Demonstration of MPV Sensor at Yuma Proving Ground, AZ
2011-06-01
data quality is similar – the receiver coils essentially behave like point receivers. Balsa wood was used instead of solid plastic; - Wood and...directly related to the acreage to be surveyed as well as the difficulty of the terrain (steep, rocky, very uneven, and wooded terrain will take...maneuverable and sturdier sensor head. Figure 27: Original MPV sensor head design (head weight: 23 lbs). The original design was built out of wood
Renewable Energy Opportunties at Dugway Proving Ground, Utah
Energy Technology Data Exchange (ETDEWEB)
Orrell, Alice C.; Kora, Angela R.; Russo, Bryan J.; Horner, Jacob A.; Williamson, Jennifer L.; Weimar, Mark R.; Gorrissen, Willy J.; Nesse, Ronald J.; Dixon, Douglas R.
2010-05-31
This document provides an overview of renewable resource potential at Dugway Proving Ground, based primarily upon analysis of secondary data sources supplemented with limited on-site evaluations. This effort focuses on grid-connected generation of electricity from renewable energy sources and ground source heat pumps (GSHPs). The effort was funded by the U.S. Army Installation Management Command (IMCOM) as follow-on to the 2005 Department of Defense (DoD) Renewables Assessment.
Unexploded ordnance issues at Aberdeen Proving Ground: Background information
Energy Technology Data Exchange (ETDEWEB)
Rosenblatt, D.H.
1996-11-01
This document summarizes currently available information about the presence and significance of unexploded ordnance (UXO) in the two main areas of Aberdeen Proving Ground: Aberdeen Area and Edgewood Area. Known UXO in the land ranges of the Aberdeen Area consists entirely of conventional munitions. The Edgewood Area contains, in addition to conventional munitions, a significant quantity of chemical-munition UXO, which is reflected in the presence of chemical agent decomposition products in Edgewood Area ground-water samples. It may be concluded from current information that the UXO at Aberdeen Proving Ground has not adversely affected the environment through release of toxic substances to the public domain, especially not by water pathways, and is not likely to do so in the near future. Nevertheless, modest but periodic monitoring of groundwater and nearby surface waters would be a prudent policy.
Preparing for Mars: The Evolvable Mars Campaign 'Proving Ground' Approach
Bobskill, Marianne R.; Lupisella, Mark L.; Mueller, Rob P.; Sibille, Laurent; Vangen, Scott; Williams-Byrd, Julie
2015-01-01
As the National Aeronautics and Space Administration (NASA) prepares to extend human presence beyond Low Earth Orbit, we are in the early stages of planning missions within the framework of an Evolvable Mars Campaign. Initial missions would be conducted in near-Earth cis-lunar space and would eventually culminate in extended duration crewed missions on the surface of Mars. To enable such exploration missions, critical technologies and capabilities must be identified, developed, and tested. NASA has followed a principled approach to identify critical capabilities and a "Proving Ground" approach is emerging to address testing needs. The Proving Ground is a period subsequent to current International Space Station activities wherein exploration-enabling capabilities and technologies are developed and the foundation is laid for sustained human presence in space. The Proving Ground domain essentially includes missions beyond Low Earth Orbit that will provide increasing mission capability while reducing technical risks. Proving Ground missions also provide valuable experience with deep space operations and support the transition from "Earth-dependence" to "Earth-independence" required for sustainable space exploration. A Technology Development Assessment Team identified a suite of critical technologies needed to support the cadence of exploration missions. Discussions among mission planners, vehicle developers, subject-matter-experts, and technologists were used to identify a minimum but sufficient set of required technologies and capabilities. Within System Maturation Teams, known challenges were identified and expressed as specific performance gaps in critical capabilities, which were then refined and activities required to close these critical gaps were identified. Analysis was performed to identify test and demonstration opportunities for critical technical capabilities across the Proving Ground spectrum of missions. This suite of critical capabilities is expected to
Energy Technology Data Exchange (ETDEWEB)
Kennedy, P.L.; Clements, W.H.; Myers, O.B.; Bestgen, H.T.; Jenkins, D.G. [Colorado State Univ., Fort Collins, CO (United States). Dept. of Fishery and Wildlife Biology
1995-01-01
This report represents an evaluation of depleted uranium (DU) introduced into the environment at the Aberdeen Proving Grounds (APG), Maryland and Yuma Proving Grounds (YPG) Arizona. This was a cooperative project between the Environmental Sciences and Statistical Analyses Groups at LANL and with the Department of Fishery and Wildlife Biology at Colorado State University. The project represents a unique approach to assessing the environmental impact of DU in two dissimilar ecosystems. Ecological exposure models were created for each ecosystem and sensitivity/uncertainty analyses were conducted to identify exposure pathways which were most influential in the fate and transport of DU in the environment. Research included field sampling, field exposure experiment, and laboratory experiments. The first section addresses DU at the APG site. Chapter topics include bioenergetics-based food web model; field exposure experiments; bioconcentration by phytoplankton and the toxicity of U to zooplankton; physical processes governing the desorption of uranium from sediment to water; transfer of uranium from sediment to benthic invertebrates; spead of adsorpion by benthic invertebrates; uptake of uranium by fish. The final section of the report addresses DU at the YPG site. Chapters include the following information: Du transport processes and pathway model; field studies of performance of exposure model; uptake and elimination rates for kangaroo rates; chemical toxicity in kangaroo rat kidneys.
Environmental geophysics, offshore Bush River Peninsula, Aberdeen Proving Ground, Maryland
Energy Technology Data Exchange (ETDEWEB)
Miller, S.F.; Kuecher, G.J.; Davies, B.E. [and others
1995-11-01
Geophysical studies in shallow waters adjacent to the Bush River Peninsula, Edgewood Area of Aberdeen Proving Ground, Maryland, have delineated the extent of waste disposal sites and established a hydrogeologic framework, which may control contaminant transport offshore. These studies indicate that during the Pleistocene Epoch, alternating stands of high and low sea levels resulted in a complex pattern of shallow channel-fill deposits around the Bush River Peninsula. Ground-penetrating radar studies reveal paleochannels greater than 50 ft deep. Some of the paleochannels are also imaged with marine seismic reflection. Conductivity highs measured with the EM-31 are also indicative of paleochannels. This paleochannel depositional system is environmentally significant because it may control the shallow groundwater flow regime beneath the peninsula. Magnetic, conductivity, and side-scan sonar anomalies outline anthropogenic anomalies in the study area. On the basis of geophysical data, underwater anthropogenic materials do exist in some isolated areas, but large-scale offshore dumping has not occurred in the area studied.
NASA SPoRT GOES-R Proving Ground Activities
Stano, Geoffrey T.; Fuell, Kevin K.; Jedloec, Gary J.
2010-01-01
The NASA Short-term Prediction Research and Transition (SPoRT) program is a partner with the GOES-R Proving Ground (PG) helping prepare forecasters understand the unique products to come from the GOES-R instrument suite. SPoRT is working collaboratively with other members of the GOES-R PG team and Algorithm Working Group (AWG) scientists to develop and disseminate a suite of proxy products that address specific forecast problems for the WFOs, Regional and National Support Centers, and other NOAA users. These products draw on SPoRT s expertise with the transition and evaluation of products into operations from the MODIS instrument and the North Alabama Lightning Mapping Array (NALMA). The MODIS instrument serves as an excellent proxy for the Advanced Baseline Imager (ABI) that will be aboard GOES-R. SPoRT has transitioned and evaluated several multi-channel MODIS products. The true and false color products are being used in natural hazard detection by several SPoRT partners to provide better observation of land features, such as fires, smoke plumes, and snow cover. Additionally, many of SPoRT s partners are coastal offices and already benefit from the MODIS sea surface temperature composite. This, along with other surface feature observations will be developed into ABI proxy products for diagnostic use in the forecast process as well as assimilation into forecast models. In addition to the MODIS instrument, the NALMA has proven very valuable to WFOs with access to these total lightning data. These data provide situational awareness and enhanced warning decision making to improve lead times for severe thunderstorm and tornado warnings. One effort by SPoRT scientists includes a lightning threat product to create short-term model forecasts of lightning activity. Additionally, SPoRT is working with the AWG to create GLM proxy data from several of the ground based total lightning networks, such as the NALMA. The evaluation will focus on the vastly improved spatial
The GOES-R Proving Ground: 2012 Update
Gurka, J.; Goodman, S. J.; Schmit, T.; Demaria, M.; Mostek, A.; Siewert, C.; Reed, B.
2011-12-01
The Geostationary Operational Environmental Satellite (GOES)-R will provide a great leap forward in observing capabilities, but will also offer a significant challenge to ensure that users are ready to exploit the vast improvements in spatial, spectral, and temporal resolutions. To ensure user readiness, forecasters and other users must have access to prototype advanced products well before launch, and have the opportunity to provide feedback to product developers and computing and communications managers. The operational assessment is critical to ensure that the end products and NOAA's computing and communications systems truly meet their needs in a rapidly evolving environment. The GOES-R Proving Ground (PG) engages the National Weather Service (NWS) forecast, watch and warning community and other agency users in pre-operational demonstrations of select products with GOES-R attributes (enhanced spectral, spatial, and temporal resolution). In the PG, developers and forecasters test and apply algorithms for new GOES-R satellite data and products using proxy and simulated data sets, including observations from current and future satellite instruments (MODIS, AIRS, IASI, SEVIRI, NAST-I, NPP/VIIRS/CrIS, LIS), lightning networks, and computer simulated products. The complete list of products to be evaluated in 2012 will be determined after evaluating results from experiments in 2011 at the NWS' Storm Prediction Center, National Hurricane Center, Aviation Weather Center, Ocean Prediction Center, Hydrometeorological Prediction Center, and from the six NWS regions. In 2012 and beyond, the PG will test and validate data processing and distribution systems and the applications of these products in operational settings. Additionally developers and forecasters will test and apply display techniques and decision aid tools in operational environments. The PG is both a recipient and a source of training. Training materials are developed using various distance training tools in
Pacific Proving Grounds radioisotope imprint in the Philippine Sea sediments.
Pittauer, Daniela; Roos, Per; Qiao, Jixin; Geibert, Walter; Elvert, Marcus; Fischer, Helmut W
2018-06-01
Radionuclide concentrations were studied in sediment cores taken at the continental slope of the Philippine Sea off Mindanao Island in the equatorial Western Pacific. High resolution deposition records of anthropogenic radionuclides were collected at this site. Excess 210 Pb together with excess 228 Th and anthropogenic radionuclides provided information about accumulation rates. Concentrations of Am and Pu isotopes were detected by gamma spectrometry, alpha spectrometry and ICP-MS. The Pu ratios indicate a high portion (minimum of 60%) of Pu from the Pacific Proving Grounds (PPG). This implies that the transport of PPG derived plutonium with the Mindanao Current southward is similarly effective as the previously known transport towards the north with the Kuroshio Current. The record is compared to other studies from northwest Pacific marginal seas and Lombok basin in the Indonesian Archipelago. The sediment core top was found to contain a 6 cm thick layer dominated by terrestrial organic matter, which was interpreted as a result of the 2012 Typhoon Pablo-related fast deposition. Copyright © 2017 Elsevier Ltd. All rights reserved.
Depleted uranium human health risk assessment, Jefferson Proving Ground, Indiana
Energy Technology Data Exchange (ETDEWEB)
Ebinger, M.H.; Hansen, W.R.
1994-04-29
The risk to human health from fragments of depleted uranium (DU) at Jefferson Proving Ground (JPG) was estimated using two types of ecosystem pathway models. A steady-state, model of the JPG area was developed to examine the effects of DU in soils, water, and vegetation on deer that were hunted and consumed by humans. The RESRAD code was also used to estimate the effects of farming the impact area and consuming the products derived from the farm. The steady-state model showed that minimal doses to humans are expected from consumption of deer that inhabit the impact area. Median values for doses to humans range from about 1 mrem ({plus_minus}2.4) to 0.04 mrem ({plus_minus}0.13) and translate to less than 1 {times} 10{sup {minus}6} detriments (excess cancers) in the population. Monte Carlo simulation of the steady-state model was used to derive the probability distributions from which the median values were drawn. Sensitivity analyses of the steady-state model showed that the amount of DU in airborne dust and, therefore, the amount of DU on the vegetation surface, controlled the amount of DU ingested by deer and by humans. Human doses from the RESRAD estimates ranged from less than 1 mrem/y to about 6.5 mrem/y in a hunting scenario and subsistence fanning scenario, respectively. The human doses exceeded the 100 mrem/y dose limit when drinking water for the farming scenario was obtained from the on-site aquifer that was presumably contaminated with DU. The two farming scenarios were unrealistic land uses because the additional risk to humans due to unexploded ordnance in the impact area was not figured into the risk estimate. The doses estimated with RESRAD translated to less than 1 {times} 10{sup {minus}6} detriments to about 1 {times} 10{sup {minus}3} detriments. The higher risks were associated only with the farming scenario in which drinking water was obtained on-site.
2013-10-01
...; Aberdeen Proving Ground, MD AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of proposed..., within the existing restricted areas R-4001A and R- 4001B, at the U.S. Army's Aberdeen Proving Ground in... nonparticipating aircraft from a hazard to navigation in the Aberdeen Proving Ground airspace. DATES: Comments must...
NASA'S Space Launch System: Progress Toward the Proving Ground
Jackman, Angie; Johnson, Les
2017-01-01
With significant and substantial progress being accomplished toward readying the Space Launch System (SLS) rocket for its first test flight, work is already also underway on preparations for the second flight – using an upgraded version of the vehicle – and beyond. Designed to support human missions into deep space, Space Launch System (SLS), is the most powerful human-rated launch vehicle the United States has ever undertaken, and together with the Orion spacecraft will support human exploration missions into the proving ground of cislunar space and ultimately to Mars. For its first flight, SLS will deliver a near-term heavy-lift capability for the nation with its 70-metric-ton Block 1 configuration. Each element of the vehicle now has flight hardware in production in support of the initial flight of the SLS, which will propel Orion around the moon and back. For its second flight, SLS will be upgraded to the more-capable Block 1B configuration. While the Block 1 configuration is capable of delivering more than 70 metric tons to low Earth orbit, the Block 1B vehicle will increase that capability to 105 metric tons. For that flight, the new configuration introduces two major new elements to the vehicle – an Exploration Upper Stage (EUS) that will be used for both ascent and in-space propulsion, and a Universal Stage Adapter (USA) that serves as a “payload bay” for the rocket, allowing the launch of large exploration systems along with the Orion spacecraft. Already, flight hardware is being prepared for the Block 1B vehicle. Beyond the second flight, additional upgrades will be made to the vehicle. The Block 1B vehicle will also be able to launch 8.4-meter-diameter payload fairings, larger than any previously flown, and the Spacecraft Payload Integration and Evolution (SPIE) Element will oversee development and production of those fairings. Ultimately, SLS will be evolved to a Block 2 configuration, which will replace the solid rocket boosters on the Block
AMR Magnetometer Data on Moving Military Vehicles at Aberdeen Proving Ground
2007-09-01
BLDG 407 PICATINNY ARSENAL NJ 07806-5000 US ARMY ARDEC ATTN AMSRD-AAR- AEP -S R T KINASEWITZ BLDG 353N PICATINNY ARSENAL NJ 07806-5000 21 US...ARMY INFO SYS ENGRG CMND ATTN AMSEL-IE- TD F JENIA FT HUACHUCA AZ 85613-5300 US ARMY NATL GROUND INTLLGNC CTR ATTN IANG-CE-MA D C LOYD
33 CFR 334.140 - Chesapeake Bay; U.S. Army Proving Ground Reservation, Aberdeen, Md.
2010-07-01
... Island to Locust Point; thence along straight line from Locust Point to Turkey Point for a distance of... right to land nor to cut or procure pound net poles or stakes on the Aberdeen Proving Ground Reservation...
Energy Technology Data Exchange (ETDEWEB)
Hlohowskyj, I.; Hayse, J.; Kuperman, R.; Van Lonkhuyzen, R.
2000-02-25
The Environmental Management Division of the U.S. Army Aberdeen Proving Ground (APG), Maryland, is conducting a remedial investigation (RI) and feasibility study (FS) of the J-Field area at APG, pursuant to the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA), as amended. As part of that activity, Argonne National Laboratory (ANL) conducted an ecological risk assessment (ERA) of the J-Field site. This report presents the results of that assessment.
Concept of Operations for a Prospective "Proving Ground" in the Lunar Vicinity
Love, Stanley G.; Hill, James J.
2016-01-01
NASA is studying a "Proving Ground" near the Moon to conduct human space exploration missions in preparation for future flights to Mars. This paper describes a concept of operations ("conops") for activities in the Proving Ground, focusing on the construction and use of a mobile Cislunar Transit Habitat capable of months-long excursions within and beyond the Earth-Moon system. Key elements in the conops include the Orion spacecraft (with mission kits for docking and other specialized operations) and the Space Launch System heavy-lift rocket. Potential additions include commercial launch vehicles and logistics carriers, solar electric propulsion stages to move elements between different orbits and eventually take them on excursions to deep space, a node module with multiple docking ports, habitation and life support blocks, and international robotic and piloted lunar landers. The landers might include reusable ascent modules which could remain docked to in-space elements between lunar sorties. The architecture will include infrastructure for launch preparation, communication, mission control, and range safety. The conops describes "case studies" of notional missions chosen to guide the design of the architecture and its elements. One such mission is the delivery of a 10-ton pressurized element, co-manifested with an Orion on a Block 1B Space Launch System rocket, to the Proving Ground. With a large solar electric propulsion stage, the architecture could enable a year-long mission to land humans on a near-Earth asteroid. In the last case, after returning to near-lunar space, two of the asteroid explorers could join two crewmembers freshly arrived from Earth for a Moon landing, helping to safely quantify the risk of landing deconditioned crews on Mars. The conops also discusses aborts and contingency operations. Early return to Earth may be difficult, especially during later Proving Ground missions. While adding risk, limited-abort conditions provide needed practice
SPoRT's Participation in the GOES-R Proving Ground Activity
Jedlovec, Gary; Fuell, Kevin; Smith, Matthew; Stano, Geoffrey; Molthan, Andrew
2011-01-01
The next generation geostationary satellite, GOES-R, will carry two new instruments with unique atmospheric and surface observing capabilities, the Advanced Baseline Imager (ABI) and the Geostationary Lightning Mapper (GLM), to study short-term weather processes. The ABI will bring enhanced multispectral observing capabilities with frequent refresh rates for regional and full disk coverage to geostationary orbit to address many existing and new forecast challenges. The GLM will, for the first time, provide the continuous monitoring of total lightning flashes over a hemispherical region from space. NOAA established the GOES-R Proving Ground activity several years ago to demonstrate the new capabilities of these instruments and to prepare forecasters for their day one use. Proving Ground partners work closely with algorithm developers and the end user community to develop and transition proxy data sets representing GOES-R observing capabilities. This close collaboration helps to maximize refine algorithms leading to the delivery of a product that effectively address a forecast challenge. The NASA Short-term Prediction Research and Transition (SPoRT) program has been a participant in the NOAA GOES-R Proving Ground activity by developing and disseminating selected GOES-R proxy products to collaborating WFOs and National Centers. Established in 2002 to demonstrate the weather and forecasting application of real-time EOS measurements, the SPoRT program has grown to be an end-to-end research to operations activity focused on the use of advanced NASA modeling and data assimilation approaches, nowcasting techniques, and unique high-resolution multispectral data from EOS satellites to improve short-term weather forecasts on a regional and local scale. Participation in the Proving Ground activities extends SPoRT s activities and taps its experience and expertise in diagnostic weather analysis, short-term weather forecasting, and the transition of research and experimental
SPoRT's Participation in the GOES-R Proving Ground Activity
Jedlovec, G.; Fuell, K.; Smith, M. R.; Stano, G. T.; Molthan, A.
2011-12-01
The next generation geostationary satellite, GOES-R, will carry two new instruments with unique atmospheric and surface observing capabilities, the Advanced Baseline Imager (ABI) and the Geostationary Lightning Mapper (GLM), to study short-term weather processes. The ABI will bring enhanced multispectral observing capabilities with frequent refresh rates for regional and full disk coverage to geostationary orbit to address many existing and new forecast challenges. The GLM will, for the first time, provide the continuous monitoring of total lightning flashes over a hemispherical region from space. NOAA established the GOES-R Proving Ground activity several years ago to demonstrate the new capabilities of these instruments and to prepare forecasters for their day one use. Proving Ground partners work closely with algorithm developers and the end user community to develop and transition proxy data sets representing GOES-R observing capabilities. This close collaboration helps to maximize refine algorithms leading to the delivery of a product that effectively address a forecast challenge. The NASA Short-term Prediction Research and Transition (SPoRT) program has been a participant in the NOAA GOES-R Proving Ground activity by developing and disseminating selected GOES-R proxy products to collaborating WFOs and National Centers. Established in 2002 to demonstrate the weather and forecasting application of real-time EOS measurements, the SPoRT program has grown to be an end-to-end research to operations activity focused on the use of advanced NASA modeling and data assimilation approaches, nowcasting techniques, and unique high-resolution multispectral data from EOS satellites to improve short-term weather forecasts on a regional and local scale. Participation in the Proving Ground activities extends SPoRT's activities and taps its experience and expertise in diagnostic weather analysis, short-term weather forecasting, and the transition of research and experimental
Satellite Proving Ground for the GOES-R Geostationary Lightning Mapper (GLM)
Goodman, Steven J.; Gurka, James; Bruning, E. C.; Blakeslee, J. R.; Rabin, Robert; Buechler, D.
2009-01-01
The key mission of the Satellite Proving Ground is to demonstrate new satellite observing data, products and capabilities in the operational environment to be ready on Day 1 to use the GOES-R suite of measurements. Algorithms, tools, and techniques must be tested, validated, and assessed by end users for their utility before they are finalized and incorporated into forecast operations. The GOES-R Proving Ground for the Geostationary Lightning Mapper (GLM) focuses on evaluating how the infusion of the new technology, algorithms, decision aids, or tailored products integrate with other available tools (weather radar and ground strike networks; nowcasting systems, mesoscale analysis, and numerical weather prediction models) in the hands of the forecaster responsible for issuing forecasts and warning products. Additionally, the testing concept fosters operation and development staff interactions which will improve training materials and support documentation development. Real-time proxy total lightning data from regional VHF lightning mapping arrays (LMA) in Northern Alabama, Central Oklahoma, Cape Canaveral Florida, and the Washington, DC Greater Metropolitan Area are the cornerstone for the GLM Proving Ground. The proxy data will simulate the 8 km Event, Group and Flash data that will be generated by GLM. Tailored products such as total flash density at 1-2 minute intervals will be provided for display in AWIPS-2 to select NWS forecast offices and national centers such as the Storm Prediction Center. Additional temporal / spatial combinations are being investigated in coordination with operational needs and case-study proxy data and prototype visualizations may also be generated from the NASA heritage Lightning Imaging Sensor and Optical Transient Detector data. End users will provide feedback on the utility of products in their operational environment, identify use cases and spatial/temporal scales of interest, and provide feedback to the developers for adjusted or
Hughes, W.B.
1995-01-01
J-Field, located in the Edgewood Area of Aberdeen Proving Ground, Md, has been used since World War II to test and dispose of explosives, chemical warfare agents, and industrial chemicals resulting in ground-water, surface-water, and soil contami- nation. The U.S. Geological Survey finite-difference model was used to better understand ground-water flow at the site and to simulate the effects of remedial actions. A surficial aquifer and a confined aquifer were simulated with the model. A confining unit separates these units and is represented by leakance between the layers. The area modeled is 3.65 mi2; the model was constructed with a variably spaced 40 X 38 grid. The horizontal and lower boundaries of the model are all no-flow boundaries. Steady-state conditions were used. Ground water at the areas under investigation flows from disposal pit areas toward discharge areas in adjacent estuaries or wetlands. Simulations indicate that capping disposal areas with an impermeable cover effectively slows advective ground water flow by 0.7 to 0.5 times. Barriers to lateral ground-water flow were simulated and effectively prevented the movement of ground water toward discharge areas. Extraction wells were simulated as a way to contain ground-water contamination and to extract ground water for treatment. Two wells pumping 5 gallons per minute each at the toxic-materials disposal area and a single well pumping 2.5 gallons per minute at the riot-control-agent disposal area effectively contained contamination at these sites. A combi- nation of barriers to horizontal flow east and south of the toxic-materials disposal area, and a single extraction well pumping at 5 gallons per minute can extract contaminated ground water and prevent pumpage of marsh water.
Research Objectives for Human Missions in the Proving Ground of Cis-Lunar Space
Spann, James; Niles, Paul; Eppler, Dean; Kennedy, Kriss; Lewis, Ruthan; Sullivan, Thomas
2016-07-01
Introduction: This talk will introduce the preliminary findings in support of NASA's Future Capabilities Team. In support of the ongoing studies conducted by NASA's Future Capabilities Team, we are tasked with collecting re-search objectives for the Proving Ground activities. The objectives could include but are certainly not limited to: demonstrating crew well being and performance over long duration missions, characterizing lunar volatiles, Earth monitoring, near Earth object search and identification, support of a far-side radio telescope, and measuring impact of deep space environment on biological systems. Beginning in as early as 2023, crewed missions beyond low Earth orbit will be enabled by the new capabilities of the SLS and Orion vehicles. This will initiate the "Proving Ground" phase of human exploration with Mars as an ultimate destination. The primary goal of the Proving Ground is to demonstrate the capability of suitably long dura-tion spaceflight without need of continuous support from Earth, i.e. become Earth Independent. A major component of the Proving Ground phase is to conduct research activities aimed at accomplishing major objectives selected from a wide variety of disciplines including but not limited to: Astronomy, Heliophysics, Fun-damental Physics, Planetary Science, Earth Science, Human Systems, Fundamental Space Biology, Microgravity, and In Situ Resource Utilization. Mapping and prioritizing the most important objectives from these disciplines will provide a strong foundation for establishing the architecture to be utilized in the Proving Ground. Possible Architectures: Activities and objectives will be accomplished during the Proving Ground phase using a deep space habitat. This habitat will potentially be accompanied by a power/propulsion bus capable of moving the habitat to accomplish different objectives within cis-lunar space. This architecture can also potentially support stag-ing of robotic and tele-robotic assets as well as
Oliveros, J.P.; Gernhardt, Patrice
1989-01-01
This report is a compilation of hydrologic and geologic data collected for the period April 1986 through March 1988 for the Canal Creek area of Aberdeen Proving Ground, Maryland. Geologic data include lithologic logs for 73 sites and geophysical logs for 71 sites. Hydrologic data consist of hydrographs and synoptic water level measurements. The hydrographs were taken from eight wells that were equipped with continuous water level recorders, and the synoptic water-level measurements were made four times during the study. Well-construction data also are included for 149 observation wells. (USGS)
Initial building investigations at Aberdeen Proving Ground, Maryland: Objectives and methodology
Energy Technology Data Exchange (ETDEWEB)
Brubaker, K.L.; Dougherty, J.M.; McGinnis, L.D.
1994-12-01
As part of an environmental-contamination source-definition program at Aberdeen Proving Ground, detailed internal and external inspections of 23 potentially contaminated buildings are being conducted to describe and characterize the state of each building as it currently exists and to identify areas potentially contaminated with toxic or other hazardous substances. In addition, a detailed geophysical investigation is being conducted in the vicinity of each target building to locate and identify subsurface structures, associated with former building operations, that are potential sources of contamination. This report describes the objectives of the initial building inspections, including the geophysical investigations, and discusses the methodology that has been developed to achieve these objectives.
Banks, W.S.; Smith, B.S.; Donnelly, C.A.
1996-01-01
The U.S. Army disposed chemical agents, laboratory materials, and unexploded ordnance at O-Field in the Edgewood area of Aberdeen Proving Ground, Maryland, from before World War II until at least the 1950's. Soil, ground water, surface water,and wetland sediments in the O-Field area were contaminated from the disposal activity. A ground-water-flow model of the O-Field area was constructed by the U.S. Geological Survey (USGS) in 1989 to simulate flow in the central and southern part of the Gunpowder Neck. The USGS began an additional study of the contamination in the O-Field area in cooperation with the U.S. Army in 1990 to (1) further define the hydrogeologic framework of the O-Field area, (2) characterize the hydraulic properties of the aquifers and confining units, and (3) define ground-water flow paths at O-Field based on the current data and simulations of ground-water flow. A water-table aquifer, an upper confining unit, and an upper confined aquifer comprise the shallow ground-water aquifer system of the O-Field area. A lower confining unit, through which ground-water movement is negligible, is considered a lower boundary to the shallow aquifer system. These units are all part of the Pleistocene Talbot Formation. The model developed in the previous study was redesigned using the data collected during this study and emphasized New O-Field. The current steady-state model was calibrated to water levels of June 1993. The rate of ground-water flow calculated by the model was approximately 0.48 feet per day (ft/d) and the rate determined from chlorofluorocarbon dates was approximately 0.39 ft/d.
Ecological survey of M-Field, Edgewood Area Aberdeen Proving Ground, Maryland
Energy Technology Data Exchange (ETDEWEB)
Downs, J.L.; Eberhardt, L.E.; Fitzner, R.E.; Rogers, L.E.
1991-12-01
An ecological survey was conducted on M-Field, at the Edgewood Area, Aberdeen Proving Ground, Maryland. M-Field is used routinely to test army smokes and obscurants, including brass flakes, carbon fibers, and fog oils. The field has been used for testing purposes for the past 40 years, but little documented history is available. Under current environmental regulations, the test field must be assessed periodically to document the presence or potential use of the area by threatened and endangered species. The M-Field area is approximately 370 acres and is part of the US Army`s Edgewood Area at Aberdeen Proving Ground in Harford County, Maryland. The grass-covered field is primarily lowlands with elevations from about 1.0 to 8 m above sea level, and several buildings and structures are present on the field. The ecological assessment of M-Field was conducted in three stages, beginning with a preliminary site visit in May to assess sampling requirements. Two field site visits were made June 3--7, and August 12--15, 1991, to identify the biota existing on the site. Data were gathered on vegetation, small mammals, invertebrates, birds, large mammals, amphibians, and reptiles.
Ecological survey of M-Field, Edgewood Area Aberdeen Proving Ground, Maryland
Energy Technology Data Exchange (ETDEWEB)
Downs, J.L.; Eberhardt, L.E.; Fitzner, R.E.; Rogers, L.E.
1991-12-01
An ecological survey was conducted on M-Field, at the Edgewood Area, Aberdeen Proving Ground, Maryland. M-Field is used routinely to test army smokes and obscurants, including brass flakes, carbon fibers, and fog oils. The field has been used for testing purposes for the past 40 years, but little documented history is available. Under current environmental regulations, the test field must be assessed periodically to document the presence or potential use of the area by threatened and endangered species. The M-Field area is approximately 370 acres and is part of the US Army's Edgewood Area at Aberdeen Proving Ground in Harford County, Maryland. The grass-covered field is primarily lowlands with elevations from about 1.0 to 8 m above sea level, and several buildings and structures are present on the field. The ecological assessment of M-Field was conducted in three stages, beginning with a preliminary site visit in May to assess sampling requirements. Two field site visits were made June 3--7, and August 12--15, 1991, to identify the biota existing on the site. Data were gathered on vegetation, small mammals, invertebrates, birds, large mammals, amphibians, and reptiles.
Stromdahl, E Y; Randolph, M P; O'Brien, J J; Gutierrez, A G
2000-05-01
Human monocytic ehrlichiosis (HME) is a sometimes fatal, emerging tick-borne disease caused by the bacterium Ehrlichia chaffeensis. It is frequently misdiagnosed because its symptoms mimic those of the flu. Current evidence indicates that Amblyomma americanum (L.), the lone star tick, is the major vector of HME. To determine if E. chaffeensis is present in ticks at Aberdeen Proving Ground, MD, questing A. americanum ticks were collected from 33 sites. Nucleic acid was extracted from 34 adult and 81 nymphal pools. Sequences diagnostic for E. chaffeensis from three different loci (16S rRNA, 120-kDa protein, and a variable-length polymerase chain reaction [PCR] target, or VLPT) were targeted for amplification by the PCR. Fifty-two percent of the collection sites yielded pools infected with E. chaffeensis, confirming the presence and widespread distribution of E. chaffeensis at Aberdeen Proving Ground. Analysis with the both the 120-kDa protein primers and the VLPT primers showed that genetic variance exists. A novel combination of variance for the two loci was detected in two tick pools. The pathogenic implications of genetic variation in E. chaffeensis are as yet unknown.
Tenbus, F.J.; Fleck, W.B.
1996-01-01
Ground water in the east-central part of Graces Quarters, a former open-air chemical-agent test facility at Aberdeen Proving Ground, Maryland, is contaminated with chlorinated volatile organic compounds. The U.S. Geological Survey's finite- difference model was used to help understand ground-water flow and simulate the effects of alternative remedial actions to clean up the ground water. Scenarios to simulate unstressed conditions and three extraction well con- figurations were used to compare alternative remedial actions on the contaminant plume. The scenarios indicate that contaminants could migrate from their present location to wetland areas within 10 years under unstressed conditions. Pumping 7 gal/min (gallons per minute) from one well upgradient of the plume will not result in containment or removal of the highest contaminant concentrations. Pumping 7 gal/min from three wells along the central axis of the plume should result in containment and removal of dissolved contami- nants, as should pumping 7 gal/min from three wells at the leading edge of the plume while injecting 7 gal/min back into an upgradient well.
Lorah, Michelle M.; Olsen, Lisa D.; Smith, Barrett L.; Johnson, Mark A.; Fleck, William B.
1997-01-01
Ground-water contaminant plumes that are flowing toward or currently discharging to wetland areas present unique remediation problems because of the hydrologic connections between ground water and surface water and the sensitive habitats in wetlands. Because wetlands typically have a large diversity of microorganisms and redox conditions that could enhance biodegradation, they are ideal environments for natural attenuation of organic contaminants, which is a treatment method that would leave the ecosystem largely undisturbed and be cost effective. During 1992-97, the U.S. Geological Survey investigated the natural attenuation of chlorinated volatile organic compounds (VOC's) in a contaminant plume that discharges from a sand aquifer to a freshwater tidal wetland along the West Branch Canal Creek at Aberdeen Proving Ground, Maryland. Characterization of the hydrogeology and geochemistry along flowpaths in the wetland area and determination of the occurrence and rates of biodegradation and sorption show that natural attenuation could be a feasible remediation method for the contaminant plume that extends along the West Branch Canal Creek.
An Overview of NASA SPoRT GOES-R JPSS Proving Ground Testbed Activities
Berndt, Emily; Stano, Geoffrey; Fuell, Kevin; Leroy, Anita; Mcgrath, Kevin; Molthan, Andrew; Schultz, Lori; Smith, Matthew; White, Kris; Schultz, Christopher;
2017-01-01
The Short-term Prediction Research and Transition (SPoRT) Center is funded by NASA's Earth Science Division and NOAA's JPSS and GOES-R Proving Grounds to transition satellite products and capabilities to the NWS to improve short term (0-48 hr) forecasts on a regional and local scale. SPoRT currently collaborates with 30+ NWS WFOs (at least one in each NWS region) and 5 National Centers/Testbeds. SPoRT matches user-identified forecast challenges to specific products, providing access to these data in AWIPS through new plug-in development, and generating applications-based training to use the products for their needs (R20). Upon transition, SPoRT collaborates with the user to assess the product impact in a real-world environment for feedback to product developers (O2R) and to benefit their peers.
Sjoberg, B.
2015-12-01
This presentation will focus on the NOAA Joint Polar Satellite System (JPSS) Program's Proving Ground and Risk Reduction (PGRR) initiative and how it has prepared NOAA users to effectively utilize new polar-orbiting capabilities. The PGRR Program was established in 2012, following the launch of the Suomi National Polar Partnership (SNPP) satellite. Two sets of PGRR Projects have been established grouped together in thirteen different initiatives. Details about how these projects have been continually tailored through the years to meet user requirements, will be highlighted. The presenter will focus on how the success of the first set of PGRR projects have been used to evaluate a follow-on set of projects and focus on exactly what the JPSS user community needs to meet their mission requirements. Details on the Dec 2014 PGRR Call-for-Proposals and the projects selected for funding will be discussed.
Optimization of ground-water withdrawal at the old O-Field area, Aberdeen Proving Ground, Maryland
Banks, William S.L.; Dillow, Jonathan J.A.
2001-01-01
The U.S. Army disposed of chemical agents, laboratory materials, and unexploded ordnance at the Old O-Field landfill at Aberdeen Proving Ground, Maryland, beginning prior to World War II and continuing until at least the 1950?s. Soil, ground water, surface water, and wetland sediments in the Old O-Field area were contaminated by the disposal of these materials. The site is in the Atlantic Coastal Plain, and is characterized by a complex series of Pleistocene and Holocene sediments formed in various fluvial, estuarine, and marine-marginal hydrogeologic environments. A previously constructed transient finite-difference ground-water-flow model was used to simulate ground-water flow and the effects of a pump-and-treat remediation system designed to prevent contaminated ground water from flowing into Watson Creek (a tidal estuary and a tributary to the Gunpowder River). The remediation system consists of 14 extraction wells located between the Old O-Field landfill and Watson Creek.Linear programming techniques were applied to the results of the flow-model simulations to identify optimal pumping strategies for the remediation system. The optimal management objective is to minimize total withdrawal from the water-table aquifer, while adhering to the following constraints: (1) ground-water flow from the landfill should be prevented from reaching Watson Creek, (2) no extraction pump should be operated at a rate that exceeds its capacity, and (3) no extraction pump should be operated at a rate below its minimum capacity, the minimum rate at which an Old O-Field pump can function. Water withdrawal is minimized by varying the rate and frequency of pumping at each of the 14 extraction wells over time. This minimizes the costs of both pumping and water treatment, thus providing the least-cost remediation alternative while simultaneously meeting all operating constraints.The optimal strategy identified using this objective and constraint set involved operating 13 of the 14
Spencer, Tracey A.; Phelan, Daniel J.; Olsen, Lisa D.; Lorah, Michelle M.
2001-01-01
This report presents ground-water and surface-water quality data from samples collected by the U.S. Geological Survey from November 1999 through May 2001 at West Branch Canal Creek, Aberdeen Proving Ground, Maryland. The report also provides a description of the sampling and analytical methods that were used to collect and analyze the samples, and includes an evaluation of the quality-assurance data. The ground-water sampling network included two 4-inch wells, two 2-inch wells, sixteen 1-inch piezometers, one hundred thirteen 0.75-inch piezometers, two 0.25-inch flexible-tubing piezo-meters, twenty-seven 0.25-inch piezometers, and forty-two multi-level monitoring system depths at six sites. Ground-water profiler samples were collected from nine sites at 34 depths. In addition, passive-diffusion-bag samplers were deployed at four sites, and porous-membrane sampling devices were installed in the upper sediment at five sites. Surface-water samples were collected from 20 sites. Samples were collected from wells and 0.75-inch piezometers for measurement of field parameters and reduction-oxidation constituents, and analysis of inorganic and organic constituents, during three sampling events in March?April and June?August 2000, and May 2001. Surface-water samples were collected from November 1999 through September 2000 during five sampling events for analysis of organic constituents. Ground-water profiler samples were collected in April?May 2000, and analyzed for field measure-ments, reduction-oxidation constituents, and inorganic constituents and organic constituents. Passive-diffusion-bag samplers were installed in September 2000, and samples were analyzed for organic constituents. Multi-level monitoring system samples were collected and analyzed for field measurements and reduction-oxidation con-stituents, inorganic constituents, and organic con-stituents in March?April and June?August 2000. Field measurements and organic constituents were collected from 0.25-inch
Molthan, Andrew
2011-01-01
SPoRT is actively involved in GOES-R Proving Ground activities in a number of ways: (1) Applying the paradigm of product development, user training, and interaction to foster interaction with end users at NOAA forecast offices national centers. (2) Providing unique capabilities in collaboration with other GOES-R Proving Ground partners (a) Hybrid GOES-MODIS imagery (b) Pseudo-GLM via regional lightning mapping arrays (c) Developing new RGB imagery from EUMETSAT guidelines
Energy Technology Data Exchange (ETDEWEB)
Schneider, J.F.; O`Neill, H.J.; Raphaelian, L.A.; Tomczyk, N.A.; Sytsma, L.F.; Cohut, V.J.; Cobo, H.A.; O`Reilly, D.P.; Zimmerman, R.E.
1995-03-01
The US Army`s Aberdeen Proving Ground has been a test site for a variety of munitions, including chemical warfare agents (CWA). The Pilot Plant Complex (PPC) at Aberdeen was the site of development, manufacture, storage, and disposal of CWA. Deterioration of the buildings and violations of environmental laws led to closure of the complex in 1986. Since that time, all equipment, piping, and conduit in the buildings have been removed. The buildings have been declared free of surface CWA contamination as a result of air sampling using the military system. However, no air sampling has been done to determine if other hazardous volatile organic compounds are present in the PPC, although a wide range of toxic and/or hazardous materials other than CWA was used in the PPC. The assumption has been that the air in the PPC is not hazardous. The purpose of this air-monitoring study was to screen the indoor air in the PPC to confirm the assumption that the air does not contain volatile organic contaminants at levels that would endanger persons in the buildings. A secondary purpose was to identify any potential sources of volatile organic contaminants that need to be monitored in subsequent sampling efforts.
Energy Technology Data Exchange (ETDEWEB)
Robison, W.L.; Brunk, J.A.; Jokela, T.A.
2000-03-21
{sup 207}Bi (t{sub 1/2}=32.2 y) was generated by activation of weapons material during a few ''clean'' nuclear tests at the U.S. Western Pacific Proving Grounds of Enewetak and Bikini Atolls. The radionuclides first appeared in the Enewetak environment during 1958 and in the environment of Bikini during 1956. Crater sediments from Bikini with high levels of {sup 207}Bi were analyzed by gamma spectrometry in an attempt to determine the relative concentrations of {sup 208}Bi (t{sup 1/2} = 3.68 x 10{sup 5} y). The bismuth isotopes were probably generated during the ''clean'', 9.3 Mt Poplar test held on 7/12/58. The atom ratio of {sup 208}Bi to {sup 207}Bi (R value) ranges from {approx}12 to over 200 in sections of core sediments from the largest nuclear crater at Bikini atoll. The presence of bismuth in the device is suggested to account for R values in excess of 10.
Hydrogeologic and chemical data for the O-Field area, Aberdeen Proving Ground, Maryland
Nemoff, P.R.; Vroblesky, D.A.
