis CareMAP: Travel and ...

  20. Parkinson's Disease Videos

    Medline Plus

    Full Text Available ... library Topic Type Living Alone: Home Safety and Management in PD Expert Briefings: Marijuana and PD: What ... consultation.jpg NPF Caregiver Summit 2016: Tools For Family Caregivers: Caremap and Caring & Coping CareMAP: Balancing Life ...

  1. Parkinson's Disease Videos

    Medline Plus

    Full Text Available ... Nonmotor Symptoms of Parkinson's Disease Expert Briefings: Gait, Balance and Falls in Parkinson's Disease Expert Briefings: Coping ... About Sexual Dysfunction? Attachment: consultation.jpg CareMAP: Balancing Life and Caregiving What Medications Help with Cognitive Impairment? ...

  2. 7 CFR 65.170 - Ground lamb.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Ground lamb. 65.170 Section 65.170 Agriculture... OF BEEF, PORK, LAMB, CHICKEN, GOAT MEAT, PERISHABLE AGRICULTURAL COMMODITIES, MACADAMIA NUTS, PECANS, PEANUTS, AND GINSENG General Provisions Definitions § 65.170 Ground lamb. Ground lamb means comminuted...

  3. 7 CFR 65.165 - Ground goat.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Ground goat. 65.165 Section 65.165 Agriculture... OF BEEF, PORK, LAMB, CHICKEN, GOAT MEAT, PERISHABLE AGRICULTURAL COMMODITIES, MACADAMIA NUTS, PECANS, PEANUTS, AND GINSENG General Provisions Definitions § 65.165 Ground goat. Ground goat means comminuted...

  4. Grounded Theory in Medical Education Research.

    Science.gov (United States)

    Tavakol, Mohsen; Torabi, Sima; Akbar Zeinaloo, Ali

    2006-12-01

    The grounded theory method provides a systematic way to generate theoretical constructs or concepts that illuminate psychosocial processes common to individual who have a similar experience of the phenomenon under investigation. There has been an increase in the number of published research reports that use the grounded theory method. However, there has been less medical education research, which is based on the grounded theory tradition. The purpose of this paper is to introduce basic tenants of qualitative research paradigm with specific reference to ground theory. The paper aims to encourage readers to think how they might possibly use the grounded theory method in medical education research and to apply such a method to their own areas of interest. The important features of a grounded theory as well as its implications for medical education research are explored. Data collection and analysis are also discussed. It seems to be reasonable to incorporate knowledge of this kind in medical education research.

  5. 30 CFR 77.801 - Grounding resistors.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Grounding resistors. 77.801 Section 77.801 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR COAL MINE SAFETY AND HEALTH...-Voltage Distribution § 77.801 Grounding resistors. The grounding resistor, where required, shall be of the...

  6. Ground states of a spin-boson model

    International Nuclear Information System (INIS)

    Amann, A.

    1991-01-01

    Phase transition with respect to ground states of a spin-boson Hamiltonian are investigated. The spin-boson model under discussion consists of one spin and infinitely many bosons with a dipole-type coupling. It is shown that the order parameter of the model vanishes with respect to arbitrary ground states if it vanishes with respect to ground states obtained as (biased) temperature to zero limits of thermic equilibrium states. The ground states of the latter special type have been investigated by H. Spohn. Spohn's respective phase diagrams are therefore valid for arbitrary ground states. Furthermore, disjointness of ground states in the broken symmetry regime is examined

  7. Ground experimental investigations into an ejected spray cooling system for space closed-loop application

    Directory of Open Access Journals (Sweden)

    Zhang Hongsheng

    2016-06-01

    Full Text Available Spray cooling has proved its superior heat transfer performance in removing high heat flux for ground applications. However, the dissipation of vapor–liquid mixture from the heat surface and the closed-loop circulation of the coolant are two challenges in reduced or zero gravity space environments. In this paper, an ejected spray cooling system for space closed-loop application was proposed and the negative pressure in the ejected condenser chamber was applied to sucking the two-phase mixture from the spray chamber. Its ground experimental setup was built and experimental investigations on the smooth circle heat surface with a diameter of 5 mm were conducted with distilled water as the coolant spraying from a nozzle of 0.51 mm orifice diameter at the inlet temperatures of 69.2 °C and 78.2 °C under the conditions of heat flux ranging from 69.76 W/cm2 to 311.45 W/cm2, volume flow through the spray nozzle varying from 11.22 L/h to 15.76 L/h. Work performance of the spray nozzle and heat transfer performance of the spray cooling system were analyzed; results show that this ejected spray cooling system has a good heat transfer performance and provides valid foundation for space closed-loop application in the near future.

  8. Modelling man-made ground to link the above- and below- ground urban domains

    NARCIS (Netherlands)

    Schokker, J.

    2017-01-01

    This report describes the results of STSM TU1206-36204. During a visit to GEUS (DK) between 23 and 27 January 2017, Jeroen Schokker (TNO-GSN, NL) has focussed on the modelling of man-made ground as a linking pin between the above- and below-ground urban domains. Key results include: • Man-made

  9. Parkinson's Disease Videos

    Medline Plus

    Full Text Available ... Spouse About Sexual Dysfunction? Attachment: consultation.jpg OHSU - Therapeutic Approaches for PD: Depression, Anxiety & Psychosis What Is the Relationship Between Depression and Parkinson's Disease? CareMAP: Travel and Transportation: Part 2 Hallucinations and Delusions CareMAP: ...

  10. THE VEGETATION ON BADLANDS OF "VARICOLORI" CLAYS IN THE MOLISE REGION (ITALY - FRAMEWORK AND INTERPRETATION

    Directory of Open Access Journals (Sweden)

    F. LUCCHESE

    2003-01-01

    Full Text Available

    jpg" alt="fanelli_g._et_al._512" width="512" height="357" />

  11. Hawaii Coral Reef Assessment and Monitoring Program (CRAMP): digital still images from transects on Maui, Molokai, and Kauai, 2007 (NODC Accession 0056791)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset consists of digital still transect images (JPG files) from CRAMP surveys taken in 2007 from 9 sites on Maui, 3 sites on Molokai, and 1 site on Kauai....

  12. Identification of resonant earthquake ground motion

    Indian Academy of Sciences (India)

    Resonant ground motion has been observed in earthquake records measured at several parts of the world. This class of ground motion is characterized by its energy being contained in a narrow frequency band. This paper develops measures to quantify the frequency content of the ground motion using the entropy ...

  13. Wind tunnel experiments to prove a hydraulic passive torque control concept for variable speed wind turbines

    NARCIS (Netherlands)

    Diepeveen, N.F.B.; Jarquin-Laguna, A.

    2014-01-01

    In this paper the results are presented of experiments to prove an innovative concept for passive torque control of variable speed wind turbines using fluid power technology. It is demonstrated that by correctly configuring the hydraulic drive train, the wind turbine rotor operates at or near

  14. 20 CFR 1002.33 - Does the employee have to prove that the employer discriminated against him or her in order to be...

    Science.gov (United States)

    2010-04-01

    ... employer discriminated against him or her in order to be eligible for reemployment? 1002.33 Section 1002.33... have to prove that the employer discriminated against him or her in order to be eligible for reemployment? No. The employee is not required to prove that the employer discriminated against him or her...

  15. Ground Water and Climate Change

    Science.gov (United States)

    Taylor, Richard G.; Scanlon, Bridget; Doell, Petra; Rodell, Matt; van Beek, Rens; Wada, Yoshihide; Longuevergne, Laurent; Leblanc, Marc; Famiglietti, James S.; Edmunds, Mike; hide

    2013-01-01

    As the world's largest distributed store of fresh water, ground water plays a central part in sustaining ecosystems and enabling human adaptation to climate variability and change. The strategic importance of ground water for global water and food security will probably intensify under climate change as more frequent and intense climate extremes (droughts and floods) increase variability in precipitation, soil moisture and surface water. Here we critically review recent research assessing the impacts of climate on ground water through natural and human-induced processes as well as through groundwater-driven feedbacks on the climate system. Furthermore, we examine the possible opportunities and challenges of using and sustaining groundwater resources in climate adaptation strategies, and highlight the lack of groundwater observations, which, at present, limits our understanding of the dynamic relationship between ground water and climate.

  16. Ground-water monitoring under RCRA

    International Nuclear Information System (INIS)

    Coalgate, J.

    1993-11-01

    In developing a regulatory strategy for the disposal of hazardous waste under the Resource Conservation and Recovery Act (RCRA), protection of ground-water resources was the primary goal of the Environmental Protection Agency (EPA). EPA's ground-water protection strategy seeks to minimize the potential for hazardous wastes and hazardous constituents in waste placed in land disposel units to migrate into the environment. This is achieved through liquids management (limiting the placement of liquid wastes in or on the land, requiring the use of liners beneath waste, installing leachate collection systems and run-on and run-off controls, and covering wastes at closure). Ground-water monitoring serves to detect any failure in EPA's liquids management strategy so that ground-water contamination can be detected and addressed as soon as possible

  17. Using periodicity to mitigate ground vibration

    DEFF Research Database (Denmark)

    Andersen, Lars Vabbersgaard

    2015-01-01

    Introduction of trenches, barriers and wave impeding blocks on the transmission path between a source and receiver can be used for mitigation of ground vibration. However, to be effective a barrier must have a depth of about one wavelength of the waves to be mitigated. Hence, while great reductions......: A soil with periodic stiffening (ground improvement) and a ground with periodic changes in the surface elevation obtained by artificial landscaping. By means of a two-dimensional finite-element model, the stiffness and mass matrices are determined for a single cell of the ground with horizonal...

  18. Citrus-orchard ground harbours a diverse, well-established and abundant ground-dwelling spider fauna

    Energy Technology Data Exchange (ETDEWEB)

    Monzo, C.; Molla, O.; Vanaclocha, P.; Monton, H.; Melic, A.; Castanera, P.; Urbaneja, A.

    2011-07-01

    Ground-dwelling spider assemblages comprise one of the most representative predatory groups to be found in many crops. There is some evidence of the role that ground-dwelling spiders play in controlling certain citrus pests; however, there are almost no studies about the abundance and composition of this predatory group in citrus orchards. A three-year survey conducted using pitfall traps in three citrus orchards in Eastern Spain yielded more than five-thousand ground-dwelling spiders belonging to more than 50 species and 20 families. Wandering families such as Lycosidae, Gnaphosidae and Zodariidae were the most numerous in terms of captures. The generalist predator Pardosa cribata Simon (Araneae: Lycosidae) was the most common species, representing a quarter of all captures, followed by Zodarion cesari Pekar. (Araneae: Zodariidae) and Trachyzelotes fuscipes (Koch) (Araneae: Gnaphosidae). Spiders were active throughout the year with a peak population in summer. The species abundance data for the three spider assemblages sampled fitted a log normal statistical model which is consistent with a well-established community. The presence of a cover crop provided higher abundance of alternative prey and consequently higher abundance and diversity of ground-dwelling spiders. This work demonstrates that the citrus-orchard ground harbours a diverse and abundant ground-dwelling spider fauna, which is also active throughout the year. A challenge for future studies will be to establish conservation management strategies for these predators, that will improve biological control of those citrus pests that inhabit or spend part of their life cycle on the orchard floor. (Author) 49 refs.

  19. Hydrogeology, simulated ground-water flow, and ground-water quality, Wright-Patterson Air Force Base, Ohio

    Science.gov (United States)

    Dumouchelle, D.H.; Schalk, C.W.; Rowe, G.L.; De Roche, J.T.

    1993-01-01

    Ground water is the primary source of water in the Wright-Patterson Air Force Base area. The aquifer consists of glacial sands and gravels that fill a buried bedrock-valley system. Consolidated rocks in the area consist of poorly permeable Ordovician shale of the Richmondian stage, in the upland areas, the Brassfield Limestone of Silurian age. The valleys are filled with glacial sediments of Wisconsinan age consisting of clay-rich tills and coarse-grained outwash deposits. Estimates of hydraulic conductivity of the shales based on results of displacement/recovery tests range from 0.0016 to 12 feet per day; estimates for the glacial sediments range from less than 1 foot per day to more than 1,000 feet per day. Ground water flow from the uplands towards the valleys and the major rivers in the region, the Great Miami and the Mad Rivers. Hydraulic-head data indicate that ground water flows between the bedrock and unconsolidated deposits. Data from a gain/loss study of the Mad River System and hydrographs from nearby wells reveal that the reach of the river next to Wright-Patterson Air Force Base is a ground-water discharge area. A steady-state, three-dimensional ground-water-flow model was developed to simulate ground-water flow in the region. The model contains three layers and encompasses about 100 square miles centered on Wright-Patterson Air Force Base. Ground water enters the modeled area primarily by river leakage and underflow at the model boundary. Ground water exits the modeled area primarily by flow through the valleys at the model boundaries and through production wells. A model sensitivity analysis involving systematic changes in values of hydrologic parameters in the model indicates that the model is most sensitive to decreases in riverbed conductance and vertical conductance between the upper two layers. The analysis also indicates that the contribution of water to the buried-valley aquifer from the bedrock that forms the valley walls is about 2 to 4

  20. Efektivitas Instagram Common Grounds

    OpenAIRE

    Wifalin, Michelle

    2016-01-01

    Efektivitas Instagram Common Grounds merupakan rumusan masalah yang diambil dalam penelitian ini. Efektivitas Instagram diukur menggunakan Customer Response Index (CRI), dimana responden diukur dalam berbagai tingkatan, mulai dari awareness, comprehend, interest, intentions dan action. Tingkatan respons inilah yang digunakan untuk mengukur efektivitas Instagram Common Grounds. Teori-teori yang digunakan untuk mendukung penelitian ini yaitu teori marketing Public Relations, teori iklan, efekti...

  1. Ground-based photo monitoring

    Science.gov (United States)

    Frederick C. Hall

    2000-01-01

    Ground-based photo monitoring is repeat photography using ground-based cameras to document change in vegetation or soil. Assume those installing the photo location will not be the ones re-photographing it. This requires a protocol that includes: (1) a map to locate the monitoring area, (2) another map diagramming the photographic layout, (3) type and make of film such...

  2. Management of ground water using isotope techniques

    International Nuclear Information System (INIS)

    Romani, Saleem

    2004-01-01

    Ground water play a major role in national economy and sustenance of life and environment. Prevalent water crisis in India includes falling water table, water quality deterioration, water logging and salinity. Keeping in view the increasing thrust on groundwater resources and the present scenario of availability vis-a vis demand there is a need to reorient our approach to ground water management. The various ground water management options require proper understanding of ground water flow system. Isotopes are increasingly being applied in hydrogeological investigations as a supplementary tool for assessment of aquifer flow and transport characteristics. Isotope techniques coupled with conventional hydrogeological and hydrochemical methods can bring in greater accuracy in the conceptualization of hydrogeological control mechanism. The use of isotope techniques in following areas can certainly be of immense help in implementing various ground water management options in an efficient manner. viz.Interaction between the surface water - groundwater systems to plan conjunctive use of surface and ground water. Establishing hydraulic interconnections between the aquifers in a multi aquifer system. Depth of circulation of water and dating of ground water. Demarcating ground water recharge and discharge areas. Plan ground water development in coastal aquifers to avoid sea water ingress. Development of flood plain aquifer. (author)

  3. Ground ice conditions in Salluit, Northern Quebec

    Science.gov (United States)

    Allard, M.; Fortier, R.; Calmels, F.; Gagnon, O.; L'Hérault, E.

    2011-12-01

    large chunks of permafrost. Volumetric ice contents between 30 and 70% were measured in the till. In addition, low lying areas where till thickness exceeds ca 5 m contain polygons with ice wedges up to 2 m wide. Colluviums on slopes laid by sheet flow have been accumulating on two sectors of the study area, the source material being eroded clay at higher elevations; these slope sediments contain alternating layers of buried organics (C-14 date of 2300 BP at base of the sequence), silt and lenses of aggradational ice. Although the surface geophysical methods (electrical resistivity,GPR) were essential for mapping ice rich permafrost, the detailed appraisal of ground ice conditions was made truly possible by drilling and extracting intact cores. The use of the Cat-scan method proved very efficient for the precise and rapid measurement of ground ice contents and for imaging cryostructures on a large number of samples, thus providing exact information on permafrost composition and for interpreting permafrost history. The Salluit study also involves climate monitoring, thermal analysis and modeling, and intense community consultations.

  4. Navigating the grounded theory terrain. Part 1.

    Science.gov (United States)

    Hunter, Andrew; Murphy, Kathy; Grealish, Annmarie; Casey, Dympna; Keady, John

    2011-01-01

    The decision to use grounded theory is not an easy one and this article aims to illustrate and explore the methodological complexity and decision-making process. It explores the decision making of one researcher in the first two years of a grounded theory PhD study looking at the psychosocial training needs of nurses and healthcare assistants working with people with dementia in residential care. It aims to map out three different approaches to grounded theory: classic, Straussian and constructivist. In nursing research, grounded theory is often referred to but it is not always well understood. This confusion is due in part to the history of grounded theory methodology, which is one of development and divergent approaches. Common elements across grounded theory approaches are briefly outlined, along with the key differences of the divergent approaches. Methodological literature pertaining to the three chosen grounded theory approaches is considered and presented to illustrate the options and support the choice made. The process of deciding on classical grounded theory as the version best suited to this research is presented. The methodological and personal factors that directed the decision are outlined. The relative strengths of Straussian and constructivist grounded theories are reviewed. All three grounded theory approaches considered offer the researcher a structured, rigorous methodology, but researchers need to understand their choices and make those choices based on a range of methodological and personal factors. In the second article, the final methodological decision will be outlined and its research application described.

  5. Principle and Design of a Single-phase Inverter-Based Grounding System for Neutral-to-ground Voltage Compensation in Distribution Networks

    DEFF Research Database (Denmark)

    Wang, Wen; Yan, Lingjie; Zeng, Xiangjun

    2017-01-01

    Neutral-to-ground overvoltage may occur in non-effectively grounded power systems because of the distributed parameters asymmetry and resonance between Petersen coil and distributed capacitances. Thus, the constraint of neutral-to-ground voltage is critical for the safety of distribution networks....... In this paper, an active grounding system based on single-phase inverter and its control parameter design method is proposed to achieve this objective. Relationship between its output current and neutral-to-ground voltage is derived to explain the principle of neutral-to-ground voltage compensation. Then...