1989-01-01
O-Field, located at the Edgewood area of Aberdeen Proving Ground , Maryland, was periodically used for disposal of munitions, waste chemicals, and chemical-warfare agents from World War II through the 1950' s. This report includes various physical, geologic, chemical, and hydrologic data obtained from well-core, groundwater, surface water, and bottom-sediment sampling sites at and near the O-Field disposal area. The data are presented in tables and hydrographs. Three site-location maps are also included. Well-core data include lithologic logs for 11 well- cluster sites, grain-size distributions, various chemical characteristics, and confining unit characteristics. Groundwater data include groundwater chemistry, method blanks for volatile organic carbon, available data on volatile and base/neutral organics, and compilation of corresponding method blanks, chemical-warfare agents, explosive-related products, radionuclides, herbicides, and groundwater levels. Surface-water data include field-measured characteristics; concentrations of various inorganic constituents including arsenic; selected organic constituents with method blanks; detection limits of organics; and a compilation of information on corresponding acids, volatiles, and semivolatiles. Bottom- sediment data include inorganic properties and constituents; organic chemistry; detection limits for organic chemicals; a compilation of information on acids, volatiles, and semivolatiles; and method blanks corresponding to acids, volatiles, and semivolatiles. A set of 15 water- level hydrographs for the period March 1986 through September 1987 also is included in the report. (USGS)
Hydrogeology and soil gas at J-Field, Aberdeen Proving Ground, Maryland
Hughes, W.B.
1993-01-01
Disposal of chemical warfare agents, munitions, and industrial chemicals in J-Field, Aberdeen Proving Ground, Maryland, has contaminated soil, groundwater and surface water. Seven exploratory borings and 38 observation wells were drilled to define the hydrogeologic framework at J-Field and to determine the type, extent, and movement of contaminants. The geologic units beneath J-Field consist of Coastal Plain sediments of the Cretaceous Patapsco Formation and Pleistocene Talbot Formation. The Patapsco Formation contains several laterally discontinuous aquifers and confining units. The Pleistocene deposits were divided into 3 hydrogeologic units--a surficial aquifer, a confining unit, and a confined aquifer. Water in the surficial aquifer flows laterally from topographically high areas to discharge areas in marshes and streams, and vertically to the underlying confined aquifer. In offshore areas, water flows from the deeper confined aquifers upward toward discharge areas in the Gunpowder River and Chesapeake Bay. Analyses of soil-gas samples showed high relative-flux values of chlorinated solvents, phthalates, and hydrocarbons at the toxic-materials disposal area, white-phosphorus disposal area, and riot-control-agent disposal area. The highest flux values were located downgradient of the toxic materials and white phosphorus disposal areas, indicating that groundwater contaminants are moving from source areas beneath the disposal pits toward discharge points in the marshes and estuaries. Elevated relative-flux values were measured upgradient and downgradient of the riot-control agent disposal area, and possibly result from soil and (or) groundwater contamination.
Contamination source review for Building E2370, Edgewood Area, Aberdeen Proving Ground, Maryland
Energy Technology Data Exchange (ETDEWEB)
O`Reilly, D.P.; Glennon, M.A.; Draugelis, A.K.; Rueda, J.; Zimmerman, R.E.
1995-09-01
The US Army Aberdeen Proving Ground (APG) commissioned Argonne National Laboratory (ANL) to conduct a contamination source review to identify and define areas of toxic or hazardous contaminants and to assess the physical condition and accessibility of APG buildings. The information obtained from this review may be used to assist the US Army in planning for the future use or disposition of the buildings. The contamination source review consisted of the following tasks: historical records search, physical inspection, photographic documentation, and geophysical investigation. This report provides the results of the contamination source review for Building E2370. Many of the APG facilities constructed between 1917 and the 1960s are no longer used because of obsolescence and their poor state of repair. Because many of these buildings were used for research, development, testing, and/or pilot-scale production of chemical warfare agents and other military substances, the potential exists for portions of the buildings to be contaminated with these substances, their degradation products, and other laboratory or industrial chemicals. These buildings and associated structures or appurtenances may contribute to environmental concerns at APG.
Contamination source review for Building E1489, Edgewood Area, Aberdeen Proving Ground, Maryland
Energy Technology Data Exchange (ETDEWEB)
Billmark, K.A.; Hayes, D.C.; Draugelis, A.K. [and others
1995-09-01
This report was prepared by Argonne National Laboratory (ANL) to document the results of a contamination source review of Building E1489 at the Aberdeen Proving Ground (APG) in Maryland. This report may be used to assist the U.S. Army-in planning for the future use or disposition of this building. The review included a historical records search, physical inspection, photographic documentation, and geophysical investigation. The field investigations were performed in 1994-1995. Building E1489 located in J-Field on the Gunpowder Peninsula in APG`s Edgewood Area housed a power generator that supplied electricity to a nearby observation tower. Building E1489 and the generator were abandoned in 1974, demolished by APG personnel and removed from real estate records. A physical inspection and photographic documentation of Building E1489 were completed by ANL staff during November 1994. In 1994, ANL staff conducted geophysical surveys in the immediate vicinity of Building E1489 by using several nonintrusive methods. Survey results suggest the presence of some underground objects near Building E1489, but they do not provide conclusive evidence of the source of geophysical anomalies observed during the survey. No air monitoring was conducted at the site, and no information on underground storage tanks associated with Building E1489 was available.
Contamination source review for Building E3180, Edgewood Area, Aberdeen Proving Ground, Maryland
Energy Technology Data Exchange (ETDEWEB)
Zellmer, S.D.; Smits, M.P.; Rueda, J.; Zimmerman, R.E.
1995-09-01
This report was prepared by Argonne National Laboratory (ANL) to document the results of a contamination source review of Building E3180 at the Aberdeen Proving Ground (APG) in Maryland. The report may be used to assist the US Army in planning for the future use or disposition of this building. The review included a historical records search, physical inspection, photographic documentation, geophysical investigation, collection of air samples, and review of available records regarding underground storage tanks associated with Building E3180. The field investigations were performed by ANL during 1994. Building,E3180 (current APG designation) is located near the eastern end of Kings Creek Road, north of Kings Creek, and about 0.5 miles east of the airstrip within APG`s Edgewood Area. The building was constructed in 1944 as a facsimile of a Japanese pillbox and used for the development of flame weapons systems until 1957 (EAI Corporation 1989). The building was not used from 1957 until 1965, when it was converted and used as a flame and incendiary laboratory. During the 1970s, the building was converted to a machine (metal) shop and used for that purpose until 1988.
Contamination source review for Building E6891, Edgewood Area, Aberdeen Proving Ground, Maryland
Energy Technology Data Exchange (ETDEWEB)
Zellmer, S.D.; Draugelis, A.K.; Rueda, J.; Zimmerman, R.E.
1995-09-01
The US Army Aberdeen Proving Ground (APG) commissioned Argonne National Laboratory (ANL) to conduct a contamination source review to identify and define areas of toxic or hazardous contaminants and to assess the physical condition and accessibility of various APG buildings. This report provides the results of the contamination source review for Building E6891. The information obtained from this review may be used to assist the US Army in planning for the future use or disposition of the buildings. The contamination source review consisted of the following tasks: historical records search, physical inspection, photographic documentation, geophysical investigation, and collection of air samples. This building is part of the Lauderick Creek Concrete Slab Test Site, located in the Lauderick Creek Area in the Edgewood Area. Many of the APG facilities constructed between 1917 and the 1960s are no longer used because of obsolescence and their poor state of repair. Because many of these buildings were used for research, development, testing, and/or pilot-scale production of chemical warfare agents and other military substances the potential exists` for portions of the buildings to be contaminated with these substances, their degradation products, and other laboratory or industrial chemicals. These buildings and associated structures or appurtenances may contribute to environmental concerns at APG.
Contamination source review for Building E3162, Edgewood Area, Aberdeen Proving Ground, Maryland
Energy Technology Data Exchange (ETDEWEB)
Miller, G.A.; Draugelis, A.K.; Rueda, J.; Zimmerman, R.E.
1995-09-01
This report was prepared by Argonne National Laboratory (ANL) to document the results of a contamination source review for Building E3162 at the Aberdeen Proving Ground (APG) in Maryland. The report may be used to assist the US Army in planning for the future use or disposition of this building. The review included a historical records search, physical inspection, photographic documentation, geophysical investigation, and collection of air samples. The field investigations were performed by ANL during 1994 and 1995. Building E3162 (APG designation) is part of the Medical Research Laboratories Building E3160 Complex. This research laboratory complex is located west of Kings Creek, east of the airfield and Ricketts Point Road, and south of Kings Creek Road in the Edgewood Area of APG. The original structures in the E3160 Complex were constructed during World War 2. The complex was originally used as a medical research laboratory. Much of the research involved wound assessment involving chemical warfare agents. Building E3162 was used as a holding and study area for animals involved in non-agent burns. The building was constructed in 1952, placed on inactive status in 1983, and remains unoccupied. Analytical results from these air samples revealed no distinguishable difference in hydrocarbon and chlorinated solvent levels between the two background samples and the sample taken inside Building E3162.
Review of analytical results from the proposed agent disposal facility site, Aberdeen Proving Ground
Energy Technology Data Exchange (ETDEWEB)
Brubaker, K.L.; Reed, L.L.; Myers, S.W.; Shepard, L.T.; Sydelko, T.G.
1997-09-01
Argonne National Laboratory reviewed the analytical results from 57 composite soil samples collected in the Bush River area of Aberdeen Proving Ground, Maryland. A suite of 16 analytical tests involving 11 different SW-846 methods was used to detect a wide range of organic and inorganic contaminants. One method (BTEX) was considered redundant, and two {open_quotes}single-number{close_quotes} methods (TPH and TOX) were found to lack the required specificity to yield unambiguous results, especially in a preliminary investigation. Volatile analytes detected at the site include 1, 1,2,2-tetrachloroethane, trichloroethylene, and tetrachloroethylene, all of which probably represent residual site contamination from past activities. Other volatile analytes detected include toluene, tridecane, methylene chloride, and trichlorofluoromethane. These compounds are probably not associated with site contamination but likely represent cross-contamination or, in the case of tridecane, a naturally occurring material. Semivolatile analytes detected include three different phthalates and low part-per-billion amounts of the pesticide DDT and its degradation product DDE. The pesticide could represent residual site contamination from past activities, and the phthalates are likely due, in part, to cross-contamination during sample handling. A number of high-molecular-weight hydrocarbons and hydrocarbon derivatives were detected and were probably naturally occurring compounds. 4 refs., 1 fig., 8 tabs.
Energy Technology Data Exchange (ETDEWEB)
Yuen, C. R.; Martino, L. E.; Biang, R. P.; Chang, Y. S.; Dolak, D.; Van Lonkhuyzen, R. A.; Patton, T. L.; Prasad, S.; Quinn, J.; Rosenblatt, D. H.; Vercellone, J.; Wang, Y. Y.
2000-03-14
This report presents the results of the remedial investigation (RI) conducted at J-Field in the Edgewood Area of Aberdeen Proving Ground (APG), a U.S. Army installation located in Harford County, Maryland. Since 1917, activities in the Edgewood Area have included the development, manufacture, and testing of chemical agents and munitions and the subsequent destruction of these materials at J-Field by open burning and open detonation. These activities have raised concerns about environmental contamination at J-Field. This RI was conducted by the Environmental Conservation and Restoration Division, Directorate of Safety, Health and Environmental Division of APG, pursuant to requirements outlined under the Comprehensive Environmental Response, Compensation, and Liability Act, as amended (CERCLA). The RI was accomplished according to the procedures developed by the U.S. Environmental Protection Agency (EPA 1988). The RI provides a comprehensive evaluation of the site conditions, nature of contaminants present, extent of contamination, potential release mechanisms and migration pathways, affected populations, and risks to human health and the environment. This information will be used as the basis for the design and implementation of remedial actions to be performed during the remedial action phase, which will follow the feasibility study (FS) for J-Field.
Lorah, Michelle M.; Clark, Jeffrey S.
1996-01-01
Chemical manufacturing, munitions filling, and other military-support activities have resulted in the contamination of ground water, surface water, and soil in the Canal Creek area of Aberdeen Proving Ground, Maryland. Chlorinated volatile organic compounds, including 1,1,2,2-tetrachloroethane and trichloroethylene, are widespread ground-water contaminants in two aquifers that are composed of unconsolidated sand and gravel. Distribution and fate of chlorinated organic compounds in the ground water has been affected by the movement and dissolution of solvents in their dense immiscible phase and by microbial degradation under anaerobic conditions. Detection of volatile organic contaminants in adjacent surface water indicates that shallow contaminated ground water discharges to surface water. Semivolatile organic compounds, especially polycyclic aromatic hydrocarbons, are the most prevalent organic contaminants in soils. Various trace elements, such as arsenic, cadmium, lead, and zinc, were found in elevated concentrations in ground water, surface water, and soil. Simulations with a ground-water-flow model and particle tracker postprocessor show that, without remedial pumpage, the contaminants will eventually migrate to Canal Creek and Gunpowder River. Simulations indicate that remedial pumpage of 2.0 million gallons per day from existing wells is needed to capture all particles originating in the contaminant plumes. Simulated pumpage from offsite wells screened in a lower confined aquifer does not affect the flow of contaminated ground water in the Canal Creek area.
Tenbus, Frederick J.; Fleck, William B.
2001-01-01
Military activity at Graces Quarters, a former open-air chemical-agent facility at Aberdeen Proving Ground, Maryland, has resulted in ground-water contamination by chlorinated hydrocarbons. As part of a ground-water remediation feasibility study, a three-dimensional model was constructed to simulate transport of four chlorinated hydrocarbons (1,1,2,2-tetrachloroethane, trichloroethene, carbon tetrachloride, and chloroform) that are components of a contaminant plume in the surficial and middle aquifers underlying the east-central part of Graces Quarters. The model was calibrated to steady-state hydraulic head at 58 observation wells and to the concentration of 1,1,2,2-tetrachloroethane in 58 observation wells and 101direct-push probe samples from the mid-1990s. Simulations using the same basic model with minor adjustments were then run for each of the other plume constituents. The error statistics between the simulated and measured concentrations of each of the constituents compared favorably to the error statisticst,1,2,2-tetrachloroethane calibration. Model simulations were used in conjunction with contaminant concentration data to examine the sources and degradation of the plume constituents. It was determined from this that mixed contaminant sources with no ambient degradation was the best approach for simulating multi-species solute transport at the site. Forward simulations were run to show potential solute transport 30 years and 100 years into the future with and without source removal. Although forward simulations are subject to uncertainty, they can be useful for illustrating various aspects of the conceptual model and its implementation. The forward simulation with no source removal indicates that contaminants would spread throughout various parts of the surficial and middle aquifers, with the100-year simulation showing potential discharge areas in either the marshes at the end of the Graces Quarters peninsula or just offshore in the estuaries. The
Work plan for conducting an ecological risk assessment at J-Field, Aberdeen Proving Ground, Maryland
Energy Technology Data Exchange (ETDEWEB)
Hlohowskyj, I.; Hayse, J.; Kuperman, R. [Argonne National Lab., IL (United States). Environmental Assessment Div.] [and others
1995-03-01
The Environmental Management Division of Aberdeen Proving Ground (APG), Maryland, is conducting a remedial investigation and feasibility study (RI/FS) of the J-Field area at APG pursuant to the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA), as amended. J-Field is within the Edgewood Area of APG in Harford County, Maryland, and activities at the Edgewood Area since World War II have included the development, manufacture, testing, and destruction of chemical agents and munitions. The J-Field site was used to destroy chemical agents and munitions by open burning and open detonation. This work plan presents the approach proposed to conduct an ecological risk assessment (ERA) as part of the RI/FS program at J-Field. This work plan identifies the locations and types of field studies proposed for each area of concern (AOC), the laboratory studies proposed to evaluate toxicity of media, and the methodology to be used in estimating doses to ecological receptors and discusses the approach that will be used to estimate and evaluate ecological risks at J-Field. Eight AOCs have been identified at J-Field, and the proposed ERA is designed to evaluate the potential for adverse impacts to ecological receptors from contaminated media at each AOC, as well as over the entire J-Field site. The proposed ERA approach consists of three major phases, incorporating field and laboratory studies as well as modeling. Phase 1 includes biotic surveys of the aquatic and terrestrial habitats, biological tissue sampling and analysis, and media toxicity testing at each AOC and appropriate reference locations. Phase 2 includes definitive toxicity testing of media from areas of known or suspected contamination or of media for which the Phase 1 results indicate toxicity or adverse ecological effects. In Phase 3, the uptake models initially developed in Phase 2 will be finalized, and contaminant dose to each receptor from all complete pathways will be estimated.
Casey, J.; Ji, B.; Shaoie, S.; Mardinoglu, A.; Sarathi Sen, P.; Jahn, O.; Reda, K.; Leigh, J.; Follows, M. J.; Nielsen, J.; Karl, D. M.
2016-02-01
Representatives of the oligotrophic marine cyanobacterium Prochlorococcus marinus are the smallest free-living photosynthetic organisms, both in terms of physical size and genome size, yet are the most abundant photoautotrophic microbes in the oceans and profoundly influence global biogeochemical cycles. Physiological and regulatory control of nutrient and light stress has been observed in MED4 in culture and in its closely related `ecotype' eMED4 in the field, however its metabolism has not been investigated in detail. We present a genome-scale metabolic network reconstruction of the high-light adapted axenic strain MED4ax ("iJCMED4") for the quantitative analysis of a range of its metabolic phenotypes. The resulting structure is a proving ground for the incorporation of enzyme kinetics, biochemical and elemental compositional data, transcriptomic, proteomic, metabolomic, and fluxomic datasets which can be implemented within a constraint-based metabolic modeling environment. The iJCMED4 stoichiometric model consists of 523 metabolic genes encoding 787 reactions with 673 unique metabolites distributed in 5 sub-cellular compartments and is mass, charge, and thermodynamically balanced. Several variants of flux balance analysis were used to simulate growth and metabolic fluxes over the diel cycle, under various stress conditions (e.g., nitrogen, phosphorus, light), and within the framework of a global biogeochemical model (DARWIN). Model simulations accurately predicted growth rates in culture under a variety of defined medium compositions and there was close agreement of photosynthetic performance, biomass and energy yields and efficiencies, and transporter fluxes for iJCMED4 and culture experiments. In addition to a nearly optimal photosynthetic quotient and central carbon metabolism efficiency, MED4 has made dramatic alterations to redox and phosphorus metabolism across biosynthetic and intermediate pathways. We propose that reductions in phosphate reaction
Potential health impacts from range fires at Aberdeen Proving Ground, Maryland.
Energy Technology Data Exchange (ETDEWEB)
Willians, G.P.; Hermes, A.M.; Policastro, A.J.; Hartmann, H.M.; Tomasko, D.
1998-03-01
This study uses atmospheric dispersion computer models to evaluate the potential for human health impacts from exposure to contaminants that could be dispersed by fires on the testing ranges at Aberdeen Proving Ground, Maryland. It was designed as a screening study and does not estimate actual human health risks. Considered are five contaminants possibly present in the soil and vegetation from past human activities at APG--lead, arsenic, trichloroethylene (TCE), depleted uranium (DU), and dichlorodiphenyltrichloroethane (DDT); and two chemical warfare agents that could be released from unexploded ordnance rounds heated in a range fire--mustard and phosgene. For comparison, dispersion of two naturally occurring compounds that could be released by burning of uncontaminated vegetation--vinyl acetate and 2-furaldehyde--is also examined. Data from previous studies on soil contamination at APG are used in conjunction with conservative estimates about plant uptake of contaminants, atmospheric conditions, and size and frequency of range fires at APG to estimate dispersion and possible human exposure. The results are compared with US Environmental Protection Agency action levels. The comparisons indicate that for all of the anthropogenic contaminants except arsenic and mustard, exposure levels would be at least an order of magnitude lower than the corresponding action levels. Because of the compoundingly conservative nature of the assumptions made, they conclude that the potential for significant human health risks from range fires is low. The authors recommend that future efforts be directed at fire management and control, rather than at conducting additional studies to more accurately estimate actual human health risk from range fires.
Folmer, M. J.; Berndt, E.; Halverson, J. B.; Dunion, J. P.; Goldberg, M.
2015-12-01
As part of the GOES-R and JPSS Satellite Proving Grounds, multiple proxy and operational products were available to analyze and forecast the complex evolution of Hurricane Arthur (2014). The National Hurricane Center, Ocean Prediction Center, Weather Prediction Center, and NESDIS Satellite Analysis Branch were able to monitor the tropical and extratropical transition of Arthur using various convective and red, green, blue (RGB) products that have been introduced in recent years. During the extratropical transition, the Air Mass RGB (AM RGB) product and AIRS/CrIS ozone products were available as a compliment to water vapor imagery to identify the upper-level low with associated stratospheric drying that absorbed much of Arthur's energy. The AM RGB product provides forecasters with an enhanced view of various air masses that are combined into a single image and can help differentiate between possible stratospheric/tropospheric interactions, moist tropical air masses, and cool, continental/maritime air masses. Even though this product provides a wealth of qualitative information about the horizontal distribution of synoptic features, forecasters are also interested in more quantitative information such as the vertical distribution of temperature, moisture, and ozone which impact the coloring of the resulting AM RGB. Currently, NOAA Unique CrIS/ATMS Processing System (NUCAPS) temperature and moisture soundings are available in AWIPS-II as a point-based display. Traditionally, soundings are used to anticipate and forecast severe convection, however unique and valuable information can be gained from soundings for other forecasting applications, such as extratropical transition, especially in data sparse regions. Additional research has been conducted to look at how NUCAPS soundings might help forecasters identify the pre-extratropical transition environment, leading to earlier diagnosis and better public advisories. NUCAPS soundings, AIRS soundings, NOAA G-IV GPS
Lorah, M.M.; Vroblesky, D.A.
1989-01-01
Groundwater chemical data were collected from November 1986 through April 1987 in the first phase of a 5-year study to assess the possibility of groundwater contamination in the Canal Creek area of Aberdeen Proving Ground, Maryland. Water samples were collected from 87 observation wells screened in Coastal Plain sediments; 59 samples were collected from the Canal Creek aquifer, 18 from the overlying surficial aquifer, and 10 from the lower confined aquifer. Dissolved solids, chloride, iron, manganese, fluoride, mercury, and chromium are present in concentrations that exceed the Federal maximum contaminant levels for drinking water. Elevated chloride and dissolved-solids concentrations appear to be related from contaminant plumes but also could result from brackish-water intrusion. Excessive concentrations of iron and manganese were the most extensive water quality problems found among the inorganic constituents and are derived from natural dissolution of minerals and oxide coatings in the aquifer sediments. Volatile organic compounds are present in the Canal Creek and surficial aquifers, but samples from the lower confined aquifer do not show any evidence of contamination by inorganic or organic chemicals. The volatile organic contaminants detected in the groundwater and their maximum concentrations (in micrograms/L) include 1,1,2,2- tetrachloroethane (9,000); carbon tetrachloride (480); chloroform (460); 1,1,2-trichloroethane (80); 1,2-dichloroethane (990); 1,1-dichloroethane (3.1); tetrachloroethylene (100); trichloroethylene (1,800); 1,2-trans- dichloroethylene (1,200); 1,1-dichloroethylene (4.4); vinyl chloride (140); benzene (70); and chlorobenzene (39). On the basis of information on past activities in the study area, some sources of the volatile organic compounds include: (1) decontaminants and degreasers; (2) clothing-impregnating operations; (3) the manufacture of impregnite material; (4) the manufacture of tear gas; and (5) fuels used in garages and at
Hydrogeology and water quality in the Graces Quarters area of Aberdeen Proving Ground, Maryland
Tenbus, Frederick J.; Blomquist, Joel D.
1995-01-01
Graces Quarters was used for open-air testing of chemical-warfare agents from the late 1940's until 1971. Testing and disposal activities have resulted in the contamination of ground water and surface water. The hydrogeology and water quality were examined at three test areas, four disposal sites, a bunker, and a service area on Graces Quarters. Methods of investigation included surface and borehole geophysics, water-quality sampling, water- level measurement, and hydrologic testing. The hydrogeologic framework is complex and consists of a discontinuous surficial aquifer, one or more upper confining units, and a confined aquifer system. Directions of ground-water flow vary spatially and temporally, and results of site investigations show that ground-water flow is controlled by the geology of the area. The ground water and surface water at Graces Quarters generally are unmineralized; the ground water is mildly acidic (median pH is 5.38) and poorly buffered. Inorganic constituents in excess of certain Federal drinking-water regulations and ambient water-quality criteria were detected at some sites, but they probably were present naturally. Volatile and semivolatile organic com- pounds were detected in the ground water and surface water at seven of the nine sites that were investi- gated. Concentrations of organic compounds at two of the nine sites exceeded Federal drinking-water regulations. Volatile compounds in concentrations as high as 6,000 m/L (micrograms per liter) were detected in the ground water at the site known as the primary test area. Concentrations of volatile compounds detected in the other areas ranged from 0.57 to 17 m/L.
Operation UPSHOT-KNOTHOLE. Operational Summary, Nevada Proving Grounds, 1 March - 9 June 1953
1982-08-01
projaing stabi±izing agents were tested including sand-cementt sodium silicateg and lignin , The sand-cemnt test panels showed no damage to the effects of... Lignin proved its valua ana mohan.tc1a stabilizing agent in regions where the peak overpressure was less than 20 psi. Evaluation of these materials from a...selected officer volunp towns trained in culoulating the offscts of atomic wespona,, wase pomi~ tionod in trenches at 2W0 and AM0 Ids fr pom sex (a
Tenbus, F.J.; Phillips, S.W.
1996-01-01
Carroll Island was used for open-air testing of chemical warfare agents from the late 1940's until 1971. Testing and disposal activities weresuspected of causing environmental contamination at 16 sites on the island. The hydrogeology and chemical quality of ground water, surface water, and soil at these sites were investigated with borehole logs, environmental samples, water-level measurements, and hydrologic tests. A surficial aquifer, upper confining unit, and upper confined aquifer were defined. Ground water in the surficial aquifer generally flows from the east-central part of the island toward the surface-water bodies, butgradient reversals caused by evapotranspiration can occur during dry seasons. In the confined aquifer, hydraulic gradients are low, and hydraulic head is affected by tidal loading and by seasonal pumpage from the west. Inorganic chemistry in the aquifers is affected by brackish-water intrusion from gradient reversals and by dissolution ofcarboniferous shell material in the confining unit.The concentrations of most inorganic constituents probably resulted from natural processes, but some concentrations exceeded Federal water-quality regulations and criteria. Organic compounds were detected in water and soil samples at maximum concentrations of 138 micrograms per liter (thiodiglycol in surface water) and 12 micrograms per gram (octadecanoic acid in soil).Concentrations of organic compounds in ground water exceeded Federal drinking-water regulations at two sites. The organic compounds that weredetected in environmental samples were variously attributed to natural processes, laboratory or field- sampling contamination, fallout from industrial air pollution, and historical military activities.
Hydrogeologic, soil, and water-quality data for j-field, Aberdeen Proving Ground, Maryland, 1989-94
Phelan, D.J.
1996-01-01
Disposal of chemical-warfare agents, munitions, and industrial chemicals in J-Field, Aberdeen Proving Ground, Maryland, has resulted in ground-water, surface-water, and soil contamination. This report presents data collected by the U.S. Geological Survey from Novembr 1989 through September 1994 as part of a remedial investigation of J-Field in response to the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA). Hydrogeologic data, soil-gas and soil-quality data, and water-qualtiy data are included.
Huang, Wenxuan; Kitchaev, Daniil A.; Dacek, Stephen T.; Rong, Ziqin; Urban, Alexander; Cao, Shan; Luo, Chuan; Ceder, Gerbrand
2016-10-01
Lattice models, also known as generalized Ising models or cluster expansions, are widely used in many areas of science and are routinely applied to the study of alloy thermodynamics, solid-solid phase transitions, magnetic and thermal properties of solids, fluid mechanics, and others. However, the problem of finding and proving the global ground state of a lattice model, which is essential for all of the aforementioned applications, has remained unresolved for relatively complex practical systems, with only a limited number of results for highly simplified systems known. In this paper, we present a practical and general algorithm that provides a provable periodically constrained ground state of a complex lattice model up to a given unit cell size and in many cases is able to prove global optimality over all other choices of unit cell. We transform the infinite-discrete-optimization problem into a pair of combinatorial optimization (MAX-SAT) and nonsmooth convex optimization (MAX-MIN) problems, which provide upper and lower bounds on the ground state energy, respectively. By systematically converging these bounds to each other, we may find and prove the exact ground state of realistic Hamiltonians whose exact solutions are difficult, if not impossible, to obtain via traditional methods. Considering that currently such practical Hamiltonians are solved using simulated annealing and genetic algorithms that are often unable to find the true global energy minimum and inherently cannot prove the optimality of their result, our paper opens the door to resolving longstanding uncertainties in lattice models of physical phenomena. An implementation of the algorithm is available at https://github.com/dkitch/maxsat-ising.
Energy Technology Data Exchange (ETDEWEB)
Thompson, M.D.; McGinnis, L.D.; Benson, M.A.; Borden, H.M.; Padar, C.A.
1994-12-01
Geophysical surveying around Building E5032 using three new continuously recording geophysical instruments - two types of electromagnetic induction instruments and a cesium vapor magnetometer that were unavailable at the time of the original survey - has provided additional information for defining the location of buried debris, vaults, tanks, and the drainage/sump system near the building. The dominant geophysical signature around Building E5032 consists of a complex pattern of linear magnetic, electrical-conductivity, and electromagnetic field anomalies that appear to be associated with drainage/sewer systems, ditches, past railway activity, the location for Building T5033 (old number 99A), and the probable location of Building 91. Integrated analysis of data acquired using the three techniques, plus a review of the existing ground-penetrating-radar data, allow a more thorough definition of the sources for the observed anomalies.
Huang, Wenxuan; Dacek, Stephen; Rong, Ziqin; Urban, Alexander; Cao, Shan; Luo, Chuan; Ceder, Gerbrand
2016-01-01
Lattice models, also known as generalized Ising models or cluster expansions, are widely used in many areas of science and are routinely applied to alloy thermodynamics, solid-solid phase transitions, magnetic and thermal properties of solids, and fluid mechanics, among others. However, the problem of finding the true global ground state of a lattice model, which is essential for all of the aforementioned applications, has remained unresolved, with only a limited number of results for highly simplified systems known. In this article, we present the first general algorithm to find the exact ground states of complex lattice models and to prove their global optimality, resolving this fundamental problem in condensed matter and materials theory. We transform the infinite-discrete-optimization problem into a pair of combinatorial optimization (MAX-SAT) and non-smooth convex optimization (MAX-MIN) problems, which provide upper and lower bounds on the ground state energy respectively. By systematically converging th...
SPoRT Participation in the GOES-R and JPSS Proving Grounds
Jedlovec, Gary; Fuell, Kevin; Smith, Matthew
2013-01-01
For the last several years, the NASA Short-term Prediction Research and Transition (SPoRT) project at has been working with the various algorithm working groups and science teams to demonstrate the utility of future operational sensors for GOES-R and the suite of instruments for the JPSS observing platforms. For GOES-R, imagery and products have been developed from polar-orbiting sensors such as MODIS and geostationary observations from SEVIRI, simulated imagery, enhanced products derived from existing GOES satellites, and data from ground-based observing systems to generate pseudo or proxy products for the ABI and GLM instruments. The suite of products include GOES-POES basic and RGB hybrid imagery, total lightning flash products, quantitative precipitation estimates, and convective initiation products. SPoRT is using imagery and products from VIIRS, CrIS, ATMS, and OMPS to show the utility of data and products from their operational counterparts on JPSS. The products include VIIRS imagery in swath form, the GOES-POES hybrid, a suite of RGB products including the air mass RGB using water vapor and ozone channels from CrIS, and several DNB products. Over a dozen SPoRT collaborative WFOs and several National Centers are involved in an intensive evaluation of the operational utility of these products.
Energy Technology Data Exchange (ETDEWEB)
Wang, Ying-Ya; Yuen, C.R.; Martino, L.
1996-05-01
A remedial investigation was conducted to identify soil contamination in the Riot Control Burning Pit area in J-field, Aberdeen Proving Ground, Maryland. The investigation included geophysical surveys to delineate the filled section of the pit, soil-gas surveys to locate the organic contamination area, field X-ray fluorescence measurements along the burning pit to identify the major metal contamination, and surface and subsurface soil analyses to investigate the nature and extent of contamination. This paper presents the results of this investigation
Birtwistle, Amy N; Laituri, Melinda J.; Bledsoe, Brian P.; Friedman, Jonathan M.
2016-01-01
This study uses growth in vegetation during the monsoon season measured from LANDSAT imagery as a proxy for measured rainfall. NDVI values from 26 years of pre- and post-monsoon season Landsat imagery were derived across Yuma Proving Ground (YPG) in southwestern Arizona, USA. The LANDSAT imagery (1986-2011) was downloaded from USGS’s GlobeVis website (http://glovis.usgs.gov/). Change in NDVI was calculated within a set of 2,843 Riparian Area Polygons (RAPs) up to 1 km in length defined in ESRI ArcMap 10.2.
Olsen, Lisa D.; Spencer, Tracey A.
2000-01-01
The U.S. Geological Survey (USGS) collected 13 surface-water samples and 3 replicates from 5 sites in the West Branch Canal Creek area at Aberdeen Proving Ground from February through August 1999, as a part of an investigation of ground-water contamination and natural attenuation processes. The samples were analyzed for volatile organic compounds, including trichloroethylene, 1,1,2,2-tetrachloroethane, carbon tetrachloride, and chloroform, which are the four major contaminants that were detected in ground water in the Canal Creek area in earlier USGS studies. Field blanks were collected during the sampling period to assess sample bias. Field replicates were used to assess sample variability, which was expressed as relative percent difference. The mean variability of the surface-water replicate analyses was larger (35.4 percent) than the mean variability of ground-water replicate analyses (14.6 percent) determined for West Branch Canal Creek from 1995 through 1996. The higher variability in surface-water analyses is probably due to heterogeneities in the composition of the surface water rather than differences in sampling or analytical procedures. The most frequently detected volatile organic compound was 1,1,2,2- tetrachloroethane, which was detected in every sample and in two of the replicates. The surface-water contamination is likely the result of cross-media transfer of contaminants from the ground water and sediments along the West Branch Canal Creek. The full extent of surface-water contamination in West Branch Canal Creek and the locations of probable contaminant sources cannot be determined from this limited set of data. Tidal mixing, creek flow patterns, and potential effects of a drought that occurred during the sampling period also complicate the evaluation of surface-water contamination.
Senus, Michael P.; Tenbus, Frederick J.
2000-01-01
This report presents lithologic and ground-water-quality data collected during April and May 2000 in the remote areas of the tidal wetland of West Branch Canal Creek, Aberdeen Proving Ground, Maryland. Contamination of the Canal Creek aquifer with volatile organic compounds has been documented in previous investigations of the area. This study was conducted to investigate areas that were previously inaccessible because of deep mud and shallow water, and to support ongoing investigations of the fate and transport of volatile organic compounds in the Canal Creek aquifer. A unique vibracore drill rig mounted on a hovercraft was used for drilling and ground-water sampling. Continuous cores of the wetland sediment and of the Canal Creek aquifer were collected at five sites. Attempts to sample ground water were made by use of a continuous profiler at 12 sites, without well installation, at a total of 81 depths within the aquifer. Of those 81 attempts, only 34 sampling depths produced enough water to collect samples. Ground-water samples from two sites had the highest concentrations of volatile organic compounds?with total volatile organic compound concentrations in the upper part of the aquifer ranging from about 15,000 to 50,000 micrograms per liter. Ground-water samples from five sites had much lower total volatile organic compound concentrations (95 to 2,100 micrograms per liter), whereas two sites were essentially not contaminated, with total volatile organic compound concentrations less than or equal to 5 micrograms per liter.
Donnelly, Colleen A.; Tenbus, Fredrick J.
1998-01-01
Water-level data and interpretations from previous hydrogeological studies conducted by the U.S. Geological Survey in the Edgewood Area of Aberdeen Proving Ground (APG), Maryland, were compared to determine similarities and differences among the aquifers. Because the sediments that comprise the shallow aquifers are discontinuous, the shallow ground-water-flow systems are local rather than extensive across the Edgewood Area. Hydrogeologic cross sections, hydrographs of water levels, and vertical gradients calculated from previous studies in the Canal Creek area, Graces Quarters, the O-Field area, Carroll Island, and the J-Field area, over periods of record ranging from 1 to 10 years during 1986-97, were used to determine recharge and discharge areas, connections between aquifers, and hydrologic responses of aquifers to natural and anthropogenic stress. Each of the aquifers in the study areas exhibited variation of hydraulic head that was attributed to seasonal changes in recharge. Upward hydraulic gradients and seasonal reversals of vertical hydraulic gradients between aquifers indicate the potential for local ground-water discharge from most of the aquifers that were studied in the Edgewood Area. Hydraulic head in individual aquifers in Graces Quarters and Carroll Island responded to offsite pumping during part of the period of record. Hydraulic head in most of the confined aquifers responded to tidal loading effects from nearby estuaries.
Energy Technology Data Exchange (ETDEWEB)
McGinnis, L.D.; Miller, S.F.; Daudt, C.R.; Thompson, M.D.; Borden, H.; Benson, M. [Argonne National Lab., IL (United States). Reclamation Engineering and Geosciences Section; Wrobel, J. [Directorate of Safety, Health, and Environment, Aberdeen Proving Ground, MD (United States)
1994-05-01
Plans to demolish and remediate the Pilot Plant complex in the Edgewood Area of Aberdeen Proving Ground have served to initiate a series of nonintrusive, environmental-geophysical studies. The studies are assisting in the location and identification of pipes, tanks, trenches, and liquid waste in the subsurface. Multiple databases have been integrated to provide support for detection of underground utilities and to determine the stratigraphy and lithology of the subsurface. The studies were conducted within the double security fence and exterior to the double fence, down gradient toward the west branch of Canal Creek. To determine if contaminants found in the creek were associated with the Pilot Plant, both the east and west banks were included in the study area. Magnetic, conductivity, inductive emf, and ground-penetrating-radar anomalies outline buried pipes, trenches, and various pieces of hardware associated with building activities. Ground-penetrating-radar imagery also defines a paleovalley cut 30 ft into Potomac Group sediments of Cretaceous age. The paleovalley crosses the site between Building E5654 and the Pilot Plant fence. The valley is environmentally significant because it may control the pathways of contaminants. The Pilot Plant complex was used to manufacture CC2 Impregnite and incapacitating agents; it also served as a production facility for nerve agents.
Energy Technology Data Exchange (ETDEWEB)
Eberhardt, L.E.; Van Voris, P.
1986-08-01
In an effort to determine whether US Army activities on the Dugway Proving Ground (DPG) have had an impact on resident wildlife, intensive studies have been conducted on the biology and ecology of the black-tailed jack rabbit (Lepus californicus) since 1965. in addition, the incidence of endemic diseases in several species of resident wildlife on the DPG have been studied from the late 1950s through the mid-1970s. The objectives of this report are to: (1) compile and summarize the jack rabbit data and some of the disease information that is presently contained only in annual reports; (2) compare the DPG jack rabbit data to data available on other jack rabbit populations; and (3) analyze the data for unusual or unexplained fluctuations in population densities or in incidence of disease.
Energy Technology Data Exchange (ETDEWEB)
Haley, M.V.; Anthony, J.S.; Chester, N.A.; Kurnas, C.W.
1995-07-01
From the late 1940s through the 1960s, the standard practice for disposing of toxic chemicals at Aberdeen Proving Ground, MD, was open burning. This disposal site has since been placed on the National Priority List (NPt) by U.S. Environmental Protection Agency. In the spring 1992, sediment samples were taken from waterways that surround that disposal area. Chemical analysis and sediment toxicity assays (Ampelisca abdita) were conducted. Toxicity comparison, with sediment leachate from an Adapted Toxicity Characteristic teaching Procedure (ATCLP), were made using Daphnia magna and a fluorescent bacterium Photobacterium phosphoreum in MICROTOX assays. Amphipods showed a wide range of mortality in mud as well as coarser sediments indicating substrate preference is not critical to the outcome of the assay. Toxicity results from the leachates showed the sediments were not toxic to daphnia and MICROTOX assays.
Directory of Open Access Journals (Sweden)
Valentin S. Fedorovsky
2015-09-01
Full Text Available The Olkhon region of the Western Pribaikalie is highly attractive for geologists due to the presence of diverse metamorphic complexes and highly complicated combinations of folded structures in this region. The Olkhon region is located within the area of the Pribaikalsky National Park of Russia. At abundant outcrops in the subject area, various geological aspects resulting from the Early Palaeozoic collision system can be studied in detail. By its parameters, the subject area can be considered a «geodynamic proving ground». In recent years, abundant aerospace materials on the area have been accumulated, and long-term field studies resulted in many discoveries and findings which encourage critical revision of the initial conceptions. The material available allows compilation of a new package of geological maps in hard and electronic versions.
Schultz, L. A.; Smith, M. R.; Fuell, K.; Stano, G. T.; LeRoy, A.; Berndt, E.
2015-12-01
Instruments aboard the Joint Polar Satellite System (JPSS) series of satellites will provide imagery and other data sets relevant to operational weather forecasts. To prepare current and future weather forecasters in application of these data sets, Proving Ground activities have been established that demonstrate future JPSS capabilities through use of similar sensors aboard NASA's Terra and Aqua satellites, and the S-NPP mission. As part of these efforts, NASA's Short-term Prediction Research and Transition (SPoRT) Center in Huntsville, Alabama partners with near real-time providers of S-NPP products (e.g., NASA, UW/CIMSS, UAF/GINA, etc.) to demonstrate future capabilities of JPSS. This includes training materials and product distribution of multi-spectral false color composites of the visible, near-infrared, and infrared bands of MODIS and VIIRS. These are designed to highlight phenomena of interest to help forecasters digest the multispectral data provided by the VIIRS sensor. In addition, forecasters have been trained on the use of the VIIRS day-night band, which provides imagery of moonlit clouds, surface, and lights emitted by human activities. Hyperspectral information from the S-NPP/CrIS instrument provides thermodynamic profiles that aid in the detection of extremely cold air aloft, helping to map specific aviation hazards at high latitudes. Hyperspectral data also support the estimation of ozone concentration, which can highlight the presence of much drier stratospheric air, and map its interaction with mid-latitude or tropical cyclones to improve predictions of their strengthening or decay. Proving Ground activities are reviewed, including training materials and methods that have been provided to forecasters, and forecaster feedback on these products that has been acquired through formal, detailed assessment of their applicability to a given forecast threat or task. Future opportunities for collaborations around the delivery of training are proposed
Energy Technology Data Exchange (ETDEWEB)
Efroymson, R.A.