  6. Learn, see, practice, prove, do, maintain: an evidence-based pedagogical framework for procedural skill training in medicine.

    Science.gov (United States)

    Sawyer, Taylor; White, Marjorie; Zaveri, Pavan; Chang, Todd; Ades, Anne; French, Heather; Anderson, JoDee; Auerbach, Marc; Johnston, Lindsay; Kessler, David

    2015-08-01

    Acquisition of competency in procedural skills is a fundamental goal of medical training. In this Perspective, the authors propose an evidence-based pedagogical framework for procedural skill training. The framework was developed based on a review of the literature using a critical synthesis approach and builds on earlier models of procedural skill training in medicine. The authors begin by describing the fundamentals of procedural skill development. Then, a six-step pedagogical framework for procedural skills training is presented: Learn, See, Practice, Prove, Do, and Maintain. In this framework, procedural skill training begins with the learner acquiring requisite cognitive knowledge through didactic education (Learn) and observation of the procedure (See). The learner then progresses to the stage of psychomotor skill acquisition and is allowed to deliberately practice the procedure on a simulator (Practice). Simulation-based mastery learning is employed to allow the trainee to prove competency prior to performing the procedure on a patient (Prove). Once competency is demonstrated on a simulator, the trainee is allowed to perform the procedure on patients with direct supervision, until he or she can be entrusted to perform the procedure independently (Do). Maintenance of the skill is ensured through continued clinical practice, supplemented by simulation-based training as needed (Maintain). Evidence in support of each component of the framework is presented. Implementation of the proposed framework presents a paradigm shift in procedural skill training. However, the authors believe that adoption of the framework will improve procedural skill training and patient safety.

  7. Management Research and Grounded Theory: A review of grounded theorybuilding approach in organisational and management research.

    Directory of Open Access Journals (Sweden)

    Graham J.J. Kenealy, Ph.D.

    2008-06-01

    Full Text Available Grounded theory is a systematic methodology for the collection and analysis of data which was discovered by Glaser and Strauss in the 1960’s. The discovery of this method was first presented to the academic community in their book ‘The Discovery of Grounded Theory’ (1967 which still remains a primary point of reference for those undertaking qualitative research and grounded theory in particular. This powerful research method has become very popular in some research domains; whilst increasing in popularity it is still less prevalent in the field of organisational and management research particularly in its original form. This self reflexive paper sets out to explore the possibilities for this imbalance which takes the discussion onto the areas of methodological adaptation and training. It also enters the debate about access to research subjects and provides a succinct argument supporting the notion that grounded theory should simply be viewed as a method that develops empirically grounded conceptual theory.

  8. Death Valley regional ground-water flow system, Nevada and California -- hydrogeologic framework and transient ground-water flow model

    Science.gov (United States)

    Belcher, Wayne R.

    2004-01-01

    A numerical three-dimensional (3D) transient ground-water flow model of the Death Valley region was developed by the U.S. Geological Survey for the U.S. Department of Energy programs at the Nevada Test Site and at Yucca Mountain, Nevada. Decades of study of aspects of the ground-water flow system and previous less extensive ground-water flow models were incorporated and reevaluated together with new data to provide greater detail for the complex, digital model. A 3D digital hydrogeologic framework model (HFM) was developed from digital elevation models, geologic maps, borehole information, geologic and hydrogeologic cross sections, and other 3D models to represent the geometry of the hydrogeologic units (HGUs). Structural features, such as faults and fractures, that affect ground-water flow also were added. The HFM represents Precambrian and Paleozoic crystalline and sedimentary rocks, Mesozoic sedimentary rocks, Mesozoic to Cenozoic intrusive rocks, Cenozoic volcanic tuffs and lavas, and late Cenozoic sedimentary deposits of the Death Valley Regional Ground-Water Flow System (DVRFS) region in 27 HGUs. Information from a series of investigations was compiled to conceptualize and quantify hydrologic components of the ground-water flow system within the DVRFS model domain and to provide hydraulic-property and head-observation data used in the calibration of the transient-flow model. These studies reevaluated natural ground-water discharge occurring through evapotranspiration and spring flow; the history of ground-water pumping from 1913 through 1998; ground-water recharge simulated as net infiltration; model boundary inflows and outflows based on regional hydraulic gradients and water budgets of surrounding areas; hydraulic conductivity and its relation to depth; and water levels appropriate for regional simulation of prepumped and pumped conditions within the DVRFS model domain. Simulation results appropriate for the regional extent and scale of the model were

  9. Seismic proving tests on the reliability for large components and equipment of nuclear power plants

    International Nuclear Information System (INIS)

    Ohno, Tokue; Tanaka, Nagatoshi

    1988-01-01

    Since Japan has destructive earthquakes frequently, the structural reliability for large components and equipment of nuclear power plants are rigorously required. They are designed using sophisticated seismic analyses and have not yet encountered a destructive earthquake. When nuclear power plants are planned, it is very important that the general public understand the structural reliability during and after an earthquake. Seismic Proving Tests have been planned by Ministry of International Trade and Industry (Miti) to comply with public requirement in Japan. A large-scale high-performance vibration table was constructed at Tasted Engineering Laboratory of Nuclear Power Engineering Test Center (NU PEC), in order to prove the structural reliability by vibrating the test model (of full scale or close to the actual size) in the condition of a destructive earthquake. As for the test models, the following four items were selected out of large components and equipment important to the safety: Reactor Containment Vessel; Primary Coolant Loop or Primary Loop Recirculation System; Reactor Pressure Vessel; and Reactor Core Internals. Here is described a brief of the vibration table, the test method and the results of the tests on PWR Reactor Containment Vessel and BWR Primary Loop Recirculation System (author)

  10. Figure-ground segmentation can occur without attention.

    Science.gov (United States)

    Kimchi, Ruth; Peterson, Mary A

    2008-07-01

    The question of whether or not figure-ground segmentation can occur without attention is unresolved. Early theorists assumed it can, but the evidence is scant and open to alternative interpretations. Recent research indicating that attention can influence figure-ground segmentation raises the question anew. We examined this issue by asking participants to perform a demanding change-detection task on a small matrix presented on a task-irrelevant scene of alternating regions organized into figures and grounds by convexity. Independently of any change in the matrix, the figure-ground organization of the scene changed or remained the same. Changes in scene organization produced congruency effects on target-change judgments, even though, when probed with surprise questions, participants could report neither the figure-ground status of the region on which the matrix appeared nor any change in that status. When attending to the scene, participants reported figure-ground status and changes to it highly accurately. These results clearly demonstrate that figure-ground segmentation can occur without focal attention.

  11. Characteristics of near-field earthquake ground motion

    International Nuclear Information System (INIS)

    Kim, H. K.; Choi, I. G.; Jeon, Y. S.; Seo, J. M.

    2002-01-01

    The near-field ground motions exhibit special response characteristics that are different from those of ordinary ground motions in the velocity and displacement response. This study first examines the characteristics of near-field ground motion depending on fault directivity and fault normal and parallel component. And the response spectra of the near field ground motion are statistically processed, and are compared with the Regulatory Guide 1.60 spectrum that is present design spectrum of the nuclear power plant. The response spectrum of the near filed ground motions shows large spectral velocity and displacement in the low frequency range. The spectral accelerations of near field ground motion are greatly amplified in the high frequency range for the rock site motions, and in the low frequency range for the soil site motions. As a result, the near field ground motion effects should be considered in the seismic design and seismic safety evaluation of the nuclear power plant structures and equipment

  12. Building Grounded Theory in Entrepreneurship Research

    DEFF Research Database (Denmark)

    Mäkelä, Markus; Turcan, Romeo V.

    2007-01-01

    In this chapter we describe the process of building of theory from data (Glaser and Strauss 1967; Strauss and Corbin 1998). We discuss current grounded theory in relation to research in entrepreneurship and point out directions and potential improvements for further research in this field....... The chapter has two goals. First, we wish to provide an explicit paradigmatic positioning of the grounded theory methodology, discussing the most relevant views of ontology and epistemology that can be used as alternative starting points for conducting grounded theory research. While the chapter introduces...... our approach to grounded theory, we acknowledge the existence of other approaches and try to locate our approach in relation to them. As an important part of this discussion, we take a stand on how to usefully define ‘grounded theory’ and ‘case study research’. Second, we seek to firmly link our...

  13. Pollutant infiltration and ground water management

    International Nuclear Information System (INIS)

    1993-01-01

    Following a short overview of hazard potentials for ground water in Germany, this book, which was compiled by the technical committee of DVWK on ground water use, discusses the natural scientific bases of pollutant movement to and in ground water. It points out whether and to what extent soil/ground water systems can be protected from harmful influences, and indicates relative strategies. Two zones are distinguished: the unsaturated zone, where local defence and remedial measures are frequently possible, and the saturated zone. From the protective function of geological systems, which is always pollutant-specific, criteria are derived for judging the systems generally, or at least regarding entire classes of pollutants. Finally, the impact of the infiltration of pollutants into ground water on its use as drinking water is pointed out and an estimate of the cost of remedial measures is given. (orig.) [de

  14. Ground Motion Prediction Models for Caucasus Region

    Science.gov (United States)

    Jorjiashvili, Nato; Godoladze, Tea; Tvaradze, Nino; Tumanova, Nino

    2016-04-01

    Ground motion prediction models (GMPMs) relate ground motion intensity measures to variables describing earthquake source, path, and site effects. Estimation of expected ground motion is a fundamental earthquake hazard assessment. The most commonly used parameter for attenuation relation is peak ground acceleration or spectral acceleration because this parameter gives useful information for Seismic Hazard Assessment. Since 2003 development of Georgian Digital Seismic Network has started. In this study new GMP models are obtained based on new data from Georgian seismic network and also from neighboring countries. Estimation of models is obtained by classical, statistical way, regression analysis. In this study site ground conditions are additionally considered because the same earthquake recorded at the same distance may cause different damage according to ground conditions. Empirical ground-motion prediction models (GMPMs) require adjustment to make them appropriate for site-specific scenarios. However, the process of making such adjustments remains a challenge. This work presents a holistic framework for the development of a peak ground acceleration (PGA) or spectral acceleration (SA) GMPE that is easily adjustable to different seismological conditions and does not suffer from the practical problems associated with adjustments in the response spectral domain.

  15. Heating and cooling with ground-loop heat pumps; Heizen und Kuehlen mit erdgekoppelten Waermepumpen

    Energy Technology Data Exchange (ETDEWEB)

    Afjei, Th.; Dott, R. [Institut Energie am Bau, Fachhochschule Nordwestschweiz (FHNW), Muttenz (Switzerland); Huber, A. [Huber Energietechnik AG, Zuerich (Switzerland)

    2007-08-15

    This final report for the Swiss Federal Office of Energy (SFOE) presents the results of the SFOE-project 'Heating and cooling with ground coupled heat pumps' in which the benefits and costs of a heat pump heating and cooling system with a borehole heat exchanger were examined. In particular the dimensioning of the hydraulic system, control concept and user behaviour are dealt with. The results of the simulations of thermal building behaviour with MATLAB/SIMULINK, CARNOT, and EWS are discussed. The results of parameter studies carried out, including varying shading, cooling characteristic curves, temperature differences in the heat exchanger and the dead time between heating and cooling mode are discussed. These showed that a simple system with heat pump and borehole heat exchanger for heating or preparation of domestic hot water as well as for passive cooling proved to be the best choice.

  16. Blow-up behavior of ground states for a nonlinear Schrödinger system with attractive and repulsive interactions

    Science.gov (United States)

    Guo, Yujin; Zeng, Xiaoyu; Zhou, Huan-Song

    2018-01-01

    We consider a nonlinear Schrödinger system arising in a two-component Bose-Einstein condensate (BEC) with attractive intraspecies interactions and repulsive interspecies interactions in R2. We get ground states of this system by solving a constrained minimization problem. For some kinds of trapping potentials, we prove that the minimization problem has a minimizer if and only if the attractive interaction strength ai (i = 1 , 2) of each component of the BEC system is strictly less than a threshold a*. Furthermore, as (a1 ,a2) ↗ (a* ,a*), the asymptotical behavior for the minimizers of the minimization problem is discussed. Our results show that each component of the BEC system concentrates at a global minimum of the associated trapping potential.

  17. Ground water pollution through air pollutants

    International Nuclear Information System (INIS)

    Cichorowski, G.; Michel, B.; Versteegen, D.; Wettmann, R.

    1989-01-01

    The aim of the investigation is to determine the significance of air pollutants for ground water quality and ground water use. The report summarizes present knowledge and assesses statements with a view to potential ground water pollution from the air. In this context pollution paths, the spreading behaviour of pollutants, and 'cross points' with burden potentials from other pollutant sources are presented. (orig.) [de

  18. American Association for the Advancement of Science

    Science.gov (United States)

    ... Lecture: Richard Harris on Challenges of Replication in Science Elect a Strong Leadership for AAAS: Deadline Ends Soon! Elect a Strong ... 20140730_leadership-seminar_teaser.jpg 13 Nov 2017 Leadership Seminar in Science & Technology Policy... REGISTER event-featured-twothird_Default_200x200. ...

  19. Main: 1V3H [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1V3H 大豆 Soybean Glycine max (L.) Merrill Beta-Amylase Name=Bmy1; Glycine Max Molecule: Beta-Amylase; Chai... 495 AA, Molecular weight: 56011 Da ATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGIIELKGPKQYDWRAYRSLFQLVQECGLTLQAI...MSFHQCGGNVGDIVNIPIPQWVLDIGESNHDIFYTNRSGTRNKEYLTVGVDNEPIFHGRTAIEIYSDYMKSFRENMSDFLESGLIIDIEVG...FLTWYSNKLLNHGDQILDEANKAFLGCKVKLAIKVSGIHWWYKVENHAAELTAGYYNLNDRDGYRPIARMLSRHHAILNFTCLEMRDSEQPSDAKSGPQELVQQVLSG...GWREDIRVAGENALPRYDATAYNQIILNAKPQGVNNNGPPKLSMFGVTYLRLSDDLLQKSNFNIFKKFVLKMHADQDYCANPQKYNHAITPLKPSAPKIPIEVLLEATKPTLPFPWLPETDMKVDG soybean_1V3H.jpg ...

  20. Hanford site ground water protection management plan

    International Nuclear Information System (INIS)

    1994-10-01

    Ground water protection at the Hanford Site consists of preventative and remedial measures that are implemented in compliance with a variety of environmental regulations at local, state, and federal levels. These measures seek to ensure that the resource can sustain a broad range of beneficial uses. To effectively coordinate and ensure compliance with applicable regulations, the U.S. Department of Energy has issued DOE Order 5400.1 (DOE 1988a). This order requires all U.S. Department of Energy facilities to prepare separate ground water protection program descriptions and plans. This document describes the Ground Water Protection Management Plan (GPMP) for the Hanford Site located in the state of Washington. DOE Order 5400.1 specifies that the GPMP covers the following general topical areas: (1) documentation of the ground water regime; (2) design and implementation of a ground water monitoring program to support resource management and comply with applicable laws and regulations; (3) a management program for ground water protection and remediation; (4) a summary and identification of areas that may be contaminated with hazardous waste; (5) strategies for controlling hazardous waste sources; (6) a remedial action program; and (7) decontamination, decommissioning, and related remedial action requirements. Many of the above elements are currently covered by existing programs at the Hanford Site; thus, one of the primary purposes of this document is to provide a framework for coordination of existing ground water protection activities. The GPMP provides the ground water protection policy and strategies for ground water protection/management at the Hanford Site, as well as an implementation plan to improve coordination of site ground water activities

  1. Simulation of the Regional Ground-Water-Flow System and Ground-Water/Surface-Water Interaction in the Rock River Basin, Wisconsin

    Science.gov (United States)

    Juckem, Paul F.

    2009-01-01

    A regional, two-dimensional, areal ground-water-flow model was developed to simulate the ground-water-flow system and ground-water/surface-water interaction in the Rock River Basin. The model was developed by the U.S. Geological Survey (USGS), in cooperation with the Rock River Coalition. The objectives of the regional model were to improve understanding of the ground-water-flow system and to develop a tool suitable for evaluating the effects of potential regional water-management programs. The computer code GFLOW was used because of the ease with which the model can simulate ground-water/surface-water interactions, provide a framework for simulating regional ground-water-flow systems, and be refined in a stepwise fashion to incorporate new data and simulate ground-water-flow patterns at multiple scales. The ground-water-flow model described in this report simulates the major hydrogeologic features of the modeled area, including bedrock and surficial aquifers, ground-water/surface-water interactions, and ground-water withdrawals from high-capacity wells. The steady-state model treats the ground-water-flow system as a single layer with hydraulic conductivity and base elevation zones that reflect the distribution of lithologic groups above the Precambrian bedrock and a regionally significant confining unit, the Maquoketa Formation. In the eastern part of the Basin where the shale-rich Maquoketa Formation is present, deep ground-water flow in the sandstone aquifer below the Maquoketa Formation was not simulated directly, but flow into this aquifer was incorporated into the GFLOW model from previous work in southeastern Wisconsin. Recharge was constrained primarily by stream base-flow estimates and was applied uniformly within zones guided by regional infiltration estimates for soils. The model includes average ground-water withdrawals from 1997 to 2006 for municipal wells and from 1997 to 2005 for high-capacity irrigation, industrial, and commercial wells. In addition

  2. High Throughput Determination of Plant Height, Ground Cover, and Above-Ground Biomass in Wheat with LiDAR.

    Science.gov (United States)

    Jimenez-Berni, Jose A; Deery, David M; Rozas-Larraondo, Pablo; Condon, Anthony Tony G; Rebetzke, Greg J; James, Richard A; Bovill, William D; Furbank, Robert T; Sirault, Xavier R R

    2018-01-01

    Crop improvement efforts are targeting increased above-ground biomass and radiation-use efficiency as drivers for greater yield. Early ground cover and canopy height contribute to biomass production, but manual measurements of these traits, and in particular above-ground biomass, are slow and labor-intensive, more so when made at multiple developmental stages. These constraints limit the ability to capture these data in a temporal fashion, hampering insights that could be gained from multi-dimensional data. Here we demonstrate the capacity of Light Detection and Ranging (LiDAR), mounted on a lightweight, mobile, ground-based platform, for rapid multi-temporal and non-destructive estimation of canopy height, ground cover and above-ground biomass. Field validation of LiDAR measurements is presented. For canopy height, strong relationships with LiDAR ( r 2 of 0.99 and root mean square error of 0.017 m) were obtained. Ground cover was estimated from LiDAR using two methodologies: red reflectance image and canopy height. In contrast to NDVI, LiDAR was not affected by saturation at high ground cover, and the comparison of both LiDAR methodologies showed strong association ( r 2 = 0.92 and slope = 1.02) at ground cover above 0.8. For above-ground biomass, a dedicated field experiment was performed with destructive biomass sampled eight times across different developmental stages. Two methodologies are presented for the estimation of biomass from LiDAR: 3D voxel index (3DVI) and 3D profile index (3DPI). The parameters involved in the calculation of 3DVI and 3DPI were optimized for each sample event from tillering to maturity, as well as generalized for any developmental stage. Individual sample point predictions were strong while predictions across all eight sample events, provided the strongest association with biomass ( r 2 = 0.93 and r 2 = 0.92) for 3DPI and 3DVI, respectively. Given these results, we believe that application of this system will provide new

  3. How cytogenetical methods help victims prove radiation exposure and claim right for social support: NCERM experience

    International Nuclear Information System (INIS)

    Aleksanin, S.; Slozina, N.; Neronova, E.; Smoliakov, E.

    2011-01-01

    Russian citizens who were irradiated because of radiation disasters, nuclear weapons testing and some other sources have a right to some social support and financial compensation. In order to get this compensation people have to prove that they were irradiated. As it is, not all victims for a variety of reasons have formal documents. Thus they apply for cytogenetic investigation to prove irradiation months, years and even decades after irradiation. Since 1992 the cytogenetic investigations related to radiation exposure were performed in NRCERM for more than 700 people. At the beginning of this investigation FISH method was not certified as a biodosimenty test in Russia. Only dicentric analysis was approved as a proof of irradiation. It is known that the rate of dicentrics decrease in time, but the residual level of cytogenetical markers could be revealed a long time after a radiation accident. Thus the dicentric analysis was performed for the people who applied for biological indication of radiation exposure at that time. Rates of dicentrics exceeding control levels were revealed in half the people who applied for radiation conformation. Now FISH method is certified in Russia and both cytogenetic tests of biodosimetry (dicentrics and FISH) are available for all comers. Increased levels of translocations were found in 8 cases (the dose rate from 0.16 to 0.64 Gy). On the basis of the results of cytogenetic tests official documents were supplied to these people and they were entitled to apply for radiation exposure compensation. Thus cytogenetic tests are very effective and in some cases the only possible way for the victims to prove irradiation exposure and to apply for radiation exposure compensation a long time after an accident.

  4. How cytogenetical methods help victims prove radiation exposure and claim right for social support: NCERM experience

    Energy Technology Data Exchange (ETDEWEB)

    Aleksanin, S., E-mail: Aleksanin@arcerm.spb.ru [Nikiforov Russian Center of Emergency and Radiation Medicine EMERCOM of Russia, (NRCERM) ul. Akademika Lebedeva 4/2, 194044 St. Petersburg (Russian Federation); Slozina, N., E-mail: NataliaSlozina@peterlink.ru [Nikiforov Russian Center of Emergency and Radiation Medicine EMERCOM of Russia, (NRCERM) ul. Akademika Lebedeva 4/2, 194044 St. Petersburg (Russian Federation); Neronova, E.; Smoliakov, E. [Nikiforov Russian Center of Emergency and Radiation Medicine EMERCOM of Russia, (NRCERM) ul. Akademika Lebedeva 4/2, 194044 St. Petersburg (Russian Federation)

    2011-09-15

    Russian citizens who were irradiated because of radiation disasters, nuclear weapons testing and some other sources have a right to some social support and financial compensation. In order to get this compensation people have to prove that they were irradiated. As it is, not all victims for a variety of reasons have formal documents. Thus they apply for cytogenetic investigation to prove irradiation months, years and even decades after irradiation. Since 1992 the cytogenetic investigations related to radiation exposure were performed in NRCERM for more than 700 people. At the beginning of this investigation FISH method was not certified as a biodosimenty test in Russia. Only dicentric analysis was approved as a proof of irradiation. It is known that the rate of dicentrics decrease in time, but the residual level of cytogenetical markers could be revealed a long time after a radiation accident. Thus the dicentric analysis was performed for the people who applied for biological indication of radiation exposure at that time. Rates of dicentrics exceeding control levels were revealed in half the people who applied for radiation conformation. Now FISH method is certified in Russia and both cytogenetic tests of biodosimetry (dicentrics and FISH) are available for all comers. Increased levels of translocations were found in 8 cases (the dose rate from 0.16 to 0.64 Gy). On the basis of the results of cytogenetic tests official documents were supplied to these people and they were entitled to apply for radiation exposure compensation. Thus cytogenetic tests are very effective and in some cases the only possible way for the victims to prove irradiation exposure and to apply for radiation exposure compensation a long time after an accident.

  5. Hanford Site ground-water surveillance for 1989

    International Nuclear Information System (INIS)

    Evans, J.C.; Bryce, R.W.; Bates, D.J.; Kemner, M.L.

    1990-06-01

    This annual report of ground-water surveillance activities provides discussions and listings of results for ground-water monitoring at the Hanford Site during 1989. The Pacific Northwest Laboratory (PNL) assesses the impacts of Hanford operations on the environment for the US Department of Energy (DOE). The impact Hanford operations has on ground water is evaluated through the Hanford Site Ground-Water Surveillance program. Five hundred and sixty-seven wells were sampled during 1989 for Hanford ground-water monitoring activities. This report contains a listing of analytical results for calendar year (CY) 1989 for species of importance as potential contaminants. 30 refs., 29 figs,. 4 tabs

  6. Research of grounding capacitive current of neutral non-grounding auxiliary system in nuclear power plants

    International Nuclear Information System (INIS)

    Yang Shan; Liu Li; Huang Xiaojing

    2014-01-01

    In the domestic and abroad standards, the grounding capacitive current limitation in the non-grounding electric auxiliary system is less than 10 A. Limiting capacitive current in the standard aims to speed up the arc extinguishing to reduce the duration of arc over-voltage, but not to prevent the arc producing, The arc over-voltage harm is related to the multiple, frequency and duration of the over-voltage. When the insulation vulnerabilities appear in the equipment, the arc over-voltage may result in insulation vulnerabilities of the electrical equipment breakdown, which leads to multiple, short-circuit accidents. The cable connector, accessory and electromotor winding are all insulation vulnerabilities. Setting the arc suppression coil which can counteract the grounding capacitive current makes the arc vanish quickly. Using the casting bus which remarkably reduces the ground capacitance of the electric transmission line makes the equipment safer. (authors)

  7. Grounding Damage to Conventional Vessels

    DEFF Research Database (Denmark)

    Lützen, Marie; Simonsen, Bo Cerup

    2003-01-01

    The present paper is concerned with rational design of conventional vessels with regard to bottom damage generated in grounding accidents. The aim of the work described here is to improve the design basis, primarily through analysis of new statistical data for grounding damage. The current regula...

  8. Procedures for ground-water investigations

    International Nuclear Information System (INIS)

    1992-12-01

    This manual was developed by the Pacific Northwest Laboratory (PNL) to document the procedures used to carry out and control the technical aspects of ground-water investigations at the PNL. Ground-water monitoring procedures are developed and used in accordance with the PNL Quality Assurance Program

  9. Humic substances in ground waters

    International Nuclear Information System (INIS)

    Paxeus, N.; Allard, B.; Olofsson, U.; Bengtsson, M.

    1986-01-01

    The presence of naturally occurring complexing agents that may enhance the migration of disposed radionuclikes and thus facilitate their uptake by plantsis a problem associated with the underground disposal of radioactive wastes in bedrock. The main purpose of this work is to characterized humic substances from ground water and compare them with humic substances from surface water. The humic materials isolated from ground waters of a borehole in Fjaellveden (Sweden) were characterized by elemental and functional group analyses. Spectroscopic properties, molecular weight distributions as well as acid-base properties of the fulvic and humic fractions were also studied. The ground water humic substances were found to be quite similar in many respects (but not identical) to the Swedish surface water humics concentrated from the Goeta River but appeared to be quite different from the American ground water humics from Biscayne Florida Aquifer or Laramie Fox-Hills in Colorado. The physico-chemical properties of the isolated humic materials are discussed

  10. Ground Loop Impedance of Long EHV Cable Lines

    DEFF Research Database (Denmark)

    Ohno, Teruo; Bak, Claus Leth; Sørensen, Thomas K.

    2012-01-01

    The distance protection scheme without communication is often applied to the backup protection of EHV cable lines. For a reliable operation of a ground distance relay, the ground loop impedance of EHV cable lines needs to have a linear relationship to the distance from the relay location...... to the fault location. The discontinuity of the ground loop impedance at cross-bonding points may have an ill effect on the reliable operation of the ground distance relay. However, the cause and parameters of the discontinuity and its effects on the ground distance relay protection have not been discussed...... in literature. Through the calculation of the ground loop impedance for cable lines, it has been found that, for long EHV cable lines, the reliable operation of the ground distance relay is possible with a typical relay setting. Effects of parameters, such as substation grounding, cable layouts...

  11. Antenna characteristics and air-ground interface deembedding methods for stepped-frequency ground-penetrating radar measurements

    DEFF Research Database (Denmark)

    Karlsen, Brian; Larsen, Jan; Jakobsen, Kaj Bjarne

    2000-01-01

    The result from field-tests using a Stepped-Frequency Ground Penetrating Radar (SF-GPR) and promising antenna and air-ground deembedding methods for a SF-GPR is presented. A monostatic S-band rectangular waveguide antenna was used in the field-tests. The advantages of the SF-GPR, e.g., amplitude...... and phase information in the SF-GPR signal, is used to deembed the characteristics of the antenna. We propose a new air-to-ground interface deembedding technique based on Principal Component Analysis which enables enhancement of the SF-GPR signal from buried objects, e.g., anti-personal landmines...

  12. Artificial ground motion compatible with specified peak ground displacement and target multi-damping response spectra

    International Nuclear Information System (INIS)

    Zhang Yushan; Zhao Fengxin

    2010-01-01

    With respect to the design ground motion of nuclear power plant (NPP), the Regular Guide 1.60 of the US not only defined the standard multi-damping response spectra, i.e. the RG1.60 spectra, but also definitely prescribed the peak ground displacement (PGD) value corresponding to the standard spectra. However, in the engineering practice of generating multi-damping-spectra-compatible artificial ground motion for the seismic design of NPP, the PGD value had been neglected. Addressing this issue, this paper proposed a synthesizing method which generates the artificial ground motion compatible with not only the target multi-damping response spectra but also the specified PGD value. Firstly, by the transfer formula between the power spectrum and the response spectrum, an initial uniformly modulated acceleration time history is synthesized by multiplying the stationary Gaussian process with the prescribed intensity envelope to simulate the amplitude-non-stationarity of earthquake ground motion. And then by superimposing a series of narrow-band time histories in the time domain, the initial time history is modified in the iterative manner to match the target PGD as well as the target multi-damping spectra with the pre-specified matching precisions. Numerical examples are provided to demonstrate the matching precisions of the proposed method to the target values.

  13. Investigation of the relationship between ground and engineering ...

    Indian Academy of Sciences (India)

    In order to investigate possible ground motion amplification in earthquake resistant building design, relationship between the ground and engineering bedrock must be ensured. In order to provide this relation, structure, basic characteristics, and thickness of the ground are investigated. In this context, calculating ground ...

  14. Closed-form critical earthquake response of elastic-plastic structures on compliant ground under near-fault ground motions

    Directory of Open Access Journals (Sweden)

    Kotaro eKojima

    2016-01-01

    Full Text Available The double impulse is introduced as a substitute of the fling-step near-fault ground motion. A closed-form solution of the elastic-plastic response of a structure on compliant (flexible ground by the ‘critical double impulse’ is derived for the first time based on the solution for the corresponding structure with fixed base. As in the case of fixed-base model, only the free-vibration appears under such double impulse and the energy approach plays an important role in the derivation of the closed-form solution of a complicated elastic-plastic response on compliant ground. It is remarkable that no iteration is needed in the derivation of the critical elastic-plastic response. It is shown via the closed-form expression that, in the case of a smaller input level of double impulse to the structural strength, as the ground stiffness becomes larger, the maximum plastic deformation becomes larger. On the other hand, in the case of a larger input level of double impulse to the structural strength, as the ground stiffness becomes smaller, the maximum plastic deformation becomes larger. The criticality and validity of the proposed theory are investigated through the comparison with the response analysis to the corresponding one-cycle sinusoidal input as a representative of the fling-step near-fault ground motion. The applicability of the proposed theory to actual recorded pulse-type ground motions is also discussed.

  15. Current density functional theory in a continuum and lattice Lagrangians: Application to spontaneously broken chiral ground states

    International Nuclear Information System (INIS)

    Rasolt, M.; Vignale, G.

    1992-03-01

    We formulate the current-density functional theory for systems in arbitrarily strong magnetic fields. A set of self-consistent equations comparable to the Kohn-Sham equations for ordinary density functional theory is derived, and proved to be gauge-invariant and to satisfy the continuity equation. These equations of Vignale and Rasolt involve the gauge field corresponding to the external magnetic field as well as a new gauge field generated entirely from the many-body interactions. We next extend this gauge theory (following Rasolt and Vignale) to a lattice Lagrangian believed to be appropriate to a tight-binding Hamiltonian in the presence of an external magnetic field. We finally examine the nature of the ground state of a strongly nonuniform electron gas in the presence of this many-body self-induced gauge field

  16. Ground Attenuation of Railroad Noise

    DEFF Research Database (Denmark)

    Makarewicz, R.; Rasmussen, Karsten Bo; Kokowski, P.

    1996-01-01

    The influence of ground effect on railroad noise is described using the concept of the peak A-weighted sound exposure level, and A-weighted sound exposure level. The train is modelled by a continuous line of incoherent point sources that have a cosine directivity. The ground effect is included...

  17. 49 CFR 234.213 - Grounds.

    Science.gov (United States)

    2010-10-01

    ... Maintenance Standards § 234.213 Grounds. Each circuit that affects the proper functioning of a highway-rail... in the circuit. This requirement does not apply to: circuits that include track rail; alternating current power distribution circuits that are grounded in the interest of safety; and common return wires...

  18. Reactions of Ground State Nitrogen Atoms N(4S) with Astrochemically-Relevant Molecules on Interstellar Dusts

    Science.gov (United States)

    Krim, Lahouari; Nourry, Sendres

    2015-06-01

    In the last few years, ambitious programs were launched to probe the interstellar medium always more accurately. One of the major challenges of these missions remains the detection of prebiotic compounds and the understanding of reaction pathways leading to their formation. These complex heterogeneous reactions mainly occur on icy dust grains, and their studies require the coupling of laboratory experiments mimicking the extreme conditions of extreme cold and dilute media. For that purpose, we have developed an original experimental approach that combine the study of heterogeneous reactions (by exposing neutral molecules adsorbed on ice to non-energetic radicals H, OH, N...) and a neon matrix isolation study at very low temperatures, which is of paramount importance to isolate and characterize highly reactive reaction intermediates. Such experimental approach has already provided answers to many questions raised about some astrochemically-relevant reactions occurring in the ground state on the surface of dust grain ices in dense molecular clouds. The aim of this new present work is to show the implication of ground state atomic nitrogen on hydrogen atom abstraction reactions from some astrochemically-relevant species, at very low temperatures (3K-20K), without providing any external energy. Under cryogenic temperatures and with high barrier heights, such reactions involving N(4S) nitrogen atoms should not occur spontaneously and require an initiating energy. However, the detection of some radicals species as byproducts, in our solid samples left in the dark for hours at 10K, proves that hydrogen abstraction reactions involving ground state N(4S) nitrogen atoms may occur in solid phase at cryogenic temperatures. Our results show the efficiency of radical species formation stemming from non-energetic N-atoms and astrochemically-relevant molecules. We will then discuss how such reactions, involving nitrogen atoms in their ground states, might be the first key step

  19. Seeing a Colleague Encourage a Student to Make an Assumption while Proving: What Teachers Put in Play when Casting an Episode of Instruction

    Science.gov (United States)

    Nachlieli, Talli; Herbst, Patricio

    2009-01-01

    This article reports on an investigation of how teachers of geometry perceived an episode of instruction presented to them as a case of engaging students in proving. Confirming what was hypothesized, participants found it remarkable that a teacher would allow a student to make an assumption while proving. But they perceived this episode in various…

  20. Making sense of grounded theory in medical education.

    Science.gov (United States)

    Kennedy, Tara J T; Lingard, Lorelei A

    2006-02-01

    Grounded theory is a research methodology designed to develop, through collection and analysis of data that is primarily (but not exclusively) qualitative, a well-integrated set of concepts that provide a theoretical explanation of a social phenomenon. This paper aims to provide an introduction to key features of grounded theory methodology within the context of medical education research. In this paper we include a discussion of the origins of grounded theory, a description of key methodological processes, a comment on pitfalls encountered commonly in the application of grounded theory research, and a summary of the strengths of grounded theory methodology with illustrations from the medical education domain. The significant strengths of grounded theory that have resulted in its enduring prominence in qualitative research include its clearly articulated analytical process and its emphasis on the generation of pragmatic theory that is grounded in the data of experience. When applied properly and thoughtfully, grounded theory can address research questions of significant relevance to the domain of medical education.

  1. Seismic test facilities at the ENEA Casaccia Research Center; Prove sismiche con le tavole vibranti al centro ricerche Enea Casaccia

    Energy Technology Data Exchange (ETDEWEB)

    De Canio, G. [ENEA, Divisione Servizi Tecnologici, Centro Ricerche Casaccia, Rome (Italy)

    2000-07-01

    The main experimental facilities for seismic tests at the ENEA C.R. Casaccia laboratories consist of two high performance shake table for three axial seismic tests of structures up to 10 ton mass and 3g acceleration applied at the Center of Gravity at 1m from the base table. The activities are principally devoted to the dynamic characterization and vibration tests for mechanical and aero spatial structures, and the experimental analysis of innovative systems for the seismic isolation and retrofitting of civil, industrial, and historical buildings; together with the seismic tests of sub-structures and scaled mock-ups, in order to evaluate the isolation/dissipation performance of the anti-seismic devices, and the failure modes of the structural parts of the building. [Italian] Le principali attrezzature per le prove sismiche presso i laboratori del C.R. Casaccia consistono di due tavole vibranti triassali per prove su strutture fino a 10t di peso con una accelerazione di 3g applicata al centro di gravita' posto ad 1 m di altezza dal piano della tavola. Le principali attivita' riguardano: (a) test di caratterizzazione dinamica e prove di vibrazioni per strutture meccaniche ed aerospaziali; (b) l'analisi sperimentale di sistemi innovativi per l'isolamento sismico ed il consolidamento di strutture civili, industriali e storico monumentali, e le prove sismiche di elementi strutturali e di modelli in scala per la valutazione della capacita' di dissipazione dei dispositivi antisismici e le modalita' di formazione delle fratture.