2002-05-09
This ecological risk assessment for a testing program at Yuma Proving Ground, Arizona, is a demonstration of the Military Ecological Risk Assessment Framework (MERAF; Suter et al. 2001). The demonstration is intended to illustrate how risk assessment guidance concerning-generic military training and testing activities and guidance concerning a specific type of activity (e.g., low-altitude aircraft overflights) may be implemented at a military installation. MERAF was developed with funding from the Strategic Research and Development Program (SERDP) of the Department of Defense. Novel aspects of MERAF include: (1) the assessment of risks from physical stressors using an ecological risk assessment framework, (2) the consideration of contingent or indirect effects of stressors (e.g., population-level effects that are derived from habitat or hydrological changes), (3) the integration of risks associated with different component activities or stressors, (4) the emphasis on quantitative risk estimates and estimates of uncertainty, and (5) the modularity of design, permitting components of the framework to be used in various military risk assessments that include similar activities. The particular subject of this report is the assessment of ecological risks associated with a testing program at Cibola Range of Yuma Proving Ground, Arizona. The program involves an Apache Longbow helicopter firing Hellfire missiles at moving targets, i.e., M60-A1 tanks. Thus, the three component activities of the Apache-Hellfire test were: (1) helicopter overflight, (2) missile firing, and (3) tracked vehicle movement. The demonstration was limited, to two ecological endpoint entities (i.e., potentially susceptible and valued populations or communities): woody desert wash communities and mule deer populations. The core assessment area is composed of about 126 km{sup 2} between the Chocolate and Middle Mountains. The core time of the program is a three-week period, including fourteen days of
Energy Technology Data Exchange (ETDEWEB)
Ebinger, M.H.; Beckman, R.J.; Myers, O.B. [Los Alamos National Lab., NM (United States); Kennedy, P.L.; Clements, W.; Bestgen, H.T. [Colorado State Univ., Ft. Collins, CO (United States). Dept. of Fishery and Wildlife Biology
1996-09-01
The purpose of this study was to evaluate the immediate and long-term consequences of depleted uranium (DU) in the environment at Aberdeen Proving Ground (APG) and Yuma Proving Ground (YPG) for the Test and Evaluation Command (TECOM) of the US Army. Specifically, we examined the potential for adverse radiological and toxicological effects to humans and ecosystems caused by exposure to DU at both installations. We developed contaminant transport models of aquatic and terrestrial ecosystems at APG and terrestrial ecosystems at YPG to assess potential adverse effects from DU exposure. Sensitivity and uncertainty analyses of the initial models showed the portions of the models that most influenced predicted DU concentrations, and the results of the sensitivity analyses were fundamental tools in designing field sampling campaigns at both installations. Results of uranium (U) isotope analyses of field samples provided data to evaluate the source of U in the environment and the toxicological and radiological doses to different ecosystem components and to humans. Probabilistic doses were estimated from the field data, and DU was identified in several components of the food chain at APG and YPG. Dose estimates from APG data indicated that U or DU uptake was insufficient to cause adverse toxicological or radiological effects. Dose estimates from YPG data indicated that U or DU uptake is insufficient to cause radiological effects in ecosystem components or in humans, but toxicological effects in small mammals (e.g., kangaroo rats and pocket mice) may occur from U or DU ingestion. The results of this study were used to modify environmental radiation monitoring plans at APG and YPG to ensure collection of adequate data for ongoing ecological and human health risk assessments.
Vroblesky, Don A.; Lorah, Michelle M.; Oliveros, James P.
1995-01-01
Disposal of munitions and chemical-warfare substances has introduced inorganic and organic contaminants to the ground water, surface water, and bottom sediment at O-Field, in the Edgewood area of Aberdeen Proving Ground, Maryland. Contaminants include chloride, arsenic, transition metals, chlorinated aliphatic hydrocarbons, aromatic compounds, and organosulfur and organophosphorus compounds. The hydrologic effects of several remedial actions were estimated by use of a ground-water-flow model. The remedial actions examined were an impermeable covering, encapsulation, subsurface barriers, a ground-water drain, pumping of wells to manage water levels or to remove contaminated ground water for treatment, and no action.
Phelan, Daniel J.; Senus, Michael P.; Olsen, Lisa D.
2001-01-01
This report presents lithologic and groundwater- quality data collected during April and May 2000 in the remote areas of the tidal wetland of West Branch Canal Creek, Aberdeen Proving Ground, Maryland. Contamination of the Canal Creek aquifer with volatile organic compounds has been documented in previous investigations of the area. This study was conducted to investigate areas that were previously inaccessible because of deep mud and shallow water, and to support ongoing investigations of the fate and transport of volatile organic compounds in the Canal Creek aquifer. A unique vibracore drill rig mounted on a hovercraft was used for drilling and groundwater sampling. Continuous cores of the wetland sediment and of the Canal Creek aquifer were collected at five sites. Attempts to sample ground water were made by use of a continuous profiler at 12 sites, without well installation, at a total of 81 depths within the aquifer. Of those 81 attempts, only 34 sampling depths produced enough water to collect samples. Ground-water samples from two sites had the highest concentrations of volatile organic compounds?with total volatile organic compound concentrations in the upper part of the aquifer ranging from about 15,000 to 50,000 micrograms per liter. Ground-water samples from five sites had much lower total volatile organic compound concentrations (95 to 2,100 micrograms per liter), whereas two sites were essentially not contaminated, with total volatile organic compound concentrations less than or equal to 5 micrograms per liter.
National Research Council Canada - National Science Library
2008-01-01
...) close Fort Monmouth, New Jersey, and realign most of its technical functions to Aberdeen Proving Ground, Maryland, as one of 182 recommendations in the 2005 base realignment and closure (BRAC) round...
Olsen, Lisa D.; Tenbus, Frederick J.
2005-01-01
A natural-gradient ground-water tracer test was designed and conducted in a tidal freshwater wetland at West Branch Canal Creek, Aberdeen Proving Ground, Maryland. The objectives of the test were to characterize solute transport at the site, obtain data to more accurately determine the ground-water velocity in the upper wetland sediments, and to compare a conservative, ionic tracer (bromide) to a volatile tracer (sulfur hexafluoride) to ascertain whether volatilization could be an important process in attenuating volatile organic compounds in the ground water. The tracer test was conducted within the upper peat unit of a layer of wetland sediments that also includes a lower clayey unit; the combined layer overlies an aquifer. The area selected for the test was thought to have an above-average rate of ground-water discharge based on ground-water head distributions and near-surface detections of volatile organic compounds measured in previous studies. Because ground-water velocities in the wetland sediments were expected to be slow compared to the underlying aquifer, the test was designed to be conducted on a small scale. Ninety-seven ?-inch-diameter inverted-screen stainless-steel piezometers were installed in a cylindrical array within approximately 25 cubic feet (2.3 cubic meters) of wetland sediments, in an area with a vertically upward hydraulic gradient. Fluorescein dye was used to qualitatively evaluate the hydrologic integrity of the tracer array before the start of the tracer test, including verifying the absence of hydraulic short-circuiting due to nonnatural vertical conduits potentially created during piezometer installation. Bromide and sulfur hexafluoride tracers (0.139 liter of solution containing 100,000 milligrams per liter of bromide ion and 23.3 milligrams per liter of sulfur hexafluoride) were co-injected and monitored to generate a dataset that could be used to evaluate solute transport in three dimensions. Piezometers were sampled 2 to 15 times
Phelan, Daniel J.; Olsen, Lisa D.; Senus, Michael P.; Spencer, Tracey A.
2001-01-01
The purpose of this report is to describe the occurrence and distribution of volatile organic compounds in surface-water samples collected by the U.S. Geological Survey in the Canal Creek area of Aberdeen Proving Ground, Maryland, from November 1999 through September 2000. The report describes the differences between years with below normal and normal precipitation, the effects of seasons, tide stages, and location on volatile organic compound concentrations in surface water, and provides estimates of volatile organic concentration loads to the tidal Gunpowder River. Eighty-four environmental samples from 20 surface-water sites were analyzed. As many as 13 different volatile organic compounds were detected in the samples. Concentrations of volatile organic compounds in surface-water samples ranged from below the reporting limit of 0.5 micrograms per liter to a maximum of 50.2 micrograms per liter for chloroform. Chloroform was detected most frequently, and was found in 55 percent of the environmental samples that were analyzed for volatile organic compounds (46 of 84 samples). Carbon tetrachloride was detected in 56 percent of the surface-water samples in the tidal part of the creek (34 of 61 samples), but was only detected in 3 of 23 samples in the nontidal part of the creek. 1,1,2,2-Tetrachloroethane was detected in 43 percent of the tidal samples (26 of 61 samples), but was detected at only two nontidal sites and only during November 1999. Three samples were collected from the tidal Gunpowder River about 300 feet from the mouth of Canal Creek in May 2000, and none of the samples contained volatile organic compound concentrations above detection levels. Volatile organic compound concentrations in surface water were highest in the reaches of the creek adjacent to the areas with the highest known levels of ground-water contamination. The load of total volatile organic compounds from Canal Creek to the Gunpowder River is approximately 1.85 pounds per day (0
Phelan, Daniel J.; Fleck, William B.; Lorah, Michelle M.; Olsen, Lisa D.
2002-01-01
Since 1917, Aberdeen Proving Ground, Maryland has been the primary chemical-warfare research and development center for the U.S. Army. Ground-water contamination has been documented in the Canal Creek aquifer because of past disposal of chemical and ordnance manufacturing waste. Comprehensive sampling for volatile organic compounds in ground water by the U.S. Geological Survey in the West Branch Canal Creek area was done in June?October 1995 and June?August 2000. The purpose of this report is (1) to compare volatile organic compound concentrations and determine changes in the ground-water contaminant plumes along two cross sections between 1995 and 2000, and (2) to incorporate data from new piezometers sampled in spring 2001 into the plume descriptions. Along the southern cross section, total concentrations of volatile organic compounds in 1995 were determined to be highest in the landfill area east of the wetland (5,200 micrograms per liter), and concentrations were next highest deep in the aquifer near the center of the wetland (3,300 micrograms per liter at 35 feet below land surface). When new piezometers were sampled in 2001, higher carbon tetrachloride and chloroform concentrations (2,000 and 2,900 micrograms per liter) were detected deep in the aquifer 38 feet below land surface, west of the 1995 sampling. A deep area in the aquifer close to the eastern edge of the wetland and a shallow area just east of the creek channel showed declines in total volatile organic compound concentrations of more than 25 percent, whereas between those two areas, con-centrations generally showed an increase of greater than 25 percent between 1995 and 2000. Along the northern cross section, total concentrations of volatile organic compounds in ground water in both 1995 and 2000 were determined to be highest (greater than 2,000 micrograms per liter) in piezometers located on the east side of the section, farthest from the creek channel, and concentrations were progressively lower
Majcher, Emily H.; Phelan, Daniel J.; Lorah, Michelle M.; McGinty, Angela L.
2007-01-01
Wetlands act as natural transition zones between ground water and surface water, characterized by the complex interdependency of hydrology, chemical and physical properties, and biotic effects. Although field and laboratory demonstrations have shown efficient natural attenuation processes in the non-seep wetland areas and stream bottom sediments of West Branch Canal Creek, chlorinated volatile organic compounds are present in a freshwater tidal creek at Aberdeen Proving Ground, Maryland. Volatile organic compound concentrations in surface water indicate that in some areas of the wetland, preferential flow paths or seeps allow transport of organic compounds from the contaminated sand aquifer to the overlying surface water without undergoing natural attenuation. From 2002 through 2004, the U.S. Geological Survey, in cooperation with the Environmental Conservation and Restoration Division of the U.S. Army Garrison, Aberdeen Proving Ground, characterized preferential ground-water seepage as part of an ongoing investigation of contaminant distribution and natural attenuation processes in wetlands at this site. Seep areas were discrete and spatially consistent during thermal infrared surveys in 2002, 2003, and 2004 throughout West Branch Canal Creek wetlands. In these seep areas, temperature measurements in shallow pore water and sediment more closely resembled those in ground water than those in nearby surface water. Generally, pore water in seep areas contaminated with chlorinated volatile organic compounds had lower methane and greater volatile organic compound concentrations than pore water in non-seep wetland sediments. The volatile organic compounds detected in shallow pore water in seeps were spatially similar to the dominant volatile organic compounds in the underlying Canal Creek aquifer, with both parent and anaerobic daughter compounds detected. Seep locations characterized as focused seeps contained the highest concentrations of chlorinated parent compounds
Schwenk, Jacob Tyler
Field data from Yuma Proving Ground, Arizona was used to test the feasibility of merging common multichannel analysis of surface waves (MASW) processing routines with mode-consistent shear-wave refraction traveltime tomography and synthetic modeling to optimize and constrain inversion results. Shear-wave first-arrival refraction tomography was used to enhance layer-model resolution and refine the MASW layer model with independent body-wave information. Shear-wave tomograms suggested a high-velocity layer, not found in initial 'smooth' MASW velocity sections that were used as initial models for tomographic inversion. Increasing the stratification of the MASW layer model, to generally match tomogram structure, resulted in a higher-resolution MASW model constrained through joint analysis. This mutual analysis of shear-wave velocity (Vs) provided multiplicity to the structural interpretation of the site. Constrained-parameterization MASW results, compressional-wave tomography (Vp:Vs ratio), and density well logs populated a 2D model for numerical modeling, which was manually updated over several iterations to converge upon the site's first-arrival and dispersion characteristics. Further evaluation of the synthetic seismograms gave insight into the relationship between acquisition geometry (offset selection) and the associated dispersion-image character. Furthermore, modeling gave a secondary measurement on depth to half-space, velocity structure, and relative Vp:Vs ratios, which formulated a final MASW profile. The gradual change of the earth model, given an evolving hierarchy of constraint, is seen as the main finding of this thesis. The calculated movement towards a higher-resolution inversion based on joint geophysical measurements, analysis, and interpretation, engenders a constrained-parameterization solution with highest confidence.
Gaydos, Joel C; Mallon, Timothy M; Rice, William A
2016-11-01
Reorganization of the Army and critical assessment of Army Graduate Medical Education programs prompted the Occupational and Environmental Medicine (OEM) Consultant to the Army Surgeon General to initiate a review of current Army OEM residency training. Available information indicated the Army OEM residency at Aberdeen Proving Ground, MD, was the first and longest operating Army OEM residency. Describing this residency was identified as the first step in the review, with the objectives of determining why the residency was started and sustained and its relevance to the needs of the Army. Records possibly related to the residency were reviewed, starting with 1954 since certification of physicians as Occupation Medicine specialists began in 1955. Interviews were conducted with selected physicians who had strong affiliations with the Army residency and the practice of Army OEM. The Army OEM residency began in 1960 and closed in 1996 with the transfer of Army OEM residency training to the Uniformed Services University of the Health Sciences, Bethesda, MD. Over 36 years, 47 uniformed residency graduates were identified; 44 were from the Army. Forty graduated between 1982 and 1996. The OEM residency was part of a dynamic cycle. Uniformed OEM leaders identified the knowledge and skills required of military OEM physicians and where these people should be stationed in the global Army. Rotations at military sites to acquire the needed knowledge and skills were integrated into the residency. Residency graduates were assigned to positions where they were needed. Having uniformed residents and preceptors facilitated the development of trust with military leaders and access to areas where OEM physician skills and knowledge could have a positive impact. Early reports indicated the residency was important in recruiting and retaining OEM physicians, with emphasis placed on supporting the Army industrial base. The late 1970s into the 1990s was a more dynamic period. There was
Energy Technology Data Exchange (ETDEWEB)
Prasad, S.; Martino, L.; Patton, T.
1995-03-01
J-Field encompasses about 460 acres at the southern end of the Gunpowder Neck Peninsula in the Edgewood Area of APG (Figure 2.1). Since World War II, the Edgewood Area of APG has been used to develop, manufacture, test, and destroy chemical agents and munitions. These materials were destroyed at J-Field by open burning and open detonation (OB/OD). For the purposes of this project, J-Field has been divided into eight geographic areas or facilities that are designated as areas of concern (AOCs): the Toxic Burning Pits (TBP), the White Phosphorus Burning Pits (WPP), the Riot Control Burning Pit (RCP), the Robins Point Demolition Ground (RPDG), the Robins Point Tower Site (RPTS), the South Beach Demolition Ground (SBDG), the South Beach Trench (SBT), and the Prototype Building (PB). The scope of this project is to conduct a remedial investigation/feasibility study (RI/FS) and ecological risk assessment to evaluate the impacts of past disposal activities at the J-Field site. Sampling for the RI will be carried out in three stages (I, II, and III) as detailed in the FSP. A phased approach will be used for the J-Field ecological risk assessment (ERA).
Energy Technology Data Exchange (ETDEWEB)
Lyon, T.L.; Del Valle, P.F.
1977-01-01
A special study of the optical radiation hazards associated with the operation of a He-Ne laser mounted to an American International Corporation Model 180 Law Enforcement Rifle was performed by this Agency. Radiometric measurements were conducted on 11 January 1977, for the US Army Human Engineering Laboratory at Aberdeen Proving Ground. It was determined that the protection standards for momentary viewing were exceeded out to a hazard distance of 9 m and to 100 m when viewing through an optical instrument. Long-term staring at the laser from within the beam exceeded the protection standards out to a caution distance of 490 m. (Author)
Energy Technology Data Exchange (ETDEWEB)
Martino, L.; Cho, E. [Argonne National Lab., Washington, DC (United States); Wrobel, J. [US Army Directorate of Safety, Health, and the Environment, Aberdeen Proving Ground, MD (United States)
1994-10-01
Investigators have used a field-portable X-Ray Fluorescence (XRF) Analyzer to screen soils for a suite of metals indicative of the open burning and open detonation (OB/OD) activities that occurred at the J-Field site at Aberdeen Proving Ground, Maryland. The field XRF results were incorporated into a multiphase investigation of contaminants at the Toxic Burning Pits Area of Concern at J-Field. The authors determined that the field-portable XRF unit used for the study and the general concept of field XRF screening are invaluable tools for investigating an OB/OD site where intrusive sampling techniques could present unacceptable hazards to site workers.
Lorah, Michelle M.; Voytek, Mary A.; Spencer, Tracey A.
2003-01-01
A preliminary assessment of the microbial communities and biodegradation processes for chlorinated volatile organic compounds was con-ducted by the U.S. Geological Survey in wetlands at the Cluster 13, Lauderick Creek area at Aberdeen Proving Ground, Maryland. The U.S. Geological Survey collected wetland sediment samples from 11 sites in the Lauderick Creek area for microbial analyses, and used existing data to evaluate biodegradation processes and rates. The bacterial and methanogen communities in the Lauderick Creek wetland sediments were similar to those observed in a previous U.S. Geological Survey study at the West Branch Canal Creek wet-land area, Aberdeen Proving Ground. Evaluation of the degradation rate of 1,1,2,2-tetrachloroethane and the daughter compounds produced also showed similar results for the two wetlands. How-ever, a vertical profile of contaminant concentra-tions in the wetlands was available at only one site in the Lauderick Creek area, and flow velocities in the wetland sediment are unknown. To better evaluate natural attenuation processes and rates in the wetland sediments at Lauderick Creek, chemi-cal and hydrologic measurements are needed along ground-water flowpaths in the wetland at additional sites and during different seasons. Nat-ural attenuation in the wetlands, enhanced biore-mediation, and constructed wetlands could be feasible remediation methods for the chlorinated volatile organic compounds discharging in the Lauderick Creek area. The similarities in the microbial communities and biodegradation pro-cesses at the Lauderick Creek and West Branch Canal Creek areas indicate that enhanced bioreme-diation techniques currently being developed for the West Branch Canal Creek wetland area would be transferable to this area.
Spencer, Tracey A.; Olsen, Lisa D.; Lorah, Michelle M.; Mount, Mastin M.
2000-01-01
This report presents water-quality data for ground-water and surface-water samples and water-level data collected by the U.S. Geological Survey from October 1998 through September 1999 at West Branch Canal Creek, Aberdeen Proving Ground, Maryland. The report also provides a description of the sampling and analytical methods that were used to collect and analyze the samples, and includes an evaluation of the quality-assurance data. The ground-water sampling network includes 88 wells or piezometers, including four 2-inch wells, two 4-inch wells, thirty 0.75-inch piezo-meters, and fifty-two 0.25-inch piezometers. Water levels were measured in 105 wells or piezometers. Surface-water samples were collected at five sites. Samples were collected from wells and 0.75-inch piezometers for measurement of field parameters, and analysis of inorganic and organic constituents during three sampling rounds: March, May through June, and July through August of 1999. Inorganic constituents and organic constituents were analyzed in samples collected from 0.25-inch piezometers during three sampling rounds in February through March, May, and September of 1999. Water levels were measured in October and November of 1998, and in February and May of 1999. Surface-water samples were collected between February and August of 1999 for analysis of organic constituents.
Energy Technology Data Exchange (ETDEWEB)
Patton, T.; Benioff, P.; Biang, C.; Butler, J. [and others
1996-06-01
The Environmental Management Division of Aberdeen Proving Ground (APG), Maryland, is conducting a remedial investigation and feasibility study of the J-Field area at APG pursuant to the Comprehensive Environmental Response, Compensation, and Liability Act, as amended (CERCLA). J-Field is located within the Edgewood Area of APG in Harford County, Maryland. Since World War II, activities in the Edgewood Area have included the development, manufacture, testing, and destruction of chemical agents and munitions. These materials were destroyed at J-Field by open burning/open detonation. Portions of J-Field continue to be used for the detonation and disposal of unexploded ordnance (UXO) by open burning/open detonation under authority of the Resource Conservation and Recovery Act.
Lorah, Michelle M.; Majcher, Emily H.; Jones, Elizabeth J.; Voytek, Mary A.
2008-01-01
Chlorinated solvents, including 1,1,2,2-tetrachloroethane, tetrachloroethene, trichloroethene, carbon tetrachloride, and chloroform, are reaching land surface in localized areas of focused ground-water discharge (seeps) in a wetland and tidal creek in the West Branch Canal Creek area, Aberdeen Proving Ground, Maryland. In cooperation with the U.S. Army Garrison, Aberdeen Proving Ground, Maryland, the U.S. Geological Survey is developing enhanced bioremediation methods that simulate the natural anaerobic degradation that occurs without intervention in non-seep areas of the wetland. A combination of natural attenuation and enhanced bioremediation could provide a remedy for the discharging ground-water plumes that would minimize disturbance to the sensitive wetland ecosystem. Biostimulation (addition of organic substrate or nutrients) and bioaugmentation (addition of microbial consortium), applied either by direct injection at depth in the wetland sediments or by construction of a permeable reactive mat at the seep surface, were tested as possible methods to enhance anaerobic degradation in the seep areas. For the first phase of developing enhanced bioremediation methods for the contaminant mixtures in the seeps, laboratory studies were conducted to develop a microbial consortium to degrade 1,1,2,2-tetrachloroethane and its chlorinated daughter products under anaerobic conditions, and to test biostimulation and bioaugmentation of wetland sediment and reactive mat matrices in microcosms. The individual components required for the direct injection and reactive mat methods were then combined in column experiments to test them under groundwater- flow rates and contaminant concentrations observed in the field. Results showed that both direct injection and the reactive mat are promising remediation methods, although the success of direct injection likely would depend on adequately distributing and maintaining organic substrate throughout the wetland sediment in the seep
Jones, Elizabeth; Voytek, Mary; Lorah, Michelle
2004-01-01
1,1,2,2-Tetrachloroethane (TeCA) contaminated groundwater at the Aberdeen Proving Ground discharges through an anaerobic wetland in West Branch Canal Creek (MD), where dechlorination occurs. Two microbially mediated pathways, dichloroelimination and hydrogenolysis, account for most of the TeCA degradation at this site. The dichloroelimination pathways lead to the formation of vinyl chloride (VC), a recalcitrant carcinogen of great concern. The goal of this investigation was to determine whether microbially-available Fe(III) in the wetland surface sediment influenced the fate of TeCA and its daughter products. Differences were identified in the TeCA degradation pathway between microcosms treated with amorphous ferric oxyhydroxide (AFO-treated) and untreated (no AFO) microcosms. TeCA degradation was accompanied by a lower accumulation of VC in AFO-treated microcosms than untreated microcosms. The microcosm incubations and subsequent experiments with the microcosm materials showed that AFO treatment resulted in lower production of VC by (1) shifting TeCA degradation from dichloroelimination pathways to production of a greater proportion of chlorinated ethane products, and (2) decreasing the microbial capability to produce VC from 1,2-dichloroethene (DCE). VC degradation was not stimulated in the presence of Fe(III). Rather, VC degradation occurred readily under methanogenic conditions and was inhibited under Fe(III)-reducing conditions.
Energy Technology Data Exchange (ETDEWEB)
Bromenshenk, J.J.; Smith, G.C.
1998-03-01
Honey bees (Apis mellifera L.) have been shown to be multi-media monitors of chemical exposures and resultant effects. This five-year project has developed an automated system to assess in real-time colony behavioral responses to stressors, both anthropogenic and natural, including inclement weather. Field trials at the Aberdeen Proving Ground-Edgewood included the Old O Field and J field landfills, the Canal Creek and Bush River areas, and a Churchville, MD reference site. Preliminary results show varying concentrations of bioavailable inorganic elements and chlorinated hydrocarbons in bee colonies from all Maryland sites. Industrial solvents in the air inside beehives exhibited the greatest between site differences, with the highest levels occurring in hives near landfills at Old O Field, J Field, and at some sites in the Bush River and Canal Creek areas. Compared to 1996, the 1997 levels of solvents in Old O Field hives decreased by an order of magnitude, and colony performance significantly improved, probably as a consequence of capping the landfill. Recent chemical monitoring accomplishments include development of a new apparatus to quantitatively calibrate TD/GC/MS analysis, a QA/QC assessment of factors that limit the precision of these analyses, and confirmation of transport of aqueous contaminants into the hive. Real-time effects monitoring advances include development of an extensive array of software tools for automated data display, inspection, and numerical analysis and the ability to deliver data from remote locations in real time through Internet or Intranet connections.
Kuhlman, K. M.; Siewert, C.; Stano, G. T.; Bruning, E. C.; Kingfield, D.; Baranowski, B.
2010-12-01
The primary objective of the Experimental Warning Program (EWP) is to evaluate the accuracy and the operational utility of new science, technology, and products in a testbed setting in order to gain feedback for improvements prior to their potential implementation into National Weather Service (NWS) operations. A developmental product for the GOES-R Geostationary Lightning Mapper (GLM) was demonstrated during the Spring 2010 EWP as part of the GOES-R Proving Ground. This product was created using data from ground-based Lightning Mapping Array (LMA) networks sorted into flashes and displayed at the 8 km resolution expected with the GLM. During the EWP, forecasters were able to examine the lightning data in AWIPS in conjunction with radar and other multi-sensor products as part of their warning-decision process for both real-time and archive events. Forecasters were then asked to provide feedback through both online surveys following the event and discussion with lead scientists. In general, the PGLM products provided a strong support tool for the forecasters and helped increase forecaster confidence to warn or not warn on a storm. Forecasters viewed future GLM data as a “great tool” or a possible “mainstream product” for “situational awareness.” Multiple forecaster comments echoed the idea of using the GLM data as an additional tool to radar, particularly during the early stages of storm development. Suggestions were given regarding display of the data as well as for future product integration. This feedback will help shape the design of the products and educational tools concerning lightning data ahead of the availability of GOES-R data in the local NWS offices. In addition to the individual forecaster feedback, all warnings issued by the forecasters during the EWP have been scored (POD, FAR) and compared with the official NWS warnings to determine what type of influence the GOES-R products may have had on the warning decision process as well as on
Majcher, Emily H.; Lorah, Michelle M.; Phelan, Daniel J.; McGinty, Angela L.
2009-01-01
Because of a lack of available in situ remediation methods for sensitive wetland environments where contaminated groundwater discharges, the U.S. Geological Survey, in cooperation with the U.S. Army Garrison, Aberdeen Proving Ground, Maryland, conceived, designed, and pilot tested a permeable reactive mat that can be placed horizontally at the groundwater/surface-water interface. Development of the reactive mat was part of an enhanced bioremediation study in a tidal wetland area along West Branch Canal Creek at Aberdeen Proving Ground, where localized areas of preferential discharge (seeps) transport groundwater contaminated with carbon tetrachloride, chloroform, tetrachloroethene, trichloroethene, and 1,1,2,2-tetrachloroethane from the Canal Creek aquifer to land surface. The reactive mat consisted of a mixture of commercially available organic- and nutrient-rich peat and compost that was bioaugmented with a dechlorinating microbial consortium, WBC-2, developed for this study. Due to elevated chlorinated methane concentrations in the pilot test site, a layer of zero-valent iron mixed with the peat and compost was added at the base of the reactive mat to promote simultaneous abiotic and biotic degradation. The reactive mat for the pilot test area was designed to optimize chlorinated volatile organic compound degradation efficiency without altering the geotechnical and hydraulic characteristics, or creating undesirable water quality in the surrounding wetland area, which is referred to in this report as achieving geotechnical, hydraulic, and water-quality compatibility. Optimization of degradation efficiency was achieved through the selection of a sustainable organic reactive matrix, electron donor, and bioaugmentation method. Consideration of geotechnical compatibility through design calculations of bearing capacity, settlement, and geotextile selection showed that a 2- to 3-feet tolerable thickness of the mat was possible, with 0.17 feet settlement predicted for
Anderson, T. S.; Miller, R.; Greenfield, R.; Fisk, D.
2002-12-01
The propagation of seismic waves through regions of complex topography is not thoroughly understood. Surface waves, are of particular interest, as they are large in amplitude and can characterize the source depth, magnitude, and frequency content. The amplitude and frequency content of seismic waves that propagate in regions with large topographical variations are affected by both the scattering and blockage of the wave energy. The ability to predict the 3-d scattering due to topography will improve the understanding of both regional scale surface wave magnitudes, and refine surface wave discriminants as well as at the local scale (Smart Weapons Test Range, Yuma Proving Ground, Arizona. The result of the KGS characterization study is a high-resolution 3-d model that is used in our seismic simulations. The velocities Vs, Vp are calculated by tomography and refraction, attenuation coefficients estimated from the surface wave and from p-waves and are provided in a model with attributes resolved in 3-d to 0.5 meters. In the present work, we present comparisons of synthetic data with seismic data collected at the Smart Weapons Test Range to benchmark the accuracy achieved in simulating 3-d wave propagation in the vicinity of a topographical anomaly (trench). Synthetic seismograms are generated using a 3-d 8th order staggered grid visco-elastic finite difference code that accounts for topography. The geologic model is based on the Yuma site characterization. The size of these calculations required use of the DoD High Performance Computers and parallelized code. Results are compared with field data. Preliminary results show an excellent match with field data using the 3-d fdtd technique.
Energy Technology Data Exchange (ETDEWEB)
Rosenblatt, D.H.; Small, M.J.; Kimmell, T.A.; Anderson, A.W.
1996-04-01
The State of Utah, Department of Environmental Quality (DEQ), Division of Solid and Hazardous Waste (DSHW), has declared residues resulting from the demilitarization, treatment, cleanup, and testing of military chemical agents to be hazardous wastes. These residues have been designated as corrosive, reactive, toxic, and acute hazardous (Hazardous Waste No. F999). The RCRA regulations (40 Code of Federal Regulations [CFR] 260-280), the Utah Administrative Code (R-315), and other state hazardous waste programs list specific wastes as hazardous but allow generators to petition the regulator to {open_quotes}delist,{close_quotes} if it can be demonstrated that such wastes are not hazardous. The U.S. Army Test and Evaluation Command (TECOM) believes that certain categories of F999 residues are not hazardous and has obtained assistance from Argonne National Laboratory (Argonne) to make the delisting demonstration. The objective of this project is to delist chemical agent decontaminated residues resulting from materials testing activities and to delist a remediation residue (e.g., contaminated soil). To delist these residues, it must be demonstrated that the residues (1) do not contain hazardous quantities of the listed agents; (2) do not contain hazardous quantities of constituents listed in 40 CFR Part 261, Appendix VIII; (3) do not exhibit other characteristics that could define the residues as hazardous; and (4) do not fail a series of acute toxicity tests. The first phase will focus on a subset of the F999 wastes generated at the U.S. Army Dugway Proving Ground (DPG), where the Army tests the effects of military chemical agents and agent-decontamination procedures on numerous military items. This effort is identified as Phase I of the Delisting Program. Subsequent phases will address other DPG chemical agent decontaminated residues and remediation wastes and similar residues at other installations.
Powars, D.S.
1997-01-01
A continuous core was recovered from a 961-foot- deep stratigraphic corehole at Robins Point, located at the southeastern tip of the Gunpowder Neck Peninsula, Harford County, Maryland. A 2-inch- diameter ground-water-quality observation well was installed with the screen set at a depth of 392 to 402 feet (ft). Geophysical logs obtained from thecorehole include: natural gamma, multipoint normal resistivity (16-inch and 64-inch), 4-ft-guard focused resistivity, acoustic (sonic) velocity, and caliper. Pollen analysis of 34 samples provided relativestratigraphic ages. Lithologies encountered in ascending order (surface elevation 4 ft above mean sea level), include: 72.4 ft of weatheredmetamorphic rock and saprolie, 711.4 ft of lower and upper Cretaceous fluvio-deltaic deposits, and 145.9 ft of Pleistocene and 31.3 ft of Holocene(?) fluvial and estuarine deposits. Aquifers and confining units identified include, in descending order: 41.8 ft of surficial aquifer, 90.9 ft of upper paleochannel confining unit, 28.8 ft of paleochannel confined aquifer, 15.7 ft of lower paleochannel confining unit, 123.7 ft of Upper Patapsco aquifer, 44.6 ft of Upper Patapsco confining unit, 92.8 ft of Middle Patapsco aquifer, 57.3 ft of Lower Patapsco confining unit, 151.7 ft of Lower Patapsco aquifer, 115.4 ft of Potomac confining unit, 126.4 ft of Patuxent aquifer, an aquifer of 23.4 ft of saprolite, and 48.7 ft of weathered-rock/saprolite confining unit.
The proving grounds: combat nursing in Vietnam.
Levasseur, Jeanne J
2003-01-01
The profession of nursing has been greatly influenced by war, and the heroic nature of the work of nursing is often emphasized during war. The purpose of this research was to examine the stories of nurses' experiences during combat in Vietnam and identify themes that would corroborate, refute, or expand prior historical research. A content analysis to determine recurrent themes was performed on 18 oral histories of military nurses who served in Vietnam that were previously collected and published. Analysis of these collections of oral histories was conducted, and thick quotes contextualize and substantiate the thematic claims. This research confirms the analysis of prior historical research on nursing in Vietnam by finding similar experiences recorded in oral histories and further claims that an authentic professional identity is often forged during the hardships and heroic opportunities of war.
Additional Soil Evaluations at Yuma Proving Ground
National Research Council Canada - National Science Library
Kurtz, James
1997-01-01
.... These tests were performed for the Army Research Laboratory. The objectives of this effort were primarily to characterize the soil conditions, particularly moisture and dielectric permittivity, in support of anticipated unexploded ordnance (UXO...
National Research Council Canada - National Science Library
Kolodny, Michael
2004-01-01
Experiments were run by the U.S. Army Research Laboratory at Yuma Proving Ground, AZ, on 10 and 12 June 2004 to obtain an initial assessment of the viability of using a powered parafoil as an unmanned air vehicle for employment...
Stefaneas, Petros; Vandoulakis, Ioannis M.
2015-12-01
This paper outlines a logical representation of certain aspects of the process of mathematical proving that are important from the point of view of Artificial Intelligence. Our starting-point is the concept of proof-event or proving, introduced by Goguen, instead of the traditional concept of mathematical proof. The reason behind this choice is that in contrast to the traditional static concept of mathematical proof, proof-events are understood as processes, which enables their use in Artificial Intelligence in such contexts, in which problem-solving procedures and strategies are studied. We represent proof-events as problem-centered spatio-temporal processes by means of the language of the calculus of events, which captures adequately certain temporal aspects of proof-events (i.e. that they have history and form sequences of proof-events evolving in time). Further, we suggest a "loose" semantics for the proof-events, by means of Kolmogorov's calculus of problems. Finally, we expose the intented interpretations for our logical model from the fields of automated theorem-proving and Web-based collective proving.
Interactive Theorem Proving and Verification
Indian Academy of Sciences (India)
Research in the area of automated reasoning is largely concentrated around two major themes – Automated Theorem Proving and Interactive Theorem Proving. The goal of Auto- mated Theorem Proving, as the name suggests, is to try to prove a wide range of mathematical theorems using a computer in an automatic ...
Lorah, Michelle M.; Voytek, Mary A.; Kirshtein, Julie D.; Jones, Elizabeth J.
2003-01-01
Defining biodegradation rates and processes is a critical part of assessing the feasibility of monitored natural attenuation as a remediation method for ground water containing organic contaminants. During 1998?2001, the U.S. Geological Survey conducted a microbial study at a freshwater tidal wetland along the West Branch Canal Creek, Aberdeen Proving Ground, Maryland, as part of an investigation of natural attenuation of chlorinated volatile organic compounds (VOCs) in the wetland sediments. Geochemical analyses and molecular biology techniques were used to investigate factors controlling anaerobic degradation of 1,1,2,2-tetrachloroethane (TeCA), and to characterize the microbial communities that potentially are important in its degradation. Rapid TeCA and daughter product degradation observed in laboratory experiments and estimated with field data confirm that natural attenuation is a feasible remediation method at this site. The diverse microbial community that seems to be involved in TeCA degradation in the wetland sediments varies with changing spatial and seasonal conditions, allowing continued effective natural attenuation throughout the year. Rates of TeCA degradation in anaerobic microcosm experiments conducted with wetland sediment collected from two different sites (WB23 and WB30) and during three different seasons (March?April 1999, July?August 1999, and October?November 2000) showed little spatial variability but high seasonal variability. Initial first-order degradation rate constants for TeCA ranged from 0.10?0.01 to 0.16?0.05 per day (half-lives of 4.3 to 6.9 days) for March?April 1999 and October?November 2000 microcosms incubated at 19 degrees Celsius, whereas lower rate constants of 0 ? 0.03 and 0.06 ? 0.03 per day were obtained in July?August 1999 microcosms incubated at 19 degrees Celsius. Microbial community profiles showed that low microbial biomass and microbial diversity in the summer, possibly due to competition for nutrients by the
Li, Hui; Zhang, Jiansheng; Ding, Rongrong
2017-11-01
The effects of alloying elements on the macrostructures, microstructures and tensile strength of AZ80 Mg alloy weldments were studied in the present study. The results indicate that with the decrease of Al element content of filler wire, the welding defects of seam are gradually eliminated and the β-Mg17Al12 phases at α-Mg boundaries are refined and become discontinuous, which are beneficial to the improvement of tensile strength. With AZ31 Mg alloy filler wire, the maximum tensile strength of AZ80 weldment is 220 MPa and fracture occurs at the welding seam of joint. It is experimentally proved that robust AZ80 Mg alloy joints can be obtained by tungsten inert gas (TIG) welding process with AZ31 Mg alloy filler wire. However, further study is required to improve the microstructures and reduce welding defects of joint in order to further improve the joining strength of AZ80 Mg alloy joint.
Geometric inequalities methods of proving
Sedrakyan, Hayk
2017-01-01
This unique collection of new and classical problems provides full coverage of geometric inequalities. Many of the 1,000 exercises are presented with detailed author-prepared-solutions, developing creativity and an arsenal of new approaches for solving mathematical problems. This book can serve teachers, high-school students, and mathematical competitors. It may also be used as supplemental reading, providing readers with new and classical methods for proving geometric inequalities. .
Investigation on the Mechanical Properties of Mg-Al Alloys (AZ41 and AZ51 and Its Composites
Directory of Open Access Journals (Sweden)
Manoj Gupta
2012-08-01
Full Text Available In the present study, AZ41 and AZ51 alloys were fabricated using disintegrated melt deposition technique followed by hot extrusion. AZ41/Yttria and AZ51/Yttria composites were prepared using 0.6 wt% yttria nano particles in the alloys using the same fabrication technique. From the tensile test results, both strengths (yield and tensile and ductility were improved in AZ51 when compared to AZ41. In comparison with its alloy counterparts, the yield and tensile strengths were enhanced while maintaining the same ductility in AZ41/Yttria composite, but comparable strengths with decreased ductility were observed in AZ51/Yttria composite. Under compressive loading, an improvement in strengths with similar ductility was observed in AZ51 when compared to AZ41. The best combination of strengths and ductility was observed in AZ51/Yttria composites from compression test results. The obtained mechanical properties are correlated with the microstructure observations.
A Cyber Proving Ground: The Search for Cyber Genius
2010-01-01
medium but also the message.15 Media theorist Marshall McLuhan suggested that advanced technological com- munication mediums, such as the Internet or...telecommunication systems, have evolved into their own messages to share with the world. Furthermore, McLuhan the- orized that evolutions in
Pacific Proving Grounds radioisotope imprint in the Philippine Sea sediments
DEFF Research Database (Denmark)
Pittauer, Daniela; Roos, Per; Qiao, Jixin
2017-01-01
Radionuclide concentrations were studied in sediment cores taken at the continental slope of the Philippine Sea off Mindanao Island in the equatorial Western Pacific. High resolution deposition records of anthropogenic radionuclides were collected at this site. Excess 210Pb together with excess 228...
ASTAMIDS minefield detection performance at Aberdeen Proving Ground test site
Maksymonko, George B.; Breiter, Karin
1997-07-01
The airborne standoff minefield detection systems (ASTAMIDS) is an airborne imaging system designed for deployment as a modular mission payload on an unmanned aerial vehicle and capable of detecting surface and buried anti-tank mines under all-weather, day/night conditions. Its primary mission is to support a forward maneuver unit with real time intelligence regarding the existence and extent of minefields in their operational area. The ASTAMIDS development effort currently consists of two parallel technical approaches, passive thermal IR sensor technology in one case and an active multi-channel sensor utilizing passive thermal IR coregistered with a near IR laser polarization data for the other case. The minefield detection capability of this system is a result of signal processing of image data. Due to the large quantities of data generated by an imaging sensor even at modest speeds of an unmanned aerial vehicle, manual exploitation of this data is not feasible in a real time tactical environment and therefore computer aided target feature extraction is a necessity to provide detection cues. Our development efforts over the past several years have concentrated on mine and minefield detection algorithms, the hardware necessary to execute these algorithms in real time, and the tools with which to measure detection performance.
Hydrogeology of the Canal Creek area, Aberdeen Proving Ground, Maryland
Oliveros, J.P.; Vroblesky, D.A.