  2. 49 CFR 229.97 - Grounding fuel tanks.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Grounding fuel tanks. 229.97 Section 229.97 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Equipment § 229.97 Grounding fuel tanks. Fuel tanks and related piping shall be electrically grounded. ...

  3. Enhanced spatial resolution on figures versus grounds.

    Science.gov (United States)

    Hecht, Lauren N; Cosman, Joshua D; Vecera, Shaun P

    2016-07-01

    Much is known about the cues that determine figure-ground assignment, but less is known about the consequences of figure-ground assignment on later visual processing. Previous work has demonstrated that regions assigned figural status are subjectively more shape-like and salient than background regions. The increase in subjective salience of figural regions could be caused by a number of processes, one of which may be enhanced perceptual processing (e.g., an enhanced neural representation) of figures relative to grounds. We explored this hypothesis by having observers perform a perceptually demanding spatial resolution task in which targets appeared on either figure or ground regions. To rule out a purely attentional account of figural salience, observers discriminated targets on the basis of a region's color (red or green), which was equally likely to define the figure or the ground. The results of our experiments showed that targets appearing on figures were discriminated more accurately than those appearing in ground regions. In addition, targets appearing on figures were discriminated better than those presented in regions considered figurally neutral, but targets appearing within ground regions were discriminated more poorly than those appearing in figurally neutral regions. Taken together, our findings suggest that when two regions share a contour, regions assigned as figure are perceptually enhanced, whereas regions assigned as ground are perceptually suppressed.

  4. Enhanced spatial resolution on figures versus grounds

    Science.gov (United States)

    Hecht, Lauren N.; Cosman, Joshua D.; Vecera, Shaun P.

    2016-01-01

    Much is known about the cues that determine figure-ground assignment, but less is known about the consequences of figure-ground assignment on later visual processing. Previous work has demonstrated that regions assigned figural status are subjectively more shape-like and salient than background regions. The increase in subjective salience of figural regions could be caused by a number of processes, one of which may be enhanced perceptual processing (e.g., an enhanced neural representation) of figures relative to grounds. We explored this hypothesis by having observers perform a perceptually demanding spatial resolution task in which targets appeared either on figure or ground regions. To rule out a purely attentional account of figural salience, observers discriminated targets on the basis of a region’s color (red or green), which was equally likely to define the figure or the ground. The results of our experiments show that targets appearing on figures were discriminated more accurately than those appearing in ground regions. In addition, targets appearing on figures were discriminated better than those presented in regions considered figurally neutral, but targets appearing within ground regions were discriminated more poorly than those appearing in figurally neutral regions. Taken together, our findings suggest that when two regions share a contour, regions assigned as figure are perceptually enhanced, whereas regions assigned as grounds are perceptually suppressed. PMID:27048441

  5. Ground-atmosphere interactions at Gale

    Science.gov (United States)

    Renno, N. O.; Martinez, G.; Ramos, M.; Hallet, B.; Gómez, F. G.; Jun, I.; Fisk, M. R.; Gomez-Elvira, J.; Hamilton, V. E.; Mischna, M. A.; Sletten, R. S.; Martin-Torres, J.; De La Torre Juarez, M.; Vasavada, A. R.; Zorzano, M.

    2013-12-01

    We analyze variations in environmental parameters and regolith properties along Curiosity's track to determine the possible causes of an abrupt change in the thermal properties of the ground and the atmosphere observed around Sol 120, as the rover transitioned from an area of sandy soil (Rocknest) to an area of fractured bedrock terrain (Yellowknife). Curiosity is instrumented with the Rover Environmental Monitoring Station (REMS) and the Dynamic Albedo of Neutrons (DAN) sensors to measure the air temperature, the ground temperature, and the hydrogen content of the shallow subsurface along Curiosity's track. Analysis of the REMS data is used to estimate the regolith's heat budget. This analysis suggests that the abrupt decrease in the ground and atmosphere temperature and the difference between ground and air temperatures observed around Sol 120 is likely caused by an increase in the soil thermal inertia. The changes in thermal inertia have been known for some time so confirming this by the REMS package provides ground truthing. A new unexpected finding is that the regolith water content, as indicated by DAN's detection of hydrogen content, is higher in the Yellowknife soil. Another interesting finding at this site are the holes and other signs of recent geological activity in the area of fractured terrain that may reflect large volumetric variations and facilitate gas exchange between the ground and atmosphere. Near-surface volumetric changes in soil and bedrock could reflect changes in the volume of subsurface H2O, or in the partitioning of H2O among its three phases. Volume increases could also result from salt crystal growth in rock pores and soil pores associated with the adsorption of water vapor. Crystallization in pores is a significant weathering process on Earth; it could well be active on Mars. Salts also inhibits the exchange of moisture between the ground and the atmosphere, and cements the soils of arid places such as in the McMurdo Dry Valleys in

  6. Infrasonic induced ground motions

    Science.gov (United States)

    Lin, Ting-Li

    On January 28, 2004, the CERI seismic network recorded seismic signals generated by an unknown source. Our conclusion is that the acoustic waves were initiated by an explosive source near the ground surface. The meteorological temperature and effective sound speed profiles suggested existence of an efficient near-surface waveguide that allowed the acoustic disturbance to propagate to large distances. An explosion occurring in an area of forest and farms would have limited the number of eyewitnesses. Resolution of the source might be possible by experiment or by detailed analysis of the ground motion data. A seismo-acoustic array was built to investigate thunder-induced ground motions. Two thunder events with similar N-wave waveforms but different horizontal slownesses are chosen to evaluate the credibility of using thunder as a seismic source. These impulsive acoustic waves excited P and S reverberations in the near surface that depend on both the incident wave horizontal slowness and the velocity structure in the upper 30 meters. Nineteen thunder events were chosen to further investigate the seismo-acoustic coupling. The consistent incident slowness differences between acoustic pressure and ground motions suggest that ground reverberations were first initiated somewhat away from the array. Acoustic and seismic signals were used to generate the time-domain transfer function through the deconvolution technique. Possible non-linear interaction for acoustic propagation into the soil at the surface was observed. The reverse radial initial motions suggest a low Poisson's ratio for the near-surface layer. The acoustic-to-seismic transfer functions show a consistent reverberation series of the Rayleigh wave type, which has a systematic dispersion relation to incident slownesses inferred from the seismic ground velocity. Air-coupled Rayleigh wave dispersion was used to quantitatively constrain the near-surface site structure with constraints afforded by near-surface body

  7. BUSTED BUTTE TEST FACILITY GROUND SUPPORT CONFIRMATION ANALYSIS

    International Nuclear Information System (INIS)

    Bonabian, S.

    1998-01-01

    The main purpose and objective of this analysis is to confirm the validity of the ground support design for Busted Butte Test Facility (BBTF). The highwall stability and adequacy of highwall and tunnel ground support is addressed in this analysis. The design of the BBTF including the ground support system was performed in a separate document (Reference 5.3). Both in situ and seismic loads are considered in the evaluation of the highwall and the tunnel ground support system. In this analysis only the ground support designed in Reference 5.3 is addressed. The additional ground support installed (still work in progress) by the constructor is not addressed in this analysis. This additional ground support was evaluated by the A/E during a site visit and its findings and recommendations are addressed in this analysis

  8. Essential methodological considerations when using grounded theory.

    Science.gov (United States)

    Achora, Susan; Matua, Gerald Amandu

    2016-07-01

    To suggest important methodological considerations when using grounded theory. A research method widely used in nursing research is grounded theory, at the centre of which is theory construction. However, researchers still struggle with some of its methodological issues. Although grounded theory is widely used to study and explain issues in nursing practice, many researchers are still failing to adhere to its rigorous standards. Researchers should articulate the focus of their investigations - the substantive area of interest as well as the focal population. This should be followed by a succinct explanation of the strategies used to collect and analyse data, supported by clear coding processes. Finally, the resolution of the core issues, including the core category and related categories, should be explained to advance readers' understanding. Researchers should endeavour to understand the tenets of grounded theory. This enables 'neophytes' in particular to make methodological decisions that will improve their studies' rigour and fit with grounded theory. This paper complements the current dialogue on improving the understanding of grounded theory methodology in nursing research. The paper also suggests important procedural decisions researchers need to make to preserve their studies' scientific merit and fit with grounded theory.

  9. Move of ground water

    International Nuclear Information System (INIS)

    Kimura, Shigehiko

    1983-01-01

    As a ground water flow which is difficult to explain by Darcy's theory, there is stagnant water in strata, which moves by pumping and leads to land subsidence. This is now a major problem in Japan. Such move on an extensive scale has been investigated in detail by means of 3 H such as from rainfall in addition to ordinary measurement. The move of ground water is divided broadly into that in an unsaturated stratum from ground surface to water-table and that in a saturated stratum below the water-table. The course of the analyses made so far by 3 H contained in water, and the future trend of its usage are described. A flow model of regarding water as plastic fluid and its flow as channel assembly may be available for some flow mechanism which is not possible to explain with Darcy's theory. (Mori, K.)

  10. Typhoon-Induced Ground Deformation

    Science.gov (United States)

    Mouyen, M.; Canitano, A.; Chao, B. F.; Hsu, Y.-J.; Steer, P.; Longuevergne, L.; Boy, J.-P.

    2017-11-01

    Geodetic instruments now offer compelling sensitivity, allowing to investigate how solid Earth and surface processes interact. By combining surface air pressure data, nontidal sea level variations model, and rainfall data, we systematically analyze the volumetric deformation of the shallow crust at seven borehole strainmeters in Taiwan induced by 31 tropical cyclones (typhoons) that made landfall to the island from 2004 to 2013. The typhoon's signature consists in a ground dilatation due to air pressure drop, generally followed by a larger ground compression. We show that this compression phase can be mostly explained by the mass loading of rainwater that falls on the ground and concentrates in the valleys towards the strainmeter sensitivity zone. Further, our analysis shows that borehole strainmeters can help quantifying the amount of rainwater accumulating and flowing over a watershed during heavy rainfalls, which is a useful constraint for building hydrological models.

  11. Relational grounding facilitates development of scientifically useful multiscale models

    Directory of Open Access Journals (Sweden)

    Lam Tai

    2011-09-01

    Full Text Available Abstract We review grounding issues that influence the scientific usefulness of any biomedical multiscale model (MSM. Groundings are the collection of units, dimensions, and/or objects to which a variable or model constituent refers. To date, models that primarily use continuous mathematics rely heavily on absolute grounding, whereas those that primarily use discrete software paradigms (e.g., object-oriented, agent-based, actor typically employ relational grounding. We review grounding issues and identify strategies to address them. We maintain that grounding issues should be addressed at the start of any MSM project and should be reevaluated throughout the model development process. We make the following points. Grounding decisions influence model flexibility, adaptability, and thus reusability. Grounding choices should be influenced by measures, uncertainty, system information, and the nature of available validation data. Absolute grounding complicates the process of combining models to form larger models unless all are grounded absolutely. Relational grounding facilitates referent knowledge embodiment within computational mechanisms but requires separate model-to-referent mappings. Absolute grounding can simplify integration by forcing common units and, hence, a common integration target, but context change may require model reengineering. Relational grounding enables synthesis of large, composite (multi-module models that can be robust to context changes. Because biological components have varying degrees of autonomy, corresponding components in MSMs need to do the same. Relational grounding facilitates achieving such autonomy. Biomimetic analogues designed to facilitate translational research and development must have long lifecycles. Exploring mechanisms of normal-to-disease transition requires model components that are grounded relationally. Multi-paradigm modeling requires both hyperspatial and relational grounding.

  12. Deflection of electron beams by ground planes

    International Nuclear Information System (INIS)

    Fernsler, R.F.; Lampe, M.

    1991-01-01

    Analytic methods are used to determine the effect of a nearby ground plane on the trajectory of a relativistic electron beam passing through dense gas. The beam is shown to respond to the ground plane in one of two distinct modes, determined by beam current and energy. Low-power beams deflect from the ground plane and tear longitudinally. High-power beams do not deflect or tear but tilt, i.e., the beam axis is no longer parallel to the direction of propagation. This conclusion is reached by computing the net beam force as a superposition of the ''bare'' ground-plane forces, the shielding forces from the beam-generated plasma, the body coupling forces induced by beam tilt, and the force that arises as the beam separates from the plasma. Effects from electromagnetic retardation and ground resistivity are shown to be negligible in typical cases of interest, and the interaction between ground planes and other external forces is discussed as well

  13. Coastal flood risk

    CSIR Research Space (South Africa)

    Luck-Vogel, Melanie

    2017-07-01

    Full Text Available ! Unless… People @ Coasts https://eoimages.gsfc.nasa.gov/images/imagerecords/79000/79765/dnb_land_ocean_ice.2012.3600x1800.jpg People & Coasts • About 40% of the world’s population is situated within 100km of the coastline (Millennium Ecosystem Assessment...

  14. The Effects of Hurricane Nora on Eomorphic Characteristics of Yuma Wash, Yuma Proving Ground, Arizona

    National Research Council Canada - National Science Library

    Wohl, Ellen

    1999-01-01

    .... Repeat surveys conducted in January 1998 were compared to the 1995 survey to measure areas of cross-sectional scour and fill, net change in channel area, and change in thalweg depth along the channel...

  15. 76 FR 30319 - Real Property Master Plan Programmatic Environmental Impact Statement, at Yuma Proving Ground...

    Science.gov (United States)

    2011-05-25

    ... Desert in southwestern Arizona and occupies portions of Yuma and La Paz counties. The mission at Yuma..., water resources, biological resources, cultural resources, socioeconomics, utilities, land use, and...

  16. 21 CFR 225.120 - Buildings and grounds.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Buildings and grounds. 225.120 Section 225.120... Buildings and grounds. Buildings used for production of medicated feed shall provide adequate space for... routine maintenance and cleaning of equipment. Buildings and grounds shall be constructed and maintained...

  17. Grounded Theory in Medical Education Research

    OpenAIRE

    Tavakol, Mohsen; Torabi, Sima; Akbar Zeinaloo, Ali

    2009-01-01

    The grounded theory method provides a systematic way to generate theoretical constructs or concepts that illuminate psychosocial processes common to individual who have a similar expe­rience of the phenomenon under investigation. There has been an increase in the number of pub­lished research reports that use the grounded theory method. However, there has been less medical education research, which is based on the grounded theory tradition. The purpose of this paper is to introduce basic tena...

  18. IMPROVED ALGORITHM FOR CALCULATING COMPLEX NON-EQUIPOTENTIAL GROUNDING DEVICES OF ELECTRICAL INSTALLATIONS TAKING INTO ACCOUNT CONDUCTIVITY OF NATURAL GROUNDINGS

    Directory of Open Access Journals (Sweden)

    K. A. Starkov

    2017-08-01

    Full Text Available Purpose. The method of natural concentrated groundings substitution by the set of electrodes taking them into account in the algorithm of electric characteristics calculation for complicated grounding connections of electric installation is offered. An equivalent model as a set of linear electrodes is chosen in accordance with two criteria: leakage resistance and potentials on the ground surface. Methodology. We have applied induced potential method and methods for computing branched electrical circuits with distributed parameters. Results. We have obtained the algorithm for calculating complex non-equipotential grounding connections, which makes it possible to obtain refined values of the potential distribution in the electric stations and substations with outdoor switchgear. Originality. For the first time, we have taking into account the conductivity of natural concentrated grounds by a set of vertical and horizontal electrodes based on equivalent electrical characteristics applied to a two-layer ground. Practical value. The using of the proposed calculation algorithm in the electric grids of JSC «Kharkivoblenergo» made it possible to determine the values of the potential distribution at short circuit in electrical substation taking into account the influence of the conductivity of natural concentrated groundings.

  19. Techniques for enhancing durability and equivalence ratio control in a rich-lean, three-stage ground power gas turbine combustor

    Science.gov (United States)

    Schultz, D. F.

    1982-01-01

    Rig tests of a can-type combustor were performed to demonstrate two advanced ground power engine combustor concepts: steam cooled rich-burn combustor primary zones for enhanced durability; and variable combustor geometry for three stage combustion equivalence ratio control. Both concepts proved to be highly successful in achieving their desired objectives. The steam cooling reduced peak liner temperatures to less than 800 K. This offers the potential of both long life and reduced use of strategic materials for liner fabrication. Three degrees of variable geometry were successfully implemented to control airflow distribution within the combustor. One was a variable blade angle axial flow air swirler to control primary airflow while the other two consisted of rotating bands to control secondary and tertiary or dilution air flow.

  20. The Steksovo II burial ground

    Directory of Open Access Journals (Sweden)

    Martianov Vladimir N.

    2014-12-01

    Full Text Available The article is dedicated to the results of many-years’ (1990-2010 excavations on the ancient Mordovian Steksovo II burial ground site. The burial ground had functioned in the 3rd to 13th centuries AD. The investigations revealed hundreds of burials, which enabled the researchers to judge upon the wealth of material items found and the variety of burial rites of the population that had formed the burial ground. The 1st millennium AD is characterized by bi-ritualism, while inhumation is characteristic of the 11-13th-century period; horses’ burials were also discovered. The data of the burial ground make it possible to modify the concept of the stages in ancient Mordovians ethnogenesis. It is generally attributed to the Erzya Mordvins, but in early burials the combination of the Erzya and Moksha ancientries is traced. Complexes of the items of crucial importance for the chronology of the burial are discussed in the article with a representation of statistical data characterizing funeral rites and traditions.

  1. The automated ground network system

    Science.gov (United States)

    Smith, Miles T.; Militch, Peter N.