1989-01-01
Geologic and borehole geophysical logs made at 77 sites show that the hydrogeologic framework of the study area consists of a sequence of unconsolidated sediments typical of the Coastal Plain of Maryland. Three aquifers and two confining units were delineated within the study area. From the surface down, they are: (1) the surficial aquifer; (2) the upper confining unit; (3) the Canal Creek aquifer; (4) the lower confining unit; and (5) the lower confined aquifer. The aquifer materials range from fine sand to coarse sand and gravel. Clay lenses were commonly found interfingered with the sand, isolating parts of the aquifers. All the units are continuous throughout the study area except for the upper confining unit, which crops out within the study area but is absent in updip outcrops. The unit also is absent within a Pleistocene paleochannel, where it has been eroded. The surficial and Canal Creek aquifers are hydraulically connected where the upper confining unit is absent, and a substantial amount of groundwater may flow between the two aquifers. Currently, no pumping stresses are known to affect the aquifers within the study area. Under current conditions, downward vertical hydraulic gradients prevail at topographic highs, and upward gradients typically prevail near surface-water bodies. Regionally, the direction of groundwater flow in the confined aquifers is to the east and southeast. Significant water level fluctuations correspond with seasonal variations in rainfall, and minor daily fluctuations reflect tidal cycles. (USGS)
Yuma Proving Ground GEM-3-E Data Collection
2007-11-01
severe desert environment. The soils in this region generally consist of calcium carbonate materials that tend to cement together in the soil, producing...desert region may have a horizon of calcium carbonates that tend to cement together in the soil, producing hard layers in the subsurface. The...determine the magnitude of the lag. The instrument was placed on a ferrite core calibration item (see Figure 8) with the DGPS streaming position data
Edgewood Area - Aberdeen Proving Ground Five-Year Review
2008-10-01
STORAGE AREA-CL 12 IP 1995 EAOE16 M-FLD MINE-FLD/P-TYPE BLDG. STO AREA C16 IP EAOE19 FORT HOYLE TRAINING AREA-CLUSTER 19 IP 1994 1997 EAOE19 FORT HOYLE ...the presence of residual white phosphorus (WP). Due to the excavation not being backfilled, a 3.6-acre pond was created. Based on historical...The removal created a 3.6-acre pond where the excavation penetrated the water table. 2.3.2 Land and Resource Use Old O-Field, located in the
Proving allelopathy in crop-weed interactions
Allelopathy (plant/plant chemical warfare) is difficult to prove, especially when competition for resources is the dominant component of plant/plant interference (interference = allelopathy +competition). This paper describes experimental approaches for proving allelopathy and points out common pit...
Characterization of the histone H2A.Z-1 and H2A.Z-2 isoforms in vertebrates
Directory of Open Access Journals (Sweden)
Helbing Caren C
2009-12-01
Full Text Available Abstract Background Within chromatin, the histone variant H2A.Z plays a role in many diverse nuclear processes including transcription, preventing the spread of heterochromatin and epigenetic transcriptional memory. The molecular mechanisms of how H2A.Z mediates its effects are not entirely understood. However, it is now known that H2A.Z has two protein isoforms in vertebrates, H2A.Z-1 and H2A.Z-2, which are encoded by separate genes and differ by 3 amino acid residues. Results We report that H2A.Z-1 and H2A.Z-2 are expressed across a wide range of human tissues, they are both acetylated at lysine residues within the N-terminal region and they exhibit similar, but nonidentical, distributions within chromatin. Our results suggest that H2A.Z-2 preferentially associates with H3 trimethylated at lysine 4 compared to H2A.Z-1. The phylogenetic analysis of the promoter regions of H2A.Z-1 and H2A.Z-2 indicate that they have evolved separately during vertebrate evolution. Conclusions Our biochemical, gene expression, and phylogenetic data suggest that the H2A.Z-1 and H2A.Z-2 variants function similarly yet they may have acquired a degree of functional independence.
Tank 241-AZ-101 tank characterization plan
Energy Technology Data Exchange (ETDEWEB)
Schreiber, R.D.
1995-02-06
The Defense Nuclear Facilities Safety Board has advised the DOE to concentrate the near-term sampling and analysis activities on identification and resolution of safety issues. The Data Quality Objective (DQO) process was chosen as a tool to be used in the resolution of safety issues. As a result, A revision in the Federal Facilities Agreement and Consent Order (Tri-Party Agreement) milestone M-44 has been made, which states that ``A Tank Characterization Plan (TCP) will also be developed for each double-shell tank (DST) and single-shell tank (SST) using the DQO process. Development of TCPs by the DQO process is intended to allow users to ensure their needs will be met and that resources are devoted to gaining only necessary information``. This document satisfies that requirement for Tank 241-AZ-101 (AZ-101) sampling activities. Tank AZ-101 is currently a non-Watch List tank, so the only DQOs applicable to this tank are the safety screening DQO and the compatibility DQO, as described below. The contents of Tank AZ-101, as of October 31, 1994, consisted of 3,630 kL (960 kgal) of dilute non-complexed waste and aging waste from PUREX (NCAW, neutralized current acid waste). Tank AZ-101 is expected to have two primary layers. The bottom layer is composed of 132 kL of sludge, and the top layer is composed of 3,500 kL of supernatant, with a total tank waste depth of approximately 8.87 meters.
Symbolic logic and mechanical theorem proving
Chang, Chin-Liang
1969-01-01
This book contains an introduction to symbolic logic and a thorough discussion of mechanical theorem proving and its applications. The book consists of three major parts. Chapters 2 and 3 constitute an introduction to symbolic logic. Chapters 4-9 introduce several techniques in mechanical theorem proving, and Chapters 10 an 11 show how theorem proving can be applied to various areas such as question answering, problem solving, program analysis, and program synthesis.
APTE: An Algorithm for Proving Trace Equivalence
Cheval, Vincent
2014-01-01
This paper presents APTE, a new tool for automatically proving the security of cryptographic protocols. It focuses on proving trace equivalence between processes, which is crucial for specifying privacy type properties such as anonymity and unlinkability.\\ud \\ud The tool can handle protocols expressed in a calculus similar to the applied-pi calculus, which allows us to capture most existing protocols that rely on classical cryptographic primitives. In particular, APTE handles private channels...
Computer simulation of the leaching and washing of waste in tanks C-106, AY-102, AZ-101, and AZ-102
Energy Technology Data Exchange (ETDEWEB)
MacLean, G.T.
1997-05-01
The waste in underground storage tanks C-106, AY-102, AZ-101, and AZ-102 will be used to prepare feed material for the proposed high level waste vitrification demonstration plant at Hanford. A chemical process simulation computer program called the Environment Simulation Program (ESP) was used to estimate the compositions and quantities of this waste and the products after pretreatment processing. The amount of precipitated material in Tank C-106 predicted to be dissolved by sluicing is 27 wt.%. The amount of precipitated material predicted to be dissolved by mild leaching is about 30% for the C-106 and AY-102 combined waste and about 50% for AZ-101, and 35% for AZ-102 wastes. The predicted caustic solution raw material requirements for leaching are 158 m{sup 3} for C-106 and AY-102, 60 m{sup 3} for AZ-101, and 146 m{sup 3} for AZ-102, all as 50 wt.% NAOH.
Joining of AZ31 and AZ91 Mg alloys by friction stir welding
Directory of Open Access Journals (Sweden)
B. Ratna Sunil
2015-12-01
Full Text Available Two dissimilar magnesium (Mg alloy sheets, one with low aluminium (AZ31 and another with high aluminium (AZ91 content, were successfully joined by friction stir welding (FSW. The effect of process parameters on the formation of hot cracks was investigated. A sound metallurgical joint was obtained at optimized process parameters (1400 rpm with 25 mm/min feed which contained fine grains and distributed β (Mg17Al12 phase within the nugget zone. An increasing trend in the hardness measurements has also confirmed more amount of dissolution of aluminium within the nugget zone. A sharp interface between nugget zone and thermo mechanical affected zone (TMAZ was clearly noticed at the AZ31 Mg alloy side (advancing but not on the AZ91 Mg alloy side (retreating. From the results it can be concluded that FSW can be effectively used to join dissimilar metals, particularly difficult to process metals such as Mg alloys, and hot cracking can be completely eliminated by choosing appropriate process parameters to achieve sound joint.
Proving program inclusion using Hoare's logic
Bergstra, J.A.; Klop, J.W.
1984-01-01
We explore conservative refinements of specifications. These form a quite appropriate framework for a proof theory for program inclusion based on a proof theory for program correctness. We propose two formalized proof methods for program inclusion and prove these to be sound. Both methods are
Affect, Behavioural Schemas and the Proving Process
Selden, Annie; McKee, Kerry; Selden, John
2010-01-01
In this largely theoretical article, we discuss the relation between a kind of affect, behavioural schemas and aspects of the proving process. We begin with affect as described in the mathematics education literature, but soon narrow our focus to a particular kind of affect--nonemotional cognitive feelings. We then mention the position of feelings…
Proving a Result in Combinatorics using Equations
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 9; Issue 2. Proving a Result in Combinatorics using Equations. V Rajesh. Classroom Volume 9 Issue 2 February 2004 pp 85-87. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/009/02/0085-0087. Keywords.
CYCLIC FATIGUE RESISTANCE OF AZ91 MAGNESIUM ALLOY
Directory of Open Access Journals (Sweden)
Aneta Němcová
2009-11-01
Full Text Available The paper deals with determination of principal mechanical properties and the investigation of fatigue behaviour of AZ91 magnesium alloy. The experimental material was made by squeeze casting technique and heat treated to obtain T4 state (solution annealing, when hard, brittle Mg17Al12 intermetallic phase is dissolved. The basic mechanical properties (Young’s modulus, ultimate tensile strength, yield strength, elongation to fracture and reduction of area were determined by static tensile test. Furthermore, fatigue parameters were investigated. The S-N curve on the basis of smooth test bars tested under symmetrical push-pull loading at room temperature was evaluated. The measured data were subsequently used for fitting with suitable regression functions (Kohout & Věchet and Stromeyer for determination of the fatigue parameters. Fatigue limit sigma-c of the studied alloy for 108 cycles is approaching 50 MPa. In addition, the fracture surfaces were observed by scanning electron microscopy. The failure analysis proved that the striations were observed in fatigue crack propagation area and in the area of static fracture was observed the transgranular ductile fracture. The structure of the studied alloy in the basic state and after heat treatment was observed by light and scanning electron microscopy.
Grain refinement of AZ31 magnesium alloy by electromagnetic ...
Indian Academy of Sciences (India)
The effects of electromagnetic stirring and Al4C3 grain refiner on the grain refinement of semicontinuously cast AZ31 magnesium alloy were discussed in this investigation. The results indicate that electromagnetic stirring has an effective refining effect on the grain size of AZ31 magnesium alloy under the effect of Al4C3 ...
ANALYSIS RESULTS FOR BUILDING 241 702-AZ A TRAIN
Energy Technology Data Exchange (ETDEWEB)
DUNCAN JB; FRYE JM; COOKE CA; LI SW; BROCKMAN FJ
2006-12-13
This report presents the analyses results for three samples obtained under RPP-PLAN-28509, Sampling and Analysis Plan for Building 241 702-AZ A Train. The sampling and analysis was done in response to problem evaluation request number PER-2004-6139, 702-AZ Filter Rooms Need Radiological Cleanup Efforts.
On proving syntactic properties of CPS programs
DEFF Research Database (Denmark)
Danvy, Olivier; Dzafic, Belmina; Pfenning, Frank
1999-01-01
Higher-order program transformations raise new challenges for proving properties of their output, since they resist traditional, first-order proof techniques. In this work, we consider (1) the “one-pass” continuation-passing style (CPS) transformation, which is second-order, and (2) the occurrences...... of parameters of continuations in its output. To this end, we specify the one-pass CPS transformation relationally and we use the proof technique of logical relations....
Automated theorem proving theory and practice
Newborn, Monty
2001-01-01
As the 21st century begins, the power of our magical new tool and partner, the computer, is increasing at an astonishing rate. Computers that perform billions of operations per second are now commonplace. Multiprocessors with thousands of little computers - relatively little! -can now carry out parallel computations and solve problems in seconds that only a few years ago took days or months. Chess-playing programs are on an even footing with the world's best players. IBM's Deep Blue defeated world champion Garry Kasparov in a match several years ago. Increasingly computers are expected to be more intelligent, to reason, to be able to draw conclusions from given facts, or abstractly, to prove theorems-the subject of this book. Specifically, this book is about two theorem-proving programs, THEO and HERBY. The first four chapters contain introductory material about automated theorem proving and the two programs. This includes material on the language used to express theorems, predicate calculus, and the rules of...
Theorem Proving In Higher Order Logics
Carreno, Victor A. (Editor); Munoz, Cesar A.; Tahar, Sofiene
2002-01-01
The TPHOLs International Conference serves as a venue for the presentation of work in theorem proving in higher-order logics and related areas in deduction, formal specification, software and hardware verification, and other applications. Fourteen papers were submitted to Track B (Work in Progress), which are included in this volume. Authors of Track B papers gave short introductory talks that were followed by an open poster session. The FCM 2002 Workshop aimed to bring together researchers working on the formalisation of continuous mathematics in theorem proving systems with those needing such libraries for their applications. Many of the major higher order theorem proving systems now have a formalisation of the real numbers and various levels of real analysis support. This work is of interest in a number of application areas, such as formal methods development for hardware and software application and computer supported mathematics. The FCM 2002 consisted of three papers, presented by their authors at the workshop venue, and one invited talk.
Has the Agrotherm method proved useful
Energy Technology Data Exchange (ETDEWEB)
Schikora, G.
1982-03-19
The author reports on the Agrotherm project. It was planned not to carry off the waste heat of power plants via conventional cooling towers but to use the heat for heating agricultural areas by conducting the hot waste water through pipes buried in the ground. One hopes to improve the yield by this measure.
Proportional Strength-Ductility Relationship of Non-SF6 Diecast AZ91D Eco-Mg Alloys
Kim, Shae K.
SF6 gas has been generally used for Mg alloys during melting and casting as a cover gas. The use of SF6 gas, however, will be limited owing to its significant impact on global warming. Non-SF6 process during melting and casting in diecasting industry has been proved with Eco-Mg alloys by a simple addition of small amount of CaO into AZ91D and AM60B Mg alloys. This paper will show non-SF6 diecasting procedures for AZ91D Eco-Mg alloys. Cold-chamber and hot-chamber diecasting mass productions were performed by using a Toshiba 135-ton cold chamber and a Frech 200-ton hot chamber diecasting machines under CO2 atmosphere without SF6 gas. An emphasis will be on proportional strength and ductility relationship of Eco-Mg alloys, in part, due to a high-quality melt, refined grain size and Al2Ca second phase strengthening. Microstructures and mechanical properties of AZ91D Eco-Mg alloys will be evaluated in comparison with those of conventional AZ91D Mg alloy.
UV Energy Distribution of AZ Cassiopeiae
Directory of Open Access Journals (Sweden)
Young Woon Kang
1994-06-01
Full Text Available The IUE low dispersion spectra of AZ Cas have been analyzed for line identifications and energy distribution in ultraviolet region. Highly ionized atoms, Si IV and C IV are identified. We could infer a temperature range of the B star between 15,000K and 20,000K. The energy density distribution shows a hump between IUE short wavelength and long wavelength regions. Photometric and spectroscopic elements were revised based on the Florkowisk photoelectric observations and collected radial velocities. The temperature of both stars were reduced as 16,000K and 3,800K. The radii of both stars are 10 R⨀ and 320 R⨀. The eccentricity and longitude of periastron are 0.61 and 10.5°, respectively.
DEFF Research Database (Denmark)
Mortensen, Thomas Bøtker
2009-01-01
Facebook Marketing – Leverage Social Media to Grow Your Business af Steven Holzner er Facebook Marketing fra A-Z, som kan anbefales til virksomheder, som overvejer at bevæge sig ud i cyber space og afprøve mulighederne for at markedsføre sig dér. Bogen beskriver på hvilke væsentlige punkter...... marketing på Facebook adskiller sig fra traditionel marketing, og gennemgår trin for trin de fundamentale ting, som man skal vide for, at virksomheden kan agere med den tilsigtede effekt i et socialt netværk som Facebook. Og eftersom 34 % af den danske befolkning i dag er hoppet med på Facebook vognen og...... har oprettet en profil på Facebook, er potentialet åbenlyst....
Interval logic. Proof theory and theorem proving
DEFF Research Database (Denmark)
Rasmussen, Thomas Marthedal
2002-01-01
of a direction of an interval, and present a sound and complete Hilbert proof system for it. Because of its generality, SIL can conveniently act as a general formalism in which other interval logics can be encoded. We develop proof theory for SIL including both a sequent calculus system and a labelled natural...... deduction system. We conduct theoretical investigations of the systems with respect to subformula properties, proof search, etc. The generic theorem proving system Isabelle is used as a framework for encoding both proof theoretical systems. We consider a number of examples/small case-studies and discuss...
A comparative corrosion behavior of Mg, AZ31 and AZ91 alloys in 3.5% NaCl solution
Directory of Open Access Journals (Sweden)
I.B. Singh
2015-06-01
Full Text Available The corrosion behavior of Mg, AZ31 and AZ91 has been evaluated in 3.5% NaCl solution using weight loss, electrochemical polarization and impedance measurements. Corrosion rate derived from the weight losses demonstrated the occurrence of steeply fast corrosion reaction on AZ91 alloy after three hours of immersion, indicating the start of galvanic corrosion. An increase of corrosion rate with immersion time was also observed for AZ31 but with lesser extent than AZ91 alloy. Whereas Mg metals showed a decrease of corrosion rate with immersion time, suggesting the formation of a protective layer on their surfaces. In contrast, the corrosion current density (Icorr derived from the Tafel plots, exhibited their corrosion resistances in order of Mg > AZ91 > AZ31. Electrochemical charge transfer resistance (Rct and double layer capacitance measured by electrochemical impedance spectroscopy (EIS, are well in accordance with the measured Icorr. EIS measurements with time and microstructural examination of the corroded and uncorroded samples are helpful in elucidation of results measured by electrochemical polarization.
Resolution methods in proving the program correctness
Directory of Open Access Journals (Sweden)
Markoski Branko
2007-01-01
Full Text Available Program testing determines whether its behavior matches the specification, and also how it behaves in different exploitation conditions. Proving of program correctness is reduced to finding a proof for assertion that given sequence of formulas represents derivation within a formal theory of special predicted calculus. A well-known variant of this conception is described: correctness based on programming logic rules. It is shown that programming logic rules may be used in automatic resolution procedure. Illustrative examples are given, realized in prolog-like LP-language (with no restrictions to Horn's clauses and without the final failure. Basic information on LP-language are also given. It has been shown how a Pascal-program is being executed in LP-system proffer.
Theorem Proving in Intel Hardware Design
O'Leary, John
2009-01-01
For the past decade, a framework combining model checking (symbolic trajectory evaluation) and higher-order logic theorem proving has been in production use at Intel. Our tools and methodology have been used to formally verify execution cluster functionality (including floating-point operations) for a number of Intel products, including the Pentium(Registered TradeMark)4 and Core(TradeMark)i7 processors. Hardware verification in 2009 is much more challenging than it was in 1999 - today s CPU chip designs contain many processor cores and significant firmware content. This talk will attempt to distill the lessons learned over the past ten years, discuss how they apply to today s problems, outline some future directions.
75 FR 81190 - Television Broadcasting Services; Yuma, AZ
2010-12-27
... From the Federal Register Online via the Government Publishing Office FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Television Broadcasting Services; Yuma, AZ AGENCY: Federal Communications Commission. ACTION: Dismissal. SUMMARY: The Commission dismisses the petition for rulemaking filed by Arizona...
Recommendation Report: EJournals/EBooks A-Z Management System
Ramli, Rindra M.
2014-01-01
This is a recommendation report for KAUST Library on the Ejournals / EBooks AZ Management systems project. It briefly described the issues faced by the ERM Team, project plan overview and the project findings as well as the recommendation(s).
Valutazione economica dello studio PROVE-IT
Directory of Open Access Journals (Sweden)
Lorenzo G. Mantovani
2007-10-01
Full Text Available Introduction: the PROVE-IT (“Intensive versus moderate lipid lowering with statins after acute coronary syndromes” was a comparison of pravastatin 40 mg/die versus atorvastatin 80 mg/die in patients with an acute coronary syndrome (ACS. Aim: our aim was to investigate the economic consequence of high dose of atorvastatin vs usual-dose of pravastatin in Italian patients with a history of acute coronary syndrome. Methods: the analysis is conducted on the basis of clinical outcomes of the PROVE-IT study. We conducted a cost-effectiveness analysis, comparing high dose of atorvastatin (80 mg/die versus usual-dose of pravastatin (40 mg/die in the perspective of the Italian National Health Service. We identified and quantified medical costs: drug costs according to the Italian National Therapeutic Formulary and hospitalizations were quantified based on the Italian National Health Service tariffs (2006. Effects were measured in terms of mortality and morbidity reduction (number of deaths, life years gained and frequency of hospitalizations. We considered an observation period of 24 months. The costs borne after the first 12 months were discounted using an annual rate of 3%. We conducted one and multi-way sensitivity analyses on unit cost and effectiveness. We also conducted a threshold analysis. Results: the cost of pravastatin or atorvastatin therapy over the 2 years period amounted to approximately 1.3 millions euro and 870,000 euro per 1,000 patients respectively. Atorvastatin was more efficacious compared to pravastatin and the overall cost of care per 1,000 patients over 24 months of follow-up was estimated at 3.2 millions euro in the pravastatin and 2.5 millions euro in the atorvastatin group, resulting into a cost saving of about 700,000 euro that is 27% of total costs occurred in the pravastatin group. Discussion: this study demonstrates that high does atorvastatin treatment leads to a reduction of direct costs for the National Health System
a Test to Prove Cloud Whitening THEORY!
Buttram, J. W.
2011-12-01
Climate science researchers believe our planet can possibly tolerate twice the present carbon dioxide levels with no upwards temperature change, IF we could increase the amount of energy reflected back out into space by about 2.0%. (c)Cloudtec basically alters a blend of seawater and applies heat derived from magma to it at a temperature exceeding 2,000 degrees F. The interaction of seawater and magma displaces the oxygen, causing the volume of water to vaporize and expand over 4,000 times - transforming billions of tons of seawater into thousands of cubic miles of white, maritime, stratocumulus clouds to reflect the incident Sun's rays back out into space. A 6 month test to prove Cloud Whitening Theory will cost 6 million dollars. (No profit added.) This study will enable everyone on the planet with a computer the transparency to use satellite imagery and check out for themselves - if and when Cloud Whitening is occurring. If Cloud Whitening Theory is validated, (c)Cloudtec's innovation can strategically create the clouds we need to reflect the Sun's rays back out into space and help neutralize the projected 3.6 degrees F rise in temperature. Based on reasonable calculations of anthropogenic global warming: this one move alone would be comparable to slashing global carbon dioxide emissions by over 60% over the next 40 years.
an emerging grounded theory for preaching on poverty in south ...
African Journals Online (AJOL)
This is a theory for the practice of preaching on Matthew 25:31-46 in the South African .... project of a grounded theory analysis of sermons with this text as sermon ..... Nijkerk: Callenbach. ChArmAz, k. 2006. Constructing grounded theory. A practical guide through qualitative analysis. London: Sage. ComBrinCk, h.J.B.. 1987.
Numerical Simulation and Experiment Study on Extrusion of AZ31 Magnesium Alloy Tube
Directory of Open Access Journals (Sweden)
SUN Ying-di
2017-06-01
Full Text Available The extrusion process of typical AZ31 magnesium alloy tube was simulated by using the constitutive model of AZ31 alloys and ALE-based HyperXtrude software. The changes of stress distribution and velocity distribution were analyzed under different conditions, through the adjustment of three structural parameters, including the height, big round corner and gradient of weld chamber. The results show that the pressure near the work zone in the weld chamber decrease with the increase of the height of weld chamber, the maximum value and average value of the pressure in the weld chamber are decreasing with the increase of big round corner of weld chamber, and the pressure in the port holes and weld chamber increases with the increase of the gradient of weld chamber. The minimum variance of metal flow rate is achieved in the height of weld chamber with 16mm, big round corner with 18mm and gradient of weld chamber with 15°. The optimized structure alleviates the issues of stress concentration and non-homogeneous flowing velocity. The final die is proved to be capable of producing the qualified products and the microstructure after extrusion is uniform and fine.
AZ-101 Mixer Pump Test Qualification Test Procedures (QTP)
Energy Technology Data Exchange (ETDEWEB)
THOMAS, W.K.
2000-01-10
Describes the Qualification test procedure for the AZ-101 Mixer Pump Data Acquisition System (DAS). The purpose of this Qualification Test Procedure (QTP) is to confirm that the AZ-101 Mixer Pump System has been properly programmed and hardware configured correctly. This QTP will test the software setpoints for the alarms and also check the wiring configuration from the SIMcart to the HMI. An Acceptance Test Procedure (ATP), similar to this QTP will be performed to test field devices and connections from the field.
AZ91C magnesium alloy modified by Cd
DEFF Research Database (Denmark)
Shabadi, R.; Ambat, Rajan; Dwarakadasa, E.S.
2014-01-01
precipitates to discontinuous β-phase upon the addition of Cd was observed. A marginal increment in mechanical properties was observed. General corrosion behaviour was followed with weight loss measurements, potentiostatic polarisation studies and surface studies in 3.5% sodium chloride solution and 3.......5% sodium chloride with 2% potassium dichromate solution. Cd addition deteriorated the corrosion behaviour of AZ91C. This behaviour was attributed to the formation of chunks of β-phase upon the addition of Cd. AZ91C with refined β-phase distribution, performed rather better in the NaCl solutions....
Thermal analytical investigations of the magnesium alloy AZ91
Directory of Open Access Journals (Sweden)
K.N. Braszczyńska - Malik
2007-04-01
Full Text Available The results of thermal derivative analysis (TDA, differential scanning calorimetric (DSC measurements and microstructure investigations of commercial AZ91 magnesium alloy are presented. The performed examinations allowed to determine the microstructure after solidification process and also precipitation process during continuous heating of supersaturated solid solution. The α-phase and α+γ semi-divorced eutectic were observed in as-cast material, whereas both discontinuous and continuous precipitates of γ phase were revealed after heating supersaturated AZ91 alloy.
Data of evolutionary structure change: 1AZ5A-2IEOA [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1AZ5A-2IEOA 1AZ5 2IEO A A PQFHLWKRPVVTAHIEGQPVEVLLDTGADDSIVTGIELG...PHYTPKIV----GFINTKEYKNVEVEVLGKRIKGTIMTGDTPINIFGRNLLTALGMSLNF PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIE...EMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNVIGRNLLTQIGATLNF EEEEE EEEEEEEE EE EEEEE---- ...e>THR CA 318 2IEO A 2IE
Assessing the ecosystem service potential of Tucson AZ's urban forest
Pavao-Zuckerman, M.
2011-12-01
Urbanization is arguably one of the most dramatic forms of landscape change, and an important anthropogenic influence on the structure and function of ecosystems. Cities have obvious impacts on local ecologies and environments, such as shifts in species diversity and alteration of local microclimates. While scientists are now familiar with many of these localized impacts of urbanization, cities and suburban areas contribute to 10-15 % of surface land cover in the conterminous U.S., pointing to the potential, yet poorly understood, contribution of cities to regional, national, and global carbon (C) and energy budgets. As cities continue to expand urban ecologists place more emphasis on understanding the functions of urban ecosystems and the ecosystem services (e.g. habitat, air, and water quality) that cities provide. While studies demonstrate that the urban environment alters the structure and function of remnant patches of native ecosystems relative to their non-urban counterparts, the ability of restoration, planning, and design to improve the provision of ecosystem services is a new approach within ecology. One strategy involves green urban design, or using ecological principles for planning or reinvigorating certain ecological processes, in cities. Increasing the amount of vegetative cover can reduce this effect by reinforcing ecosystem services in cities, including shading of surfaces, promotion of cooling through evapotranspiration, and the sequestration of atmospheric CO2 in plant tissues and soils. However, the on-the-ground reality of such strategies is relatively unknown. A pilot study is being conducted in Tucson, AZ to investigate the impact of increasing the cover of trees in the urban landscape on local microclimates and the urban heat island. Trees (Velvet Mesquite, Chilean Mesquite, and Desert Willow) were planted in two neighborhoods in Tucson in 1990. We are collecting data during the summer 2011 monsoon (DBH, crown volume, and hemispherical
75 FR 76293 - Radio Broadcasting Services; Peach Springs, AZ
2010-12-08
... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Peach Springs, AZ AGENCY: Federal Communications... CFR Part 73 Radio, Radio broadcasting. 0 As stated in the preamble, the Federal Communications Commission amends 47 CFR part 73 as follows: PART 73--RADIO BROADCAST SERVICES 0 1. The authority citation...
Grain refinement of AZ31 magnesium alloy by electromagnetic ...
Indian Academy of Sciences (India)
cess are discussed; furthermore, effect of holding time on the refinement of AZ31 magnesium alloy was investigated. 2. Experimental. Al4C3 grain refiner was synthesized by powder metallurgy. The raw materials included aluminum powder (99·8% pure,. 50 μm in diameter), graphite powder (99·6% pure, 50 μm in diameter) ...
2010-07-01
... Gulf of Mexico adjacent to Santa Rosa Island, Air Force Proving Ground Command, Eglin Air Force Base... Sound and Gulf of Mexico adjacent to Santa Rosa Island, Air Force Proving Ground Command, Eglin Air... regulations. (1) Experimental test operations will be conducted by the U.S. Air Force within the prohibited...
Bernal Díaz del Castillo en Guatemala
Directory of Open Access Journals (Sweden)
Julio César Pinto Soria
2014-10-01
Full Text Available Este artículo se ocupa de la hasta ahora poco investigada vida de Bernal Díaz del Castillo en Guatemala, país donde escribe la Historia verdadera de la conquista de la Nueva España en la segunda mitad del siglo xvi. La primera parte analiza la crónica, su importancia y principales ediciones críticas. La parte central se dedica a la relación de Bernal Díaz con la historia de Guatemala. Se aborda su comportamiento como encomendero, su vínculo con los indígenas y con el régimen colonial guatemalteco. La última parte profundiza en el cronista, las circunstancias y sus motivos para escribir la crónica, y en el lugar de esta en el imaginario cultural y político de Guatemala. En una posdata se hace referencia crítica a la obra de Christian Duverger (2012 que cuestiona a Bernal Díaz como autor de la crónica. Abstract This article deals with the hitherto scarcely researched life of Bernal Díaz del Castillo in Guatemala, country where he wrote the True History of the Conquest of New Spain in the second half of the 16th century. The first chapter examines the chronicle, its importance and main critical editions. The Bernal Diaz’s relationship with the history of Guatemala is addressed in the main chapter, exploring his behavior as an encomendero, his link with the indigenous people and the Guatemalan colonial regime. The last chapter delves in the chronicler, the circumstances and his motivation for writing the chronicle, as well as its place in the cultural and political imaginary of Guatemala. As a PostScript, a critical reference to the work of Christian Duverger (2012, who questions Bernal Díaz as the author of the chronicle, is presented.
Very high cycle fatigue behaviour of as-extruded AZ31, AZ80, and ZK60 magnesium alloys
Energy Technology Data Exchange (ETDEWEB)
Novy, Frantisek; Skorik, Viktor [Zilina Univ. (Slovakia). Dept. of Materials Engineering; Janecek, Milos [Charles Univ., Prague (Czech Republic). Dept. of Physics of Materials; Mueller, Julia; Wagner, Lothar [Technische Univ. Clausthal, Clausthal-Zellerfeld (Germany). Inst. of Materials Science and Technology
2009-03-15
The very high cycle fatigue properties of extruded AZ31, AZ80, and ZK60 magnesium alloys were investigated. Fatigue tests were performed at ultrasonic cyclic frequency and at a load ratio of R = -1 at ambient temperature using smooth electropolished specimens. Fatigue failures were observed at lifetimes above 10{sup 9} cycles. The fatigue life was found to increase with decreasing stress amplitude. The fracture surfaces and fracture profiles of selected specimens cycled until failure were examined. The purpose of the study was to determine the role of the microstructure on the fatigue crack nucleation and growth. Furthermore, the fatigue properties were discussed on the basis of microstructure and the presence of inclusions which are known as crack initiation sites. In AZ31 and AZ80 alloys only surface-induced fatigue cracks were observed. On the other hand, in the ZK60 alloy both surface- and interior-induced fatigue cracks were observed. Both mechanisms operate in the ZK60 also at a lifetime of around 10{sup 1}0 cycles. Interior-induced fatigue cracks were accompanied by clear fish-eye marks on the fracture surfaces of the ZK60 alloy. (orig.)
Effect of fiber laser parameters on laser welded AZ31B Magnesium alloys
Directory of Open Access Journals (Sweden)
Mat Salleh Naqiuddin
2017-01-01
Full Text Available Recently, the usage of Magnesium (Mg alloys has been hugely applied in the industrial application such as in automotive, marine, and electronic due to its advantages of recyclability and lightweight. This alloys required low heat input to be weld since it is easily evaporated due to the Magnesium Oxide (MgO at the surface and it also possesses lower melting point compared to steel. Laser welding is more convenient to weld Mg alloys due to its high power and lower heat input. AZ31B was selected since it has strong mechanical properties among others Mg alloys due to the major alloying elements; Aluminium (Al and Zinc (Zn. Low power fiber laser machine with wavelength of 900 nm was used in this experiment. The intention of this work was to investigate the effect of low power fiber laser parameters and effect of shielding gas on weld penetration and microstructure. Another aim in this work was to produce the joint for this thin sheets metal. Penetration depth and microstructure evaluation were emphasized in the analysis section. Bead-on-Plate (BOP and laser lap welding was conducted on AZ31B with thicknesses of 1.0 mm and 0.6 mm for feasibility study using pulsed wave (PW mode. Defocusing features was used in order to find better focal position, which has less occurrence of evaporation (underfill. The effect of different angle of irradiation was also investigated. Two types of shielding gases, Argon (Ar and Nitrogen (N2 were used in order to study the effect of shielding gas. Lastly, the effect of pulsed energy on penetration types and depth of BOP welded samples was investigated. Focus point was found at focal length of 156 mm with 393.75 μm. For BOP experiment, higher pulsed energy used contributes to melt through defect. Meanwhile, Ns shielding gas proved to be better shielding gas in laser welding the AZ31B. Higher angle of irradiation could reduce the underfill defect. Fillet Lap joint of similar metal was successfully done where 2.0 J of
Information Management for Installation Restoration with Focus on Aberdeen Proving Ground, Maryland
1993-08-01
would be identi- fied as an error during the data QA check. On the other hand, a typographi - cal error such as entering ൜" instead of 薘" ft for...input. This menu -driven, interacting program checks data as they are entered for compati- bility with the IRDMIS system. This is the same program used by...generated from reports written from IRDMIS. Standard reports exist in the IRDMIS IR menu , but tailored reports can also be written, as discussed in Part
An Archeological Overview and Management Plan for the Dugway Proving Ground.
1984-03-29
kangaroo rats, gophers, and other rodents. Rodent species composition varies between plant communities (Vest 1962), but carnivores and omnivores range more...conducted in the fall and winter, when the fur and meat was at prime. Gophers, an abundant source of food, were trapped or flooded out of their holes...sometimes located in the center with a smokehole at the top. Household goods consisted of mano and metates used for grinding seeds, insects, meat
Historic American Landscapes Survey: Arco Naval Proving Ground (Idaho National Laboratory)
Energy Technology Data Exchange (ETDEWEB)
Olson, Christina [Idaho National Lab. (INL), Idaho Falls, ID (United States); Holmer, Marie [Idaho National Lab. (INL), Idaho Falls, ID (United States); Gilbert, Hollie [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2015-07-01
Based on historical evaluations in 1993 and 1997, historians determined that the then-remaining Arco NPG structures were significant to the nation’s history through their association with World War II . Through ensuing discussions with the SHPO, it was further determined that the infrastructure and associated landscape were also significant. According to provisions of INL’s Cultural Resource Management Plan (CRMP) as legitimized through a 2004 Programmatic Agreement between DOE-ID, the Idaho State Historic Preservation Office (SHPO), and Advisory Council on Historic Preservation (ACHP) historians identified the World War II structures as DOE “Signature Properties”. As defined by DOE-HQ, Signature Properties “denote its [DOE’s] most historically important properties across the complex…and/or those properties that are viewed as having tourism potential.” The INL is a secure site and the INL land and structures are not accessible to the public and, therefore have no “tourism potential”. Although DOE-ID actively sought other uses for the vacant, unused buildings, none were identified and the buildings present safety and health concerns. A condition assessment found lead based paint, asbestos, rodent infestation/droppings, small animal carcasses, mold, and, in CF-633, areas of radiological contamination. In early 2013, DOE-ID notified the Idaho SHPO, ACHP, and, as required by the INL CRMP and PA, DOE-Headquarters Federal Preservation Officer, of their intent to demolish the vacant buildings (CF-606, CF-607, CF-613, CF-632, and CF-633). The proposed “end-state” of the buildings will be either grass and/or gravel pads. Through the NHPA Section 106 consultation process, measures to mitigate the adverse impacts of demolition were determined and agreed to through a Memorandum of Agreement (MOA) between DOE-ID, SHPO, and ACHP. The measures include the development and installation of interpretive signs to be placed at a publicly accessible location, retention of original components of CF-633, and completion of this HALS standard format report. Buildings, infrastructure, and features that are not scheduled for removal are documented here as well as properties that are scheduled for removal and the overall Arco NPG landscape. The Arco NPG, located in the remote high-desert of eastern Idaho aided in the defense and eventual ally victory in the Pacific Theater of World War II, in addition to revising national standards for the safe storage and transport of conventional ordnance.
Energy Technology Data Exchange (ETDEWEB)
Kuperman, R.G.
1995-12-31
Despite the expansion of environmental toxicology studies over the past decade, soil ecosystems have largely been ignored in ecotoxicological studies in the United States. The objective of this project was to develop and test the efficacy of a comprehensive methodology for assessing ecological impacts of soil contamination. A hierarchical approach that integrates biotic parameters and ecosystem processes was used to give insight into the mechanisms that lead to alterations in the structure and function of soil ecosystems in contaminated areas. This approach involved (1) a thorough survey of the soil biota to determine community structure, (2) laboratory and field tests on critical ecosystem processes, (3) toxicity trials, and (4) the use of spatial analyses to provide input to the decision-making, process. This methodology appears to, offer an efficient and potentially cost-saving tool for remedial investigations of contaminated sites.
Assessment of Aberdeen Proving Ground - Army Contracting Command, Contract Management Processes
2015-04-11
transparency within public administration (Schapper et al., 2006). “ Value for money is the core principle governing public procurement and is supported...2008, p.782). In turn, public entities should strive to achieve the “ value for money ” for the public through use of elements to include customer...achieving value for money and providing the highest quality services and products to the customer (Cavanagh et al., 1999). Weele (2010) conducted a
2015-07-01
three transmitters and 21 receiver loops. The collected data were inverted and analyzed using the UX-Analyze Advanced module in Geosoft Oasis montaj ...on 2,116 targets. The static cued data were processed using Geosoft Oasis montaj software, Advanced UX-Analyze module to extract the three principal...converted to ASCII *.CSV files using Geometrics EM3D data conversion software. Converted data were then imported into Geosoft Oasis montaj for processing
1988-07-01
residue, or a serine, threonine , %r cystidine. We looked at ATP hydrolysis with this and we didn’t gai any advantage. When we restricted it by...chosen, azobenzene is found in literature going back to about the early 1940’s. Azohenzene 92 is essentially nonpolar with no dipole moment in its normal...compatibility, and an azobenzene derived hydroxyMthylaorylamide monomer to give us this photo conformational property. A small amount of monomer with a reactive
Jefferson Proving Ground, South of the Firing Line Health and Safety Plan, Volume 4
National Research Council Canada - National Science Library
1992-01-01
.... The purpose of this Site Health and Safety Plan (SHSP) is to assign SECD personnel health and safety responsibilities, to prescribe mandatory operating procedures, and to establish personal-protective-equipment (PPE...
2015-10-01
walker’s zig zag pattern...............................................................6 Fig. 7 Day 3 walker’s line horizontal pattern...m apart. Fig. 4 Day 3 walker’s heavy right wedge pattern 6 Fig. 5 Day 3 walker’s diamond pattern Fig. 6 Day 3 walker’s zig zag pattern
1952-07-01
ricrocurie of ejvln Sr 9 0 3--e retained in the body). a- PRO=EC 6.3-2 I T-. ii -T -O R I 05 a. 10-6 ISO are reandi tebd) I ii 26 I’~~lawI~ JioJE-T 6.3-2 was...Contaminated Water: Suspended Turbidity 1.7 4 x 10-2 38500 Disuolved 0.85 x 10-2 18820 Total 2.59 x 10-2 57320 After Slurrying with Pow- 0.86 x 10-2 19100... 38500 (suspended turbidity from laboratory f il- tration) 30.75 " " 32870 45.20 M 27036 69.75 " 19630 6.62 Contaminated water 18820 (filtrate from
2013-03-01
control using a CMG array is prone to geometric singularities. Singularities are commonly avoided by limiting a vehicle’s performance via limitation of the...ball bearings, tolerancing and fitting, materials, or balancing. For help in these areas, where I had only general knowledge, we looked to experts
Dugway Proving Ground: Closure Plan Module 2, for SWMUs 20, 164, 166 and 170
1997-07-01
PAGE wApme Pubiner soll Moo"" NtIso doem~ me soW N mq Va S amoay uaggm 8=0 "porn soV b~ Someo a a" motra~ioofso -.,,d I, bi~mn bainowi amemminea fr...cross the placenta and accumulate in the amniotic fluid (Danielsson and others, 1986). Associated developmental effects of high doses of chloroform in...inhalation exposure to chromium (VI) compounds. Other effects observed following chromium (VI) exposure include effects on the immune system, nervous
The Corrosion Protection of Magnesium Alloy AZ31B
Danford, M. D.; Mendrek, M. J.; Mitchell, M. L.; Torres, P. D.
1997-01-01
Corrosion rates for bare and coated Magnesium alloy AZ31B have been measured. Two coatings, Dow-23(Trademark) and Tagnite(Trademark), have been tested by electrochemical methods and their effectiveness determined. Electrochemical methods employed were the scanning reference electrode technique (SRET), the polarization resistance technique (PR) and the electrochemical impedance spectroscopy technique (EIS). In addition, general corrosion and stress corrosion methods were employed to examine the effectiveness of the above coatings in 90 percent humidity. Results from these studies are presented.