    1993-01-01

    The primary goal of the Automated Ground Network System (AGNS) project is to reduce Ground Network (GN) station life-cycle costs. To accomplish this goal, the AGNS project will employ an object-oriented approach to develop a new infrastructure that will permit continuous application of new technologies and methodologies to the Ground Network's class of problems. The AGNS project is a Total Quality (TQ) project. Through use of an open collaborative development environment, developers and users will have equal input into the end-to-end design and development process. This will permit direct user input and feedback and will enable rapid prototyping for requirements clarification. This paper describes the AGNS objectives, operations concept, and proposed design.

  2. Ground-water flow and ground- and surface-water interaction at the Weldon Spring quarry, St. Charles County, Missouri

    International Nuclear Information System (INIS)

    Imes, J.L.; Kleeschulte, M.J.

    1997-01-01

    Ground-water-level measurements to support remedial actions were made in 37 piezometers and 19 monitoring wells during a 19-month period to assess the potential for ground-water flow from an abandoned quarry to the nearby St. Charles County well field, which withdraws water from the base of the alluvial aquifer. From 1957 to 1966, low-level radioactive waste products from the Weldon Spring chemical plant were placed in the quarry a few hundred feet north of the Missouri River alluvial plain. Uranium-based contaminants subsequently were detected in alluvial ground water south of the quarry. During all but flood conditions, lateral ground-water flow in the bedrock from the quarry, as interpreted from water-table maps, generally is southwest toward Little Femme Osage Creek or south into the alluvial aquifer. After entering the alluvial aquifer, the ground water flows southeast to east toward a ground-water depression presumably produced by pumping at the St. Charles County well field. The depression position varies depending on the Missouri River stage and probably the number and location of active wells in the St. Charles County well field

  3. A Manual Transportable Instrument Platform for Ground-Based Spectro-Directional Observations (ManTIS and the Resultant Hyperspectral Field Goniometer System

    Directory of Open Access Journals (Sweden)

    Marcel Buchhorn

    2013-11-01

    Full Text Available This article presents and technically describes a new field spectro-goniometer system for the ground-based characterization of the surface reflectance anisotropy under natural illumination conditions developed at the Alfred Wegener Institute (AWI. The spectro-goniometer consists of a Manual Transportable Instrument platform for ground-based Spectro-directional observations (ManTIS, and a hyperspectral sensor system. The presented measurement strategy shows that the AWI ManTIS field spectro-goniometer can deliver high quality hemispherical conical reflectance factor (HCRF measurements with a pointing accuracy of ±6 cm within the constant observation center. The sampling of a ManTIS hemisphere (up to 30° viewing zenith, 360° viewing azimuth needs approx. 18 min. The developed data processing chain in combination with the software used for the semi-automatic control provides a reliable method to reduce temporal effects during the measurements. The presented visualization and analysis approaches of the HCRF data of an Arctic low growing vegetation showcase prove the high quality of spectro-goniometer measurements. The patented low-cost and lightweight ManTIS instrument platform can be customized for various research needs and is available for purchase.

  4. Fake News: A Technological Approach to Proving the Origins of Content, Using Blockchains.

    Science.gov (United States)

    Huckle, Steve; White, Martin

    2017-12-01

    In this article, we introduce a prototype of an innovative technology for proving the origins of captured digital media. In an era of fake news, when someone shows us a video or picture of some event, how can we trust its authenticity? It seems that the public no longer believe that traditional media is a reliable reference of fact, perhaps due, in part, to the onset of many diverse sources of conflicting information, via social media. Indeed, the issue of "fake" reached a crescendo during the 2016 U.S. Presidential Election, when the winner, Donald Trump, claimed that The New York Times was trying to discredit him by pushing disinformation. Current research into overcoming the problem of fake news does not focus on establishing the ownership of media resources used in such stories-the blockchain-based application introduced in this article is technology that is capable of indicating the authenticity of digital media. Put simply, using the trust mechanisms of blockchain technology, the tool can show, beyond doubt, the provenance of any source of digital media, including images used out of context in attempts to mislead. Although the application is an early prototype and its capability to find fake resources is somewhat limited, we outline future improvements that would overcome such limitations. Furthermore, we believe that our application (and its use of blockchain technology and standardized metadata) introduces a novel approach to overcoming falsities in news reporting and the provenance of media resources used therein. However, while our application has the potential to be able to verify the originality of media resources, we believe that technology is only capable of providing a partial solution to fake news. That is because it is incapable of proving the authenticity of a news story as a whole. We believe that takes human skills.

  5. Monitoring Ground Subsidence in Hong Kong via Spaceborne Radar: Experiments and Validation

    Directory of Open Access Journals (Sweden)

    Yuxiao Qin

    2015-08-01

    Full Text Available The persistent scatterers interferometry (PSI technique is gradually becoming known for its capability of providing up to millimeter accuracy of measurement on ground displacement. Nevertheless, there is still quite a good amount of doubt regarding its correctness or accuracy. In this paper, we carried out an experiment corroborating the capability of the PSI technique with the help of a traditional survey method in the urban area of Hong Kong, China. Seventy three TerraSAR-X (TSX and TanDEM-X (TDX images spanning over four years are used for the data process. There are three aims of this study. The first is to generate a displacement map of urban Hong Kong and to check for spots with possible ground movements. This information will be provided to the local surveyors so that they can check these specific locations. The second is to validate if the accuracy of the PSI technique can indeed reach the millimeter level in this real application scenario. For validating the accuracy of PSI, four corner reflectors (CR were installed at a construction site on reclaimed land in Hong Kong. They were manually moved up or down by a few to tens of millimeters, and the value derived from the PSI analysis was compared to the true value. The experiment, carried out in unideal conditions, nevertheless proved undoubtedly that millimeter accuracy can be achieved by the PSI technique. The last is to evaluate the advantages and limitations of the PSI technique. Overall, the PSI technique can be extremely useful if used in collaboration with other techniques, so that the advantages can be highlighted and the drawbacks avoided.

  6. Reassessment of Ground-Water Recharge and Simulated Ground-Water Availability for the Hawi Area of North Kohala, Hawaii

    Science.gov (United States)

    Oki, Delwyn S.

    2002-01-01

    An estimate of ground-water availability in the Hawi area of north Kohala, Hawaii, is needed to determine whether ground-water resources are adequate to meet future demand within the area and other areas to the south. For the Hawi area, estimated average annual recharge from infiltration of rainfall, fog drip, and irrigation is 37.5 million gallons per day from a daily water budget. Low and high annual recharge estimates for the Hawi area that incorporate estimated uncertainty are 19.9 and 55.4 million gallons per day, respectively. The recharge estimates from this study are lower than the recharge of 68.4 million gallons per day previously estimated from a monthly water budget. Three ground-water models, using the low, intermediate, and high recharge estimates (19.9, 37.5, and 55.4 million gallons per day, respectively), were developed for the Hawi area to simulate ground-water levels and discharges for the 1990?s. To assess potential ground-water availability, the numerical ground-water flow models were used to simulate the response of the freshwater-lens system to withdrawals at rates in excess of the average 1990?s withdrawal rates. Because of uncertainty in the recharge estimate, estimates of ground-water availability also are uncertain. Results from numerical simulations indicate that for appropriate well sites, depths, and withdrawal rates (1) for the low recharge estimate (19.9 million gallons per day) it may be possible to develop an additional 10 million gallons per day of fresh ground water from the Hawi area and maintain a freshwater-lens thickness of 160 feet near the withdrawal sites, (2) for the intermediate recharge estimate (37.5 million gallons per day) it may be possible to develop an additional 15 million gallons per day of fresh ground water from the Hawi area and maintain a freshwater-lens thickness of 190 feet near the withdrawal sites, and (3) for the high recharge estimate (55.4 million gallons per day) it may be possible to develop at

  7. Seismic proving test of process computer systems with a seismic floor isolation system

    International Nuclear Information System (INIS)

    Fujimoto, S.; Niwa, H.; Kondo, H.

    1995-01-01

    The authors have carried out seismic proving tests for process computer systems as a Nuclear Power Engineering Corporation (NUPEC) project sponsored by the Ministry of International Trade and Industry (MITI). This paper presents the seismic test results for evaluating functional capabilities of process computer systems with a seismic floor isolation system. The seismic floor isolation system to isolate the horizontal motion was composed of a floor frame (13 m x 13 m), ball bearing units, and spring-damper units. A series of seismic excitation tests was carried out using a large-scale shaking table of NUPEC. From the test results, the functional capabilities during large earthquakes of computer systems with a seismic floor isolation system were verified

  8. 46 CFR 120.376 - Grounded distribution systems (Neutral grounded).

    Science.gov (United States)

    2010-10-01

    ....376 Section 120.376 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS CARRYING MORE THAN 150 PASSENGERS OR WITH OVERNIGHT ACCOMMODATIONS FOR MORE THAN 49 PASSENGERS... distribution system having a neutral bus or conductor must have the neutral grounded. (c) The neutral or each...

  9. River as a part of ground battlefield

    Science.gov (United States)

    Vračar, Miodrag S.; Pokrajac, Ivan; Okiljević, Predrag

    2013-05-01

    The rivers are in some circumstances part of the ground battlefield. Microseisms induced at the riverbed or ground at the river surrounding might be consequence of military activities (military ground transports, explosions, troop's activities, etc). Vibrations of those fluid-solid structures are modeled in terms of solid displacement and change of fluid pressure. This time varying fluid pressure in river, which originates from ground microseisms, is possible to detect with hydrophones. Therefore, hydroacoustic measurements in rivers enables detecting, identification and localization various types of military noisy activities at the ground as and those, which origin is in the river water (hydrodynamics of water flow, wind, waves, river vessels, etc). In this paper are presented river ambient noise measurements of the three great rivers: the Danube, the Sava and the Tisa, which flows in north part of Serbia in purpose to establish limits in detection of the ground vibrations in relatively wide frequency range from zero to 20 kHz. To confirm statement that the river is a part of ground battlefield, and that hydroacoustic noise is possible to use in detecting and analyzing ground microseisms induced by civil or military activities, some previous collected data of hydroacoustic noise measurement in the rivers are used. The data of the river ambient noise include noise induced by civil engineering activities, that ordinary take place in large cities, noise that produced ships and ambient noise of the river when human activities are significantly reduced. The poly spectral method was used in analysis such events.

  10. Cooking with Clifford: New Irish Cooking

    OpenAIRE

    Clifford, Michael

    1993-01-01

    Published by Mercier Press, PO Box 5, 5 French Church Street, Cork and 24 Lower Abbey Street, Dublin 1 in 1993. Illustrations John Sheehan Photography Ltd. 95p., col.ill., 22cm., paperback Access the Publisher's website here http://arrow.dit.ie/irckbooks/1028/thumbnail.jpg

  11. Ground Motion Models for Future Linear Colliders

    International Nuclear Information System (INIS)

    Seryi, Andrei

    2000-01-01

    Optimization of the parameters of a future linear collider requires comprehensive models of ground motion. Both general models of ground motion and specific models of the particular site and local conditions are essential. Existing models are not completely adequate, either because they are too general, or because they omit important peculiarities of ground motion. The model considered in this paper is based on recent ground motion measurements performed at SLAC and at other accelerator laboratories, as well as on historical data. The issues to be studied for the models to become more predictive are also discussed

  12. Measurement of ground motion in various sites

    International Nuclear Information System (INIS)

    Bialowons, W.; Amirikas, R.; Bertolini, A.; Kruecker, D.

    2007-04-01

    Ground vibrations may affect low emittance beam transport in linear colliders, Free Electron Lasers (FEL) and synchrotron radiation facilities. This paper is an overview of a study program to measure ground vibrations in various sites which can be used for site characterization in relation to accelerator design. Commercial broadband seismometers have been used to measure ground vibrations and the resultant database is available to the scientific community. The methodology employed is to use the same equipment and data analysis tools for ease of comparison. This database of ground vibrations taken in 19 sites around the world is first of its kind. (orig.)

  13. The ground-fault detection system for DIII-D

    International Nuclear Information System (INIS)

    Scoville, J.T.; Petersen, P.I.

    1987-10-01

    This paper presents a discussion of the ground-fault detection systems on the DIII-D tokamak. The subsystems that must be monitored for an inadvertent ground include the toroidal and poloidal coil systems, the vacuum vessel, and the coil support structures. In general, one point of each coil is tied to coil/power supply ground through a current limiting resistor. For ground protection the current through this resistor is monitored using a dynamically feedback balanced Hall probe transducer from LEM Industries. When large inductive currents flow in closed loops near the tokamak, the result is undesirable magnetic error fields in the plasma region and noise generation on signal cables. Therefore, attention must be paid to avoid closed loops in the design of the coil and vessel support structure. For DIII-D a concept of dual insulating breaks and a single-point ground for all structure elements was used to satisfy this requirement. The integrity of the support structure is monitored by a system which continuously attempts to couple a variable frequency waveform onto these single-point grounds. The presence of an additional ground completes the circuit resulting in current flow. A Rogowski coil is then used to track the unwanted ground path in order to eliminate it. Details of the ground fault detection circuitry, and a description of its operation will be presented. 2 refs., 7 figs

  14. Ground water

    International Nuclear Information System (INIS)

    Osmond, J.K.; Cowart, J.B.

    1992-01-01

    The great variations in concentrations and activity ratios of 234 U/ 238 U in ground waters and the features causing elemental and isotopic mobility in the hydrosphere are discussed. Fractionation processes and their application to hydrology and other environmental problems such as earthquake, groundwater and aquifer dating are described. (UK)

  15. XML Flight/Ground Data Dictionary Management

    Science.gov (United States)

    Wright, Jesse; Wiklow, Colette

    2007-01-01

    A computer program generates Extensible Markup Language (XML) files that effect coupling between the command- and telemetry-handling software running aboard a spacecraft and the corresponding software running in ground support systems. The XML files are produced by use of information from the flight software and from flight-system engineering. The XML files are converted to legacy ground-system data formats for command and telemetry, transformed into Web-based and printed documentation, and used in developing new ground-system data-handling software. Previously, the information about telemetry and command was scattered in various paper documents that were not synchronized. The process of searching and reading the documents was time-consuming and introduced errors. In contrast, the XML files contain all of the information in one place. XML structures can evolve in such a manner as to enable the addition, to the XML files, of the metadata necessary to track the changes and the associated documentation. The use of this software has reduced the extent of manual operations in developing a ground data system, thereby saving considerable time and removing errors that previously arose in the translation and transcription of software information from the flight to the ground system.

  16. Ibis ground calibration

    International Nuclear Information System (INIS)

    Bird, A.J.; Barlow, E.J.; Tikkanen, T.; Bazzano, A.; Del Santo, M.; Ubertini, P.; Blondel, C.; Laurent, P.; Lebrun, F.; Di Cocco, G.; Malaguti, E.; Gabriele, M.; La Rosa, G.; Segreto, A.; Quadrini, E.; Volkmer, R.

    2003-01-01

    We present an overview of results obtained from IBIS ground calibrations. The spectral and spatial characteristics of the detector planes and surrounding passive materials have been determined through a series of calibration campaigns. Measurements of pixel gain, energy resolution, detection uniformity, efficiency and imaging capability are presented. The key results obtained from the ground calibration have been: - optimization of the instrument tunable parameters, - determination of energy linearity for all detection modes, - determination of energy resolution as a function of energy through the range 20 keV - 3 MeV, - demonstration of imaging capability in each mode, - measurement of intrinsic detector non-uniformity and understanding of the effects of passive materials surrounding the detector plane, and - discovery (and closure) of various leakage paths through the passive shielding system

  17. 46 CFR 183.376 - Grounded distribution systems (neutral grounded).

    Science.gov (United States)

    2010-10-01

    ....376 Section 183.376 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER... propulsion, power, lighting, or distribution system having a neutral bus or conductor must have the neutral... generator to ground before the generator is connected to the bus, except the neutral of an emergency power...

  18. Mechanisms in wing-in-ground effect aerodynamics

    Science.gov (United States)

    Jones, Marvin Alan

    An aircraft in low-level flight experiences a large increase in lift and a marked reduction in drag, compared with flight at altitude. This phenomenon is termed the 'wing-in-ground' effect. In these circumstances a region of high pressure is created beneath the aerofoil, and a pressure difference is set up between its upper and lower surfaces. A pressure difference is not permitted at the trailing edge and therefore a mechanism must exist which allows the pressures above and below to adjust themselves to produce a continuous pressure field in the wake. It is the study of this mechanism and its role in the aerodynamics of low-level flight that forms the basis of our investigation. We begin in Chapter 2 by considering the flow past a thin aero-foil moving at moderate distances from the ground, the typical ground clearance a being of order unity. The aforementioned mechanism is introduced and described in detail in the context of this inviscid problem. Chapter 3 considers the same flow for large and small ground clearances and in the later case shows that the flow solution beneath the aerofoil takes on a particularly simple form. In this case the lift is shown to increase as a-1. In Chapter 4 we focus on the flow past the trailing edge of an aerofoil moving even nearer the ground, with the ground just outside the boundary layer. We show that in this case our asymptotic theory for small a is consistent with a 'triple-deck' approach to the problem which incorporates ground effects via a new pressure-displacement law. The triple-deck ground-interference problem is stated and solved. In Chapter 5 we investigate the case where the aerofoil is so near the ground that the ground is inside the boundary layer. Here the moving ground interacts with the aerofoil in a fully viscous way and the non-linear boundary layer equations hold along the entire length of the aerofoil. Again a pressure difference at the trailing edge is not permitted and this produces upstream adjustment

  19. Ground and Space Radar Volume Matching and Comparison Software

    Science.gov (United States)

    Morris, Kenneth; Schwaller, Mathew

    2010-01-01

    This software enables easy comparison of ground- and space-based radar observations. The software was initially designed to compare ground radar reflectivity from operational, ground based Sand C-band meteorological radars with comparable measurements from the Tropical Rainfall Measuring Mission (TRMM) satellite s Precipitation Radar (PR) instrument. The software is also applicable to other ground-based and space-based radars. The ground and space radar volume matching and comparison software was developed in response to requirements defined by the Ground Validation System (GVS) of Goddard s Global Precipitation Mission (GPM) project. This software innovation is specifically concerned with simplifying the comparison of ground- and spacebased radar measurements for the purpose of GPM algorithm and data product validation. This software is unique in that it provides an operational environment to routinely create comparison products, and uses a direct geometric approach to derive common volumes of space- and ground-based radar data. In this approach, spatially coincident volumes are defined by the intersection of individual space-based Precipitation Radar rays with the each of the conical elevation sweeps of the ground radar. Thus, the resampled volume elements of the space and ground radar reflectivity can be directly compared to one another.