Histone variant H2A.Z.2 mediates proliferation and drug sensitivity of malignant melanoma
Vardabasso, Chiara; Gaspar-Maia, Alexandre; Hasson, Dan; Pünzeler, Sebastian; Valle-Garcia, David; Straub, Tobias; Keilhauer, Eva C.; Strub, Thomas; Dong, Joanna; Panda, Taniya; Chung, Chi-Yeh; Yao, Jonathan L.; Singh, Rajendra; Segura, Miguel F.; Fontanals-Cirera, Barbara; Verma, Amit; Mann, Matthias; Hernando, Eva; Hake, Sandra B.; Bernstein, Emily
2015-01-01
SUMMARY Histone variants are emerging as key regulatory molecules in cancer. Here we report a novel role for the H2A.Z isoform H2A.Z.2 as a driver of malignant melanoma. H2A.Z.2 is highly expressed in metastatic melanoma, correlates with decreased patient survival, and is required for cellular proliferation. Our integrated genomic analyses reveal that H2A.Z.2 controls the transcriptional output of E2F target genes in melanoma cells. These genes are highly expressed and display a distinct signature of H2A.Z occupancy. We identify BRD2 as an H2A.Z interacting protein, whose levels are also elevated in melanoma. We further demonstrate that H2A.Z.2 regulated genes are bound by BRD2 and E2F1 in a H2A.Z.2-dependent manner. Importantly, H2A.Z.2 deficiency sensitizes melanoma cells to chemotherapy and targeted therapies. Collectively, our findings implicate H2A.Z.2 as a mediator of cell proliferation and drug sensitivity in malignant melanoma, holding translational potential for novel therapeutic strategies. PMID:26051178
25 CFR 11.702 - Proving and admitting will.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Proving and admitting will. 11.702 Section 11.702 Indians... ORDER CODE Probate Proceedings § 11.702 Proving and admitting will. (a) Upon initiating the probate of an estate, the will of the decedent shall be filed with the court. Such will may be proven and...
Reasoning and Proving Opportunities in Textbooks: A Comparative Analysis
Hong, Dae S.; Choi, Kyong Mi
2018-01-01
In this study, we analyzed and compared reasoning and proving opportunities in geometry lessons from American standard-based textbooks and Korean textbooks to understand how these textbooks provide student opportunities to engage in reasoning and proving activities. Overall, around 40% of exercise problems in Core Plus Mathematics Project (CPMP)…
The Earth is Flat, and I Can Prove It!
Klinger, Art
1998-01-01
Describes an educational program that asks students to attempt to prove that the earth is spherical and that it rotates. Presents tips to pique student interest and charts related to sensing the spin, nonrotation notions, flat earth fallacies, evidence that the earth is spherical and rotates, and the role of watersheds in proving that the earth…
20 CFR 219.23 - Evidence to prove death.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Evidence to prove death. 219.23 Section 219... EVIDENCE REQUIRED FOR PAYMENT Evidence of Age and Death § 219.23 Evidence to prove death. (a) Preferred evidence of death. The best evidence of a person's death is— (1) A certified copy of or extract from the...
Energy Technology Data Exchange (ETDEWEB)
Rojaee, Ramin, E-mail: raminrojaee@aim.com [Biomaterials Research Group, Department of Materials Engineering, Isfahan University of Technology, Isfahan, 84156-83111 (Iran, Islamic Republic of); Fathi, Mohammadhossein [Biomaterials Research Group, Department of Materials Engineering, Isfahan University of Technology, Isfahan, 84156-83111 (Iran, Islamic Republic of); Dental Materials Research Center, Isfahan University of Medical Sciences, Isfahan (Iran, Islamic Republic of); Raeissi, Keyvan [Department of Materials Engineering, Isfahan University of Technology, Isfahan, 84156-83111 (Iran, Islamic Republic of)
2013-10-15
Magnesium (Mg) alloys have been introduced as new generation of biodegradable orthopedic materials in recent years since it has been proved that Mg is one of the main minerals required for osseous tissue revival. The main goal of the present study was to establish a desired harmony between the necessities of orthopedic patient body to Mg{sup 2+} ions and degradation rate of the Mg based implants as a new class of biodegradable/bioresorbable materials. This prospect was followed by providing a sol–gel derived nanostructured hydroxyapatite (n-HAp) coating on AZ91 alloy using dip coating technique. Phase structural analysis, morphology study, microstructure characterization, and functional group identification were performed using X-ray diffraction (XRD), Fourier transform infrared (FTIR), scanning electron microscopy (SEM), and transmission electron microscopy (TEM) techniques. The prepared samples were immersed in simulated body fluid in order to study the formation of apatite-like precipitations, barricade properties of the n-HAp coating, and to estimate the dosage of released Mg{sup 2+} ions within a specified and limited time of implantation. Electrochemical polarization tests were carried out to evaluate and compare the corrosion behavior of the n-HAp coated and uncoated samples. The changes of the in vitro pH values were also evaluated. Results posed the noticeable capability of n-HAp coating on stabilizing alkalization behavior and improving the corrosion resistance of AZ91 alloy. It was concluded that n-HAp coated AZ91 alloy could be a good candidate as a type of biodegradable implant material for biomedical applications. - Highlights: • Nanostructured hydroxyapatite coatings were applied on Mg based alloy. • The whole corrosion process of Mg based alloy was controlled in body fluid. • This coating was able to act as a barrier against further release of Mg{sup 2+} ions. • The coating improved the stabilization of Mg alkalization behavior.
Reorganization of Damaged Chromatin by the Exchange of Histone Variant H2A.Z-2
Energy Technology Data Exchange (ETDEWEB)
Nishibuchi, Ikuno [Department of Cellular Biology, Research Institute for Radiation Biology and Medicine, Hiroshima University, Hiroshima (Japan); Department of Radiation Oncology, Graduate School of Biomedical and Health Sciences, Hiroshima University, Hiroshima (Japan); Department of Radiation Oncology, Hiroshima Prefectural Hospital, Hiroshima (Japan); Suzuki, Hidekazu; Kinomura, Aiko; Sun, Jiying; Liu, Ning-Ang [Department of Cellular Biology, Research Institute for Radiation Biology and Medicine, Hiroshima University, Hiroshima (Japan); Horikoshi, Yasunori [Department of Cellular Biology, Research Institute for Radiation Biology and Medicine, Hiroshima University, Hiroshima (Japan); Research Center for Mathematics of Chromatin Live Dynamics, Hiroshima University, Hiroshima (Japan); Shima, Hiroki [Department of Biochemistry, Graduate School of Medical Sciences, Tohoku University, Sendai (Japan); Kusakabe, Masayuki; Harata, Masahiko [Laboratory of Molecular Biology, Graduate School of Agricultural Science, Tohoku University, Sendai (Japan); Fukagawa, Tatsuo [Department of Molecular Genetics, National Institute of Genetics and The Graduate University for Advanced Studies, Mishima (Japan); Ikura, Tsuyoshi [Laboratory of Chromatin Regulatory Network, Department of Mutagenesis, Radiation Biology Center, Kyoto University, Kyoto (Japan); Ishida, Takafumi [Department of Cardiovascular Medicine, Graduate School of Biomedical and Health Sciences, Hiroshima University, Hiroshima (Japan); Nagata, Yasushi [Department of Radiation Oncology, Graduate School of Biomedical and Health Sciences, Hiroshima University, Hiroshima (Japan); Tashiro, Satoshi, E-mail: ktashiro@hiroshima-u.ac.jp [Department of Cellular Biology, Research Institute for Radiation Biology and Medicine, Hiroshima University, Hiroshima (Japan); Research Center for Mathematics of Chromatin Live Dynamics, Hiroshima University, Hiroshima (Japan)
2014-07-15
Purpose: The reorganization of damaged chromatin plays an important role in the regulation of the DNA damage response. A recent study revealed the presence of 2 vertebrate H2A.Z isoforms, H2A.Z-1 and H2A.Z-2. However, the roles of the vertebrate H2A.Z isoforms are still unclear. Thus, in this study we examined the roles of the vertebrate H2A.Z isoforms in chromatin reorganization after the induction of DNA double-strand breaks (DSBs). Methods and Materials: To examine the dynamics of H2A.Z isoforms at damaged sites, we constructed GM0637 cells stably expressing each of the green fluorescent protein (GFP)-labeled H2A.Z isoforms, and performed fluorescence recovery after photobleaching (FRAP) analysis and inverted FRAP analysis in combination with microirradiation. Immunofluorescence staining using an anti-RAD51 antibody was performed to study the kinetics of RAD51 foci formation after 2-Gy irradiation of wild-type (WT), H2A.Z-1- and H2A.Z-2-deficient DT40 cells. Colony-forming assays were also performed to compare the survival rates of WT, H2A.Z-1-, and H2A.Z-2-deficient DT40 cells with control, and H2A.Z-1- and H2A.Z-2-depleted U2OS cells after irradiation. Results: FRAP analysis revealed that H2A.Z-2 was incorporated into damaged chromatin just after the induction of DSBs, whereas H2A.Z-1 remained essentially unchanged. Inverted FRAP analysis showed that H2A.Z-2 was released from damaged chromatin. These findings indicated that H2A.Z-2 was exchanged at DSB sites immediately after the induction of DSBs. RAD51 focus formation after ionizing irradiation was disturbed in H2A.Z-2-deficient DT40 cells but not in H2A.Z-1-deficient cells. The survival rate of H2A.Z-2-deficient cells after irradiation was lower than those of WT and H2A.Z-1- DT40 cells. Similar to DT40 cells, H2A.Z-2-depleted U2OS cells were also radiation-sensitive compared to control and H2A.Z-1-depleted cells. Conclusions: We found that vertebrate H2A.Z-2 is involved in the regulation of the DNA
Directory of Open Access Journals (Sweden)
J. Jayakumar
2013-01-01
Full Text Available Multiwall carbon nanotubes (MWCNTs reinforced Mg alloy AZ31 nanocomposites were fabricated by mechanical alloying and powder metallurgy technique. The reinforcement material MWCNTs were blended in three weight fractions (0.33%, 0.66%, and 1% with the matrix material AZ31 (Al-3%, zinc-1% rest Mg and blended through mechanical alloying using a high energy planetary ball mill. Specimens of monolithic AZ31 and AZ31-MWCNT composites were fabricated through powder metallurgy technique. The microstructure, density, hardness, porosity, ductility, and tensile properties of monolithic AZ31 and AZ31-MWCNT nano composites were characterized and compared. The characterization reveals significant reduction in CNT (carbon nanoTube agglomeration and enhancement in microstructure and mechanical properties due to mechanical alloying through ball milling.
241-AZ Tank Farm Construction Extent of Condition Review for Tank Integrity
Energy Technology Data Exchange (ETDEWEB)
Barnes, Travis J.; Boomer, Kayle D.; Gunter, Jason R.; Venetz, Theodore J.
2013-07-30
This report provides the results of an extent of condition construction history review for tanks 241-AZ-101 and 241-AZ-102. The construction history of the 241-AZ tank farm has been reviewed to identify issues similar to those experienced during tank AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank AY-102 as the comparison benchmark. In the 241-AZ tank farm, the second DST farm constructed, both refractory quality and tank and liner fabrication were improved.
Directory of Open Access Journals (Sweden)
Yan Li
2017-04-01
Full Text Available A bimetal composite of 2205 duplex stainless steel and AZ31B magnesium alloy was cladded successfully through the method of explosive welding. The microstructural characteristics and mechanical properties of 2205/AZ31B bimetal composite are discussed. The interface of 2205/AZ31B bimetallic composite was a less regular wavy morphology with locally melted pockets. Adiabatic shear bands occurred only in the AZ31B side near explosive welding interface. The microstructure observed with EBSD showed a strong refinement near the interface zones. Line scan confirmed that the interface had a short element diffusion zone which would contribute to the metallurgical bonding between 2205 duplex stainless steel and AZ31B magnesium alloy. The value of micro-hardness near the bonding interface of composite plate increased because of work hardening and grain refinement. The tensile shear strength of bonding interface of 2205/AZ31B composite was 105.63 MPa. Tensile strength of 2205/AZ31B composite material was higher than the base AZ31B. There were two abrupt drops in stress in the stress–strain curves of the 2205/AZ31B composite materials.
Electrochemical characteristics of calcium-phosphatized AZ31 magnesium alloy in 0.9 % NaCl solution.
Hadzima, Branislav; Mhaede, Mansour; Pastorek, Filip
2014-05-01
Magnesium alloys suffer from their high reactivity in common environments. Protective layers are widely created on the surface of magnesium alloys to improve their corrosion resistance. This article evaluates the influence of a calcium-phosphate layer on the electrochemical characteristics of AZ31 magnesium alloy in 0.9 % NaCl solution. The calcium phosphate (CaP) layer was electrochemically deposited in a solution containing 0.1 M Ca(NO3)2, 0.06 M NH4H2PO4 and 10 ml l(-1) of H2O2. The formed surface layer was composed mainly of brushite [(dicalcium phosphate dihidrate (DCPD)] as proved by energy-dispersive X-ray analysis. The surface morphology was observed by scanning electron microscopy. Immersion test was performed in order to observe degradation of the calcium phosphatized surfaces. The influence of the phosphate layer on the electrochemical characteristics of AZ31, in 0.9 % NaCl solution, was evaluated by potentiodynamic measurements and electrochemical impedance spectroscopy. The obtained results were analysed by the Tafel-extrapolation method and equivalent circuits method. The results showed that the polarization resistance of the DCPD-coated surface is about 25 times higher than that of non-coated surface. The CaP electro-deposition process increased the activation energy of corrosion process.
New Az/El mount for Haystack Observatory's Small Radio Telescope kit
Cobb, M. L.
2005-12-01
The Small Radio Telescope (SRT) kit was designed by Haystack Observatory as part of their educational outreach effort. The SRT uses a custom designed FFT based radio spectrometer receiver with a controller to position a 2.3m dish to make various radio astronomy observations including the 21 cm spin flip line of atomic hydrogen. Because there is no sizable commercial market for a two dimensional mount for dishes of this size, finding an appropriate provider as been a recurring problem for the project. Originally, the kit used a modified motor mount from Kaultronics called the H180. Two of these motors were combined by a specially designed adaptor to allow motion in azimuth and elevation. When Kaultronics was bought out by California Amplifier they discontinued production of the H180. The next iteration used a compact unit called the alfa-spid which was made in Germany and imported through Canada. The alfa-spid was designed to point various ham radio antennas and proved problematic with 2.3m dishes. Most recently the CASSI (Custom Astronomical Support Services, Inc.) corporation has designed and certified a robust Az/El mount capable of supporting dishes up to 12 feet (3.6m) with 100 MPH wind loads. This paper presents the design and operating characteristics of the new CASSI mount. The CASSI mount is now shipped with the SRT kit and should serve the project well for the foreseeable future.
Ziyaei, E.; Atapour, M.; Edris, H.; Hakimizad, A.
2017-07-01
The PEO coating started on magnesium AZ31 using a unipolar DC power source. The coating was generated in the electrolyte based on Na3PO4·12H2O and KOH with calcium acetate as additive. The x-ray diffraction method showed some phases containing calcium and phosphate, which was created in the presence of additive. Also, the EDS tests of the sample's surfaces proved the existence of calcium on the surface. Based on the electrochemical tests results, the most corrosion resistance belongs to the sample with calcium acetate additive. In fact, the results of the EIS tests showed the coating with calcium acetate has the highest resistance but the lowest capacitance. However, this state belongs to the surface morphology, the lower porosity, and surface chemical composition.
Mitev, Ariel Zoltán
2012-01-01
A grounded theory olyan kutatási módszer, ahol az elmélet az empirikus adatokból fejlődik ki és abban gyökerezik (Glaser - Strauss, 1967). Annak ellenére, hogy a módszer nemzetközileg rendkívül népszerű, a grounded theory nem igazán vert gyökeret a hazai menedzsment- és marketingkutatás talajában. A cikk célja a grounded theory kulcsfontosságú mozzanatainak bemutatása és a módszer népszerűsítése. / === / Grounded theory is a research method in which theory emerges from the data and is grounde...
PROVE Surface albedo of Jornada Experimental Range, New Mexico, 1997
National Aeronautics and Space Administration — The objective of this study was to determine the spatial variations in field measurements of broadband albedo as related to the ground cover and under a range of...
PROVE Surface albedo of Jornada Experimental Range, New Mexico, 1997
National Aeronautics and Space Administration — ABSTRACT: The objective of this study was to determine the spatial variations in field measurements of broadband albedo as related to the ground cover and under a...
Fabrication of bimodal size SiCp reinforced AZ31B magnesium matrix composites
Energy Technology Data Exchange (ETDEWEB)
Shen, M.J., E-mail: smjiekaka@163.com [School of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China); Wang, X.J., E-mail: xjwang@hit.edu.cn [School of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China); Zhang, M.F. [Hisense Ronshen Co., Ltd., Yingkou 115000 (China); Hu, X.S.; Zheng, M.Y.; Wu, K. [School of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China)
2014-04-01
Bimodal sized (Micro-particles: m and Nano-particles: n) SiC particulates (SiCp) reinforced magnesium matrix composites with different volume fractions of micro-particles (1n+4p, 1n+9p and 1n+14p) were prepared by a semisolid stirring assisted ultrasonic vibration method. Both the as-cast SiCp/AZ31B composites and the AZ31B alloy were extruded at 350 °C with the extrusion ratio of 12:1 at a constant ram speed of 15 mm/s. The microstructure investigation was carried out by optical microscope (OM), scanning electron microscope (SEM) and transmission electron microscopy (TEM). The results show that the distribution of bimodal size SiCp and the mechanical properties of the AZ31B alloy were significantly improved after hot extrusion. When the volume fraction of nano SiCp is 1 vol%, both the yield strength and ultimate tensile strength of the AZ31B/SiC/1n+14p composite are stronger than that of the AZ31B/SiC/1n+4p and AZ31B/SiC/1n+9p composites, while the elongation to fracture was decreased comparing with the AZ31B/SiC/1n+4p and AZ31B/SiC/1n+9p composites.
Data of evolutionary structure change: 1B99C-2AZ1D [Confc[Archive
Lifescience Database Archive (English)
Full Text Available GSDS--VESAN >E --HHHHH> ATOM 316...>D 2AZ1D HGSDHEDEGANE >E HHH...pdbID>1B99 C 1B99C EELLT-EVKPN ...> - > ATOM 3319 CA GLU C 141 17.330 5.755...DChain>2AZ1D DELVDWDRDAS re>GG EEGGHcture
Data of evolutionary structure change: 1JH5I-2AZ5A [Confc[Archive
Lifescience Database Archive (English)
Full Text Available ID> I 1JH5I LYTDK-----TYAMG ...>EE -----EEEEE> ATOM 9622 CA LEU I 59 -64.244 97.997...ain> 2AZ5A LFKGQGCPSTHVLLT >EEEE EE... 2AZ5A IAVSY----QTKVN ...>E ---- EEE > ATOM 526 CA ILE A 83 -19.844 60.232 51
Genome Sequence of the Acidophilic Bacterium Acidocella sp. Strain MX-AZ02
DEFF Research Database (Denmark)
Servín-Garcidueñas, Luis E.; Garrett, Roger A.; Amils, Ricardo
2013-01-01
Here, we report the draft genome sequence of Acidocella sp. strain MX-AZ02, an acidophilic and heterotrophic alphaproteobacterium isolated from a geothermal lake in western Mexico.......Here, we report the draft genome sequence of Acidocella sp. strain MX-AZ02, an acidophilic and heterotrophic alphaproteobacterium isolated from a geothermal lake in western Mexico....
Lodox Statscan proves to be invaluable in forensic medicine ...
African Journals Online (AJOL)
Lodox Statscan proves to be invaluable in forensic medicine: forensic files. GJ Knobel, G Flash, GF Bowie. Abstract. No Abstract. South African Medical Journal Vol. 96(7) 2006: 593-594. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals ...
Conditional and preferential logics proof methods and theorem proving
Pozzato, GL
2010-01-01
Contains a version of the author's PhD dissertation and focuses on proof methods and theorem proving for conditional and preferential logics. This book introduces proof methods (sequent and tableau calculi) for conditional and preferential logics, as well as theorem provers obtained by implementing the proposed calculi.
Proving the correctness of client/server software
Indian Academy of Sciences (India)
, formal specification and verification of RPC mechanisms is a prerequisite for the verification of any such software. In this paper, we present a mathematical specification of an RPC mechanism and we outline how to prove the correctness of an ...
Overcoming the Obstacle of Poor Knowledge in Proving Geometry Tasks
Directory of Open Access Journals (Sweden)
Zlatan Magajna
2013-12-01
Full Text Available Proving in school geometry is not just about validating the truth of a claim. In the school setting, the main function of the proof is to convince someone that a claim is true by providing an explanation. Students consider proving to be difficult; in fact, they find the very concept of proof demanding. Proving a claim in planar geometry involves several processes, the most salient being visual observation and deductive argumentation. These two processes are interwoven, but often poor observation hinders deductive argumentation. In the present article, we consider the possibility of overcoming the obstacle of a student’s poor observation by making use of computer-aided observation with appropriate software. We present the results of two small-scale research projects, both of which indicate that students are able to work out considerably more deductions if computer-aided observation is used. Not all students use computer-aided observation effectively in proving tasks: some find an exhaustive computer-provided list of properties confusing and are not able to choose the properties that are relevant to the task.
Engaging Students in Proving: A Double Bind on the Teacher.
Herbst, Patricio G.
2002-01-01
Explores what is involved in the teacher's work of engaging students in producing a proof. Analyzes what teachers do to create a task in which students can produce a proof and what teachers do to get students to prove a proposition. Indicates that traditional, formal, two-column proofs place contradictory demands on teachers regarding how ideas…
Proof phenomenon as a function of the phenomenology of proving.
Hipólito, Inês
2015-12-01
Kurt Gödel wrote (1964, p. 272), after he had read Husserl, that the notion of objectivity raises a question: "the question of the objective existence of the objects of mathematical intuition (which, incidentally, is an exact replica of the question of the objective existence of the outer world)". This "exact replica" brings to mind the close analogy Husserl saw between our intuition of essences in Wesensschau and of physical objects in perception. What is it like to experience a mathematical proving process? What is the ontological status of a mathematical proof? Can computer assisted provers output a proof? Taking a naturalized world account, I will assess the relationship between mathematics, the physical world and consciousness by introducing a significant conceptual distinction between proving and proof. I will propose that proving is a phenomenological conscious experience. This experience involves a combination of what Kurt Gödel called intuition, and what Husserl called intentionality. In contrast, proof is a function of that process - the mathematical phenomenon - that objectively self-presents a property in the world, and that results from a spatiotemporal unity being subject to the exact laws of nature. In this essay, I apply phenomenology to mathematical proving as a performance of consciousness, that is, a lived experience expressed and formalized in language, in which there is the possibility of formulating intersubjectively shareable meanings. Copyright © 2015. Published by Elsevier Ltd.
Feedback theory extended for proving generation of contraction semigroups
Kurula, Mikael; Zwart, Hans
2016-01-01
Recently, the following novel method for proving the existence of solutions for certain linear time-invariant PDEs was introduced: The operator associated with a given PDE is represented by a (larger) operator with an internal loop. If the larger operator (without the internal loop) generates a
Prove It! Putting Together the Evidence-Based Practice Puzzle
Little, Hannah Byrd
2015-01-01
Why is it important to prove that school libraries add value to the school program? The National Center for Education Statistics reports that 20 percent of U.S. public schools lack a full or part-time certified librarian (NCES 2013). In California the ratio of certified school librarians to students is 1:7,374 (California Department of Education…
Energy Technology Data Exchange (ETDEWEB)
Schaefer, F. (ed.); Basshuysen, R. van
2004-04-01
This dictionary describes current engine technology and gives an outlook to the future. Cross-references, broader and narrower terms ensure optimal user guidance. Entries do not stand alone but provide content-oriented information. About 4,500 terms are included from A-Z, providing an outline of subjects like exhaust systems, acoustics, supercharging, combustion chamber, injection systems, control, flame propagation, mixing, catalytic converters, pistons, fuels, cooling, crank casing, stratified charging, lambda control, camshaft, oil, particulate filters, sensors/actuators, pollutants, valves, combustion processes, efficiency, ignition, cylinder head. The dictionary is for development engineers in the motor car industry, in component and system development in the supply industry, university teachers and students, foremen in motor car repair shops, etc. (orig.) [German] Das Lexikon Motorentechnik ist ein Nachschlagewerk, das die aktuelle Motorentechnik umfassend beschreibt und Ausblicke in der Zukunft ermoeglicht. Das ausgefeilte System aus Querverweisen fuehrt alle Unterbegriffe zum Hauptbegriff und ermoeglicht so eine optimale Benutzerfuehrung. Dadurch stehen die Stichwoerter nicht isoliert, sondern es werden inhaltlich zusammenhaengende Betrachtungen moeglich. Der Inhalt umfasst 4 500 Begriffe von A-Z wie z.B.: Abgastechnik, Akustik, Aufladung, Brennraum, Einspritzsysteme, Elektronische Motorsteuerung, Flammenausbreitung, Gemischbildung, Katalysator, Kolben, Kraftstoff, Kuehlung, Kurbelgehaeuse, Kurbeltrieb, Ladungswechsel, Lambda-Regelung, Nockenwelle, Oel, Partikelfilter, Sensoren/Aktuatoren, Schadstoffe, Ventiltrieb, Verbrennungsverfahren, Wirkungsgrad, Zuendung, Zylinderkopf. Die Zielgruppen waeren Ingenieure in Motoren- und Fahrzeugentwicklung der Automobilindustrie, Ingenieure in der Komponenten- und Systementwicklung der Zuliefererindustrie, Professoren und Studenten an Hochschulen mit Schwerpunkt Kraftfahrzeugtechnik, Meister in Kfz-Werkstaetten. (orig.)
Pengembangan Perangkat Pembelajaran Geometri Ruang dengan Model Proving Theorem
Directory of Open Access Journals (Sweden)
Bambang Eko Susilo
2016-03-01
Full Text Available Kemampuan berpikir kritis dan kreatif mahasiswa masih lemah. Hal ini ditemukan pada mahasiswa yang mengambil mata kuliah Geometri Ruang yaitu dalam membuktikan soal-soal pembuktian (problem to proof. Mahasiswa masih menyelesaikan secara algoritmik atau prosedural sehingga diperlukan pengembangan perangkat pembelajaran Geometri Ruang berbasis kompetensi dan konservasi dengan model Proving Theorem. Dalam penelitian ini perangkat perkuliahan yang dikembangkan yaitu Silabus, Satuan Acara Perkuliahan (SAP, Kontrak Perkuliahan, Media Pembelajaran, Bahan Ajar, Tes UTS dan UAS serta Angket Karakter Konservasi telah dilaksanakan dengan baik dengan kriteria (1 validasi perangkat pembelajaran mata kuliah Geometri ruang berbasis kompetensi dan konservasi dengan model proving theorem berkategori baik dan layak digunakan dan (2 keterlaksanaan RPP pada pembelajaran yang dikembangkan secara keseluruhan berkategori baik.Critical and creative thinking abilities of students still weak. It is found in students who take Space Geometry subjects that is in solving problems to to prove. Students still finish in algorithmic or procedural so that the required the development of Space Geometry learning tools based on competency and conservation with Proving Theorem models. This is a research development which refers to the 4-D models that have been modified for the Space Geometry learning tools, second semester academic year 2014/2015. Instruments used include validation sheet, learning tools and character assessment questionnaire. In this research, the learning tools are developed, namely Syllabus, Lesson Plan, Lecture Contract, Learning Media, Teaching Material, Tests, and Character Conservation Questionnaire had been properly implemented with the criteria (1 validation of Space Geometry learning tools based on competency and conservation with Proving Theorem models categorized good and feasible to use, and (2 the implementation of Lesson Plan on learning categorized
Directory of Open Access Journals (Sweden)
Jian Zou
2017-01-01
Full Text Available In recent years, more and more methods have been developed to improve the bioactivity of the biodegradable materials in bone tissue regeneration. In present study, we used rat mesenchymal stem cells (rMSCs to evaluate the outcomes of Mg alloys (AZ31B, Magnesium, and Aluminum and Platelet-rich plasma (PRP/Mg alloys on rMSCs biocompatibility and osteogenic differentiation. Water absorption experiments indicated that both bare AZ31B and PRP/AZ31B were capable of absorbing large amounts of water. But the water absorption ratio for PRP/AZ31B was significantly higher than that for bare AZ31B. The degradability experiments implied that both samples degraded at same speed. rMSCs on the surface of AZ31B distributed more and better than those on the AZ31B scaffold. In ALP activity experiment, the activity of rMSCs on the PRP/AZ31B was markedly higher than that on the AZ31B scaffolds on the 7th day and 14th day. qRT-PCR also showed that OPN and OCN were expressed in both samples. OPN and OCN expression in PRP/AZ31B sample were higher than those in bare AZ31B samples. In summary, the in vitro study implied that AZ31B combined with PRP could remarkably improve cell seeding, attachment, proliferation, and differentiation.
Unicorns do exist: a tutorial on "proving" the null hypothesis.
Streiner, David L
2003-12-01
Introductory statistics classes teach us that we can never prove the null hypothesis; all we can do is reject or fail to reject it. However, there are times when it is necessary to try to prove the nonexistence of a difference between groups. This most often happens within the context of comparing a new treatment against an established one and showing that the new intervention is not inferior to the standard. This article first outlines the logic of "noninferiority" testing by differentiating between the null hypothesis (that which we are trying to nullify) and the "nill" hypothesis (there is no difference), reversing the role of the null and alternate hypotheses, and defining an interval within which groups are said to be equivalent. We then work through an example and show how to calculate sample sizes for noninferiority studies.
On the deformation twinning of Mg AZ31B
DEFF Research Database (Denmark)
Abdolvand, Hamidreza; Majkut, Marta; Oddershede, Jette
2015-01-01
Crystals with a hexagonal close-packed (HCP) structure are inherently anisotropic, and have a limited number of independent slip systems, which leads to strong deformation textures and reduced formability in polycrystalline products. Tension along the c-axis of the crystal ideally activates...... extension twinning as a deformation mode due to the lack of easy-slip systems. In this work, experiments were devised to study extension twinning in a polycrystalline Mg alloy AZ31B with a strong basal rolling texture by tensile deformation parallel to the plate normal. Three-dimensional synchrotron X......-ray diffraction (3DXRD) was used to map the center-of-mass positions, volumes, orientations, elastic strains, and stress tensors of over 1400 grains in-situ up to a true strain of 1.4%. More than 700 tensile twins were observed to form in the mapped volume under deformation. The measured center-of-mass positions...
Electrochemical properties of fine-grained AZ31 magnesium alloy
Energy Technology Data Exchange (ETDEWEB)
Hadzima, Branislav; Bukovina, Michal [Univ. of Zilina (Slovakia). Dept. of Materials Engineering; Janecek, Milos; Kral, Robert [Charles Univ., Dept. of Physics of Materials, Prague (Czech Republic)
2009-09-15
The influence of equal channel angular pressing (ECAP) on the microstructure changes of magnesium alloy AZ31 was investigated. The microstructure changes were correlated with electrochemical characteristics of the surface. Eight passes of ECAP resulted in significant grain refinement (factor 100) of the initial squeeze-cast (SC) alloy. The influence of microstructure changes on electrochemical properties of the surface was evaluated using electrochemical impedance spectroscopy. The variation of electrochemical characteristics of the surface of the SC and ECAP alloy was determined after 3 and 7-day exposure in the corrosion solution of 0.1 M NaCl. The fine-grained deformed structure after ECAP was found to have significantly higher charge transfer resistance as compared to the squeeze-cast material. (orig.)
High speed cutting of AZ31 magnesium alloy
Directory of Open Access Journals (Sweden)
Liwei Lu
2016-06-01
Full Text Available Using LBR-370 numerical control lathe, high speed cutting was applied to AZ31 magnesium alloy. The influence of cutting parameters on microstructure, surface roughness and machining hardening were investigated by using the methods of single factor and orthogonal experiment. The results show that the cutting parameters have an important effect on microstructure, surface roughness and machine hardening. The depth of stress layer, roughness and hardening present a declining tendency with the increase of the cutting speed and also increase with the augment of the cutting depth and feed rate. Moreover, we established a prediction model of the roughness, which has an important guidance on actual machining process of magnesium alloy.
Zlatanova, Jordanka; Thakar, Amit
2008-02-01
For a couple of decades the chromatin field has endured undeserved neglect. Indeed, what could be so exciting about a monotonous repeating structure whose purpose in life was to package DNA? Chromatin glamour is triumphantly back, due to the realization that chromatin is a major player in the regulation of gene expression and other nuclear processes that occur on the DNA template. The dynamics of the structure that regulates transcription is itself regulated by a variety of complex processes, including histone postsynthetic modifications, chromatin remodeling, and the use of nonallelic histone variants. This review is an attempt to understand the mechanisms of action of the evolutionarily conserved variant H2A.Z, a player with a variety of seemingly unrelated, even contrary, functions. This attempt was prompted by the recent avalanche of genome-wide studies that provide insights that were unthinkable until very recently.
Programming and Proving Correctness of the Scanning Algorithm with Backtrack,
1980-09-19
components A, . A2,...An of the Cartesian product and that all eie- ments of the set A are generated sequentially from them. It is simplest to program how n...the gradual refine- ment of the program and proving its correctness and we do not work towards a meaningful program which will solve a given problem and...Privara, I..- " Teoria a aplikacia formalnej semantiky programovacich jazykov" LThe Theory and Application of ?ormal Semantics in Program- .m~ng
Logic for computer science foundations of automatic theorem proving
Gallier, Jean H
2015-01-01
This advanced text for undergraduate and graduate students introduces mathematical logic with an emphasis on proof theory and procedures for algorithmic construction of formal proofs. The self-contained treatment is also useful for computer scientists and mathematically inclined readers interested in the formalization of proofs and basics of automatic theorem proving. Topics include propositional logic and its resolution, first-order logic, Gentzen's cut elimination theorem and applications, and Gentzen's sharpened Hauptsatz and Herbrand's theorem. Additional subjects include resolution in fir
Harris, Tina
2014-01-01
Grounded theory is a popular research approach in health care and the social sciences. This article provides a description of grounded theory methodology and its key components, using examples from published studies to demonstrate practical application. It aims to demystify grounded theory for novice nurse researchers, by explaining what it is, when to use it, why they would want to use it and how to use it. It should enable nurse researchers to decide if grounded theory is an appropriate app...
Propiedades mecánicas de la aleación AZ31 procesada por una ruta eco-sostenible
Directory of Open Access Journals (Sweden)
D’Errico, F.
2013-12-01
Full Text Available Recently it has been proved that molding of defect-free components of various commercial alloys of magnesium can be carried out succesfully when small amounts of CaO are added to the melt, making unnecessary the use of SF6 coverage. In the case of AZ alloys, this process also remarkably improves their mechanical properties not only by the greater cleaning of alloys but also by the formation of CaAl2 phase. This work, part of the Green project Metallurgy (http://www.green-metallurgy.eu funded by the European Union (LIFE+2009, studies the influence of different CaO additions on the microstructure and mechanical properties of AZ31 Eco-Mg alloy. The alloy was processed by a conventional route involving extrusion of as-cast rods as well as by a powder metallurgy route (PM using chips as starting material. The objective was to analyze the viability of recycling machining chips to manufacture components for the automobile industry and transportation in general, because of its low cost and environmental impact. It has been demostrated that alloys processed from chips exhibit the highest tensile stress values, close to 320 MPa.Recientemente se ha demostrado la posibilidad de fabricar por moldeo, componentes libres de defectos de diferentes aleaciones comerciales de magnesio, añadiendo CaO al caldo, sin emplear SF6. En el caso de las aleaciones AZ este proceso, además, mejora notablemente las propiedades mecánicas, no sólo por la mayor limpieza de las aleaciones sino también por la presencia de la fase CaAl2 que se forma por la incorporación de calcio al caldo. Este trabajo, enmarcado dentro del proyecto Green Metallurgy (http://www.green-metallurgy.eu financiado por la Unión Europea (Programa LIFE+2009, estudia la influencia de diferentes adiciones de CaO en la microestructura y propiedades mecánicas de la aleación Eco-Mg AZ31. El estudio se lleva a cabo en aleaciones AZ31 con 0,5, 1 y 1,5% CaO procesadas por dos rutas diferentes, aleaciones
Resúmen Ejecutivo Caña de Azúcar
Ministerio de Agricultura y Riego
2010-01-01
El cultivo de caña de azúcar en el Perú, es de gran potencial de producción, principalmente por las condiciones óptimas de clima y suelo existentes, que ayudan a tener rendimientos muy buenos alrededor 120 toneladas por hectárea, convirtiéndose en un factor competitivo importante, de este cultivo se pueden extraer productos como el guarapo, azúcar rubia artesanal, chancaca y otros. La producción de caña de azúcar no tiene una estacionalidad definida por tanto la siembra y la cosecha se rea...
Proving Causation With Epidemiological Evidence in Tobacco Lawsuits
Directory of Open Access Journals (Sweden)
Sun Goo Lee
2016-03-01
Full Text Available Recently, a series of lawsuits were filed in Korea claiming tort liability against tobacco companies. The Supreme Court has already issued decisions in some cases, while others are still pending. The primary issue in these cases is whether the epidemiological evidence submitted by the plaintiffs clearly proves the causal relationship between smoking and disease as required by civil law. Proving causation is difficult in tobacco lawsuits because factors other than smoking are involved in the development of a disease, and also because of the lapse of time between smoking and the manifestation of the disease. The Supreme Court (Supreme Court Decision, 2011Da22092, April 10, 2014 has imposed some limitations on using epidemiological evidence to prove causation in tobacco lawsuits filed by smokers and their family members, but these limitations should be reconsidered. First, the Court stated that a disease can be categorized as specific or non-specific, and for each disease type, causation can be proven by different types of evidence. However, the concept of specific diseases is not compatible with multifactor theory, which is generally accepted in the field of public health. Second, when the epidemiological association between the disease and the risk factor is proven to be significant, imposing additional burdens of proof on the plaintiff may considerably limit the plaintiff’s right to recovery, but the Court required the plaintiffs to provide additional information such as health condition and lifestyle. Third, the Supreme Court is not giving greater weight to the evidential value of epidemiological study results because the Court focuses on the fact that these studies were group-level, not individual-level. However, group-level studies could still offer valuable information about individual members of the group, e.g., probability of causation.
On proving confluence modulo equivalence for Constraint Handling Rules
DEFF Research Database (Denmark)
Christiansen, Henning; Kirkeby, Maja Hanne
2017-01-01
Previous results on proving confluence for Constraint Handling Rules are extended in two ways in order to allow a larger and more realistic class of CHR programs to be considered confluent. Firstly, we introduce the relaxed notion of confluence modulo equivalence into the context of CHR: while...... with meta-level restrictions that reflect the non-logical and incomplete predicates. This language represents subproofs as diagrams, which facilitates a systematic enumeration of proof cases, pointing forward to a mechanical support for such proofs. The Project is supported by The Danish...
Harris, Tina
2015-04-29
Grounded theory is a popular research approach in health care and the social sciences. This article provides a description of grounded theory methodology and its key components, using examples from published studies to demonstrate practical application. It aims to demystify grounded theory for novice nurse researchers, by explaining what it is, when to use it, why they would want to use it and how to use it. It should enable nurse researchers to decide if grounded theory is an appropriate approach for their research, and to determine the quality of any grounded theory research they read.
Puopolo, Gerardo; Sonego, Paolo; Engelen, Kristof; Pertot, Ilaria
2014-04-24
Lysobacter capsici AZ78, isolated from tobacco rhizosphere, effectively controls Phytophthora infestans and Plasmopara viticola on tomato and grapevine plants, respectively. We report the first draft genome sequence of the L. capsici species.
EnviroAtlas - Phoenix, AZ - Meter-Scale Urban Land Cover (MULC) Data (2010)
U.S. Environmental Protection Agency — The EnviroAtlas Phoenix, AZ Meter-Scale Urban Land Cover (MULC) data and map were generated from USDA NAIP (National Agricultural Imagery Program) four band (red,...
EnviroAtlas - Phoenix, AZ- One Meter Resolution Urban Land Cover Data (2010) Web Service
U.S. Environmental Protection Agency — This EnviroAtlas web service supports research and online mapping activities related to EnviroAtlas (https://www.epa.gov/enviroatlas). The EnviroAtlas Phoenix, AZ...
Directory of Open Access Journals (Sweden)
J. Kamieniak
2011-07-01
Full Text Available AZ91 magnesium alloy matrix composites with aluminosilicate glass cenospheres were fabricated successfully by the pressure infiltration method. Different parameters of the fabrication process, such as temperature of the mould and temperature of cenospheres were used. Influence of the temperature variation of particular parameters on the microstructure has been investigated. The microstructure of AZ91 magnesium alloy and fabricated composites have been investigated by light microscopy (LM and scanning electron microscopy (SEM. The results revealed that AZ91 magnesium alloy consists of -Mg matrix and eutectic -Mg17Al12 and a small amount of discontinuous precipitates of phase. The microstructure of matrix AZ91 in fabricated composites is characterized also by the presence of -Mg matrix and eutectic -Mg17Al12. However, in the composite fabricated byusingthe mould heated to 500 °C more discontinuous precipitates of phase were observed.
Effect of cenospheres addition on microstructure and properties of AZ91D alloy
National Research Council Canada - National Science Library
Zhi-qiu Huang Si-rong Yu Ming Hu Ying-chun Shi Liu-yan Li Guo-yan Bo
2015-01-01
The cenospheres/AZ91D composites were fabricated by melt stir method. The phases, microstructure and tensile fracture morphology of the composites were analyzed using XRD, Olympus metallurgical microscopy and SEM methods...
EnviroAtlas - Phoenix, AZ - BenMAP Results by Block Group
U.S. Environmental Protection Agency — This EnviroAtlas dataset demonstrates the effect of changes in pollution concentration on local populations in 2,434 block groups in Phoenix, AZ. The US EPA's...
Remediation System Evaluation, A-Z Automotive in West Milford, New Jersey
The A-Z Automotive site is a former gasoline retail outlet and automobile service station located on Union Valley Road between St. George Street and Lou Ann Boulevard in West Milford, Passaic County, New Jersey.
2010-08-13
... Employment and Training Administration Freescale Semiconductor, Inc., Technical Information Center, Tempe, AZ; Freescale Semiconductor, Inc., Technical Information Center, Woburn, MA; Amended Certification Regarding... to Apply for Worker Adjustment Assistance on October 1, 2009, applicable to workers of Freescale...
System Description for Tank 241-AZ-101 Waste Retrieval Data Acquisition System
Energy Technology Data Exchange (ETDEWEB)
ROMERO, S.G.
2000-02-14
The proposed activity provides the description of the Data Acquisition System for Tank 241-AZ-101. This description is documented in HNF-5572, Tank 241-AZ-101 Waste Retrieval Data Acquisition System (DAS). This activity supports the planned mixer pump tests for Tank 241-AZ-101. Tank 241-AZ-101 has been selected for the first full-scale demonstration of a mixer pump system. The tank currently holds over 960,000 gallons of neutralized current acid waste, including approximately 12.7 inches of settling solids (sludge) at the bottom of the tank. As described in Addendum 4 of the FSAR (LMHC 2000a), two 300 HP mixer pumps with associated measurement and monitoring equipment have been installed in Tank 241-AZ-101. The purpose of the Tank 241-AZ-101 retrieval system Data Acquisition System (DAS) is to provide monitoring and data acquisition of key parameters in order to confirm the effectiveness of the mixer pumps utilized for suspending solids in the tank. The suspension of solids in Tank 241-AZ-101 is necessary for pretreatment of the neutralized current acid waste and eventual disposal as glass via the Hanford Waste Vitrification Plant. HNF-5572 provides a basic description of the Tank 241-AZ-101 retrieval system DAS, including the field instrumentation and application software. The DAS is provided to fulfill requirements for data collection and monitoring. This document is not an operations procedure or is it intended to describe the mixing operation. This USQ screening provides evaluation of HNF-5572 (Revision 1) including the changes as documented on ECN 654001. The changes include (1) add information on historical trending and data backup, (2) modify DAS I/O list in Appendix E to reflect actual conditions in the field, and (3) delete IP address in Appendix F per Lockheed Martin Services, Inc. request.
Asif Baloch; M. Bobby Kannan
2017-01-01
In this study, polyaniline was coated on AZ91 magnesium alloy using an electropolymerisation technique, and the effect of corrosiveness of the coating electrolytes on the polymerisation and the coating performance were evaluated. Two electrolytes, i.e., aniline + sodium salicylate (PASS) and aniline + potassium hydroxide (PAPH), with different corrosiveness, were used for polyaniline coating on AZ91 magnesium alloy. Potentiodynamic polarisation results suggested that salicylic acid (C7H5NaO3)...
J. Kamieniak; A. Żydek; K.N. Braszczyńska-Malik
2011-01-01
AZ91 magnesium alloy matrix composites with aluminosilicate glass cenospheres were fabricated successfully by the pressure infiltration method. Different parameters of the fabrication process, such as temperature of the mould and temperature of cenospheres were used. Influence of the temperature variation of particular parameters on the microstructure has been investigated. The microstructure of AZ91 magnesium alloy and fabricated composites have been investigated by light microscopy (LM) and...
The Spectroscopic Studies of the Long Period Eclipsing Binary AZ CAS
Directory of Open Access Journals (Sweden)
Mun-Suk Chun
1994-06-01
Full Text Available Spectroscopic observations of the long period eclipsing binary AZ Cas were made using 122cm telescope/Image Tube. From the relatively sharp and strong spectral FeI lines we can calculate the mean radial velocity as -39.7 km/sec. The estimated equivalent widths of some atomic lines are well fitted to the phase of the AZ Cas.
Model Checking Failed Conjectures in Theorem Proving: A Case Study
Pike, Lee; Miner, Paul; Torres-Pomales, Wilfredo
2004-01-01
Interactive mechanical theorem proving can provide high assurance of correct design, but it can also be a slow iterative process. Much time is spent determining why a proof of a conjecture is not forthcoming. In some cases, the conjecture is false and in others, the attempted proof is insufficient. In this case study, we use the SAL family of model checkers to generate a concrete counterexample to an unproven conjecture specified in the mechanical theorem prover, PVS. The focus of our case study is the ROBUS Interactive Consistency Protocol. We combine the use of a mechanical theorem prover and a model checker to expose a subtle flaw in the protocol that occurs under a particular scenario of faults and processor states. Uncovering the flaw allows us to mend the protocol and complete its general verification in PVS.
Formal Analysis of Soft Errors using Theorem Proving
Directory of Open Access Journals (Sweden)
Sofiène Tahar
2013-07-01
Full Text Available Modeling and analysis of soft errors in electronic circuits has traditionally been done using computer simulations. Computer simulations cannot guarantee correctness of analysis because they utilize approximate real number representations and pseudo random numbers in the analysis and thus are not well suited for analyzing safety-critical applications. In this paper, we present a higher-order logic theorem proving based method for modeling and analysis of soft errors in electronic circuits. Our developed infrastructure includes formalized continuous random variable pairs, their Cumulative Distribution Function (CDF properties and independent standard uniform and Gaussian random variables. We illustrate the usefulness of our approach by modeling and analyzing soft errors in commonly used dynamic random access memory sense amplifier circuits.
A Hybrid Approach to Proving Memory Reference Monotonicity
Oancea, Cosmin E.
2013-01-01
Array references indexed by non-linear expressions or subscript arrays represent a major obstacle to compiler analysis and to automatic parallelization. Most previous proposed solutions either enhance the static analysis repertoire to recognize more patterns, to infer array-value properties, and to refine the mathematical support, or apply expensive run time analysis of memory reference traces to disambiguate these accesses. This paper presents an automated solution based on static construction of access summaries, in which the reference non-linearity problem can be solved for a large number of reference patterns by extracting arbitrarily-shaped predicates that can (in)validate the reference monotonicity property and thus (dis)prove loop independence. Experiments on six benchmarks show that our general technique for dynamic validation of the monotonicity property can cover a large class of codes, incurs minimal run-time overhead and obtains good speedups. © 2013 Springer-Verlag.
DEFF Research Database (Denmark)
Nielsen, Rasmus Kleis
Political campaigns today are won or lost in the so-called ground war--the strategic deployment of teams of staffers, volunteers, and paid part-timers who work the phones and canvass block by block, house by house, voter by voter. Ground Wars provides an in-depth ethnographic portrait of two...... of ground war tactics for how we understand political campaigns and what it means to participate in them. He shows how ground wars are waged using resources well beyond those of a given candidate and their staff. These include allied interest groups and civic associations, party-provided technical...... of professionals. Yet he also quashes the romantic idea that canvassing is a purer form of grassroots politics. In today's political ground wars, Nielsen demonstrates, even the most ordinary-seeming volunteer knocking at your door is backed up by high-tech targeting technologies and party expertise. Ground Wars...
Puopolo, Gerardo; Giovannini, Oscar; Pertot, Ilaria
2014-01-01
The bacterial genus Lysobacter represents a still underdeveloped source of biocontrol agents able to protect plants against pathogenic oomycetes. In this work the L. capsici strain AZ78 was evaluated with regard to the biological control of Plasmopara viticola, the causal agent of grapevine downy mildew. L. capsici AZ78 is able to resist copper ions and its resistance to this metal is probably due to the presence of genes coding for copper oxidase (copA) and copper exporting PIB-type ATPases (ctpA). The presence of both genes was also detected in other members of the Lysobacter genus. Resistance to copper allowed L. capsici AZ78 to be combined with a low-dose of a copper-based fungicide, leading to more effective control of grapevine downy mildew. Notably, prophylactic application of L. capsici AZ78 alone to grapevine leaves reduced downy mildew disease to the same degree as a copper-based fungicide. Furthermore, L. capsici AZ78 persists in the phyllosphere of grapevine plants and tolerates environmental stresses such as starvation, freezing, mild heat shock and UV light irradiation. These traits suggest that L. capsici AZ78 could be a suitable candidate for developing a new biofungicide to be used in combination with copper to control grapevine downy mildew. Copyright © 2013 Elsevier GmbH. All rights reserved.
Electrochemical corrosion behavior of AZ91D alloy in ethylene glycol
Energy Technology Data Exchange (ETDEWEB)
Fekry, A.M. [Chemistry Department, Faculty of Science, Cairo University, Giza 12613 (Egypt)], E-mail: hham4@hotmail.com; Fatayerji, M.Z. [Chemistry Department, Faculty of Science, Cairo University, Giza 12613 (Egypt)
2009-11-01
The effect of concentration on the corrosion behavior of Mg-based alloy AZ91D was investigated in ethylene glycol-water solutions using electrochemical techniques i.e. potentiodynamic polarization, electrochemical impedance measurements (EIS) and surface examination via scanning electron microscope (SEM) technique. This can provide a basis for developing new coolants for magnesium alloy engine blocks. Corrosion behavior of AZ91D alloy by coolant is important in the automotive industry. It was found that the corrosion rate of AZ91D alloy decreased with increasing concentration of ethylene glycol. For AZ91D alloy in chloride >0.05 M or fluoride <0.05 M containing 30% ethylene glycol solution, they are more corrosive than the blank (30% ethylene glycol-70% water). However, at concentrations <0.05 for chloride or >0.05 M for fluoride containing ethylene glycol solution, some inhibition effect has been observed. The corrosion of AZ91D alloy in the blank can be effectively inhibited by addition of 0.05 mM paracetamol that reacts with AZ91D alloy and forms a protective film on the surface at this concentration as confirmed by surface examination.
Bioactive benzofuran derivatives: moracins A-Z in medicinal chemistry.
Naik, Ravi; Harmalkar, Dipesh S; Xu, Xuezhen; Jang, Kyusic; Lee, Kyeong
2015-01-27
Benzofuran heterocycles are fundamental structural units in a variety of biologically active natural products as well as synthetic materials. Over the time, benzofuran derivatives have attracted many researchers due to the broad scope of their biological activity, which include anticancer, antimicrobial, immunomodulatory, antioxidant and anti-inflammatory properties. Egonol, homoegonol and moracin families are biologically active natural products containing benzofuran heterocycle as basic structural units. This paper focuses on the moracin family (moracin A to Z). Morus, a genus of flowering plants in the family Moraceae, comprises 10-16 species of deciduous trees commonly known as mulberries. The root bark, stem bark and leaves of Morus alba, M. lhou, Morus macroura are the main sources for arylbenzofuran derivatives including the moracins. A large volume of research has been carried out on moracins and their derivatives, which has shown the pharmacological importance of this benzofuran heterocyclic nucleus. In this mini-review, we attempt to highlight the importance of moracins, as they have been a major source for drug development. Herein, we also summarize the current state of the art concerning the synthesis and medicinal use of moracins A-Z. Copyright © 2014 Elsevier Masson SAS. All rights reserved.
Assessment of Debris Flow Hazards, North Mountain, Phoenix, AZ
Reavis, K. J.; Wasklewicz, T. A.
2014-12-01
Urban sprawl in many western U.S. cities has expanded development onto alluvial fans. In the case of metropolitan Phoenix, AZ (MPA), urban sprawl has led to an exponential outward growth into surrounding mountainous areas and onto alluvial fans. Building on alluvial fans places humans at greater risk to flooding and debris flow hazards. Recent research has shown debris flows often supply large quantities of material to many alluvial fans in MPA. However, the risk of debris flows to built environments is relatively unknown. We use a 2D debris flow modeling approach, aided by high-resolution airborne LiDAR and terrestrial laser scanning (TLS) topographic data, to examine debris flow behavior in a densely populated portion of the MPA to assess the risk and vulnerability of debris flow damage to the built infrastructure. A calibrated 2D debris flow model is developed for a "known" recent debris flow at an undeveloped site in MPA. The calibrated model and two other model scenarios are applied to a populated area with historical evidence of debris flow activity. Results from the modeled scenarios show evidence of debris flow damage to houses built on the alluvial fan. Debris flow inundation is also evident on streets on the fan. We use housing values and building damage to estimate the costs assocaited with various modeled debris flow scenarios.
Why prove it again? alternative proofs in mathematical practice
Dawson, Jr , John W
2015-01-01
This monograph considers several well-known mathematical theorems and asks the question, “Why prove it again?” while examining alternative proofs. It explores the different rationales mathematicians may have for pursuing and presenting new proofs of previously established results, as well as how they judge whether two proofs of a given result are different. While a number of books have examined alternative proofs of individual theorems, this is the first that presents comparative case studies of other methods for a variety of different theorems. The author begins by laying out the criteria for distinguishing among proofs and enumerates reasons why new proofs have, for so long, played a prominent role in mathematical practice. He then outlines various purposes that alternative proofs may serve. Each chapter that follows provides a detailed case study of alternative proofs for particular theorems, including the Pythagorean Theorem, the Fundamental Theorem of Arithmetic, Desargues’ Theorem, the...
Energy Technology Data Exchange (ETDEWEB)
Feliu, Sebastián, E-mail: sfeliu@cenim.csic.es [Centro Nacional de Investigaciones Metalúrgicas CSIC, Avda. Gregorio del Amo 8, 28040 Madrid (Spain); Samaniego, Alejandro [Centro Nacional de Investigaciones Metalúrgicas CSIC, Avda. Gregorio del Amo 8, 28040 Madrid (Spain); Barranco, Violeta [Instituto de Ciencias de Materiales de Madrid, ICMM, Consejo Superior de Investigaciones Científicas, CSIC, Sor Juana Inés de la Cruz, 3, Cantoblanco, 28049, Madrid (Spain); El-Hadad, A.A. [Physics Department, Faculty of Science, Al-Azhar University, Nasr City 11884, Cairo (Egypt); Llorente, Irene [Centro Nacional de Investigaciones Metalúrgicas CSIC, Avda. Gregorio del Amo 8, 28040 Madrid (Spain); Serra, Carmen [Servicio de Nanotecnologia y Análisis de Superficies, CACTI, Universidade de Vigo, 36310 Vigo (Spain); Galván, J.C. [Centro Nacional de Investigaciones Metalúrgicas CSIC, Avda. Gregorio del Amo 8, 28040 Madrid (Spain)
2014-03-01
Highlights: • Surface chemistry of heat treated magnesium alloys. • Relation between heat treatment and aluminium subsurface enrichment. • Relation between surface composition and corrosion behaviour. - Abstract: This paper studies the changes in chemical composition of the thin oxide surface films induced by heating in air at 200 °C for time intervals from 5 min to 60 min on the freshly polished commercial AZ31 and AZ61 alloys with a view to better understanding their protective properties. This thermal treatment resulted in the formation of layers enriched in metallic aluminium at the interface between the outer MgO surface films and the bulk material. A strong link was found between the degree of metallic Al enrichment in the subsurface layer (from 10 to 15 at.%) observed by XPS (X-ray photoelectron spectroscopy) in the AZ61 treated samples and the increase in protective properties observed by EIS (electrochemical impedance spectroscopy) in the immersion test in 0.6 M NaCl. Heating for 5–60 min in air at 200 °C seems to be an effective, easy to perform and inexpensive method for increasing the corrosion resistance of the AZ61 alloy by approximately two or three times.
Rapid coating of AZ31 magnesium alloy with calcium deficient hydroxyapatite using microwave energy
Energy Technology Data Exchange (ETDEWEB)
Ren, Yufu, E-mail: Yufu.Ren@rockets.utoledo.edu [Department of Mechanical, Industrial and Manufacturing Engineering, The University of Toledo, Toledo, OH (United States); Zhou, Huan [Department of Mechanical, Industrial and Manufacturing Engineering, The University of Toledo, Toledo, OH (United States); Institute of Biomedical Engineering and Health Sciences, Changzhou University, Changzhou, Jiangsu (China); Nabiyouni, Maryam [Department of Bioengineering, The University of Toledo, Toledo, OH (United States); Bhaduri, Sarit B. [Department of Mechanical, Industrial and Manufacturing Engineering, The University of Toledo, Toledo, OH (United States); Division of Dentistry, The University of Toledo, Toledo, OH (United States)
2015-04-01
Due to their unique biodegradability, magnesium alloys have been recognized as suitable metallic implant materials for degradable bone implants and bioresorbable cardiovascular stents. However, the extremely high degradation rate of magnesium alloys in physiological environment has restricted its practical application. This paper reports the use of a novel microwave assisted coating technology to improve the in vitro corrosion resistance and biocompatibility of Mg alloy AZ31. Results indicate that a dense calcium deficient hydroxyapatite (CDHA) layer was uniformly coated on a AZ31 substrate in less than 10 min. Weight loss measurement and SEM were used to evaluate corrosion behaviors in vitro of coated samples and of non-coated samples. It was seen that CDHA coatings remarkably reduced the mass loss of AZ31 alloy after 7 days of immersion in SBF. In addition, the prompt precipitation of bone-like apatite layer on the sample surface during immersion demonstrated a good bioactivity of the CDHA coatings. Proliferation of osteoblast cells was promoted in 5 days of incubation, which indicated that the CDHA coatings could improve the cytocompatibility of the AZ31 alloy. All the results suggest that the CDHA coatings, serving as a protective layer, can enhance the corrosion resistance and biological response of magnesium alloys. Furthermore, this microwave assisted coating technology could be a promising method for rapid surface modification of biomedical materials. - Highlights: • A microwave assisted coating process for biodegradable Mg alloy. • CDHA coatings were successfully developed on AZ31 alloy in minutes. • The as-deposited CDHA coatings significantly reduced the degradation rate of AZ31 alloy. • The CDHA coated AZ31 alloy showed good bioactivity and biocompatibility in vitro. • The microwave assisted coating process can be used as rapid surface modification for bioimplants.
Directory of Open Access Journals (Sweden)
Ramos Gómez, Oscar Gerardo
2005-04-01
Full Text Available This article studies the sugar industry in Colombia, mainly in the Cauca Valley. The analysis is focused on the technical evolution undergone since its inception and the way in which a «sugar culture» evolved. This work also studies the participation of «hacendados» and croppers during the Independence period and the formation of republican oligarchies, their adaptation to the economy modernization processes in the 20th Century, as well as the State intervention and the associative mechanisms the sector used to confront the 1930 crisis. These mechanisms helped to expand the sector. Finally the recent performance of the sugar industry is analyzed, mainly its growth in the seventies and the present efforts at competitiveness, environmental impact and situation in the world trade.
Este artículo analiza la industria azucarera en Colombia, sobre todo en el Valle del Cauca, su evolución técnica desde sus orígenes y el modo en que se fue configurando una cultura de la caña de azúcar. Además, estudia la participación de los hacendados y cultivadores en la independencia y la formación de las oligarquías republicanas, su adaptación a la modernización de la economía nacional en el siglo XX y la intervención el Estado y los mecanismos asociativos con que hizo frente el sector a la crisis de 1930 y que dieron lugar a una notable expansión del mismo. La parte final del texto explora el desempeño reciente de dicha actividad, su fuerte crecimiento en el decenio de 1970 y sus actuales esfuerzos por mejorar su competitividad, impacto medioambiental y posición en el comercio mundial.
Energy Technology Data Exchange (ETDEWEB)
Feliu, Sebastian, E-mail: sfeliu@cenim.csic.es [Centro Nacional de Investigaciones Metalurgicas CSIC, Avda. Gregorio del Amo 8, 28040 Madrid (Spain); Maffiotte, C. [CIEMAT-DT edificio 30, Avda. Complutense, 22, 28040 Madrid (Spain); Samaniego, A.; Galvan, Juan Carlos [Centro Nacional de Investigaciones Metalurgicas CSIC, Avda. Gregorio del Amo 8, 28040 Madrid (Spain); Barranco, Violeta [Centro Nacional de Investigaciones Metalurgicas CSIC, Avda. Gregorio del Amo 8, 28040 Madrid (Spain); Instituto de Ciencias de Materiales de Madrid, ICMM, Consejo Superior de Investigaciones Cientificas, CSIC, Sor Juana Ines de la Cruz, 3, Cantoblanco, 28049, Madrid (Spain)
2011-08-01
The purpose of this study has been to advance in knowledge of the chemical composition, structure and thickness of the thin native oxide film formed spontaneously in contact with the laboratory atmosphere on the surface of freshly polished commercial AZ31 and AZ61 alloys with a view to furthering the understanding of protection mechanisms. For comparative purposes, and to more fully describe the behaviour of the native oxide film, the external oxide films formed as a result of the manufacturing process (as-received condition) have been characterised. The technique applied in this research to study the thin oxide films (thickness of just a few nanometres) present on the surface of the alloys has basically been XPS (X-ray photoelectron spectroscopy) in combination with ion sputtering. Corrosion properties of the alloys were studied in 0.6 M NaCl by measuring charge transfer resistance values, which are deduced from EIS (electrochemical impedance spectroscopy) measurements after 1 h of exposure. Alloy AZ61 generally showed better corrosion resistance than AZ31, and the freshly polished alloys showed better corrosion resistance than the alloys in as-received condition. This is attributed to a combination of (1) higher thickness of the native oxide film on the AZ61 alloy and (2) greater uniformity of the oxide film in the polished condition. The formation of an additional oxide layer composed by a mixture of spinel (MgAl{sub 2}O{sub 4}) and MgO seems to diminish the protective properties of the passive layer on the surface of the alloys in as-received condition.
Geotechnics - the key to ground water protection
DEFF Research Database (Denmark)
Baumann, Jens; Foged, Niels; Jørgensen, Peter
2000-01-01
During the past 5 to 10 years research into ground water protection has proved that fractures in clay till may increase the hydraulic conductivity and herby the vulnerability of the ground water considerably. However, research has not identified a non-expensive and efficient method to map...... the character of a certain type of clay till and hereby find the necessary tool in future geographical mapping of the vulnerability of the ground water resources....
Effect of Extrusion Speed on the Microstructure and Tensile Properties of AZ31 Alloy
Directory of Open Access Journals (Sweden)
Yang Shengnan
2016-01-01
Full Text Available The influences of extrusion speed on the microstructure and tensile properties of AZ31 alloy were investigated. The results suggested that the yield and tensile strength of AZ31 alloy decrease but elongation increases with the reduction of extruded speed. High speed extrusion produces fine grains with texture of c-axis perpendicular with extruded direction. The tension deformation is dominated by slip and the formed texture is obstructive for the basal slip, and also the inhomogeneous structure formed at high speed extrusion is harmful to the ductility. Samples extruded at low speed have comparatively homogeneous and coarse microstructure. Twinning provided more tension deformation and the lattice rotation induced by twinning is favorable for the activities of new slip systems, which induced the better ductility of AZ31 alloy.
Grain Refinement and Deformation Mechanisms in Room Temperature Severe Plastic Deformed Mg-AZ31
Directory of Open Access Journals (Sweden)
Ludwig Schultz
2013-07-01
Full Text Available A Ti-AZ31 composite was severely plastically deformed by rotary swaging at room temperature up to a logarithmic deformation strain of 2.98. A value far beyond the forming limit of pure AZ31 when being equivalently deformed. It is observed, that the microstructure evolution in Mg-AZ31 is strongly influenced by twinning. At low strains the {̅1011} (10̅12 and the {̅1012} (10̅11 twin systems lead to fragmentation of the initial grains. Inside the primary twins, grain refinement takes place by dynamic recrystallization, dynamic recovery and twinning. These mechanisms lead to a final grain size of ≈1 μm, while a strong centered ring fibre texture is evolved.
The effect of extrusion conditions on the properties and textures of AZ31B alloy
Directory of Open Access Journals (Sweden)
Qiang Liu
2017-06-01
Full Text Available The effect of extrusion conditions on the tensile properties and texture of AZ31B alloy has been investigated by means of optical microscopy (OM, scanning electron microscopy (SEM, electron backscattered diffraction (EBSD and tensile tests. It is found that the ultimate tensile strength (UTS, the yield strength (YS and elongation (EN of the extruded AZ31B alloy are more significantly influenced by extrusion velocities in contrast with temperature. Although the extrusion conditions are different, the {112¯0} 〈011¯0〉 texture is the chief texture in the AZ31B after extrusion. Moreover, the extrusion textures become scattered with increasing the temperatures at the same extrusion velocity. As the extrusion velocity is raised at the same temperature, the orientation density of textures increases and the separated textures become relatively concentrated. This leads to the changes of tensile properties at different extrusion conditions.
Influence of The Arrangement of Materials and Microstructural Analysis During FSW of AZ80A
Directory of Open Access Journals (Sweden)
Sevvel P.
2017-09-01
Full Text Available The main objective of this paper is to produce defect free weldments with improved properties during friction stir welding of dissimilar Mg alloys. The influence of the anisotropic arrangement of materials when AZ80A Mg alloy is taken as advancing side and AZ91C Mg alloy as retreating side and vice versa with respect to their mechanical properties and microstructural characteristics were investigated. The effects of various FSW parameters on the quality of these joints were also analyzed and best optimized FSW parameters were suggested. Defect free sound joints with excellent mechanical properties were produced when AZ80A Mg alloy was positioned at retreating side. At the same time, it seems a little bit difficult to obtain good quality joints with the contrary arrangement of materials. These investigations revealed that materials having inferior plastic deformability must be kept at the advancing side to obtain sound joints during FSW of dissimilar alloys of Magnesium.
Diffusion Bonding and Post-Weld Heat Treatment of Extruded AZ91 Magnesium Alloys
Directory of Open Access Journals (Sweden)
Fei LIN
2015-11-01
Full Text Available The grain size of as-extruded AZ91 magnesium alloys was refined to 12.31 μm from 21.41 μm by recrystallization annealing. The vacuum diffusion welding of as-annealed AZ91 magnesium alloys was researched. The results showed that the maximum shear strength of joints reached 64.70 MPa in the situation of 10 MPa bonding pressure, 18 Pa vacuum degree, 470 °C bonding temperature and 90 min bonding time; both bonding temperature and time are the main influence factors on as-extruded AZ91 magnesium alloys diffusion welding. Then the diffusion welded specimens were annealed, and the shear strength of joints was further improved to 76.93 MPa.DOI: http://dx.doi.org/10.5755/j01.ms.21.4.9699
Korozní odolnost tvářených hořčíkových slitin AZ31 a AZ61 v Hankovì roztoku
Czech Academy of Sciences Publication Activity Database
Tkacz, J.; Slouková, K.; Minda, J.; Drábiková, J.; Fintová, Stanislava; Doležal, P.; Wasserbauer, J.
2016-01-01
Roč. 60, č. 4 (2016), s. 101-106 ISSN 1804-1213 Institutional support: RVO:68081723 Keywords : corrosion * AZ31 magnesium alloy * AZ61 magnesium alloy Subject RIV: JK - Corrosion ; Surface Treatment of Materials https://www.degruyter.com/view/j/kom.2016.60.issue-4/kom-2016-0016/kom-2016-0016. xml ?format=INT
Corrosion and mechanical performance of AZ91 exposed to simulated inflammatory conditions.
Brooks, Emily K; Der, Stephanie; Ehrensberger, Mark T
2016-03-01
Magnesium (Mg) and its alloys, including Mg-9%Al-1%Zn (AZ91), are biodegradable metals with potential use as temporary orthopedic implants. Invasive orthopedic procedures can provoke an inflammatory response that produces hydrogen peroxide (H2O2) and an acidic environment near the implant. This study assessed the influence of inflammation on both the corrosion and mechanical properties of AZ91. The AZ91 samples in the inflammatory protocol were immersed for three days in a complex biologically relevant electrolyte (AMEM culture media) that contained serum proteins (FBS), 150 mM of H2O2, and was titrated to a pH of 5. The control protocol immersed AZ91 samples in the same biologically relevant electrolyte (AMEM & FBS) but without H2O2 and the acid titration. After 3 days all samples were switched into fresh AMEM & FBS for an additional 3-day immersion. During the initial immersion, inflammatory protocol samples showed increased corrosion rate determined by mass loss testing, increased Mg and Al ion released to solution, and a completely corroded surface morphology as compared to the control protocol. Although corrosion in both protocols slowed once the test electrolyte solution was replaced at 3 days, the samples originally exposed to the simulated inflammatory conditions continued to display enhanced corrosion rates as compared to the control protocol. These lingering effects may indicate the initial inflammatory corrosion processes modified components of the surface oxide and corrosion film or initiated aggressive localized processes that subsequently left the interface more vulnerable to continued enhanced corrosion. The electrochemical properties of the interfaces were also evaluated by EIS, which found that the corrosion characteristics of the AZ91 samples were potentially influenced by the role of intermediate adsorption layer processes. The increased corrosion observed for the inflammatory protocol did not affect the flexural mechanical properties of the AZ91
Şimşek, Abdullah; Yapıcı, İlhami; Babalık, Mesiha; Şimşek, Zekiye; Kolsuz, Mustafa
2016-01-01
To determine the proportional distribution of endobronchial tuberculosis (EBTB) subtypes and to evaluate the types of bronchoscopic diagnostic procedures that can prove granulomatous inflammation. This was a retrospective study of 18 HIV-negative patients with biopsy-proven EBTB treated between 2010 and 2014. The most common EBTB subtypes, as classified by the bronchoscopic features, were tumorous and granular (in 22.2% for both). Sputum smear microscopy was performed in 11 patients and was positive for AFB in 4 (36.3%). Sputum culture was also performed in 11 patients and was positive for Mycobacterium tuberculosis in 10 (90.9%). Smear microscopy of BAL fluid (BALF) was performed in 16 patients and was positive for AFB in 10 (62.5%). Culture of BALF was also performed in 16 patients and was positive for M. tuberculosis in 15 (93.7%). Culture of BALF was positive for M. tuberculosis in 93.7% of the 16 patients tested. Among the 18 patients with EBTB, granulomatous inflammation was proven by the following bronchoscopic diagnostic procedures: bronchial mucosal biopsy, in 8 (44.4%); bronchial brushing, in 7 (38.8%); fine-needle aspiration biopsy, in 2 (11.1%); and BAL, in 2 (11.1%). Bronchial anthracofibrosis was observed in 5 (27.7%) of the 18 cases evaluated. In our sample of EBTB patients, the most common subtypes were the tumorous and granular subtypes. We recommend that sputum samples and BALF samples be evaluated by smear microscopy for AFB and by culture for M. tuberculosis, which could increase the rates of early diagnosis of EBTB. We also recommend that bronchial brushing be employed together with other bronchoscopic diagnostic procedures in patients suspected of having EBTB. Determinar a distribuição proporcional dos subtipos de tuberculose endobrônquica (TBEB) e avaliar os tipos de procedimentos diagnósticos broncoscópicos que podem revelar inflamação granulomatosa. Este foi um estudo retrospectivo com 18 pacientes HIV negativos com TBEB comprovada
Energy Technology Data Exchange (ETDEWEB)
Carboneras, M.; Iglesias, C.; Perez-Maceda, B. T.; Valle, J. A. de; Garcia-Alonso, M. C.; Alobera, M. A.; Clemente, C.; Rubio, J. C.; Escudero, M. I.; Lozano, R. M.
2011-07-01
The present work evaluates the corrosion behaviour and the in vitro/in vivo biocompatibility of the AZ31 magnesium alloy, which fulfills the mechanical requirements of bone. The corrosion kinetic of as-received AZ31 alloy was not compatible with the cell growth. To improve its performance, the AZ31 alloy was surface modified by a chemical conversion treatment in hydrofluoric acid. The magnesium fluoride layer generated by the surface treatment of AZ31 alloy enhances its corrosion behaviour, allowing the in vitro growth of osteoblastic cells over the surface and the in vivo formation of a highly compact layer of new bone tissue. These results lead to consider the magnesium fluoride coating as necessary for potential use of the AZ31 alloy as biodegradable and absorbable implant for bone repair. (Author) 18 refs.
Patrón de consumo e ingestas recomendadas de azúcar
Joan Quiles i Izquierdo
2013-01-01
Los azúcares son hidratos de carbono con sabor dulce que proveen energía al organismo. El cerebro adulto utiliza aproximadamente 140 g de glucosa al día, cantidad que puede representar hasta el 50% del total de hidratos de carbono que se consumen. En nuestro país el patrón de consumo de azúcar en alimentos permanece constante, mientras que el consumo de bebidas refrescantes presenta un aumento en los últimos cuatro años. La Encuesta Nacional de Ingesta Dietética de España (ENIDE, 2010-11) est...
La trehalosa. Parte I: su presencia en la caña de azúcar
Eduardo L. Ramos; Susana Ravelo; Enrique Muñoz; Carlos Pérez
2009-01-01
Varios de los problemas que se presentan al tratar de elevar la eficiencia industrial durante la producción de azúcar, están asociados fundamentalmente a la capacidad de la caña para formar en sus jugos la sacarosa y sus monosacáridos constituyentes. Se ha determinado que luego del corte se acentúa la formación de azúcares, como: la D-Xilosa, la Lactosacarosa, las Kestosas, la Rafinosa y varios polisacáridos, sustancias que impiden el desarrollo normal del cristal de sacarosa y disminuyen la ...
Az egyetemek három missziójának vizsgálata
Zuti, Bence
2014-01-01
Ma már az egyetemek az intézményi stratégia kialakítása mentén is arra törekednek, hogy nemzetközi színtereken is megjelenjenek, hazai és külföldi kereteken belül is ismert és elismert legyen oktatásuk színvonala, kutatómunkájuk és harmadik missziós tevékenységük értéke.
Differential deposition of H2A.Z in rice seedling tissue during the day-night cycle.
Zhang, Kang; Xu, Wenying; Wang, Chunchao; Yi, Xin; Su, Zhen
2017-03-04
Chromatin structure has an important role in modulating gene expression. The incorporation of histone variants into the nucleosome leads to important changes in the chromatin structure. The histone variant H2A.Z is highly conserved between different species of fungi, animals, and plants. However, dynamic changes to H2A.Z in rice have not been reported during the day-night cycle. In this study, we generated genome wide maps of H2A.Z for day and night time in harvested seedling tissues by combining chromatin immunoprecipitation and high-throughput sequencing. The analysis results for the H2A.Z data sets detected 7099 genes with higher depositions of H2A.Z in seedling tissues harvested at night compared with seedling tissues harvested during the day, whereas 4597 genes had higher H2A.Z depositions in seedlings harvested during the day. The gene expression profiles data suggested that H2A.Z probably negatively regulated gene expression during the day-night cycle and was involved in many important biologic processes. In general, our results indicated that H2A.Z may play an important role in plant responses to the diurnal oscillation process.
1993-10-01
AýNL EE :>22020E 11N BREAST MILK dd. & ACCX2JSS5 PAGE 03 OF 06 * ~HEALTH EFFECTS AND FIRST AID I INHALATION; 1-ASCORBIC ACID: * ACUTE EXPOSURE...rJAOE’ UHTE EV1DEN-EA -iIMA 1NI-E E. ýL-N R ’RE RS jED 7,; - ), 4 ’Jh’ - THE S5 R-4i3 Jrr 15 J5 PRIZ’.: T - - - - - SLS itN N -L -S 4001>’ ’NAL C.A.T
1953-06-01
8 0.3 2 Urchin and 0 0.2 2 4 4 4 1 0.3 0.02 3 sand dollar Cucumber 0 0.02 0.1 2 0.08 0.08 0.3 1 0.6 0.5 Crustacean 0 0.04 0.03 0.5 0.08 2 0.6 1...is to locality. Compari- son with 1949 findings at Eniwetok shows mutual tendencies toward high activities in samples of hydroids, sponges...Terns are not scavengers and do not eat refuse. The food of the shore birds is composed mostly of insects and small crustaceans found on the beaches
Meeting on Solute/Solvent Interactions Held in Aberdeen Proving Ground, Maryland on May 29-30, 1991
1992-01-01
0.55 6 Cysteine Ficin 1 0.57 6 Cysteine Ficin 1I 0.62 6 Cysteine Actinidin 1 0.74 6 Cysteine Bromelain B 1 0.70 6 Cys-Leine Bromelain B 1I 0.68 6...Cysteine Bromelain D 1 0.63 6 Cysteine Subtilisin 1 0.49 7 Serine Chymotrypsin 1 0.42 6.9 Serine Trypsin I Q21L 7 Serine Mean - 0.61 132 Table 11 Browse
Greener Cleanup practices were implemented as part of a successful Time-Critical Removal Action (TCRA) completed at the APG Former NIKE Missile Site which has resulted in a reduced environmental footprint, accelerated site closure, and a cost savings.
1975-06-30
parallel or en echelon faults (Mattick and others, 1973) in the vicinity of the Algodones fault. Shallow exploratory trenching across the Algodones fault...a El cm a A CAMJ -*c F a w 0 -w *w 7 - a - D ina /5MO I MA, nc .MNTI 5 7. Ownership and Cultural Features The first two overlays show non-specific...States and Mexico . 2.1.2.2 Surface Water There are no known perennial surface water occurrences within the YPG/LWBGR boundaries (Shepard and others, 1955
2011-05-01
11, January-February 2008). In the 2009 edition of their book, “Execution: The Discipline of Getting Things Done,” Larry Bossidy and Ram Charan make a...responsibilities. Ram Charan of “Execution” notes that 2 in 5 CEOs fail in their first 18 months on the job because of poor selection. The failure can...8 (Mathis, p. 288). the army civilian talent management program Bossidy and Charan make the case that given the many things businesses can’t control
1993-10-01
bite thoroughly with an antiseptic and seek medical attention as soon as possible. The various stages and symptoms of both diseases are well recognized...the bite . The extremely painful characteristics of a pit viper bite (e.g., rattlesnake, copperhead) 4 include rapid swelling that can be identified...Recognition of Symptoms and Signs ........................... 3-7 0 3.1.2 Hazard Communication Program Procedures .......................... 3-7 3.1.3
2017-08-23
Complete coverage of the demonstration site Footprint coverage calculated using UX-Process Footprint Coverage Quality Control (QC) tool; excludes...Complete coverage of the demonstration site Footprint coverage calculated using UX-Process Footprint Coverage QC tool; excludes inaccessible...installed Vegetation thinned IVS installation 37 seed items installed Vegetation thinned IVS installation Data Collection 11.23 acres
155-mm M795 Aerofuze Test at the KOFA Range, Yuma Proving Ground, Arizona, 19 May 2015
2017-09-01
Monday, May 18, 2015, at gun location GP19-1 at YPG, a John Douglas Associates Decommutator/Breakout Box (JDA DECOM/BOB) was set up in the...DECOM lock was established and relayed to the gun crew before the round was screwed onto the projectile, which was the second M795 spotter round...during the 1BB test. The round was fired approximately 3:09 min later, and the signal lock was retained throughout 51 sec of flight until impact
1995-05-01
acrocyanosis, angina pectoris, hypertension, myocardia! infarction, mesenicric thrombosis, systemic occlusive arterial disease, bronchiectasis, and...Columbia, MS. pp. 13-24. Borgono, J.M.; Vincent , P.; Venturino, H.; Infante, A. 1977. Arsenic in the drinking water of the city of Antofagast
1993-10-01
tetrachloroethane, TCE, and PCE. Dithlane is an organosulfur compound usually associated with the degradation of mustard. Elevated levels of iron and...34 :!II S!.. I S , I all I -- 1.... 1.. ..... ...I .S, .. .. "•.,. N TABLE A-5 CONCENTRATIONS OF SEMIVOLATILE ORGANIC CONSTITUANTS AND ORGANOSULFUR
2015-07-01
PERFORMING ORGANIZATION REPORT NUMBER Weston Solutions 1400 Weston Way West Chester, PA 19380 9. SPONSORING / MONITORING AGENCY NAME(S) AND ADDRESS(ES) 10...centimeter DGM digital geophysical mapping DSB Defense Science Board EE /CA Engineering Evaluation/Cost Analysis EMI electromagnetic induction...presented in this section is taken from the Engineering Evaluation/Cost Analysis ( EE /CA) [1 and 2]. More details can be obtained in the EE /CA and in
1994-05-01
141 PC 00 PCu PCU 6PC CPC PCU ~OWN 4E142 ZI POU) CICc S.•,p I I ’P I II P 04 3 143 "CBP EQUATIONS Ve-M ; - Vb =, .- -•)(1) z = 1 2pt 2 ZP 2 Z, - y (3...Phone: 813-578- 8239 Ft. Washington. PA 19034-3211 FAX: 813-578-8119 Phone: 215-542-1200 Mr. Michael Nusca Dr. C. -C Hsiao U.S. Army Research Laboratory
2011-02-10
... workers of Hewlett Packard formerly known as EDS, Global Product Development, Non-IT Business Development... Packard formerly known as EDS, Global Product Development, Non-IT Business Development Team and..., CDI Professional Services, Engineering Labs, Inc., Global Technology Associates, LTD., IAV Automotive...
Comportamiento mecánico de la aleación AZ31 reforzada con nanofibras de carbono
Directory of Open Access Journals (Sweden)
Adeva, P.
2010-12-01
Full Text Available The aim of this study is to investigate the effect of reinforcing AZ31 with carbon nanofibres. The materials AZ31, AZ31-1 % C y AZ31-2 % C were produced by a conventional powder metallurgy route consisting of mechanical mixing of nanofibres and powders of AZ31, cool compactation and extrusion at 350 °C. After extrusion the three materials exhibited a recrystallized microstructure of similar grain size, fine and rather inhomogeneous. Furthermore, they presented a weak fibre texture with basal plane parallel to the extrusion direction. The tensile properties were affected by the nanofibres presence only at 100 °C. At this temperature, yield strength and tensile strength were 30% higher than in the unreinforced alloy.
En este trabajo se ha estudiado el efecto de la adición de nanofibras de carbono en las propiedades mecánicas de la aleación AZ31 procesada por una ruta pulvimetalúrgica convencional. Se prepararon tres materiales, AZ31, AZ31- 1 % C y AZ31-2 % C. Tras una mezcla mecánica de las nanofibras con los polvos de AZ31, se precompactaron en frío y se extruyeron a 350 °C. Los tres presentan una microestructura recristalizada con un tamaño de grano similar, fino aunque algo heterogéneo. Los tres materiales presentan una débil textura de fibra con el plano basal paralelo a la dirección de extrusión. Las propiedades mecánicas a tracción únicamente se ven afectadas por la presencia de nanofibras a 100 °C superando los materiales reforzados en un 30 % a los valores de límite elástico y resistencia de la aleación sin reforzar.
2012-01-17
... COMMISSION 47 CFR Part 73 [MB Docket No. 08-85; RM-11427, RM-11517, RM-11518, RM-11519; DA 11- 2059] Radio Broadcasting Services; Ehrenberg, First Mesa, Kachina Village, Wickenburg, and Williams, AZ, and Needles, CA... Radio, Inc. (RM-11517) and Univision Radio License Corporation (RM-11518), which are mutually exclusive...
75 FR 11939 - DNS Electronics, Chandler, AZ; Notice of Termination of Investigation
2010-03-12
... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF LABOR Employment and Training Administration DNS Electronics, Chandler, AZ; Notice of Termination of Investigation... a petition filed on May 27, 2009, by three workers on behalf of workers of DNS Electronics, Chandler...
Effects of organic acid pickling on the corrosion resistance of magnesium alloy AZ31 sheet
DEFF Research Database (Denmark)
Nwaogu, Ugochukwu Chibuzoh; Blawert, C.; Scharnagl, N.
2010-01-01
Organic acids were used to clean AZ31 magnesium alloy sheet and the effect of the cleaning processes on the surface condition and corrosion performance of the alloy was investigated. Organic acid cleanings reduced the surface impurities and enhanced the corrosion resistance. Removal of at least 4...
Laser cladding of Zr-based coating on AZ91D magnesium alloy for ...
Indian Academy of Sciences (India)
based coating made of Zr powder was fabricated on AZ91D magnesium alloy by laser cladding. The microstructure of the coating was characterized by XRD, SEM and TEM techniques. The wear resistance of the coating was evaluated under dry ...
Compression Deformation Behavior of AZ81 Magnesium Alloy at Elevated Temperatures
Directory of Open Access Journals (Sweden)
Xiaoping Luo
2014-01-01
Full Text Available The hot deformation behavior of an AZ81 magnesium alloy was investigated by hot compressive testing on a Gleeble-1500 thermal mechanical simulator in the temperature range from 200 to 400°C and in the strain rate range of 0.001–5 s−1. The relationships among flow stress, strain rate, and deformation temperature were analyzed, and the deformation activation energy and stress exponent were calculated. The microstructure evolution of the AZ81 magnesium alloy under high deformation was examined. The results indicated that the maximum value of the flow stress increased with the decrease of deformation temperature and the increase of strain rate. When the deformation temperature is constant, the flow stress of the AZ81 magnesium alloy increases with the increase of strain rate, which can be demonstrated by a Zener-Hollomon parameter in a hyperbolic-sine-type equation with a hot compression deformation activation energy of 176.01 KJ/mol and basic hot deformation material factors A, n, and a in the analytical expression of the AZ81 magnesium alloy flow stress of 3.21227×1014 s−1, 7.85, and 0.00866 MPa, respectively.