  20. Navigating Grounded Theory:A critical and reflective response to the challenges of using grounded theory in an education PhD

    OpenAIRE

    Nelson, James

    2015-01-01

    This paper offers a critical reflection upon the use of a grounded theory approach within a doctoral study. As well as providing an outline of grounded theory, it begins by noting the existence of some powerful critiques of a grounded theory approach, in particular around the key concepts of ‘theory’, ‘discovery’ and ‘ground’. It is argued that, in some cases, grounded theory struggles to counter these challenges, especially in its ‘purist’ forms. However, with reference to research carried o...

  1. Ground water

    International Nuclear Information System (INIS)

    Osmond, J.K.; Cowart, J.B.

    1982-01-01

    The subject is discussed under the headings: background and theory (introduction; fractionation in the hydrosphere; mobility factors; radioisotope evolution and aquifer classification; aquifer disequilibria and geochemical fronts); case studies (introduction; (a) conservative, and (b) non-conservative, behaviour); ground water dating applications (general requirements; radon and helium; radium isotopes; uranium isotopes). (U.K.)

  2. Determination of trace elements in ground water by two preconcentration methods using atomic absorption spectrometry

    International Nuclear Information System (INIS)

    Elhag, A. Y.

    2004-01-01

    This is a comparative study between two different methods of preconcentration done to separate the trace elements cadmium, nickel. chromium, manganese, copper, zinc, and lead in drinking (ground) water samples taken from different locations in Gezira State, central Sudan (the map); these methods are (coprecipitation) with aluminium hydroxide and by Ammonium Pyrrolidine Dithiocarbamate (APDC) using Methyl Isobutyl Ketone (MIBK) as an organic solvent; and subsequent analysis by Atomic Absorption Spectrometry (AAS) for both methods. The result of comparison showed the superiority of the (APDC) coprecipitation method over the aluminium hydroxide coprecipitation method in the total percentage recoveries of the studied trace elements in drinking (ground) water samples, such results confirm previous studies. This study also involves direct analysis of these water samples by atomic absorption spectrometry to determine the concentrations of trace elements Cadmium, Nickel, Chromium, Manganese, Copper, Zinc and Lead and compare it to the corresponding guide line values described by the World Health Organization and the maximum concentrations of trace elements in drinking water permitted by the Sudanese Standards and Metrology Organizations (SSMO), where the concentrations of some elements in some samples were found to be different than the described values by both of the organizations. The study includes a trial to throw light on the effect of the proximity of the water samples sources to the Blue Nile river on its trace elements concentrations; no relation was proved to exist in that respect.(Author)

  3. Experimental studies on a ground coupled heat pump with solar thermal collectors for space heating

    International Nuclear Information System (INIS)

    Xi, Chen; Hongxing, Yang; Lin, Lu; Jinggang, Wang; Wei, Liu

    2011-01-01

    This paper presents experimental studies on a solar-assisted ground coupled heat pump (SAGCHP) system for space heating. The system was installed at the Hebei Academy of Sciences in Shijiazhuang (lat. N38 o 03', long. E114 o 26'), China. Solar collectors are in series connection with the borehole array through plate heat exchangers. Four operation modes of the system were investigated throughout the coldest period in winter (Dec 5th to Dec 27th). The heat pump performance, borehole temperature distributions and solar colleting characteristics of the SAGCHP system are analyzed and compared when the system worked in continuous or intermittent modes with or without solar-assisted heating. The SAGCHP system is proved to perform space heating with high energy efficiency and satisfactory solar fraction, which is a promising substitute for the conventional heating systems. It is also recommended to use the collected solar thermal energy as an alternative source for the heat pump instead of recharging boreholes for heat storage because of the enormous heat capacity of the earth. -- Highlights: → We study four working modes of a solar-assisted ground coupled heat pump. → The heating performance is in direct relation with the borehole temperature. → Solar-assisted heating elevates borehole temperature and system performance. → The system shows higher efficiency over traditional heating systems in cold areas. → Solar heat is not suggested for high temperature seasonal storage.

  4. Understanding cyclic seismicity and ground deformation patterns at volcanoes: Intriguing lessons from Tungurahua volcano, Ecuador

    Science.gov (United States)

    Neuberg, Jürgen W.; Collinson, Amy S. D.; Mothes, Patricia A.; Ruiz, Mario C.; Aguaiza, Santiago

    2018-01-01

    Cyclic seismicity and ground deformation patterns are observed on many volcanoes worldwide where seismic swarms and the tilt of the volcanic flanks provide sensitive tools to assess the state of volcanic activity. Ground deformation at active volcanoes is often interpreted as pressure changes in a magmatic reservoir, and tilt is simply translated accordingly into inflation and deflation of such a reservoir. Tilt data recorded by an instrument in the summit area of Tungurahua volcano in Ecuador, however, show an intriguing and unexpected behaviour on several occasions: prior to a Vulcanian explosion when a pressurisation of the system would be expected, the tilt signal declines significantly, hence indicating depressurisation. At the same time, seismicity increases drastically. Envisaging that such a pattern could carry the potential to forecast Vulcanian explosions on Tungurahua, we use numerical modelling and reproduce the observed tilt patterns in both space and time. We demonstrate that the tilt signal can be more easily explained as caused by shear stress due to viscous flow resistance, rather than by pressurisation of the magmatic plumbing system. In general, our numerical models prove that if magma shear viscosity and ascent rate are high enough, the resulting shear stress is sufficient to generate a tilt signal as observed on Tungurahua. Furthermore, we address the interdependence of tilt and seismicity through shear stress partitioning and suggest that a joint interpretation of tilt and seismicity can shed new light on the eruption potential of silicic volcanoes.

  5. Modeled ground water age distributions

    Science.gov (United States)

    Woolfenden, Linda R.; Ginn, Timothy R.

    2009-01-01

    The age of ground water in any given sample is a distributed quantity representing distributed provenance (in space and time) of the water. Conventional analysis of tracers such as unstable isotopes or anthropogenic chemical species gives discrete or binary measures of the presence of water of a given age. Modeled ground water age distributions provide a continuous measure of contributions from different recharge sources to aquifers. A numerical solution of the ground water age equation of Ginn (1999) was tested both on a hypothetical simplified one-dimensional flow system and under real world conditions. Results from these simulations yield the first continuous distributions of ground water age using this model. Complete age distributions as a function of one and two space dimensions were obtained from both numerical experiments. Simulations in the test problem produced mean ages that were consistent with the expected value at the end of the model domain for all dispersivity values tested, although the mean ages for the two highest dispersivity values deviated slightly from the expected value. Mean ages in the dispersionless case also were consistent with the expected mean ages throughout the physical model domain. Simulations under real world conditions for three dispersivity values resulted in decreasing mean age with increasing dispersivity. This likely is a consequence of an edge effect. However, simulations for all three dispersivity values tested were mass balanced and stable demonstrating that the solution of the ground water age equation can provide estimates of water mass density distributions over age under real world conditions.

  6. Evaluation of multimodal ground cues

    DEFF Research Database (Denmark)

    Nordahl, Rolf; Lecuyer, Anatole; Serafin, Stefania

    2012-01-01

    This chapter presents an array of results on the perception of ground surfaces via multiple sensory modalities,with special attention to non visual perceptual cues, notably those arising from audition and haptics, as well as interactions between them. It also reviews approaches to combining...... synthetic multimodal cues, from vision, haptics, and audition, in order to realize virtual experiences of walking on simulated ground surfaces or other features....

  7. Ground water currents: Developments in innovative ground water treatment, March 1994

    Energy Technology Data Exchange (ETDEWEB)

    Eilers, R.

    1994-03-01

    ;Contents: Hydrodynamic cavitation oxidation destroys organics; Biosparging documented in fuel remediation study; Surfactant flushing research to remove organic liquids from aquifers; and Compilation of Ground-Water Models (a book review).

  8. Principle and Control Design of Active Ground-Fault Arc Suppression Device for Full Compensation of Ground Current

    DEFF Research Database (Denmark)

    Wang, Wen; Zeng, Xiangjun; Yan, Lingjie

    2017-01-01

    current into the neutral without any large-capacity reactors, and thus avoids the aforementioned overvoltage. It compensates all the active, reactive and harmonic components of the ground current to reliably extinguish the ground-fault arcs. A dual-loop voltage control method is proposed to realize arc...... suppression without capacitive current detection. Its time-based feature also brings the benefit of fast response on ground-fault arc suppression. The principle of full current compensation is analyzed, together with the controller design method of the proposed device. Experiment on a prototype was carried...

  9. Method for analysis the complex grounding cables system

    International Nuclear Information System (INIS)

    Ackovski, R.; Acevski, N.

    2002-01-01

    A new iterative method for the analysis of the performances of the complex grounding systems (GS) in underground cable power networks with coated and/or uncoated metal sheathed cables is proposed in this paper. The analyzed grounding system consists of the grounding grid of a high voltage (HV) supplying transformer station (TS), middle voltage/low voltage (MV/LV) consumer TSs and arbitrary number of power cables, connecting them. The derived method takes into consideration the drops of voltage in the cable sheets and the mutual influence among all earthing electrodes, due to the resistive coupling through the soil. By means of the presented method it is possible to calculate the main grounding system performances, such as earth electrode potentials under short circuit fault to ground conditions, earth fault current distribution in the whole complex grounding system, step and touch voltages in the nearness of the earthing electrodes dissipating the fault current in the earth, impedances (resistances) to ground of all possible fault locations, apparent shield impedances to ground of all power cables, e.t.c. The proposed method is based on the admittance summation method [1] and is appropriately extended, so that it takes into account resistive coupling between the elements that the GS. (Author)

  10. Visual Inspection of Water Leakage from Ground Penetrating Radar Radargram

    Science.gov (United States)

    Halimshah, N. N.; Yusup, A.; Mat Amin, Z.; Ghazalli, M. D.

    2015-10-01

    Water loss in town and suburban is currently a significant issue which reflect the performance of water supply management in Malaysia. Consequently, water supply distribution system has to be maintained in order to prevent shortage of water supply in an area. Various techniques for detecting a mains water leaks are available but mostly are time-consuming, disruptive and expensive. In this paper, the potential of Ground Penetrating Radar (GPR) as a non-destructive method to correctly and efficiently detect mains water leaks has been examined. Several experiments were designed and conducted to prove that GPR can be used as tool for water leakage detection. These include instrument validation test and soil compaction test to clarify the maximum dry density (MDD) of soil and simulation studies on water leakage at a test bed consisting of PVC pipe burying in sand to a depth of 40 cm. Data from GPR detection are processed using the Reflex 2D software. Identification of water leakage was visually inspected from the anomalies in the radargram based on GPR reflection coefficients. The results have ascertained the capability and effectiveness of the GPR in detecting water leakage which could help avoiding difficulties with other leak detection methods.

  11. VISUAL INSPECTION OF WATER LEAKAGE FROM GROUND PENETRATING RADAR RADARGRAM

    Directory of Open Access Journals (Sweden)

    N. N. Halimshah

    2015-10-01

    Full Text Available Water loss in town and suburban is currently a significant issue which reflect the performance of water supply management in Malaysia. Consequently, water supply distribution system has to be maintained in order to prevent shortage of water supply in an area. Various techniques for detecting a mains water leaks are available but mostly are time-consuming, disruptive and expensive. In this paper, the potential of Ground Penetrating Radar (GPR as a non-destructive method to correctly and efficiently detect mains water leaks has been examined. Several experiments were designed and conducted to prove that GPR can be used as tool for water leakage detection. These include instrument validation test and soil compaction test to clarify the maximum dry density (MDD of soil and simulation studies on water leakage at a test bed consisting of PVC pipe burying in sand to a depth of 40 cm. Data from GPR detection are processed using the Reflex 2D software. Identification of water leakage was visually inspected from the anomalies in the radargram based on GPR reflection coefficients. The results have ascertained the capability and effectiveness of the GPR in detecting water leakage which could help avoiding difficulties with other leak detection methods.

  12. Grounded theory methodology - has it become a movement?

    OpenAIRE

    Berterö, Carina

    2012-01-01

    There is an ongoing debate regarding the nature of grounded theory, and an examination of many studies claiming to follow grounded theory indicates a wide range of approaches. In 1967 Glaser and Strauss’s ‘‘The Discovery of Grounded Theory; Strategies for Qualitative Research’’ was published and represented a breakthrough in qualitative research; it offered methodological consensus and systematic strategies for qualitative research practice. The defining characteristics of grounded theory inc...

  13. Predicting Ground Illuminance

    Science.gov (United States)

    Lesniak, Michael V.; Tregoning, Brett D.; Hitchens, Alexandra E.

    2015-01-01

    Our Sun outputs 3.85 x 1026 W of radiation, of which roughly 37% is in the visible band. It is directly responsible for nearly all natural illuminance experienced on Earth's surface, either in the form of direct/refracted sunlight or in reflected light bouncing off the surfaces and/or atmospheres of our Moon and the visible planets. Ground illuminance, defined as the amount of visible light intercepting a unit area of surface (from all incident angles), varies over 7 orders of magnitude from day to night. It is highly dependent on well-modeled factors such as the relative positions of the Sun, Earth, and Moon. It is also dependent on less predictable factors such as local atmospheric conditions and weather.Several models have been proposed to predict ground illuminance, including Brown (1952) and Shapiro (1982, 1987). The Brown model is a set of empirical data collected from observation points around the world that has been reduced to a smooth fit of illuminance against a single variable, solar altitude. It provides limited applicability to the Moon and for cloudy conditions via multiplicative reduction factors. The Shapiro model is a theoretical model that treats the atmosphere as a three layer system of light reflectance and transmittance. It has different sets of reflectance and transmittance coefficients for various cloud types.In this paper we compare the models' predictions to ground illuminance data from an observing run at the White Sands missile range (data was obtained from the United Kingdom's Meteorology Office). Continuous illuminance readings were recorded under various cloud conditions, during both daytime and nighttime hours. We find that under clear skies, the Shapiro model tends to better fit the observations during daytime hours with typical discrepancies under 10%. Under cloudy skies, both models tend to poorly predict ground illuminance. However, the Shapiro model, with typical average daytime discrepancies of 25% or less in many cases

  14. Hanford Site ground-water monitoring for 1994

    International Nuclear Information System (INIS)

    Dresel, P.E.; Thorne, P.D.; Luttrell, S.P.

    1995-08-01

    This report presents the results of the Ground-Water Surveillance Project monitoring for calendar year 1994 on the Hanford Site, Washington. Hanford Site operations from 1943 onward produced large quantities of radiologic and chemical waste that have impacted ground-water quality on the Site. Monitoring of water levels and ground-water chemistry is performed to track the extent of contamination and trends in contaminant concentrations. The 1994 monitoring was also designed to identify emerging ground-water quality problems. The information obtained is used to verify compliance with applicable environmental regulations and to evaluate remedial actions. Data from other monitoring and characterization programs were incorporated to provide an integrated assessment of Site ground-water quality. Additional characterization of the Site's geologic setting and hydrology was performed to support the interpretation of contaminant distributions. Numerical modeling of sitewide ground-water flow also supported the overall project goals. Water-level monitoring was performed to evaluate ground-water flow directions, to track changes in water levels, and to relate such changes to changes in site disposal practices. Water levels over most of the Hanford Site continued to decline between June 1993 and June 1994. These declines are part of the continued response to the cessation of discharge to U Pond and other disposal facilities. The low permeability in this area which enhanced mounding of waste-water discharge has also slowed the response to the reduction of disposal

  15. Hanford Site ground-water monitoring for 1994

    Energy Technology Data Exchange (ETDEWEB)

    Dresel, P.E.; Thorne, P.D.; Luttrell, S.P. [and others

    1995-08-01

    This report presents the results of the Ground-Water Surveillance Project monitoring for calendar year 1994 on the Hanford Site, Washington. Hanford Site operations from 1943 onward produced large quantities of radiologic and chemical waste that have impacted ground-water quality on the Site. Monitoring of water levels and ground-water chemistry is performed to track the extent of contamination and trends in contaminant concentrations. The 1994 monitoring was also designed to identify emerging ground-water quality problems. The information obtained is used to verify compliance with applicable environmental regulations and to evaluate remedial actions. Data from other monitoring and characterization programs were incorporated to provide an integrated assessment of Site ground-water quality. Additional characterization of the Site`s geologic setting and hydrology was performed to support the interpretation of contaminant distributions. Numerical modeling of sitewide ground-water flow also supported the overall project goals. Water-level monitoring was performed to evaluate ground-water flow directions, to track changes in water levels, and to relate such changes to changes in site disposal practices. Water levels over most of the Hanford Site continued to decline between June 1993 and June 1994. These declines are part of the continued response to the cessation of discharge to U Pond and other disposal facilities. The low permeability in this area which enhanced mounding of waste-water discharge has also slowed the response to the reduction of disposal.

  16. Navigating the grounded theory terrain. Part 2.

    Science.gov (United States)

    Hunter, Andrew; Murphy, Kathy; Grealish, Annmarie; Casey, Dympna; Keady, John

    2011-01-01

    In this paper, the choice of classic grounded theory will be discussed and justified in the context of the first author's PhD research. The methodological discussion takes place within the context of PhD research entitled: Development of a stakeholder-led framework for a structured education programme that will prepare nurses and healthcare assistants to deliver a psychosocial intervention for people with dementia. There is a lack of research and limited understanding of the effect of psychosocial interventions on people with dementia. The first author thought classic grounded theory a suitable research methodology to investigate as it is held to be ideal for areas of research where there is little understanding of the social processes at work. The literature relating to the practical application of classic grounded theory is illustrated using examples relating to four key grounded theory components: Theory development: using constant comparison and memoing, Methodological rigour, Emergence of a core category, Inclusion of self and engagement with participants. Following discussion of the choice and application of classic grounded theory, this paper explores the need for researchers to visit and understand the various grounded theory options. This paper argues that researchers new to grounded theory must be familiar with and understand the various options. The researchers will then be able to apply the methodologies they choose consistently and critically. Doing so will allow them to develop theory rigorously and they will ultimately be able to better defend their final methodological destinations.