75 FR 5115 - Temporary Concession Contract for Lake Mead National Recreation Area, AZ/NV
2010-02-01
... concession contract for Lake Mead National Recreation Area. SUMMARY: Pursuant to 36 CFR 51.24, public notice... National Park Service Temporary Concession Contract for Lake Mead National Recreation Area, AZ/NV AGENCY... the conduct of certain visitor services within Lake Mead National Recreation Area, Arizona and Nevada...
75 FR 10552 - Noise Exposure Map Notice for Chandler Municipal Airport, Chandler, AZ
2010-03-08
... Federal Aviation Administration Noise Exposure Map Notice for Chandler Municipal Airport, Chandler, AZ... Administration (FAA) announces its determination that the noise exposure maps submitted by City of Chandler, for...: The effective date of the FAA's determination on the noise exposure maps is February 19, 2010. FOR...
76 FR 30907 - Proposed Foreign-Trade Zone-Eloy, AZ; Application
2011-05-27
... Foreign-Trade Zones Board Proposed Foreign-Trade Zone--Eloy, AZ; Application An application has been submitted to the Foreign-Trade Zones Board (the Board) by the City of Eloy to establish a general-purpose foreign- trade zone at sites in Pinal County, Arizona, adjacent to the Phoenix U.S. Customs and Border...
Selectividad de caña de azúcar en bovinos
Directory of Open Access Journals (Sweden)
E. M. Aranda
2009-01-01
Full Text Available Se condujo este trabajo con el objetivo de conocer la aceptación del forraje de caña de azúcar integral en la dieta con base de pasto para bovinos adultos fistulados en rumen y duodeno estabulados; para ello, se ofreció pasto estrella africana (Cynodon plectostachyus y caña de azúcar (Saccharum officinarum mezclada con 1% de urea a voluntad, por separado. Se midió la composición de los alimentos, consumo de materia seca, pH ruminal y duodenal. Se utilizaron técnicas de la estadística descriptiva, como la media aritmética y error estándar. La proteína, paredes celulares y hemicelulosa fueron mayores para el pasto estrella. El consumo de MS fue de 46.6 y 38.1% para la caña de azúcar y el pasto, respectivamente; el pH ruminal tuvo valores de 7.3, disminuyendo a 6.7 a las 12 h.; y el pH de la digesta duodenal osciló de 3.7 a 4.7. Se concluye que hubo mayor aceptación por la caña de azúcar y el pH ruminal no indica valores que afecten la celulólisis ruminal.
78 FR 40381 - Establishment of Class E Airspace; Grand Canyon, AZ
2013-07-05
...This action establishes Class E airspace at the Grand Canyon VHF Omni-Directional Radio Range/Distance Measuring Equipment (VOR/DME) navigation aid, Grand Canyon, AZ, to facilitate vectoring of Instrument Flight Rules (IFR) aircraft under control of Los Angeles Air Route Traffic Control Center (ARTCC). This improves the safety and management of IFR operations within the National Airspace System.
75 FR 35504 - San Rafael Cattle Company; Habitat Conservation Plan; Santa Cruz County, AZ
2010-06-22
... Fish and Wildlife Service San Rafael Cattle Company; Habitat Conservation Plan; Santa Cruz County, AZ... Conservation Plan in support of incidental take permit application. SUMMARY: San Rafael Cattle Company... the future: Sonoran tiger salamander (Ambystoma mavortium stebbinsi), Gila chub (Gila intermedia...
78 FR 63869 - Change of Using Agency for Restricted Areas R-2309 and R-2312, AZ
2013-10-25
... Federal Aviation Administration 14 CFR Part 73 RIN 2120-AA66 Change of Using Agency for Restricted Areas R-2309 and R-2312, AZ AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final rule. SUMMARY: This action updates the name of the using agency for Restricted Areas R-2309 and R-2312 located in...
2012-04-04
... Manufacturing Authority; Suntech Arizona, Inc., (Solar Panel Manufacturing), Goodyear, AZ An application has... 275 and 290 watt solar panels for industrial use. Components and materials sourced from abroad... to choose the duty rates during customs entry procedures that apply to solar panels (duty-free) for...
Synthesis of dittmarite/Mg(OH){sub 2} composite coating on AZ31 using hydrothermal treatment
Energy Technology Data Exchange (ETDEWEB)
Zhao, Qing, E-mail: qzhaoyuping@bit.edu.cn; Mahmood, Waqas; Zhu, Yanying
2016-03-30
Highlights: • Synthesis of dittmarite Mg(OH){sub 2} coating on AZ31 alloy by hydrothermal method. • The mechanism of composite coating growth and its characterizations. • The coating is corrosion resistant significantly. • Lack of hydroxyl deposition on the coating surface. • Strong adhesion between the coating and the substrate. • The synthesized coating meets the cytotoxicity standards. - Abstract: In this work, we have used hydrothermal method for the synthesis of dittmarite/Mg(OH){sub 2} composite (DMC) layer on AZ31 alloy of magnesium. The synthesized coating was characterized by X-ray diffraction (XRD), field emission scanning electron microscopy (FESEM) and energy dispersive X-ray spectroscopy (EDS). In a test immersion into the Hank's mixture for 31 days, the synthesized coating inhibited corrosion of AZ31 significantly and the amorphous calcium apatite precursor deposited on the coating surface. In another tape test, we noticed strong adhesion between the coating and substrate that eventually concludes that the synthesized coating is hydrophilic and a promising candidate to be used in the absorbable implant materials. Besides, the cytotoxicity of the AZ31 alloy with DMC coating, grown under different conditions on L-929 cells in vitro was examined indirectly through the growth inhibition method (MTT assay). The cytotoxicity of the deposited coating lie between 0 ∼ 1 that indicates it as a promising biomaterial.
Microstructure of Magnesium alloy AZ91-HP cast in permanent and non-permanent moulds
DEFF Research Database (Denmark)
Tiedje, Niels; Sørensen, Rasmus Kirkegaard; Albachari, Sami
2003-01-01
Casting of different geometries were made with AZ91-HP in different moulding media, so that a range of cooling conditions were obtained. Cooling curves were measured and compared to the microstructures found in the castings. It was shown that segregation in the alloy is highly dependent on cooling...
Radioisotope inventory of T101AZ thermocouple tree from riser 13D
Energy Technology Data Exchange (ETDEWEB)
Kessler, S.F., Westinghouse Hanford
1996-06-12
The radionuclide inventory for the thermocouple tree removed from tank T101-AZ riser 13D was estimated using measured {sup 137}Cs activity. This activity was measured by detectors as the tree was removed from the tank. Other radionuclide activities were estimated using the results of tank samples.
Analysis of dynamic deformation behavior of AZ31 using Taylor Rod on Anvil Impact Tests
Sharma, Maruwada Sukanya; Kirtley, Daniel; Gokhale, Arun; Thadhani, Naresh
2017-06-01
The dynamic behavior and detailed microstructural characterization of rolled magnesium alloy AZ31 is described in this work. Magnesium alloys have gained considerable importance as they possess a high strength-to-weight ratio. The goal of the current work is to provide an insight on the dynamic deformation of AZ31 magnesium alloys. Taylor rod-on-anvil impact tests have been conducted at different velocities, on rods machined along the rolling and transverse directions of the as-rolled AZ31 plate, in order to capture the effects of anisotropy on the dynamic deformation behavior. The experiments used laser beam interruption to measure the impact velocity of the samples and high-speed digital imaging to capture transient deformation states. The impacted samples showed anisotropic deformation resulting in an elliptical impact surface foot print. Additionally, detailed orientation maps and micrographs revealed extensive twinning along with some cracks on the impact faces of the samples. Quantitative microscopy revealed that the surface area per unit volume of twins at least tripled under all impact conditions. In this presentation evolution of microstructure and anisotropy in rolled AZ31 samples subjected to Taylor rod-on-anvil impact tests will be discussed.
DEFF Research Database (Denmark)
Schmidt, Garbi
2012-01-01
A prominent strand within current migration research argues that, to understand the participation of immigrants in their host societies, we must focus on their incorporation into the cities in which they settle. This article narrows the perspective further by focusing on the role that immigrants...... play within one particular neighbourhood: Nørrebro in the Danish capital, Copenhagen. The article introduces the concept of grounded politics to analyse how groups of Muslim immigrants in Nørrebro use the space, relationships and history of the neighbourhood for identity political statements...
Az adóráták és a korrupció hatása az adóbevételekre. Az OECD-országok összehasonlítása, 2000-2004
Lackó, Mária
2009-01-01
A tanulmány az adóráták (különös tekintettel a munkát sújtó adórátákra) és a korrupció szintjének (mint extraadónak) az együttes hatását vizsgálja az adóbevételek GDP-hez viszonyított arányára 27 OECD-ország 2000-2004. évi adatai alapján. Az adóéknek a korrupció szintjével kombinált interakciója és a megfelelő adóbevételek közötti grafikus ábrázolásban egy Laffer-görbe típusú kapcsolat látható. A cikk megmutatja, hogy ez az összefüggés több egymástól elkülöníthető hatás eredője: az egyik az a...
Elizabeth Abagail Sampson
2015-01-01
El estudio aborda el tema de la dictadora en La dama de cristal (1999), de Zelmar Acevedo Díaz (Argentina, 1951). Se comparan con otras novelas sobre el mismo tema y se examinan coincidencias o disparidades entre la representación literaria femenina y masculina del autoritarismo. La dictadura latinoamericana como fenómeno político ha persistido en América Latina con diferentes matices ideológicos. Gabriel García Márquez en El otoño del patriarca, Mario Vargas Llosa en La fiesta del Chivo o Lu...
Bioetanol de la caña de azúcar
Directory of Open Access Journals (Sweden)
N. Aguilar-Rivera
2007-01-01
Full Text Available La búsqueda de la viabilidad y desarrollo de la agroindustria de la caña de azúcar es ya una política imperativa. La producción de caña y azúcar constituyen la principal agroindustria del país, con presencia en 57 ingenios azucareros, localizados en 15 estados de la república. Sin embargo, la actual ineficiencia productiva, altos costos y otras causas como la entrada de jarabe de maíz de alta fructosa (HFCS de menor costo han desplazado el consumo interno de azúcar de caña, principalmente en bebidas embotelladas. Todos estos factores han contribuido a la actual y prolongada crisis del sector azucarero. Por lo tanto, la industria debe reestructurarse y reducir la producción de azúcar hacia la competitividad, con la alternativa del etanol combustible en la búsqueda de un futuro para la industria azucarera en México. Con la producción de etanol (EtOH a gran escala, por parte de los ingenios azucareros, es posible visualizar un nuevo y futuro mercado de uso de energías renovables en México, oportunidades para la exportación e incrementar los beneficios ambientales y económicos a través de su uso. La flexibilidad de la producción combinada, de azúcar y etanol en los ingenios, permitirá alcanzar esquemas y objetivos ambientales como nación. Para la industria azucarera, su mayor competidesafío, en este sentido, representa disminuir los costos actuales de producción de etanol a través del uso de la ingeniería genética, uso de diferentes materias primas y la totalidad de la planta de caña de azúcar e introducir mejoras tecnológicas.
DEFF Research Database (Denmark)
Marfelt, Mikkel Mouritz
2016-01-01
Purpose – The purpose of this paper is to build on contemporary intersectional literature to develop a grounded methodological framework for the study of social differences. Design/methodology/approach – A systematic literature review serves as the foundation for a discussion of the challenges...... associated with intersectional research. The findings assist in positioning the proposed methodological framework within recent intersectional debates. Findings – The review shows a rise in intersectional publications since the birth of the “intersectionality” term in 1989. Moreover, the paper points to four...... tensions within the field: a tension between looking at or beyond oppression; a tension between structural-oriented and process-oriented perspectives; an apparent incommensurability among the macro, meso, and micro levels of analysis; and a lack of coherent methodology. Research limitations...
Yang, Yuansheng; Zhao, Fuze; Feng, Xiaohui
2017-10-01
The dispersion of carbon nanotubes (CNTs) in AZ91D melt by ultrasonic processing and microstructure formation of CNTs/AZ91D composite were studied using numerical and physical simulations. The sound field and acoustic streaming were predicted using finite element method. Meanwhile, optimal immersion depth of the ultrasonic probe and suitable ultrasonic power were obtained. Single-bubble model was used to predict ultrasonic cavitation in AZ91D melt. The relationship between sound pressure amplitude and ultrasonic cavitation was established. Physical simulations of acoustic streaming and ultrasonic cavitation agreed well with the numerical simulations. It was confirmed that the dispersion of carbon nanotubes was remarkably improved by ultrasonic processing. Microstructure formation of CNTs/AZ91D composite was numerically simulated using cellular automation method. In addition, grain refinement was achieved and the growth of dendrites was changed due to the uniform dispersion of CNTs.
Li, Hui; Zhang, Jiansheng
2017-12-01
The evolution of microstructures, corrosion resistance and mechanical properties of AZ80 joints using an ultrasonic vibration assisted welding process is investigated. The results show that, with ultrasonic vibration treatment, a reliable AZ80 joint without defects is obtained. The coarsening α-Mg grains are refined to about 83.5 ± 3.3 µm and the continuous β-Mg17Al12 phases are broken to granular morphology, owing to the acoustic streaming effect and the cavitation effect evoked by ultrasonic vibration. Both immersion and electrochemical test results indicate that the corrosion resistance of the AZ80 joint welded with ultrasonic vibration is improved, attributed to microstructure evolution. With ultrasonic power of 900 W, the maximum tensile strength of an AZ80 specimen is 261 ± 7.5 MPa and fracture occurs near the heat affected zone of the joint.
Corrosion behavior of friction stir welded AZ31B Mg alloy - Al6063 alloy joint
Directory of Open Access Journals (Sweden)
B. Ratna Sunil
2016-12-01
Full Text Available In the present work, AZ31B Mg alloy and Al6063 alloy-rolled sheets were successfully joined by friction stir welding. Microstructural studies revealed a sound joint with good mechanical mixing of both the alloys at the nugget zone. Corrosion performance of the joint was assessed by immersing in 3.5% NaCl solution for different intervals of time and the corrosion rate was calculated. The joint has undergone severe corrosion attack compared with both the base materials (AZ31B and Al6063 alloys. The predominant corrosion mechanism behind the high corrosion rate of the joint was found to be high galvanic corrosion. From the results, it can be suggested that the severe corrosion of dissimilar Mg–Al joints must be considered as a valid input while designing structures intended to work in corroding environment.
Hardness evolution of AZ80 magnesium alloy processed by HPT at different temperatures
Directory of Open Access Journals (Sweden)
Saad A. Alsubaie
2017-10-01
Full Text Available Discs of an extruded AZ80 magnesium alloy were processed by high-pressure torsion (HPT using 6.0 GPa up to 10 turns at different temperatures (296 K and 473 K. The disc surfaces and cross-sectional planes were examined before and after processing using scanning electron microscopy (SEM and Vickers microhardness (Hv. The microhardness results at the surface show differences in the strength of the material as a function of distance from the disc centres up to saturation, as well as a function of distance from the bottom to the surface in the cross-sectional plane. This study analyses the effect of processing temperature on the evolution of microhardness in the AZ80 magnesium alloy processed by high-pressure torsion. Keywords: Hardness, High-pressure torsion, Magnesium alloy, Severe plastic deformation
Directory of Open Access Journals (Sweden)
Agnieszka Witecka, Akiko Yamamoto, Henryk Dybiec and Wojciech Swieszkowski
2012-01-01
Full Text Available Mg alloys with high Al contents have superior corrosion resistance in aqueous environments, but poor cytocompatibility compared to that of pure Mg. We have silanized the cast AZ91 alloy to improve its cytocompatibility using five different silanes: ethyltriethoxysilane (S1, 3-aminopropyltriethoxysilane (S2, 3-isocyanatopyltriethoxysilane (S3, phenyltriethoxysilane (S4 and octadecyltriethoxysilane (S5. The surface hydrophilicity/hydrophobicity was evaluated by water contact angle measurements. X-ray photoelectron analysis was performed to investigate the changes in surface states and chemical composition. All silane reagents increased adsorption of the albumin to the modified surface. In vitro cytocompatibility evaluation revealed that silanization improved cell growth on AZ91 modified by silane S1. Measurement of the concentration of Mg2+ ions released during the cell culture indicated that silanization does not affect substrate degradation.
Study on Corrosion and Stress Corrosion Cracking Behaviors of AZ31 Alloy in Sodium Sulfate Solution
He, Xiuli; Yan, Zhifeng; Liang, Hongyu; Wei, Yinghui
2017-05-01
The potentiodynamic polarization test and slow strain rate tensile test were carried out in 3.5 wt.% Na2SO4 solution with different pH values (2, 7, and 12). It was found that the SCC susceptibility of AZ31 magnesium alloy in 3.5 wt.% Na2SO4 solution was deteriorated significantly with the decreasing pH. This was consistent with the electrochemical properties. There were filiform corrosion forms on the specimen surface after slow strain rate tensile test in 3.5 wt.% Na2SO4 solution, which indicated the characteristics of general corrosion. Moreover, there were multiple stress corrosion crack initiation sources. The SCC fracture of AZ31 magnesium alloy in air was a mix type, while it was cleavage fracture in 3.5 wt.% Na2SO4 solution.
Directory of Open Access Journals (Sweden)
Masafumi Noda
2011-01-01
Full Text Available Magnesium alloys can be used for reducing the weight of various structural products, because of their high specific strength. They have attracted considerable attention as materials with a reduced environmental load, since they help to save both resources and energy. In order to use Mg alloys for manufacturing vehicles, it is important to investigate the deformation mechanism and transition point for optimizing the material and vehicle design. In this study, we investigated the transition of the deformation mechanism during the high-temperature uniaxial tensile deformation of the AZ31 Mg alloy. At a test temperature of 523 K and an initial strain rate of 3×10−3 s-1, the AZ31 Mg alloy (mean grain size: ~5 μm exhibited stable deformation behavior and the deformation mechanism changed to one dominated by grain boundary sliding.
Hammer forging process of lever drop forging from AZ31 magnesium alloy
Directory of Open Access Journals (Sweden)
A. Gontarz
2013-07-01
Full Text Available The results of theoretical and experimental analysis of hammer forging process of lever drop forging from AZ31 magnesium alloy are presented in this paper. In order to design a process guaranteeing obtaining a proper product, numerous simulations were made, in which material flow kinematics, strain and damage criterion distributions and forging energy were analyzed. On the basis of the obtained results, the analysis of limiting phenomena, which could appear during the process, was made. Experimental tests in industrial conditions according to designed technology were carried out. Good quality of drop forgings were obtained. On the basis of conducted research, it was stated that hammer forging of lever drop forging from AZ31 magnesium alloy is possible.
Theoretical and experimental research of hammer forging process of RIM from AZ31 magnesium alloy
Directory of Open Access Journals (Sweden)
A. Gontarz
2014-10-01
Full Text Available The results of theoretical analysis and experimental tests of hammer forging process of rim part from AZ31 magnesium alloy are presented in this paper. On the basis of numerical simulation results, the analysis of limiting phenomena was made. These phenomena include: possibility of overlapping presence, not filling of die impression, overheating of material and cracks. The results of theoretical analysis provided the support for planning of experimental tests in industrial conditions. Forging tests were conducted in one of Polish forming plants, applying steam-air hammer of blow energy 63 kJ. On the basis of experimental verification, it was stated that it is possible to obtain rim forging from AZ31 alloy of assumed quality in the hammer forging process.
Energy Technology Data Exchange (ETDEWEB)
Morrey, E.V.; Tingey, J.M.
1996-04-01
A vitrification plant is planned to process the high-level waste (HLW) solids from Hanford Site tanks into canistered glass logs for disposal in a national repository. Programs have been established within the Pacific Northwest Laboratory Vitrification Technology Development (PVTD) Project to test and model simulated waste to support design, feed processability, operations, permitting, safety, and waste-form qualification. Parallel testing with actual radioactive waste is being performed on a laboratory-scale to confirm the validity of using simulants and glass property models developed from simulants. Laboratory-scale testing has been completed on three radioactive core samples from tanks 101-AZ and 102-AZ containing neutralized current acid waste (NCAW), which is one of the first waste types to be processed in the high-level waste vitrification plant under a privatization scenario. Properties of the radioactive waste measured during process and product testing were compared to simulant properties and model predictions to confirm the validity of simulant and glass property models work. This report includes results from the three NCAW core samples, comparable results from slurry and glass simulants, and comparisons to glass property model predictions.
Directory of Open Access Journals (Sweden)
Elizabeth Abagail Sampson
2015-11-01
Full Text Available El estudio aborda el tema de la dictadora en La dama de cristal (1999, de Zelmar Acevedo Díaz (Argentina, 1951. Se comparan con otras novelas sobre el mismo tema y se examinan coincidencias o disparidades entre la representación literaria femenina y masculina del autoritarismo. La dictadura latinoamericana como fenómeno político ha persistido en América Latina con diferentes matices ideológicos. Gabriel García Márquez en El otoño del patriarca, Mario Vargas Llosa en La fiesta del Chivo o Luis Spota en El tiempo de la ira tratan este hecho para perfilar sus rasgos distintivos. Existe un caso particular en que el autoritarismo lo encarna una mujer. This study focuses on the theme of female dictator in La dama de cristal (1999, by Zelmar Acevedo Díaz (Argentina, 1951. It is compared with other novels on the same theme and an analysis is carried out of coincidences or disparities between the feminine and masculine literary representation of authoritarianism. Latin American dictatorships are a political phenomenon that has persisted in Latin America with different ideological tones. Gabriel García Márquez in El otoño del patriarca; Mario Vargas Llosa in La fiesta del Chivo or Luis Spota in El tiempo de la ira have approached this issue to profile its distinctive features. There is one particular case of a female dictator.
Porfirio Díaz en la historiografía masónica mexicana
Directory of Open Access Journals (Sweden)
Marco Antonio Flores Zavala
2015-01-01
Full Text Available En este artículo se analiza la presencia del general Porfirio Díaz en la historiografía masónica mexicana. Parala redacción de este texto se recurrió a las obras de José María Mateos (Historia de la masonería en Méxicodesde 1806 hasta 1884, Richard Chism (Una contribución a la historia masónica de México y Luis J. Zalce(Apuntes para la historia de la masonería en México, de mis lecturas y mis recuerdos. El cuestionario esbásico: ¿Qué fuentes documentales utilizaron los autores para redactar sus textos? ¿Cómo examinan laactuación del general Díaz, como actor de un régimen o un hermano masón? Pese a lo elemental de laspreguntas, éstas colaboran para situar parte de los tópicos y de las formas en que fueron redactadas lashistorias de la masonería en México. El artículo está integrado con dos secciones. En la primera se esboza unabiografía del general Díaz y se presentan las obras que se definen como historiografía masónica mexicana. Lasegunda sección presenta la descripción de las obras y cómo examinaron la presencia de Díaz en lamasonería.
Thermal stability of magnesium alloy AZ91 prepared by severe plastic deformation
Directory of Open Access Journals (Sweden)
Roman Štěpánek
2013-12-01
Full Text Available This paper deals with the thermal stability of ultrafine-grained alloy AZ91 prepared by means of ECAP (Equal Channel Angular Pressing method. Annealing experiments were conducted isochronally for 30 minutes in the temperature range of 220 to 400 °C in argon atmosphere. EBSD (Electron Backscatter Diffraction method was used to image the changes in microstructure due to increased temperature.
Laser offset welding of AZ31B magnesium alloy to 316 stainless steel
Casalino, G.; Guglielmi, P; LORUSSO, V.D.; MORTELLO, M; PEYRE, P; Sorgente, D.
2016-01-01
In this paper, the feasibility of using a fiber laser to perform a dissimilar metal joining was explored. AZ31B magnesium and 316 stainless steel were autogenously joined in butt configuration. The weldability between different materials is often compromised by a large difference in thermal properties and poor metallurgical compatibility. Thus, the beam was focused onto the top surface of the magnesium plate, at a certain distance from the interfaces (offset), and without using any interlayer...
75 FR 26098 - Safety Zone; Under Water Clean Up of Copper Canyon, Lake Havasu, AZ
2010-05-11
... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Under Water Clean Up of Copper Canyon, Lake....T11-179 to read as follows: Sec. 165.T11-179 Safety zone; Copper Canyon Clean Up, Lake Havasu, AZ. (a... establishing a temporary safety zone on the navigable waters of Lake Havasu in the Copper Canyon in support of...
Superplastic behaviour of an AZ61 alloy processed by equal channel angular extrusion
M. Eddahbi; Ruano, Oscar Antonio
2006-01-01
This study is concerned with microstructural and mechanical characterization of the superplastic behaviour of a magnesium base AZ61 alloy processed by equal channel angular extrusion (ECA). Microscopic examinations showed that the microstructure after ECA was homogeneous and the grain size was about 5 mm. The extruded material showed better mechanical properties than the rolled material. The strain rate sensitivity exponent, at 250ºC, was 0.5 at strain rates ranging from 10-4 to 5 . 10-...
78 FR 25404 - Proposed Establishment of Class E Airspace; Grand Canyon, AZ
2013-05-01
...This action proposes to establish Class E airspace at the Grand Canyon VHF Omni-Directional Radio Range/Distance Measuring Equipment (VOR/DME) navigation aid, Grand Canyon, AZ, to facilitate vectoring of Instrument Flight Rules (IFR) aircraft under control of Los Angeles Air Route Traffic Control Center (ARTCC). The FAA is proposing this action to enhance the safety and management of aircraft operations within the National Airspace System.
El comercio catalán del azúcar en el siglo XIV
Directory of Open Access Journals (Sweden)
Coulon, Damien
2001-12-01
Full Text Available The purpose of this article is to document some aspects of the sugar trade in fourteenth century Catalonia. More especially it aims to highlight the following paradox: Barcelonese traders regularly travelled to Eastern Mediterranean to fetch sugar, yet sugar cane had been introduced in the Iberian Peninsula as early as the tenth century. After presenting the main stages of sugar production until the fourteenth century, the author examines recent works on the history of sugar production in Eastern Mediterranean. He also reviews various documents on the exportation of sugar to Catalonia in the fourteenth century, mostly from the Barcelonese archives. The article ends with a table of the different kinds of sugar produced and exported during the period under review.
Este artículo tiene por objeto presentar algunos aspectos del comercio catalán del azúcar en el siglo XIV y, en particular, resolver la siguiente paradoja: los comerciantes barceloneses iban efectivamente de manera regular a buscar este producto en el Mediterráneo oriental cuando la caña de azúcar había sido introducida en la Península Ibérica desde el siglo X. Después de haber presentado las principales etapas de la expansión de este cultivo hasta el siglo XIV, el autor examina con detalle algunos trabajos recientes relativos a la producción de azúcar en el Mediterráneo oriental así como los documentos que atestiguan su exportación hacia Cataluña en el siglo XIV, centrándose especialmente en las fuentes barcelonesas. El estudio se completa con un cuadro de los diferentes tipos de azúcar encontrados.
Residual stresses of a magnesium alloy (AZ31 welded by the friction stir welding processes
Directory of Open Access Journals (Sweden)
Kouadri-Henni A.
2016-01-01
Full Text Available The objective of this study was to evaluate the residual stresses of FSW welding magnesium alloys (AZ31. The results show that the FSW processes lead to the formation of several distinct zones with differing mechanical properties. The residual stresses evolution have been explained by the heterogeneous modifications of the microstructure particularly a marked decrease in the grain size, a high modification of the crystallographic texture and the different anisotropic properties resulting from plasticity induced by the FSW process.
Theoretical and experimental research of hammer forging process of RIM from AZ31 magnesium alloy
Gontarz, A.
2014-01-01
The results of theoretical analysis and experimental tests of hammer forging process of rim part from AZ31 magnesium alloy are presented in this paper. On the basis of numerical simulation results, the analysis of limiting phenomena was made. These phenomena include: possibility of overlapping presence, not filling of die impression, overheating of material and cracks. The results of theoretical analysis provided the support for planning of experimental tests in industrial conditions. Forging...
Hammer forging process of lever drop forging from AZ31 magnesium alloy
Gontarz, A.; Z. Pater; K. Drozdowski
2013-01-01
The results of theoretical and experimental analysis of hammer forging process of lever drop forging from AZ31 magnesium alloy are presented in this paper. In order to design a process guaranteeing obtaining a proper product, numerous simulations were made, in which material flow kinematics, strain and damage criterion distributions and forging energy were analyzed. On the basis of the obtained results, the analysis of limiting phenomena, which could appear during the process, was made. Exper...
H2A.Z helps genes remember their history so we can remember ours.
Zovkic, Iva B; Walters, Brandon J
2015-06-01
Histone variant exchange is a novel epigenetic regulator of cognition. We speculate that H2A.Z, a variant of canonical histone H2A, exerts unique effects on transcription during distinct stages of memory formation, ultimately acting to maintain memory of previous transcriptional states and poise genes for re-activation. Hippocampus-dependent memory formation is initiated by transient expression of memory-related genes, which support the storage of recently acquired memories. Soon after, memories undergo systems consolidation, which transfers memories from the hippocampus to the cortex for long-term storage, and requires ongoing re-activation of memory-related genes. We speculate that learning-induced H2A.Z eviction from nucleosomes initially contributes to stimulus-induced transcriptional induction needed for the initial process of memory consolidation. During systems consolidation, we speculate that delayed incorporation of H2A.Z into nucleosomes of memory-related genes in the cortex is needed to poise genes for rapid re-activation, thus supporting the long-term process of memory stabilization. © 2015 WILEY Periodicals, Inc.
Profiling gene expression in citrus fruit calyx abscission zone (AZ-C) treated with ethylene.
Cheng, Chunzhen; Zhang, Lingyun; Yang, Xuelian; Zhong, Guangyan
2015-10-01
On-tree storage and harvesting of mature fruit account for a large proportion of cost in the production of citrus, and a reduction of the cost would not be achieved without a thorough understanding of the mechani sm of the mature fruit abscission. Genome-wide gene expression changes in ethylene-treated fruit calyx abscission zone (AZ-C) of Citrus sinensis cv. Olinda were therefore investigated using a citrus genome array representing up to 33,879 citrus transcripts. In total, 1313 and 1044 differentially regulated genes were identified in AZ-C treated with ethylene for 4 and 24 h, respectively. The results showed that mature citrus fruit abscission commenced with the activation of ethylene signal transduction pathway that led to the activation of ethylene responsive transcription factors and the subsequent transcriptional regulation of a large set of ethylene responsive genes. Significantly down-regulated genes included those of starch/sugar biosynthesis, transportation of water and growth promoting hormone synthesis and signaling, whereas significantly up-regulated genes were those involved in defense, cell wall degradation, and secondary metabolism. Our data unraveled the underlying mechanisms of some known important biochemical events occurring at AZ-C and should provide informative suggestions for future manipulation of the events to achieve a controllable abscission for mature citrus fruit.
Directory of Open Access Journals (Sweden)
Muhammad Rashad
2016-12-01
Full Text Available Outstanding mechanical properties of graphene nanoplatelets (GNPs make them ideal reinforcement for mass production of composites. In this research, the composites were fabricated by stir-casting method. GNPs were added in 1.5 and 3.0 wt.% into Mg–3wt.% Al–1wt.% Zn (AZ31 magnesium alloy. As cast ingots were preheated for one hour and extruded at 350 °C with extrusion ratio of 5.2:1. As extruded AZ31-GNPs composites were micro-structurally characterized with X-ray diffraction, optical microscopy and scanning electron microscopy. Vickers micro-hardness of synthesized materials was investigated both in parallel and perpendicular to extrusion directions. Room temperature mechanical testing revealed that with increasing GNP's content, tensile fracture strain was remarkably increased without significant compromise in tensile strength. Furthermore, as extruded AZ31-3GNPs composites were subjected to tensile testing at temperatures ranging from 75 °C to 300 °C with initial strain rate of 2 × 10−3 s−1 to evaluate high temperature formability of composite. It was found that like CNTs, GNPs also have the potential to sustain tensile strength at high temperatures.
Cerium Addition Improved the Dry Sliding Wear Resistance of Surface Welding AZ91 Alloy
Directory of Open Access Journals (Sweden)
Qingqiang Chen
2018-02-01
Full Text Available In this study, the effects of cerium (Ce addition on the friction and wear properties of surface welding AZ91 magnesium alloys were evaluated by pin-on-disk dry sliding friction and wear tests at normal temperature. The results show that both the friction coefficient and wear rate of surfacing magnesium alloys decreased with the decrease in load and increase in sliding speed. The surfacing AZ91 alloy with 1.5% Ce had the lowest friction coefficient and wear rate. The alloy without Ce had the worst wear resistance, mainly because it contained a lot of irregularly shaped and coarse β-Mg17Al12 phases. During friction, the β phase readily caused stress concentration and thus formed cracks at the interface between β phase and α-Mg matrix. The addition of Ce reduced the size and amount of Mg17Al12, while generating Al4Ce phase with a higher thermal stability. The Al-Ce phase could hinder the grain-boundary sliding and migration and reduced the degree of plastic deformation of subsurface metal. Scanning electron microscopy observation showed that the surfacing AZ91 alloy with 1.5% Ce had a total of four types of wear mechanism: abrasion, oxidation, and severe plastic deformation were the primary mechanisms; delamination was the secondary mechanism.
Cerium Addition Improved the Dry Sliding Wear Resistance of Surface Welding AZ91 Alloy.
Chen, Qingqiang; Zhao, Zhihao; Zhu, Qingfeng; Wang, Gaosong; Tao, Kai
2018-02-06
In this study, the effects of cerium (Ce) addition on the friction and wear properties of surface welding AZ91 magnesium alloys were evaluated by pin-on-disk dry sliding friction and wear tests at normal temperature. The results show that both the friction coefficient and wear rate of surfacing magnesium alloys decreased with the decrease in load and increase in sliding speed. The surfacing AZ91 alloy with 1.5% Ce had the lowest friction coefficient and wear rate. The alloy without Ce had the worst wear resistance, mainly because it contained a lot of irregularly shaped and coarse β-Mg 17 Al 12 phases. During friction, the β phase readily caused stress concentration and thus formed cracks at the interface between β phase and α-Mg matrix. The addition of Ce reduced the size and amount of Mg 17 Al 12 , while generating Al₄Ce phase with a higher thermal stability. The Al-Ce phase could hinder the grain-boundary sliding and migration and reduced the degree of plastic deformation of subsurface metal. Scanning electron microscopy observation showed that the surfacing AZ91 alloy with 1.5% Ce had a total of four types of wear mechanism: abrasion, oxidation, and severe plastic deformation were the primary mechanisms; delamination was the secondary mechanism.
Characteristics of AZ31 Mg alloy joint using automatic TIG welding
Liu, Hong-tao; Zhou, Ji-xue; Zhao, Dong-qing; Liu, Yun-teng; Wu, Jian-hua; Yang, Yuan-sheng; Ma, Bai-chang; Zhuang, Hai-hua
2017-01-01
The automatic tungsten-inert gas welding (ATIGW) of AZ31 Mg alloys was performed using a six-axis robot. The evolution of the microstructure and texture of the AZ31 auto-welded joints was studied by optical microscopy, scanning electron microscopy, energy-dispersive X-ray spectroscopy, and electron backscatter diffraction. The ATIGW process resulted in coarse recrystallized grains in the heat affected zone (HAZ) and epitaxial growth of columnar grains in the fusion zone (FZ). Substantial changes of texture between the base material (BM) and the FZ were detected. The {0002} basal plane in the BM was largely parallel to the sheet rolling plane, whereas the c-axis of the crystal lattice in the FZ inclined approximately 25° with respect to the welding direction. The maximum pole density increased from 9.45 in the BM to 12.9 in the FZ. The microhardness distribution, tensile properties, and fracture features of the AZ31 auto-welded joints were also investigated.
RGDC Peptide-Induced Biomimetic Calcium Phosphate Coating Formed on AZ31 Magnesium Alloy
Cao, Lin; Wang, Lina; Fan, Lingying; Xiao, Wenjun; Lin, Bingpeng; Xu, Yimeng; Liang, Jun; Cao, Baocheng
2017-01-01
Magnesium alloys as biodegradable metal implants have received a lot of interest in biomedical applications. However, magnesium alloys have extremely high corrosion rates a in physiological environment, which have limited their application in the orthopedic field. In this study, calcium phosphate compounds (Ca–P) coating was prepared by arginine–glycine–aspartic acid–cysteine (RGDC) peptide-induced mineralization in 1.5 simulated body fluid (SBF) to improve the corrosion resistance and biocompatibility of the AZ31 magnesium alloys. The adhesion of Ca–P coating to the AZ31 substrates was evaluated by a scratch test. Corrosion resistance and cytocompatibility of the Ca–P coating were investigated. The results showed that the RGDC could effectively promote the nucleation and crystallization of the Ca–P coating and the Ca–P coating had poor adhesion to the AZ31 substrates. The corrosion resistance and biocompatibility of the biomimetic Ca–P coating Mg alloys were greatly improved compared with that of the uncoated sample. PMID:28772717
Microstructures and tensile properties of submerged friction stir processed AZ91 magnesium alloy
Directory of Open Access Journals (Sweden)
Fang Chai
2015-09-01
Full Text Available 6 mm thick AZ91 casting alloy plates were subjected to normal friction stir processing (NFSP, in air and submerged friction stir processing (SFSP, under water, and microstructures and tensile properties of the experimental materials were investigated. After FSP, the coarse microstructures in the as-cast condition are replaced by fine and equiaxed grains and the network-like eutectic β-Mg17Al12 phases disappear and are changed into particles pinned at the grain boundaries. SFSP results in further grain refinement in comparison with NFSP, and the average grain sizes of the NFSP and SFSP alloys are 8.4 ± 1.3 and 2.8 ± 0.8 µm, respectively. XRD results reveal that the intensity of β-Mg17Al12 diffraction peaks in the SFSP specimen decreases compared with NFSP. Due to significant grain refinement, the tensile strength and elongation of the SFSP AZ91 alloy are increased from 262 MPa and 18.9% for the NFSP material to 282 MPa and 25.4%, and the tensile strength (282 MPa is nearly three times that of the BM (105 MPa. SFSP is an effective approach to refine the grain size and enhance the tensile properties of AZ91 casting alloy.
Study on fluidity of squeeze cast AZ91D magnesium alloy with different wall thicknesses
Directory of Open Access Journals (Sweden)
Chen Yun
2014-03-01
Full Text Available Rectangular cross-section specimens with different section thicknesses were prepared to study the influences of pouring temperature, mould temperature and squeeze velocity on the fluidity of squeeze cast AZ91D magnesium alloy by means of orthogonal test design method. The results show that pouring temperature, mould temperature and squeeze velocity can significantly affect the fluidity of magnesium alloy specimens with wall thickness no more than 4 mm, and the pouring temperature is the most influential factor on the fluidity of specimens with wall thickness of 1, 2 and 3 mm, while mould temperature is the one for specimens with wall thickness of 4 mm. Increasing pouring temperature between 700 °C and 750 °C is beneficial to the fluidity of AZ91D magnesium alloy, and increasing mould temperature significantly enhances the filling ability of thick (3 and 4 mm section castings. The fluidity of squeeze cast magnesium alloy increases with the increase of wall thickness. It is not recommended to produce magnesium alloy casting with wall thickness of smaller than 3 mm by squeeze cast process due to the poor fluidity. The software DPS was used to generate the regression model, and linear regression equations of the fluidity of squeeze cast AZ91D with different wall thicknesses are obtained using the test results.
Directory of Open Access Journals (Sweden)
Thomas J Wood
Full Text Available The incorporation of histone variants into nucleosomes is a critical mechanism for regulating essential DNA-templated processes and for establishing distinct chromatin architectures with specialised functions. H2A.Z is an evolutionarily conserved H2A variant that has diverse roles in transcriptional regulation, heterochromatin boundary definition, chromosome stability and DNA repair. The H2A.Z C-terminus diverges in sequence from canonical H2A and imparts unique functions to H2A.Z in the yeast S. cerevisiae. Although mediated in part through the acid patch-containing M6 region, many molecular determinants of this divergent structure-function relationship remain unclear. Here, by using an unbiased random mutagenesis screen of H2A.Z alleles, we identify point mutations in the C-terminus outside of the M6 region that disrupt the normal function of H2A.Z in response to cytotoxic stress. These functional defects correlate with reduced chromatin association, which we attribute to reduced physical stability within chromatin, but also to altered interactions with the SWR and INO80 chromatin remodeling complexes. Together with experimental data, computational modelling of these residue changes in the context of protein structure suggests the importance of C-terminal domain integrity and configuration for maintaining the level of H2A.Z in nucleosomes.
Euthanasia: above ground, below ground.
Magnusson, R S
2004-10-01
The key to the euthanasia debate lies in how best to regulate what doctors do. Opponents of euthanasia frequently warn of the possible negative consequences of legalising physician assisted suicide and active euthanasia (PAS/AE) while ignoring the covert practice of PAS/AE by doctors and other health professionals. Against the background of survey studies suggesting that anything from 4% to 10% of doctors have intentionally assisted a patient to die, and interview evidence of the unregulated, idiosyncratic nature of underground PAS/AE, this paper assesses three alternatives to the current policy of prohibition. It argues that although legalisation may never succeed in making euthanasia perfectly safe, legalising PAS/AE may nevertheless be safer, and therefore a preferable policy alternative, to prohibition. At a minimum, debate about harm minimisation and the regulation of euthanasia needs to take account of PAS/AE wherever it is practised, both above and below ground.
Lactancia materna, alimentación artificial y el primer contacto con azúcar
Directory of Open Access Journals (Sweden)
Fabian Calixto Fraiz
2013-01-01
Full Text Available Objetivo: Este estudio evaluó los cambios en el patrón de lactancia materna, alimentación artificial y en la introducción de azúcar en la dieta de niños de 0 a 36 meses, a través de dos estudios, con un intervalo de 13 años en la ciudad de Curitiba, Paraná, Brasil. Material y métodos: Poblaciones semejantes de una misma región geográfica fueron evaluadas a través de un cuestionario, en los años de 1993 y 2006, envolviendo, respectivamente, las madres de 180 y 94 niños. Introducción de azúcar en la dieta fue considerada precoz cuando ocurrió antes del 6º mes completo de vida. Los datos fueron analizados estadísticamente a través del test de qui-cuadrado y test exacto de Fisher (α= 0,05. Resultados: Hubo diferencias en la frecuencia del primer contacto con azúcar (p <0,001, que ocurrió en el primer mes de vida en 61,7% de los niños del primer estudio y en sólo 3,2% de los niños del segundo estudio. Hubo diferencias en el patrón de lactancia materna (p = 0,02, siendo la prevalencia de niños amamantados mayor en el segundo estudio. No fueron encontradas diferencias estadísticamente significativas en la prevalencia de uso de biberón, uso de biberón durante la noche y lactancia materna durante la noche, así como en el uso de biberón conteniendo azúcar. Conclusiones: Estos resultados indican que la lactancia materna puede, además de sus varias ventajas, también promover el aplazamiento de la introducción de azúcar en la dieta infantil. Nuevas investigaciones son necesarias para confirmar esta hipótesis.