  17. Airfield Ground Safety

    National Research Council Canada - National Science Library

    Petrescu, Jon

    2000-01-01

    .... The system developed under AGS, called the Ground Safety Tracking and Reporting System, uses multisensor data fusion from in-pavement inductive loop sensors to address a critical problem affecting out nation's airports: runway incursions...

  18. Ground Motion Prediction Equations Empowered by Stress Drop Measurement

    Science.gov (United States)

    Miyake, H.; Oth, A.

    2015-12-01

    Significant variation of stress drop is a crucial issue for ground motion prediction equations and probabilistic seismic hazard assessment, since only a few ground motion prediction equations take into account stress drop. In addition to average and sigma studies of stress drop and ground motion prediction equations (e.g., Cotton et al., 2013; Baltay and Hanks, 2014), we explore 1-to-1 relationship for each earthquake between stress drop and between-event residual of a ground motion prediction equation. We used the stress drop dataset of Oth (2013) for Japanese crustal earthquakes ranging 0.1 to 100 MPa and K-NET/KiK-net ground motion dataset against for several ground motion prediction equations with volcanic front treatment. Between-event residuals for ground accelerations and velocities are generally coincident with stress drop, as investigated by seismic intensity measures of Oth et al. (2015). Moreover, we found faster attenuation of ground acceleration and velocities for large stress drop events for the similar fault distance range and focal depth. It may suggest an alternative parameterization of stress drop to control attenuation distance rate for ground motion prediction equations. We also investigate 1-to-1 relationship and sigma for regional/national-scale stress drop variation and current national-scale ground motion equations.

  19. Effectiveness of the Factory Reset on a Mobile Device

    Science.gov (United States)

    2014-03-01

    images and photos taken by the camera (.jpg, .png)  Other user data (address book /phone book /calendar data) The data that should be left behind...statements  Credit card statements  Tax returns  Emails  Contact lists  Photos The authors tested secondhand phones purchased through

  20. Ground-Water Protection and Monitoring Program

    Energy Technology Data Exchange (ETDEWEB)

    Dresel, P.E.

    1995-06-01

    This section of the 1994 Hanford Site Environmental Report summarizes the ground-water protection and monitoring program strategy for the Hanford Site in 1994. Two of the key elements of this strategy are to (1) protect the unconfined aquifer from further contamination, and (2) conduct a monitoring program to provide early warning when contamination of ground water does occur. The monitoring program at Hanford is designed to document the distribution and movement of existing ground-water contamination and provides a historical baseline for evaluating current and future risk from exposure to the contamination and for deciding on remedial action options.

  1. Ground-Water Protection and Monitoring Program

    International Nuclear Information System (INIS)

    Dresel, P.E.

    1995-01-01

    This section of the 1994 Hanford Site Environmental Report summarizes the ground-water protection and monitoring program strategy for the Hanford Site in 1994. Two of the key elements of this strategy are to (1) protect the unconfined aquifer from further contamination, and (2) conduct a monitoring program to provide early warning when contamination of ground water does occur. The monitoring program at Hanford is designed to document the distribution and movement of existing ground-water contamination and provides a historical baseline for evaluating current and future risk from exposure to the contamination and for deciding on remedial action options

  2. Ground motion effects

    Energy Technology Data Exchange (ETDEWEB)

    Blume, J A [John A. Blume and Associates, San Francisco, CA (United States)

    1969-07-01

    Ground motion caused by natural earthquakes or by nuclear explosion causes buildings and other structures to respond in such manner as possibly to have high unit stresses and to be subject to damage or-in some cases-collapse. Even minor damage may constitute a hazard to persons within or adjacent to buildings. The risk of damage may well be the governing restraint on the uses of nuclear energy for peaceful purposes. Theory is advanced regarding structural-dynamic response but real buildings and structures are complex, highly variable, and often difficult to model realistically. This paper discusses the state of knowledge, the art of damage prediction and safety precautions, and shows ground motion effects from explosions of underground nuclear devices in the continental United States including events Salmon, Gasbuggy, Boxcar, Faultless and Benham. (author)

  3. Ground motion effects

    International Nuclear Information System (INIS)

    Blume, J.A.

    1969-01-01

    Ground motion caused by natural earthquakes or by nuclear explosion causes buildings and other structures to respond in such manner as possibly to have high unit stresses and to be subject to damage or-in some cases-collapse. Even minor damage may constitute a hazard to persons within or adjacent to buildings. The risk of damage may well be the governing restraint on the uses of nuclear energy for peaceful purposes. Theory is advanced regarding structural-dynamic response but real buildings and structures are complex, highly variable, and often difficult to model realistically. This paper discusses the state of knowledge, the art of damage prediction and safety precautions, and shows ground motion effects from explosions of underground nuclear devices in the continental United States including events Salmon, Gasbuggy, Boxcar, Faultless and Benham. (author)

  4. Advanced Testing Method for Ground Thermal Conductivity

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Xiaobing [ORNL; Clemenzi, Rick [Geothermal Design Center Inc.; Liu, Su [University of Tennessee (UT)

    2017-04-01

    A new method is developed that can quickly and more accurately determine the effective ground thermal conductivity (GTC) based on thermal response test (TRT) results. Ground thermal conductivity is an important parameter for sizing ground heat exchangers (GHEXs) used by geothermal heat pump systems. The conventional GTC test method usually requires a TRT for 48 hours with a very stable electric power supply throughout the entire test. In contrast, the new method reduces the required test time by 40%–60% or more, and it can determine GTC even with an unstable or intermittent power supply. Consequently, it can significantly reduce the cost of GTC testing and increase its use, which will enable optimal design of geothermal heat pump systems. Further, this new method provides more information about the thermal properties of the GHEX and the ground than previous techniques. It can verify the installation quality of GHEXs and has the potential, if developed, to characterize the heterogeneous thermal properties of the ground formation surrounding the GHEXs.

  5. Figure-ground mechanisms provide structure for selective attention

    OpenAIRE

    Qiu, Fangtu T.; Sugihara, Tadashi; von der Heydt, Rüdiger

    2007-01-01

    Attention depends on figure-ground organization: figures draw attention, while shapes of the ground tend to be ignored. Recent research has demonstrated mechanisms of figure-ground organization in the visual cortex, but how they relate to the attention process remains unclear. Here we show that the influences of figure-ground organization and volitional (top-down) attention converge in single neurons of area V2. While assignment of border ownership was found for attended as well as for ignore...

  6. Grounded meets floating

    Science.gov (United States)

    Walker, Ryan T.

    2018-04-01

    A comprehensive assessment of grounding-line migration rates around Antarctica, covering a third of the coast, suggests retreat in considerable portions of the continent, beyond the rates expected from adjustment following the Last Glacial Maximum.

  7. Electromagnetic properties of the three-nucleon ground state

    International Nuclear Information System (INIS)

    Strueve, W.

    1985-01-01

    The electromagnetic form factors of the three-nucleon ground state are calculated on the base of an exact solution of the Faddeev equations. In a Hilbert space of nucleons and a possible Δ-isobar the effects of a non-perturbative description of the Δ-isobar on the magnetic form factors are studied. Pure nucleonic current operators with two- and three-particle character can be described in the extended Hilbert space by simpler one-body operators. Additionally nonrelativistic meson-exchange corrections due to π and ρ exchange are calculated consistently with the requirements of current conservation. Further relativistic corrections are estimated on selected examples. The calculations yield a total magnetic contribution of the Δ-isobar which is smaller than hitherto assumed, a static approximation of the Δ propagation is proved as inadmissible and must be rejected. Together with the meson-exchange corrections a well agreement with the experimental data at low momentum transfers results. Especially the magnetic moments and magnetization radii can be explained. For higher momentum transfers the results show the importance of further corrections. The regard of selected relativistic corrections leads to a good description of the experimental magnetic form factors. Also by this way the position of the minimum and the height of the second maximum in the 3 He charge form factor can be explained. The comparison with the latest experimental results reveals furthermore unresolved problems in the description of the 3 H charge form factor. (orig.) [de

  8. Characterization of the effects of borehole configuration and interference with long term ground temperature modelling of ground source heat pumps

    International Nuclear Information System (INIS)

    Law, Ying Lam E.; Dworkin, Seth B.

    2016-01-01

    Highlights: • Long term ground temperature response is explored using finite element methods. • Simulation method is validated against experimental and analytical data. • Temperature changes at a fast rate in the first few years and slows down gradually. • ASHRAE recommended separation distances are not always sufficient. • Thermal accumulation occurs at the centre of borehole field. - Abstract: Ground source heat pumps (GSHPs) are an environmentally friendly alternative to conventional heating and cooling systems because of their high efficiency and low greenhouse gas emissions. The ground acts as a heat sink/source for the excess/required heat inside a building for cooling and heating modes, respectively. However, imbalance in heating and cooling needs can change ground temperature over the operating duration. This increase/decrease in ground temperature lowers system efficiency and causes the ground to foul—failing to accept or provide more heat. In order to ensure that GSHPs can operate to their designed conditions, thermal modelling is required to simulate the ground temperature during system operation. In addition, the borehole field layout can have a major impact on ground temperature. In this study, four buildings were studied—a hospital, fast-food restaurant, residence, and school, each with varying borehole configurations. Boreholes were modelled in a soil volume using finite-element methods and heating and cooling fluxes were applied to the borehole walls to simulate the GSHP operation. 20 years of operation were modelled for each building for 2 × 2, 4 × 4, and 2 × 8 borehole configurations. Results indicate that the borehole separation distance of 6 m, recommended by ASHRAE, is not always sufficient to prevent borehole thermal interactions. Benefits of using a 2 × 8 configuration as opposed to a 4 × 4 configuration, which can be observed because of the larger perimeter it provides for heat to dissipate to surrounding soil were

  9. Antimicrobial activity of the pygidial gland secretion of three ground beetle species (Insecta: Coleoptera: Carabidae)

    Science.gov (United States)

    Nenadić, Marija; Soković, Marina; Glamočlija, Jasmina; Ćirić, Ana; Perić-Mataruga, Vesna; Ilijin, Larisa; Tešević, Vele; Vujisić, Ljubodrag; Todosijević, Marina; Vesović, Nikola; Ćurčić, Srećko

    2016-04-01

    The antimicrobial properties of the pygidial gland secretions released by the adults of the three ground beetle species, Carabus ullrichii, C. coriaceus, and Abax parallelepipedus, have been tested. Microdilution method was applied for detection of minimal inhibitory concentrations (MICs), minimal bactericidal concentrations (MBCs), and minimal fungicidal concentrations (MFCs). Additionally, morpho-histology of the pygidial glands is investigated. We have tested 16 laboratory and clinical strains of human pathogens—eight bacterial both gram-positive and gram-negative species and eight fungal species. The pygidial secretion samples of C. ullrichii have showed the strongest antimicrobial effect against all strains of treated bacteria and fungi. Staphylococcus aureus, Lysteria monocytogenes, and Salmonella typhimurium proved to be the most sensitive bacterial strains. Penicillium funiculosum proved to be the most sensitive micromycete, while P. ochrochloron and P. verrucosum var . cyclopium the most resistant micromycetes. The pygidial secretion of C. coriaceus has showed antibacterial potential solely against Pseudomonas aeruginosa and antifungal activity against Aspergillus fumigatus, A. versicolor, A. ochraceus, and P. ochrochloron. Antibacterial properties of pygidial gland secretion of A. parallelepipedus were achieved against P. aeruginosa, while antifungal activity was detected against five of the eight tested micromycetes (A. fumigatus, A. versicolor, A. ochraceus, Trichoderma viride, and P. verrucosum var . cyclopium). Commercial antibiotics Streptomycin and Ampicillin and mycotics Ketoconazole and Bifonazole, applied as the positive controls, showed higher antibacterial/antifungal properties for all bacterial and fungal strains. The results of this observation might have a significant impact on the environmental aspects and possible medical purpose in the future.

  10. 30 CFR 75.801 - Grounding resistors.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Grounding resistors. 75.801 Section 75.801 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR COAL MINE SAFETY AND HEALTH MANDATORY SAFETY STANDARDS-UNDERGROUND COAL MINES Underground High-Voltage Distribution § 75.801 Grounding...

  11. Automated Theorem Proving in High-Quality Software Design

    Science.gov (United States)

    Schumann, Johann; Swanson, Keith (Technical Monitor)

    2001-01-01

    The amount and complexity of software developed during the last few years has increased tremendously. In particular, programs are being used more and more in embedded systems (from car-brakes to plant-control). Many of these applications are safety-relevant, i.e. a malfunction of hardware or software can cause severe damage or loss. Tremendous risks are typically present in the area of aviation, (nuclear) power plants or (chemical) plant control. Here, even small problems can lead to thousands of casualties and huge financial losses. Large financial risks also exist when computer systems are used in the area of telecommunication (telephone, electronic commerce) or space exploration. Computer applications in this area are not only subject to safety considerations, but also security issues are important. All these systems must be designed and developed to guarantee high quality with respect to safety and security. Even in an industrial setting which is (or at least should be) aware of the high requirements in Software Engineering, many incidents occur. For example, the Warshaw Airbus crash, was caused by an incomplete requirements specification. Uncontrolled reuse of an Ariane 4 software module was the reason for the Ariane 5 disaster. Some recent incidents in the telecommunication area, like illegal "cloning" of smart-cards of D2GSM handies, or the extraction of (secret) passwords from German T-online users show that also in this area serious flaws can happen. Due to the inherent complexity of computer systems, most authors claim that only a rigorous application of formal methods in all stages of the software life cycle can ensure high quality of the software and lead to real safe and secure systems. In this paper, we will have a look, in how far automated theorem proving can contribute to a more widespread application of formal methods and their tools, and what automated theorem provers (ATPs) must provide in order to be useful.

  12. Tethered Pyrotechnic Apparatus for Acquiring a Ground Sample

    Science.gov (United States)

    Jones, Jack; Zimmerman, Wayne; Wu, Jiunn Jenq; Badescu, Mircea; Sherrit, Stewart

    2009-01-01

    A proposed alternative design for the balloon-borne ground-sampling system described in the immediately preceding article would not rely on free fall to drive a harpoonlike sample-collecting device into the ground. Instead, the harpoon-like sample-collecting device would be a pyrotechnically driven, tethered projectile. The apparatus would include a tripod that would be tethered to the gondola. A gun for shooting the projectile into the ground would be mounted at the apex of the tripod. The gun would include an electronic trigger circuit, a chamber at the breech end containing a pyrotechnic charge, and a barrel. A sabot would be placed in the barrel just below the pyrotechnic charge, and the tethered projectile would be placed in the barrel just below the sabot. The tripod feet would be equipped with contact sensors connected to the trigger circuit. In operation, the tripod would be lowered to the ground on its tether. Once contact with the ground was detected by the sensors on all three tripod feet, the trigger circuit would fire the pyrotechnic charge to drive the projectile into the ground. (Requiring contact among all three tripod feet and the ground would ensure that the projectile would be fired into the ground, rather than up toward the gondola or the balloon.) The tethered projectile would then be reeled back up to the gondola for analysis of the sample.

  13. Formation keeping of unmanned ground vehicles

    Directory of Open Access Journals (Sweden)

    Muangmin Kamonwan

    2017-01-01

    Full Text Available Controlling motions of an unmanned ground vehicle becomes more popular in real world practices. Its application is useful for household chores, military services, medical purposes, and industrial revolutions, etc. An analysis of motions by using the Fundamental Equations of Constrained Motion (FECM is one effective tool to determine the motions. Its conceptualization is done in three-step procedure as follows: (I Determining an unconstrained motion (II Assigning constraint equations and (III Computing a constrained motion. The equations of motion obtained are expressed as liner functions of acceleration. Then other kinematical information of the unmanned ground vehicles can be obtained by integration its acceleration. In this work, the FECM is used as a tool to analyze motions of a group of unmanned ground vehicles in various forms. The simulation results show that control forces obtained from the approach can regulate motions of unmanned ground vehicles to maneuver in desired formations.

  14. Grounded theory research: literature reviewing and reflexivity.

    Science.gov (United States)

    McGhee, Gerry; Marland, Glenn R; Atkinson, Jacqueline

    2007-11-01

    This paper is a report of a discussion of the arguments surrounding the role of the initial literature review in grounded theory. Researchers new to grounded theory may find themselves confused about the literature review, something we ourselves experienced, pointing to the need for clarity about use of the literature in grounded theory to help guide others about to embark on similar research journeys. The arguments for and against the use of a substantial topic-related initial literature review in a grounded theory study are discussed, giving examples from our own studies. The use of theoretically sampled literature and the necessity for reflexivity are also discussed. Reflexivity is viewed as the explicit quest to limit researcher effects on the data by awareness of self, something seen as integral both to the process of data collection and the constant comparison method essential to grounded theory. A researcher who is close to the field may already be theoretically sensitized and familiar with the literature on the study topic. Use of literature or any other preknowledge should not prevent a grounded theory arising from the inductive-deductive interplay which is at the heart of this method. Reflexivity is needed to prevent prior knowledge distorting the researcher's perceptions of the data.

  15. Detecting and characterizing unroofed caves by ground penetrating radar

    Science.gov (United States)

    Čeru, Teja; Šegina, Ela; Knez, Martin; Benac, Čedomir; Gosar, Andrej

    2018-02-01

    The bare karst surface in the southeastern part of Krk Island (Croatia) is characterized by different surface karst features, such as valley-like shallow linear depressions and partially or fully sediment-filled depressions of various shapes and sizes. They were noticed due to locally increased thickness of sediment and enhanced vegetation but had not yet been systematically studied and defined. Considering only the geometry of the investigated surface features and the rare traces of cave environments detected by field surveys, it was unclear which processes (surface karstification and/or speleogenesis) contributed most to their formation. The low-frequency ground penetrating radar (GPR) method using a special 50 MHz RTA antenna was applied to study and describe these karst features. Three study sites were chosen and 5 km of GPR profiles were positioned to include various surface features. The results obtained from the GPR investigation lead to the following conclusions: (1) an increased thickness of sediment was detected in all the investigated depressions indicating their considerable depth; (2) areas between different depressions expressed as attenuated zones in GPR images reveal their interconnection; (3) transitions between surface and underground features are characterized by a collapsed passage visible in the GPR data; and (4) an underground continuation of surface valley-like depressions was detected, proving the speleogenetic origin of such features. Subsurface information obtained using GPR indicates that the valley-like depressions, irregular depressions completely or partially filled with sediment, and some dolines are associated with a nearly 4 km-long unroofed cave and developed as a result of karst denudation. In the regional context, these results suggest long-lasting karstification processes in the area, in contrast to the pre-karstic fluvial phase previously assumed to have occurred here. This research is the first application of the GPR method to

  16. Cooperative heat transfer and ground coupled storage system

    Science.gov (United States)

    Metz, P.D.

    A cooperative heat transfer and ground coupled storage system wherein collected solar heat energy is ground stored and permitted to radiate into the adjacent ground for storage therein over an extended period of time when such heat energy is seasonally maximally available. Thereafter, when said heat energy is seasonally minimally available and has propagated through the adjacent ground a substantial distance, the stored heat energy may be retrieved by a circumferentially arranged heat transfer means having a high rate of heat transfer.

  17. Compensation for incoherent ground motion

    International Nuclear Information System (INIS)

    Shigeru, Takeda; Hiroshi, Matsumoto; Masakazu, Yoshioka; Yasunori, Takeuchi; Kikuo, Kudo; Tsuneya, Tsubokawa; Mitsuaki, Nozaki; Kiyotomo, Kawagoe

    1999-01-01

    The power spectrum density and coherence function for ground motions are studied for the construction of the next generation electron-positron linear collider. It should provide a center of mass energy between 500 GeV-1 TeV with luminosity as high as 10 33 to 10 34 cm -2 sec -1 . Since the linear collider has a relatively slow repetition rate, large number of particles and small sizes of the beam should be generated and preserved in the machine to obtain the required high luminosity. One of the most critical parameters is the extremely small vertical beam size at the interaction point, thus a proper alignment system for the focusing and accelerating elements of the machine is necessary to achieve the luminosity. We describe recent observed incoherent ground motions and an alignment system to compensate the distortion by the ground motions. (authors)

  18. Ambulatory Measurement of Ground Reaction Forces

    NARCIS (Netherlands)

    Veltink, Peter H.; Liedtke, Christian; Droog, Ed

    2004-01-01

    The measurement of ground reaction forces is important in the biomechanical analysis of gait and other motor activities. It is the purpose of this study to show the feasibility of ambulatory measurement of ground reaction forces using two six degrees of freedom sensors mounted under the shoe. One

  19. Ground Truth Collections at the MTI Core Sites

    International Nuclear Information System (INIS)

    Garrett, A.J.

    2001-01-01

    The Savannah River Technology Center (SRTC) selected 13 sites across the continental US and one site in the western Pacific to serve as the primary or core site for collection of ground truth data for validation of MTI science algorithms. Imagery and ground truth data from several of these sites are presented in this paper. These sites are the Comanche Peak, Pilgrim and Turkey Point power plants, Ivanpah playas, Crater Lake, Stennis Space Center and the Tropical Western Pacific ARM site on the island of Nauru. Ground truth data includes water temperatures (bulk and skin), radiometric data, meteorological data and plant operating data. The organizations that manage these sites assist SRTC with its ground truth data collections and also give the MTI project a variety of ground truth measurements that they make for their own purposes. Collectively, the ground truth data from the 14 core sites constitute a comprehensive database for science algorithm validation

  20. Dynamic tire pressure sensor for measuring ground vibration.

    Science.gov (United States)

    Wang, Qi; McDaniel, James Gregory; Wang, Ming L

    2012-11-07

    This work presents a convenient and non-contact acoustic sensing approach for measuring ground vibration. This approach, which uses an instantaneous dynamic tire pressure sensor (DTPS), possesses the capability to replace the accelerometer or directional microphone currently being used for inspecting pavement conditions. By measuring dynamic pressure changes inside the tire, ground vibration can be amplified and isolated from environmental noise. In this work, verifications of the DTPS concept of sensing inside the tire have been carried out. In addition, comparisons between a DTPS, ground-mounted accelerometer, and directional microphone are made. A data analysis algorithm has been developed and optimized to reconstruct ground acceleration from DTPS data. Numerical and experimental studies of this DTPS reveal a strong potential for measuring ground vibration caused by a moving vehicle. A calibration of transfer function between dynamic tire pressure change and ground acceleration may be needed for different tire system or for more accurate application.

  1. Grounding line processes on the Totten Glacier

    Science.gov (United States)

    Cook, S.; Watson, C. S.; Galton-Fenzi, B.; Peters, L. E.; Coleman, R.

    2017-12-01

    The Totten Glacier has been an area of recent interest due to its large drainage basin, much of which is grounded below sea level and has a history of large scale grounding line movement. Reports that warm water reaches the sub-ice shelf cavity have led to speculation that it could be vulnerable to future grounding line retreat. Over the Antarctic summer 2016/17 an array of 6 GPS and autonomous phase-sensitive radar (ApRES) units were deployed in the grounding zone of the Totten Glacier. These instruments measure changes in ice velocity and thickness which can be used to investigate both ice dynamics across the grounding line, and the interaction between ice and ocean in the subglacial cavity. Basal melt rates calculated from the ApRES units on floating ice range from 1 to 17 m/a. These values are significantly lower than previous estimates of basal melt rate produced by ocean modelling of the subglacial cavity. Meanwhile, GPS-derived velocity and elevation on the surface of the ice show a strong tidal signal, as does the vertical strain rate within the ice derived from internal layering from the ApRES instruments. These results demonstrate the significance of the complex grounding pattern of the Totten Glacier. The presence of re-grounding points has significant implications for the dynamics of the glacier and the ocean circulation within the subglacial cavity. We discuss what can be learned from our in situ measurements, and how they can be used to improve models of the glacier's future behaviour.

  2. Heat recovery from ground below the solar pond

    NARCIS (Netherlands)

    Ganguly, S.; Date, Abhijit; Akbarzadeh, Aliakbar

    2017-01-01

    The method of heat recovery from the ground below solar ponds is investigated in the present brief note. Solar ponds lose considerable amount of heat from its bottom to the ground due to temperature gradient between them. This waste heat from ground, which is at different temperature at different

  3. Modelling of the evolution of ground waters in a granite system at low temperature: the Stripa ground waters, Sweden

    International Nuclear Information System (INIS)

    Grimaud, D.; Michard, G.; Beaucaire, C.

    1990-01-01

    From chemical data on the Stripa ground waters we have tried to model the evolution of the chemical composition of a ground water in a granitic system at low temperature. The existence of two end-member ground water compositions made it possible first, to test the conventional model of a geothermal system according to which an overall equilibrium between the waters and a given mineral assemblage can be defined, and then to show that such a model could be extended to low temperatures (10 o C). Conversely, if we know the mineral assemblage, the equilibration temperature and the charge of the mobile ions (in this case, Cl), the composition of the solution is entirely fixed. In our model of the Stripa ground waters, the existence of two end-member ground water compositions can be explained by an evolution from a ''kaolinite-albite-laumontite'' equilibrium to a ''prehnite-albite-laumontite'' equilibrium, the latter requiring less Al than the former. We have also emphasized the importance of the Cl ion concentrations of the ground waters, because they can be considered as indicators of the degree of reaction progress between rock and water, thus determining the degree of equilibration of the system. (author)

  4. Biodiesel Production from Spent Coffee Grounds

    Science.gov (United States)

    Blinová, Lenka; Bartošová, Alica; Sirotiak, Maroš

    2017-06-01

    The residue after brewing the spent coffee grounds is an oil-containing waste material having a potential of being used as biodiesel feedstock. Biodiesel production from the waste coffee grounds oil involves collection and transportation of coffee residue, drying, oil extraction, and finally production of biodiesel. Different methods of oil extraction with organic solvents under different conditions show significant differences in the extraction yields. In the manufacturing of biodiesel from coffee oil, the level of reaction completion strongly depends on the quality of the feedstock oil. This paper presents an overview of oil extraction and a method of biodiesel production from spent coffee grounds.

  5. Great Moravian burial grounds in Rajhrad and Rajhradice

    OpenAIRE

    Hendrychová, Soňa

    2015-01-01

    The diploma thesis presented deals with an overall assessment of the Great Moravian burial ground in Rajhrad (Brno- venkov), which was excavated in the years 1972 to 1976. The work is based on a catalogue of this burial ground and the neighbouring one in Rajhradice published by Čeněk Staňa. It follows individual aspects of funeral rites at a necropolis and evaluates the inventory of the graves. Based on the findings, the work dates the burial ground, compares with burial ground in Rajhradice ...

  6. On the ground state of Yang-Mills theory

    International Nuclear Information System (INIS)

    Bakry, Ahmed S.; Leinweber, Derek B.; Williams, Anthony G.

    2011-01-01

    Highlights: → The ground state overlap for sets of meson potential trial states is measured. → Non-uniform gluonic distributions are probed via Wilson loop operator. → The locally UV-regulated flux-tube operators can optimize the ground state overlap. - Abstract: We investigate the overlap of the ground state meson potential with sets of mesonic-trial wave functions corresponding to different gluonic distributions. We probe the transverse structure of the flux tube through the creation of non-uniform smearing profiles for the string of glue connecting two color sources in Wilson loop operator. The non-uniformly UV-regulated flux-tube operators are found to optimize the overlap with the ground state and display interesting features in the ground state overlap.

  7. A Guide for Using the Transient Ground-Water Flow Model of the Death Valley Regional Ground-Water Flow System, Nevada and California

    Energy Technology Data Exchange (ETDEWEB)

    Joan B. Blainey; Claudia C. Faunt, and Mary C. Hill

    2006-05-16

    This report is a guide for executing numerical simulations with the transient ground-water flow model of the Death Valley regional ground-water flow system, Nevada and California using the U.S. Geological Survey modular finite-difference ground-water flow model, MODFLOW-2000. Model inputs, including observations of hydraulic head, discharge, and boundary flows, are summarized. Modification of the DVRFS transient ground-water model is discussed for two common uses of the Death Valley regional ground-water flow system model: predictive pumping scenarios that extend beyond the end of the model simulation period (1998), and model simulations with only steady-state conditions.

  8. Puzzling the Picture Using Grounded Theory

    Science.gov (United States)

    Bennett, Elisabeth E.

    2016-01-01

    Since the first publication by Glaser and Strauss in 1967, Grounded Theory has become a highly influential research approach in the social sciences. The approach provides techniques and coding strategies for building theory inductively from the "ground up" as concepts within the data earn relevance into an evolving substantive theory.…

  9. Ground-based observations of exoplanet atmospheres

    NARCIS (Netherlands)

    Mooij, Ernst Johan Walter de

    2011-01-01

    This thesis focuses on the properties of exoplanet atmospheres. The results for ground-based near-infrared secondary eclipse observations of three different exoplanets, TrES-3b, HAT-P-1b and WASP-33b, are presented which have been obtained with ground-based telescopes as part of the GROUSE project.

  10. 14 CFR 415.117 - Ground safety.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Ground safety. 415.117 Section 415.117... TRANSPORTATION LICENSING LAUNCH LICENSE Safety Review and Approval for Launch of an Expendable Launch Vehicle From a Non-Federal Launch Site § 415.117 Ground safety. (a) General. An applicant's safety review...

  11. Ground Truth Annotation in T Analyst

    DEFF Research Database (Denmark)

    2015-01-01

    This video shows how to annotate the ground truth tracks in the thermal videos. The ground truth tracks are produced to be able to compare them to tracks obtained from a Computer Vision tracking approach. The program used for annotation is T-Analyst, which is developed by Aliaksei Laureshyn, Ph...

  12. Examining the Nexus between Grounded Theory and Symbolic Interactionism

    Directory of Open Access Journals (Sweden)

    P. Jane Milliken RN, PhD

    2012-12-01

    Full Text Available Grounded theory is inherently symbolic interactionist; however, not all grounded theory researchers appreciate its importance or benefit from its influence. Elsewhere, we have written about the intrinsic relationship between grounded theory and symbolic interactionism, highlighting the silent, fundamental contribution of symbolic interactionism to the methodology. At the same time, there are significant insights to be had by bringing a conscious awareness of the philosophy of symbolic interactionism to grounded theory research. In this article we discuss the symbolic interactionist concepts of mind, self, and society, and their applicability in grounded theorizing. Our purpose is to highlight foundational concepts of symbolic interactionism and their centrality in the processes of conducting grounded theory research.

  13. Ground use by northern muriquis (Brachyteles hypoxanthus).

    Science.gov (United States)

    Mourthé, Italo M C; Guedes, Danusa; Fidelis, Janaína; Boubli, Jean P; Mendes, Sérgio L; Strier, Karen B

    2007-06-01

    Many arboreal primates descend to the ground, a custom that may occur more frequently in disturbed habitats, and in the presence of researchers to whom the primates are habituated. In this paper, we describe opportunistic observations of ground use in two groups of northern muriquis (Brachyteles hypoxanthus) at the RPPN Feliciano Miguel Abdala, Minas Gerais, Brazil. Members of both groups were observed drinking, resting, feeding, playing, and traveling on the ground to different degrees, and variation in the levels of habituation of the two groups may be responsible for the differences in the distribution of their terrestrial activities. The potential increase in vulnerability to predation or disease owing to ground use has implications for the conservation of this critically endangered species. (c) 2007 Wiley-Liss, Inc.

  14. Hanford Site ground-water monitoring for 1990

    International Nuclear Information System (INIS)

    Evans, J.C.; Bryce, R.W.; Bates, D.J.

    1992-06-01

    The Pacific Northwest Laboratory monitors ground-water quality across the Hanford Site for the US Department of Energy (DOE) to assess the impact of Site operations on the environment. Monitoring activities were conducted to determine the distribution of mobile radionuclides and identify chemicals present in ground water as a result of Site operations and whenever possible, relate the distribution of these constituents to Site operations. To comply with the Resource Conservation and Recovery Act, additional monitoring was conducted at individual waste sites by the Site Operating Contractor, Westinghouse Hanford Company (WHC), to assess the impact that specific facilities have had on ground-water quality. Six hundred and twenty-nine wells were sampled during 1990 by all Hanford ground-water monitoring activities

  15. Pure Indulgence : Ireland's Top Chefs and Cocktail Experts Reveal the Secrets of Creating with Baileys

    OpenAIRE

    R. & A. Bailey

    2000-01-01

    Published by A & A Farmar , Beech House, 18 Ranelagh Village, Dublin 6 in 2000. Recipes tested by Alacoque Meehan, photography by Walter Pfeiffer, Declan Shanahan & Brian Daly. Designed and set at Cobalt. Printed and bound by Betaprint. 142 p., col.ill.,24 cm. http://arrow.dit.ie/irckbooks/1060/thumbnail.jpg

  16. Irish Soups and Bread

    OpenAIRE

    Cullen, Nuala

    2001-01-01

    Published by Gill & Macmillan Ltd. Hume Avenue, Park West, Dublin 12 in 2001. Index compiled by Cover to Cover, Illustrations by Eva Byrne, Design by Slick Fish Design, Print Origination by Carole Lynch, Printed by ColourBooks, Dublin. 118p, 19cm., paperback http://arrow.dit.ie/irckbooks/1047/thumbnail.jpg

  17. TNX Burying Ground: Environmental information document

    International Nuclear Information System (INIS)

    Dunaway, J.K.W.; Johnson, W.F.; Kingley, L.E.; Simmons, R.V.; Bledsoe, H.W.

    1987-03-01

    The TNX Burying Ground, located within the TNX Area of the Savannah River Plant (SRP), was originally built to dispose of debris from an experimental evaporator explosion at TNX in 1953. This evaporator contained approximately 590 kg of uranyl nitrate. From 1980 to 1984, much of the waste material buried at TNX was excavated and sent to the SRP Radioactive Waste Burial Grounds for reburial. An estimated 27 kg of uranyl nitrate remains buried at TNX. The TNX Burying Ground consists of three sites known to contain waste and one site suspected of containing waste material. All four sites are located within the TNX security fenceline. Groundwater at the TNX Burying Ground was not evaluated because there are no groundwater monitoring wells installed in the immediate vicinity of this waste site. The closure options considered for the TNX Burying Ground are waste removal and closure, no waste removal and closure, and no action. The predominant pathways for human exposure to chemical and/or radioactive constituents are through surface, subsurface, and atmospheric transport. Modeling calculations were made to determine the risks to human population via these general pathways for the three postulated closure options. An ecological assessment was conducted to predict the environmental impacts on aquatic and terrestrial biota. The relative costs for each of the closure options were estimated

  18. Grounding the Underground

    Science.gov (United States)

    2013-06-01

    By educating the workers party, Marxism educates the vanguard of the proletariat…”21 the idea being that by raising political consciousness, workers...Press, 1966), 41–42. 127 Frances Fox Piven and Richard A. Cloward, Poor People’s Movements: Why They Succeed, How They Fail (New York: Vintage...dogma, stressing those aspects that are well regarded by the people; don’t hesitate to interpret Marxism -Leninism in any way that proves beneficial. Soft

  19. Functional data analysis on ground reaction force of military load carriage increment

    Science.gov (United States)

    Din, Wan Rozita Wan; Rambely, Azmin Sham

    2014-06-01

    Analysis of ground reaction force on military load carriage is done through functional data analysis (FDA) statistical technique. The main objective of the research is to investigate the effect of 10% load increment and to find the maximum suitable load for the Malaysian military. Ten military soldiers age 31 ± 6.2 years, weigh 71.6 ± 10.4 kg and height of 166.3 ± 5.9 cm carrying different military load range from 0% body weight (BW) up to 40% BW participated in an experiment to gather the GRF and kinematic data using Vicon Motion Analysis System, Kirstler force plates and thirty nine body markers. The analysis is conducted in sagittal, medial lateral and anterior posterior planes. The results show that 10% BW load increment has an effect when heel strike and toe-off for all the three planes analyzed with P-value less than 0.001 at 0.05 significant levels. FDA proves to be one of the best statistical techniques in analyzing the functional data. It has the ability to handle filtering, smoothing and curve aligning according to curve features and points of interest.

  20. Ground-Water Hydrology and Projected Effects of Ground-Water Withdrawals in the Sevier Desert, Utah

    OpenAIRE

    United States Geological Survey

    1983-01-01

    The principal ground-water reservoir in the Sevier Desert is the unconsolidated basin fill. The fill has been divided generally into aquifers and confining beds, although there are no clearcut boundaries between these units--the primary aquifers are the shallow and deep artesian aquifers. Recharge to the ground-water reservoir is by infiltration of precipitation; seepage from streams, canals, reservoirs, and unconsumed irrigation water; and subsurface inflow from consolidated rocks in mount...