Directory of Open Access Journals (Sweden)
Vidya Subramanian
Full Text Available The histone H2A variant H2A.Z is essential for embryonic development and for proper control of developmental gene expression programs in embryonic stem cells (ESCs. Divergent regions of amino acid sequence of H2A.Z likely determine its functional specialization compared to core histone H2A. For example, H2A.Z contains three divergent residues in the essential C-terminal acidic patch that reside on the surface of the histone octamer as an uninterrupted acidic patch domain; however, we know little about how these residues contribute to chromatin structure and function. Here, we show that the divergent amino acids Gly92, Asp97, and Ser98 in the H2A.Z C-terminal acidic patch (H2A.Z(AP3 are critical for lineage commitment during ESC differentiation. H2A.Z is enriched at most H3K4me3 promoters in ESCs including poised, bivalent promoters that harbor both activating and repressive marks, H3K4me3 and H3K27me3 respectively. We found that while H2A.Z(AP3 interacted with its deposition complex and displayed a highly similar distribution pattern compared to wild-type H2A.Z, its enrichment levels were reduced at target promoters. Further analysis revealed that H2A.Z(AP3 was less tightly associated with chromatin, suggesting that the mutant is more dynamic. Notably, bivalent genes in H2A.Z(AP3 ESCs displayed significant changes in expression compared to active genes. Moreover, bivalent genes in H2A.Z(AP3 ESCs gained H3.3, a variant associated with higher nucleosome turnover, compared to wild-type H2A.Z. We next performed single cell imaging to measure H2A.Z dynamics. We found that H2A.Z(AP3 displayed higher mobility in chromatin compared to wild-type H2A.Z by fluorescent recovery after photobleaching (FRAP. Moreover, ESCs treated with the transcriptional inhibitor flavopiridol resulted in a decrease in the H2A.Z(AP3 mobile fraction and an increase in its occupancy at target genes indicating that the mutant can be properly incorporated into chromatin
Page 1 238 S Kesavan 5. Conclusion It has been proved that non ...
Indian Academy of Sciences (India)
which has been used only to prove the existence of a solution via a priori estimates. Indeed this condition can be removed and replaced by any other which guarantees the existence of a non-singular solution of the homogenized problem alone. Then the method of this paper can be used to prove (without new hypotheses) ...
Energy Technology Data Exchange (ETDEWEB)
Catorceno, L.L.C.; Zimmermann, A.J.O.; Padilha, A.F., E-mail: litzy.catorceno@poli.usp.b [Universidade de Sao Paulo (DEMM/EP/USP), SP (Brazil). Escola Politecnica. Dept. de Engenharia Metalurgica e de Materiais
2010-07-01
The magnesium alloy AZ31B presents an interesting set of properties, which makes it potential candidate for applications in automotive and aeronautics. The main limitation of magnesium alloys is the low capacity of plastic forming at room temperature. The main motivation of this project is to understand and control the microstructure and crystallographic texture of magnesium alloys, to improve their formability. The effect of rolling temperature on the formability of the alloy was studied in this stage of the project. The alloy in the form of annealed and recrystallized sheets (2 mm thick) was deformed by rolling at four different temperatures: 25, 100, 200 and 250 deg C. The microstructural characterization was achieved using several complementary techniques of microstructural analysis, such as optical microscopy, scanning electron microscopy, X-ray analysis by energy dispersive, X-ray diffraction and microhardness. Results about the effect of rolling temperature on the alloy formability were presented and discussed. (author)
Effects of sintering temperature on the corrosion behavior of AZ31 alloy with Ca–P sol–gel coating
Energy Technology Data Exchange (ETDEWEB)
Niu, Bo [School of Materials Science and Engineering, Liaoning University of Technology, Jinzhou, Liaoning Province, 121001 (China); Shi, Ping, E-mail: p_shi@sohu.com [School of Materials Science and Engineering, Liaoning University of Technology, Jinzhou, Liaoning Province, 121001 (China); Wei, Donghua [School of Materials Science and Engineering, Liaoning University of Technology, Jinzhou, Liaoning Province, 121001 (China); E, Shanshan [School of Mathematics and Physics, Bohai University, Jinzhou, Liaoning Province, 121013 (China); Li, Qiang; Chen, Yang [School of Materials Science and Engineering, Liaoning University of Technology, Jinzhou, Liaoning Province, 121001 (China)
2016-04-25
To slow down the initial biodegradation rate of magnesium alloy, calcium phosphate (Ca–P) coatings were prepared on AZ31 magnesium alloy by a sol–gel technique. To study the effects of sintering temperature on microstructure, bonding strength and corrosion behavior of the coatings, scanning electron microscopy (SEM), energy dispersive spectroscopy (EDS), X-ray diffraction (XRD) and an adhesive strength test were used to characterize the coatings. The corrosion resistance of the coatings was investigated by immersion test and electrochemical corrosion techniques in simulated body fluid (SBF) solution. It shows that the sol–gel coatings consist of Ca{sub 2}P{sub 2}O{sub 7}, mixture of Ca{sub 2}P{sub 2}O{sub 7}, Ca{sub 3}(PO{sub 4}){sub 2} and hydroxyapatite, and hydroxyapatite, by sintering respectively at 300 °C, 400 °C and 500 °C. There are major cracks on the coatings. The crack area portion on the coating and the bonding strength at the interface between the calcium phosphate coating and the bare AZ31 increases, and the corrosion resistance of the coated AZ31 in SBF decreases with increasing sintering temperatures from 300 °C to 500 °C. Based on our investigations, the corrosion resistance of the coated AZ31 in SBF depends mainly on the crack area portion on the coatings, rather than on the coating phase stability. - Highlights: • Ca–P coating was prepared on AZ31 alloy by a sol–gel technique. • Crack area portion in the coating increases with temperatures. • Bonding strength between Ca–P coating and substrate increases with temperatures. • Corrosion resistance of the coated AZ31 in SBF decreases with temperatures. • Corrosion resistance of the coated AZ31 depends mainly on the crack area portion.
Zhang, Kang; Xu, Wenying; Wang, Chunchao; Yi, Xin; Zhang, Wenli; Su, Zhen
2017-01-01
As a histone variant, H2A.Z is highly conserved among species and plays a significant role in diverse cellular processes. Here, we generated genome-wide maps of H2A.Z in Oryza sativa (rice) callus and seedling by combining chromatin immunoprecipitation using H2A.Z antibody and high-throughput sequencing. We found a significantly high peak and a small peak of H2A.Z distributed at the 5' and 3' ends of highly expressed genes, respectively. H2A.Z was also associated with inactive genes in both tissues. H3 lysine 4 trimethylation was associated with H2A.Z deposition at the 5' end of expressed genes, and H3 lysine 27 trimethylation peaks were partially associated with H2A.Z. In summary, our study provides global analysis data for the distribution of H2A.Z in the rice genome. Our results demonstrate that the differential deposition of H2A.Z might play important roles in gene transcription during rice development. © 2016 The Authors The Plant Journal © 2016 John Wiley & Sons Ltd.
Energy Technology Data Exchange (ETDEWEB)
Jia, Ruiling, E-mail: jrl014014@163.com [College of Materials Science and Engineering, Inner Mongolia University of Technology, Hohhot, Inner Mongolia 010051 (China); Zhang, Ming; Zhang, Lina [College of Materials Science and Engineering, Inner Mongolia University of Technology, Hohhot, Inner Mongolia 010051 (China); Zhang, Wei [Laboratory for Corrosion and Protection, Institute of Metal Research, Chinese Academy of Sciences, 62 Wencui Road, Shenyang 110016 (China); Guo, Feng [College of Materials Science and Engineering, Inner Mongolia University of Technology, Hohhot, Inner Mongolia 010051 (China)
2015-06-15
Highlights: • The effect of Y addition into the AZ91 Mg alloys was investigated. • Initial stage of corrosion was studied by in-situ 3D digital microscopy observation. • The potential difference was investigated by Kelvin probe force microscopy. • The effect of Y addition on the corrosion mechanisms of AZ91 alloy was studied. - Abstract: Microstructure characterization of the AZ91 magnesium alloys with or without rare earth element yttrium (Y) has been revealed by SEM, EDS and EPMA. Some Y-rich phases can be found in the magnesium alloys with Y additions. The fraction of β-Mg{sub 17}Al{sub 12} phase obvious decreases and turns into granular distribution with the increase of Y addition instead of original wet distribution along grain boundaries. The results of the potentiodynamic polarization tests show that the corrosion resistance of AZ91 alloy is improved with appropriate Y additions. But an in-situ observation of 3D digital microscopy for the initial stage of corrosion of the magnesium alloy with 0.9%Y addition shows that Y-rich phases act as cathodic effect and the α phases in the vicinity of them acting as anode are corroded. So the additions of Y have a beneficial effect that can depress the overall corrosion of AZ91 alloy, whereas its harmful effect is related to Y-rich phases because they present the highest Volta potential difference from the adjacent matrix and they can drive galvanic corrosion.
Qi, M. F.; Kang, Y. L.; Yan, Y.; Zhu, G. M.; Liao, W. N.
2015-10-01
The microstructure and mechanical properties of AZ91D alloy thin-wall parts produced by the rheomolding (RM) process were investigated and compared with the same alloy formed by conventional high-pressure die casting (HPDC). The results indicate that the RM process is able to get such AZ91D parts in which α 1 -Mg with average size of 27.36 μm are spherical and uniformly distributed in the matrix, and the matrix is a mixture of numerous fine α 2 -Mg and intermetallic β-Mg17Al12. High mechanical properties including ultimate tensile strength (UTS) of 270 MPa, yield strength (YS) of 169 MPa, elongation of 7.1%, and Vickers hardness of 102 are obtained in parts formed by RM due to the fine and uniform microstructure and less porosities. Compared with HPDC, the UTS, YS, elongation, and hardness of RM AZ91D are increased by 14.4, 9.7, 86.8, and 21.4%, respectively. The solidified grains in RM AZ91D alloy show a smaller aluminum gradient than that in HPDC. This indicates that the solidification of the RM AZ91D is closer to equilibrium.
Energy Technology Data Exchange (ETDEWEB)
Jafarian, Mojtaba [Young Researchers and Elite Club, Science and Research Branch, Islamic Azad University, Tehran (Iran, Islamic Republic of); Rizi, Mohsen Saboktakin, E-mail: M.saboktakin@Pa.iut.ac.ir [Department of Materials Engineering, Isfahan University of Technology, Isfahan 8415683111 (Iran, Islamic Republic of); Department of Industrial Engineering, Lenjan Branch, Islamic Azad University, Isfahan (Iran, Islamic Republic of); Jafarian, Morteza [Young Researchers and Elite Club, Science and Research Branch, Islamic Azad University, Tehran (Iran, Islamic Republic of); Honarmand, Mehrdad [Department of Mechanical Engineering, Tiran Branch, Islamic Azad University, Isfahan (Iran, Islamic Republic of); Javadinejad, Hamid Reza; Ghaheri, Ali [Department of Materials Engineering, Isfahan University of Technology, Isfahan 8415683111 (Iran, Islamic Republic of); Department of Industrial Engineering, Lenjan Branch, Islamic Azad University, Isfahan (Iran, Islamic Republic of); Bahramipour, Mohammad Taghi [Materials Engineering Department, Hakim Sabzevari University, Sabzevar, 397 (Iran, Islamic Republic of); Ebrahimian, Marzieh [Department of Materials Engineering, Isfahan University of Technology, Isfahan 8415683111 (Iran, Islamic Republic of); Department of Industrial Engineering, Lenjan Branch, Islamic Azad University, Isfahan (Iran, Islamic Republic of)
2016-06-01
The objective of this study is to investigate the effect of the types thermal tempering of aluminum alloy on microstructure and mechanical properties of AZ31-O Mg and Al 6061-T6 diffusion bonding. Using Optical Microscope (OM) and Scanning Electron Microscopes (SEM) equipped with EDS analysis and line scan the interfaces of joints were evaluated. The XRD analysis was carried out to characterize phase constitution near the interface zone. The mechanical properties of joints were measured using Vickers micro-hardness and shear strength. According to the results in bonding of AZ31-Mg/Al-6061-O, in less plastic deformation in magnesium alloy, diffusion rate of most magnesium atoms occurred to aluminum alloy and formation of diffusion zone with minimum micro-hardness (140 HV) and maximum shear strength (32 MPa) compared to Al 6061-T6/Mg-AZ31 bonding. Evaluation of fracture surfaces indicates an occurrence of failure from the brittle intermetallic phases. - Highlights: • Diffusion bonding AZ31 to Al-6061withoutany interlayer was successful. • Thermal tempered aluminum alloy plays a vital role in the mechanical properties of joint. • Less thickness of reaction layers and micro-hardness in bonding annealed Al- 6061 layers to AZ31 was achieved. • Fracture surfaces indicated that the onset of fracture from intermetallic compounds resulted in fracture of the cleavage.
interacción sporisorium scitamineum - caña de azúcar
Directory of Open Access Journals (Sweden)
Mar\\u00EDa La O- Hechavarr\\u00EDa
2007-01-01
Full Text Available Proteínas relacionadas con la defensa en la interacción Sporisorium scitamineum - caña de azúcar. El presente trabajo se realizó en el Centro Nacional de Sanidad Agropecuaria (CENSA, Habana, Cuba, durante el periodo 2001-2005, con el objetivo de determinar los patrones isoenzimáticos superóxido dismutasa y las secuencias de proteínas relacionadas con la defensa inducida en la interacción S. scitamineum - caña de azúcar, para lo cual fueron inoculadas con el patógeno las yemas de las variedades Ja60-5 (susceptible y M31/45 (resistente con una suspensión de esporidios del patógeno. La separación electroforética en condiciones nativas permitió la detección de dos isoformas ácidas de la enzima, una que se induce en mayor magnitud en la variedad resistente en comparación con la susceptible y otra que mantiene su nivel constitutivo para ambas variedades. El análisis ADNc-AFLP permitió la obtención de secuencias de PRs homólogas a glucanasas (PR2, quitinasas (PR3 y osmotina (PR5 inducidas diferencialmente en la variedad resistente. Los resultados obtenidos sugieren la participación de la enzima superóxido dismutasa en la señalización de la infección en esta interacción; así como la participación de PRs en la respuesta de resistencia inducida. Todo esto brinda la posibilidad de utilizar dichas proteínas como posibles marcadores bioquímicos y moleculares en Programas de Selección de Variedades Resistentes al Carbón de la Caña de Azúcar.
Molecular cloaking of H2A.Z on mortal DNA chromosomes during nonrandom segregation.
Huh, Yang Hoon; Sherley, James L
2011-10-01
Although nonrandom sister chromatid segregation is a singular property of distributed stem cells (DSCs) that are responsible for renewing and repairing mature vertebrate tissues, both its cellular function and its molecular mechanism remain unknown. This situation persists in part because of the lack of facile methods for detecting and quantifying nonrandom segregating cells and for identifying chromosomes with immortal DNA strands, the cellular molecules that signify nonrandom segregation. During nonrandom segregation, at each mitosis, asymmetrically self-renewing DSCs continuously cosegregate to themselves the set of chromosomes that contain immortal DNA strands, which are the oldest DNA strands. Here, we report the discovery of a molecular asymmetry between segregating sets of immortal chromosomes and opposed mortal chromosomes (i.e., containing the younger set of DNA template strands) that constitutes a new convenient biomarker for detection of cells undergoing nonrandom segregation and direct delineation of chromosomes that bear immortal DNA strands. In both cells engineered with DSC-specific properties and ex vivo-expanded mouse hair follicle stem cells, the histone H2A variant H2A.Z shows specific immunodetection on immortal DNA chromosomes. Cell fixation analyses indicate that H2A.Z is present on mortal chromosomes as well but is cloaked from immunodetection, and the cloaking entity is acid labile. The H2A.Z chromosomal asymmetry produced by molecular cloaking provides a first direct assay for nonrandom segregation and for chromosomes with immortal DNA strands. It also seems likely to manifest an important aspect of the underlying mechanism(s) responsible for nonrandom sister chromatid segregation in DSCs. Copyright © 2011 AlphaMed Press.
Artificial Neural Network Modelling of Vibration in the Milling of AZ91D Alloy
Directory of Open Access Journals (Sweden)
Ireneusz Zagórski
2017-09-01
Full Text Available The paper reports the results of artificial neural network modelling of vibration in. a milling process of magnesium alloy AZ91D by a TiAlN-coated carbide tool. Vibrations in machining processes are regarded as an additional, absolute machinability index. The modelling was performed using the so-called “black box” model. The best fit was determined for the input and output data obtained from the machining process. The simulations were performed by the Statistica software using two types of neural networks: RBF (Radial Basis Function and MLP (Multi-Layered Perceptron.
Influence of mictrostructure features on the corrosion behaviourof AZ91 alloy in chloride media
Directory of Open Access Journals (Sweden)
Lenka Bukovinová
2014-11-01
Full Text Available The influence of the microstructure of as-cast AZ91 magnesium alloy, which applied to solution annealing treatment and ageing treatment respectively, was evaluated in terms of its corrosion behaviour in 0.1 M NaCl solution at room temperature. The corrosion process was monitored by electrochemical impedance spectroscopy (EIS and the surface was characterized by scanning Kelvin probe force microscopy (SKPFM. The extent of corrosion damage was dependent on the microstructure. Surface potential maps indicated that, the surface potential of α-matrix is more positive than surface potential of β phase.
5X reticle fabrication using MEBES multiphase virtual address and AZ5206 resist
Milner, Kathy S.; Chipman, Paul S.
1991-03-01
An alternative exposure strategy has been developed for the MEBES electron beam exposure system that enhances throughput and improves registration accuracy of 5X reticles. The Multi-Phase Virtual Address (MPVA) exposure strategy utilizes a voting technique to minimize scan related distortions while increasing writing address size thus decreasing the write time significantly over present methods. The resist chosen to evaluate this writing strategy was Hoechst AZ5206. The technique was evaluated to determine performance capabilities for mask registration, linewidth tolerance and uniformity, scan related error reduction and throughput improvements.
Effect of cenospheres addition on microstructure and properties of AZ91D alloy
Zhi-qiu Huang; Si-rong Yu; Ming Hu
2015-01-01
The cenospheres/AZ91D composites were fabricated by melt stir method. The phases, microstructure and tensile fracture morphology of the composites were analyzed using XRD, Olympus metallurgical microscopy and SEM methods. The thermal expansion coefficient (CTE) and tensile properties were measured. The results showed that the cenospheres distribute uniformly in the Mg alloy matrix and refine the matrix microstructure. Mg2Si and MgO were found in addition to α-Mg and β-Mg17Al12 phases using XR...
Conversion Coatings Produced on AZ61 Magnesium Alloy by Low-Voltage Process
Directory of Open Access Journals (Sweden)
Nowak M.
2016-03-01
Full Text Available The resultes of anodic oxide conversion coatings on wrought AZ61 magnesium alloy production are describe. The studies were conducted in a solution containing: KOH (80 g/l and KF (300 g/l using anodic current densities of 3, 5 and 10 A/dm2 and different process durations. The obtained coatings were examined under a microscope and corrosion tests were performed by electrochemical method. Based on these results, it was found that the low-voltage process produces coatings conferring improved corrosion resistance to the tested magnesium alloy.
Fatigue behaviour of welded joints from magnesium alloy (AZ31) according to the local strain concept
Energy Technology Data Exchange (ETDEWEB)
Karakas, Oe.; Guelsoez, A. [Engineering Faculty, Department of Mechanical Engineering, University Pamukkale, Denizli (Turkey); Kaufmann, H.; Sonsino, C.M. [Fraunhofer - Institute for Structural Durability and System Reliability, LBF, Darmstadt (Germany)
2010-02-15
In the present study, the results of fatigue tests with the magnesium alloy AZ31 (ISO-MgAl3Zn1) in the material states base metal, heat affected zone and weld metal obtained under strain control at room temperature within a range from 2.10{sup 2} to 5 .10 {sup 6} cycles are presented. The fatigue behaviour was characterized by the Coffin-Manson-Basquin equations and the stress - strain behaviour by the Ramberg-Osgood equation. The data can be used to assess welded magnesium joints according to the local strain concept. (Abstract Copyright [2010], Wiley Periodicals, Inc.)
Evaluation of 241-AZ tank farm supporting phase 1 privatization waste feed delivery
Energy Technology Data Exchange (ETDEWEB)
CARLSON, A.B.
1998-11-19
This evaluation is one in a series of evaluations determining the process needs and assessing the adequacy of existing and planned equipment in meeting those needs at various double-shell tank farms in support of Phase 1 privatization. A number of tank-to-tank transfers and waste preparation activities are needed to process and feed waste to the private contractor in support of Phase 1 privatization. The scope of this evaluation is limited to process needs associated with 241-AZ tank farm during the Phase 1 privatization.
El azúcar y el ejercicio físico: su importancia en los deportistas
Peinado Lozano, Ana Belen; Rojo Tirado, Miguel Angel; Benito Peinado, Pedro José
2013-01-01
El glucógeno muscular, principal almacén de glucosa en el organismo, y la glucemia sanguínea constituyen uno de los principales sustratos energéticos para la contracción muscular durante el ejercicio. El azúcar (sacarosa) es un estupendo suplemento al suministrar tanto glucosa como fructosa. Por ello, es esencial que los deportistas cuiden su alimentación, para mantener y aumentar los depósitos de este combustible, ya que las reservas de glucógeno muscular constituyen un factor limitante de l...
Patria y nación en la época de Porfirio Díaz
Enrique Florescano
2005-01-01
El presente trabajo analiza las diversas visiones de la idea de Patria y Nación en la época de Porfirio Díaz. Las pinturas, litografías, monumentos patrióticos, narraciones históricas, entre otras expresiones; fungen como relatores de los orígenes e identidad nacional. Es importante destacar la representación evolutiva del pasado y la revaloración del mundo mesoamericano como ejemplo de la antigua nación indígena. Dentro de las celebraciones del Centenario de la Independencia s...
Classificació de proves no paramètriques. Com aplicar-les en SPSS
Directory of Open Access Journals (Sweden)
Vanesa Berlanga-Silvente
2012-07-01
Full Text Available Les proves no paramètriques engloben una sèrie de proves estadístiques, que tenen com a denominador comú l'absència de assumpcions sobre la llei de probabilitat que segueix la població de la qual ha estat extreta la mostra. Per aquesta raó és comú referir-s'hi com a proves de distribució lliure. A l'article es descriuen i treballen les proves no paramètriques ressaltant el seu fonament i les indicacions per al seu ús quan es tracta d'una sola mostra (Chi-quadrat, de dues mostres amb dades independents (U de Mann-Whitney, de dues mostres amb dades relacionades (T de Wilcoxon, de diverses mostres amb dades independents (H de Kruskal-Wallis i de diverses mostres amb dades relacionades (Friedman.
PROVE GOES-8 Images of Jornada Experimental Range, New Mexico, 1997
National Aeronautics and Space Administration — As part of the Prototype Validation Experiment (PROVE) at the Jornada Experimental Range, GOES-8 images were collected every 30 minutes for 15 days overlapping the...
PROVE Land Cover and Leaf Area of Jornada Experimental Range, New Mexico, 1997
National Aeronautics and Space Administration — Field measurement of shrubland ecological properties is important for both site monitoring and validation of remote-sensing information. During the PROVE exercise on...
The Development of the Proving Process Within a Dynamic Geometry Environment
Directory of Open Access Journals (Sweden)
Danh Nam Nguyen
2012-10-01
Full Text Available In this paper we classify student’s proving level and design an interactive help system (IHS corresponding with these levels in order to investigate the development of the proving process within a dynamic geometry environment. This help system was also used to provide tertiary students with a strategy for proving and to improve their proving levels. The open-ended questions and explorative tasks in the IHS make a contribution to support students’ learning of proving, especially during the processes of realizing invariants, formulating conjectures, producing arguments, and writing proofs. This research wants to react on the well-known students’ difficulties in writing a formal proof. The hypothesis of this work is that these difficulties are based on the lack of students’ understanding the relationship between argumentation and proof. Therefore, we used Toulmin model to analyze student’s argumentation structure and examine the role of abduction in writing a deductive proof. Furthermore, this paper also provides mathematics teachers with three basic conditions for understanding the development of the proving process and teaching strategies for assisting their students in constructing formal proofs.
Microstructure and mechanical properties of AZ91D alloy prepared by a semi-solid diecasting process
Energy Technology Data Exchange (ETDEWEB)
Du, X.H.; Wu, B.L. [Shenyang Inst. of Aeronautical Engineering, Shenyang (China). Dept. of Materials Engineering; Zhang, E.L. [Chinese Academy of Sciences, Shenyang (China). Inst. of Metal Research
2007-03-15
Semi-solid processing has been combined with die-casting for the magnesium alloy AZ91D. The microstructure of the semi-solid diecast AZ91D has been examined by optical microscopy and scanning electron microscopy. No pores were visible under optical microscopy, indicating a very low porosity. Mechanical properties of the semi-solid diecast AZ91D alloy have also been tested. High ultimate tensile strength and elongation have been achieved due to the low porosity and the fine microstructure. The fracture surfaces have been investigated by scanning electron microscopy in order to reveal the fracture mechanism. A typical inter-granular fracture surface was observed, indicating that the alloy fails in a brittle manner. The vertical-section microstructure of the fractured sample has indicated that the crack mainly propagates along the grain boundaries through the brittle fracture of the eutectic phase or the interface decohesion of the primary Mg phase and the eutectic phases. (orig.)
The negative-difference effect during the localized corrosion of magnesium and of the AZ91HP alloy
Directory of Open Access Journals (Sweden)
Weber Cristina R.
2003-01-01
Full Text Available Galvanostatic tests with pure magnesium and with the AZ91HP alloy were performed in NaCl solutions, and the volume of hydrogen evolved during the tests was measured. In order to examine the negative-difference effect, a concept was developed to separate the hydrogen evolution (H.E. on the passive surface and the H.E. inside the pits. An analysis of the volumetric data showed that the current density of H.E. inside the pits is much higher for Mg than for the AZ91HP alloy. With the assumption, that the ratio between the hydrogen reduction rate and the rate of the anodic metal dissolution, expressed by the factor k, does not change with the polarization, a k value of ca. 0.5 for pure Mg was found, while for the AZ91HP alloy this value was only ca. 0.3.
Bankoti, A. K. S.; Mondal, A. K.; Perugu, Chandra S.; Ray, B. C.; Kumar, S.
2017-10-01
The effect of individual and mixed additions of calcium (Ca) and antimony (Sb) on the corrosion behavior of the squeeze-cast AZ91 alloy have been investigated. The corrosion resistance of all modified alloys is better as a result of the refined and reduced volume fraction of the β-Mg17Al12 phase as well as grain refinement. Individual additions are better than mixed additions. The AZ91-1.0Ca (AZX911) alloy comprising individual Ca addition with a continuous network of the Al2Ca phase reveals the lowest corrosion rate. Among the alloys comprising combined additions, the AZ91-2.0Ca-0.3Sb (AZXY9120) alloy exhibits the best corrosion resistance because of the higher and lower volume fractions of the Al2Ca and Ca2Sb phases, respectively.
Microstructure of fly ash cenosphere/AZ91D composite during solution treatment at 380-420℃
Directory of Open Access Journals (Sweden)
Huang Zhiqiu
2011-02-01
Full Text Available The fly ash cenosphere/AZ91D (FAC/AZ91D composites containing 5 wt.% and 100 µm in size of fly-ash cenosphere particles were fabricated by means of the compcasting method. The microstructures of the as-cast samples and the effect of the solution treatment at 380℃, 400℃, and 420℃ for 16 h on the microstructures of the samples were investigated by using of OM, SEM, XRD and EDS. The results showed that the cenospheres distributed homogeneously in the Mg alloy, and were almost filled with Mg alloy. The main interfacial phase between the cenospheres and AZ91D Mg alloy was identified as MgAl2O4 according to XRD, EDS and thermodynamic analysis. Mg2Si particles tended to be spheroidized via the solution treatment and the β phase (Mg17Al12 dissolved completely at 400℃.
Estudio toxicológico de un producto derivado de la caña de azúcar
Directory of Open Access Journals (Sweden)
Carmen Luisa García Rivero
1997-08-01
Full Text Available Se presentan los resultados obtenidos en la evaluación toxicológica preclínica de un principio activo formulado en crema con propiedades cicatrizantes y antifúngicas a partir de un producto natural derivado de la caña de azúcar, al cual se le determinó su inocuidad en animales de experimentación mediante la estimación de la dosis letal media en conejos F1 y ratas albinas Wistar, utilizando niveles de dosis elevados. También se estudió el potencial irritante sobre la piel, mucosa ocular, vaginal y rectal, así como su potencial como agente sensibilizante. De forma general los síntomas tóxicos observados no fueron significativos y desaparecieron en un período corto, no se presentó mortalidad y se comprobó la ausencia de efectos irritantes sobre la piel y mucosas evaluadas. Se demostró que el producto no es un agente sensibilizante. Los resultados obtenidos en el estudio realizado permiten clasificar al producto de una baja toxicidad.This paper reports on the results obtained from the preclinical toxicity assessment of an active ingredient formulated as a cream having healing and antifungal properties which was obtained from a natural product derived from sugar cane. The drug testing included the determination of its safety in experimental animals by the estimation of the mean lethal dose in rabbits F1 and albino Wistar rats using high dose levels. The potential irritancy on the skin, ophthalmic, vaginal and rectal mucosa was also studied, as well as the potential as a sensibilizing agent. Overall, the toxic symptoms observed were found to be no significant and they dissapeared within a short period of time. There was no mortality and the absence of irritant effects on the skin and mucosa was evidenced in the evaluation. It was proved that this product is not a sensibilizing agent. Results obtained from the study carried out allow to classify this product as having low toxicity levels.
Energy Technology Data Exchange (ETDEWEB)
Azizieh, M., E-mail: azizieh@gmail.com [Department of Materials Science and Engineering, Ahvaz Branch, Islamic Azad University, Ahvaz (Iran, Islamic Republic of); Sadeghi Alavijeh, A. [School of Mechatronic Systems Engineering, Simon Fraser University, 250-13450 102 Avenue, Surrey, BC V3T 0A3 (Canada); Abbasi, M. [High Temperature Energy Materials, Korea Institute of Science and Technology, Seoul, 136-791 (Korea, Republic of); Balak, Z. [Department of Materials Science and Engineering, Ahvaz Branch, Islamic Azad University, Ahvaz (Iran, Islamic Republic of); Kim, H.S. [Department of Materials Science and Engineering, Pohang University of Science and Technology, Pohang, 790-784 (Korea, Republic of)
2016-02-15
In this paper, microstructure and mechanical properties of dissimilar friction stir welds of AA1100 and AZ31 were investigated to understand the effects of rotational and travel speed as well as pin position. The tensile results of welded samples revealed that the sound welds were formed when the stirring pin deviated from the centreline to the AZ31 side. The X-ray diffraction shows that Al{sub 3}Mg{sub 2} and Al{sub 12}Mg{sub 17} intermetallics formation occurs in the stir zone during the welding process. High hardness of these intermetallic phases increased the hardness of the stir zone to 110 Hv. The best tensile results were obtained in the sample processed in the range of 28–32 (rev/mm) rotational to travel speed ratio. - Highlights: • For Al to Mg friction stir welding, tool offset must be to Mg side. • There is an optimum rotational speed for obtain the highest strength. • Intermetallics form in any welding condition. • The volume fraction of intermetallic is directly related to FSW peak temperature.
Dynamic recrystallization behavior of AZ31 magnesium alloy processed by alternate forward extrusion
Li, Feng; Liu, Yang; Li, Xu-Bo
2017-09-01
One of the important factors that affect the microstructure and properties of extruded products is recrystallization behavior. Alternate forward extrusion (AFE) is a new type of metal extrusion process with strong potential. In this paper, we carried out the AFE process experiments of as-cast AZ31 magnesium alloy and obtained extrusion bar whose microstructure and deformation mechanism were analyzed by means of optical microscopy, electron backscattered diffraction and transmission electron microscopy. The experimental results indicated that homogeneous fine-grained structure with mean grain size of 3.91 μm was obtained after AFE at 573 K. The dominant reason of grain refinement was considered the dynamic recrystallization (DRX) induced by strain localization and shear plastic deformation. In the 573-673 K range, the yield strength, tensile strength and elongation of the composite mechanical properties are reduced accordingly with the increase of the forming temperature. Shown as in relevant statistics, the proportion of the large-angle grain boundaries decreased significantly. The above results provide an important scientific basis of the scheme formulation and active control on microstructure and property for AZ31 magnesium alloy AFE process.
Mechanical properties of homogenized twin-roll cast and conventionally cast AZ31 magnesium alloys
Directory of Open Access Journals (Sweden)
Mariia Zimina
2015-02-01
Full Text Available The improvement of mechanical properties of magnesium alloys nowadays is very important, because of the variety of industrial applications. For this goal, the number of casting techniques and further treatments were developed. Among the continuous casting techniques, which allow producing long strips of the alloys, is twin-roll casting. Using this process one can get the magnesium alloy with finest microstructure and higher specific strength. In this paper the comparison of tensile properties of conventionally cast and twin-roll cast AZ31 magnesium alloys was made. Tensile tests were carried out with constant strain rate 10-3 s-1 at temperatures ranging from 100 to 300 °C. Both materials were tested in as-cast state and after homogenization treatment at 450 °C for 10 hours. The investigation showed that there are no significant changes in ductility of AZ31 conventionally cast alloy even after heat treatment, while the ductility of twin-roll cast alloy increases.
Influence of Friction Stir Welding on Mechanical Properties of Butt Joints of AZ61 Magnesium Alloy
Directory of Open Access Journals (Sweden)
Seung-Ju Sun
2017-01-01
Full Text Available In this study, the effect of heat input on the mechanical properties and fracture behaviors of AZ61 magnesium alloy joints has been studied. Magnesium alloy AZ61 plates with thickness of 5 mm were welded at different ratios of tool rotational speed to welding speed (ω/ν. The average ultimate tensile strength of all weld conditions satisfying a ω/ν ratio of 3 reached 100% of the strength of the base material. Fractures occurred at the interface between the thermomechanical affected zone at advancing side and the stir zone in all welded specimens. From the scanning electron microscope and electron backscatter diffraction analysis, it was determined that the interface between the thermomechanical affected zone and the stir zone, which is the region where the grain orientation changes, was the weakest part; the advancing side region was relatively weaker than the retreating side region because the grain orientation change occurred more dramatically in the advancing side region.
TiO2 Deposition on AZ31 Magnesium Alloy Using Plasma Electrolytic Oxidation
Directory of Open Access Journals (Sweden)
Leon White
2013-01-01
Full Text Available Plasma electrolytic oxidation (PEO has been used in the past as a useful surface treatment technique to improve the anticorrosion properties of Mg alloys by forming protective layer. Coatings were prepared on AZ31 magnesium alloy in phosphate electrolyte with the addition of TiO2 nanoparticles using plasma electrolytic oxidation (PEO. This present work focuses on developing a TiO2 functional coating to create a novel electrophotocatalyst while observing the surface morphology, structure, composition, and corrosion resistance of the PEO coating. Microstructural characterization of the coating was investigated by X-ray diffraction (XRD and scanning electron microscopy (SEM followed by image analysis and energy dispersive spectroscopy (EDX. The corrosion resistance of the PEO treated samples was evaluated with electrochemical impedance spectroscopy (EIS and DC polarization tests in 3.5 wt.% NaCl. The XRD pattern shows that the components of the oxide film include Mg from the substrate as well as MgO and Mg2TiO4 due to the TiO2 nanoparticle addition. The results show that the PEO coating with TiO2 nanoparticles did improve the corrosion resistance when compared to the AZ31 substrate alloy.
Influence of second phase particles on fracture toughness in AZ31 magnesium alloys
Energy Technology Data Exchange (ETDEWEB)
Sasaki, T.; Somekawa, H. [Dept. of Metallurgy and Materials Science, Osaka Prefecture Univ., Sakai (Japan); Takara, A.; Nishikawa, Y. [Matsushita Electric Industrial Co., Ltd., Osaka (Japan); Higashi, K. [Dept. of Metallurgy and Materials Science, Osaka Prefecture Univ., Sakai (Japan)
2004-07-01
Three kinds of thin AZ31 wrought magnesium alloys sheets were used in order to investigate the influence of the second phase particles on fracture toughness. From the theoretical model, the ratio of {lambda}{sub p}/d{sub p} would be estimated 5 {proportional_to} 6. On the other hand, from the microstructural observation, average particle spacing on each material was sample A: 13.1 {mu}m, sample B: 14.1, and sample C: 12 {mu}. In addition, average particle size on each sample was sample A: 2.1, sample B: 1.9, and sample C: 2.3 {mu}m. Therefore, the ratio of {lambda}{sub p}/d{sub p} calculated from fracture surface observation would be predicted 6 {proportional_to} 7. In comparison with the result of the prediction by theoretical analysis was in good agreement with the result of fracture toughness observation. It was found that the variation in plane-strain fracture toughness on AZ31 were affected by both of particle spacing and particle size. (orig.)
El blocao (y el bloqueo de José Díaz Fernández
Directory of Open Access Journals (Sweden)
Luis Fernando Bueno Morillas
2015-06-01
Full Text Available El blocao (1928 fue la primera novela de José Díaz Fernández. Supuso un éxito editorial insólito hasta entonces porque reunía tres características novedosas: una actitud crítica ante la guerra de Marruecos, una integración de las novedades vanguardistas en la que su autor llamó literatura de avanzada y un posicionamiento del intelectual al lado de las reivindicaciones del pueblo. Sin embargo, aunque publicó otra novela un año después (La Venus mecánica, un libro teórico en el que definía la literatura que él propugnaba y practicaba (El nuevo romanticismo y algunas narraciones breves, Díaz Fernández se bloqueó y dejó la literatura narrativa que tan buenas expectativas levantó. Analizaremos las posibles causas de ese bloqueo.
Geologie study off gravels of the Agua Fria River, Phoenix, AZ
Langer, W.H.; Dewitt, E.; Adams, D.T.; O'Briens, T.
2010-01-01
The annual consumption of sand and gravel aggregate in 2006 in the Phoenix, AZ metropolitan area was about 76 Mt (84 million st) (USGS, 2009), or about 18 t (20 st) per capita. Quaternary alluvial deposits in the modern stream channel of the Agua Fria River west of Phoenix are mined and processed to provide some of this aggregate to the greater Phoenix area. The Agua Fria drainage basin (Fig. 1) is characterized by rugged mountains with high elevations and steep stream gradients in the north, and by broad alluvial filled basins separated by elongated faultblock mountain ranges in the south. The Agua Fria River, the basin’s main drainage, flows south from Prescott, AZ and west of Phoenix to the Gila River. The Waddel Dam impounds Lake Pleasant and greatly limits the flow of the Agua Fria River south of the lake. The southern portion of the watershed, south of Lake Pleasant, opens out into a broad valley where the river flows through urban and agricultural lands to its confluence with the Gila River, a tributary of the Colorado River.
Environmental friendly anodizing of AZ91D magnesium alloy in alkaline borate-benzoate electrolyte
Energy Technology Data Exchange (ETDEWEB)
Liu Yan [Department of Chemistry, Zhejiang University, Hangzhou 310027 (China); Department of Chemistry, Tianshui Normal University, Tianshui 741000 (China); Wei Zhongling [Magnesium Technology Co., Ltd., Chinese Academy of Sciences, Jiaxing 314051 (China); Yang Fuwei [Department of Chemistry, Tianshui Normal University, Tianshui 741000 (China); Zhang Zhao, E-mail: eaglezzy@zjuem.zju.edu.cn [Department of Chemistry, Zhejiang University, Hangzhou 310027 (China); Key Laboratory for Light Alloy Materials Technology, Jiaxing 314051 (China)
2011-06-02
Highlights: > Environmental friendly PEO technology for AZ91 magnesium alloy is developed. > NaBz is used as new additive and it is low-cost and environmental friendly. > The effect of NaBz additive on the properties of the anodized film was studied. > Anodized film with excellent corrosion resistance is obtained. > The forming mechanism of anodized film in the presence of NaBz is approached. - Abstract: A kind of environmental friendly anodizing routine for AZ91D magnesium alloy, based on an alkaline borate-sodium benzoate electrolyte (NaBz) was studied. The effect of NaBz on the properties of the anodized film was investigated by scanning electron microscopy (SEM), X-ray diffraction (XRD), energy dispersive spectrometry (EDS), potentiodynamic polarization and electrochemical impedance spectroscopy (EIS), respectively. The results showed that the anodizing process, surface morphology, thickness, phase structure and corrosion resistance of the anodized film were strongly dependent on the concentration of NaBz. In the presence of adequate NaBz, a thick, compact and smoothing anodized film with excellent corrosion resistance was produced. Moreover, the forming mechanism of the anodized film in the presence of NaBz additive was also approached, which was a suppression of arc discharge process by the adsorption of Bz{sup -} on the surface of magnesium alloy substrate.
EnviroAtlas - Phoenix, AZ - BenMAP Results by Block Group
This EnviroAtlas dataset demonstrates the effect of changes in pollution concentration on local populations in 2,434 block groups in Phoenix, AZ. The US EPA's Environmental Benefits Mapping and Analysis Program (BenMAP) was used to estimate the incidence of adverse health effects (i.e., mortality and morbidity) and associated monetary value that result from changes in pollution concentrations for Maricopa County, AZ. Incidence and value estimates for the block groups are calculated using i-Tree models (www.itreetools.org), local weather data, pollution data, and U.S. Census derived population data. This dataset was produced by the US Forest Service to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (https://www.epa.gov/enviroatlas) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data (https://edg.epa.gov/data/Public/ORD/EnviroAtlas) or as an EnviroAtlas map service. Additional descriptive information about each attribute in this dataset can be found in its associated EnviroAtlas Fact Sheet (https://www.epa.gov/enviroatlas/enviroatlas-fact-sheets).
Energy Technology Data Exchange (ETDEWEB)
Rojaee, Ramin, E-mail: raminrojaee@aim.com [Biomaterials Research Group, Department of Materials Engineering, Isfahan University of Technology, Isfahan, 84156-83111 (Iran, Islamic Republic of); Fathi, Mohammadhossein [Biomaterials Research Group, Department of Materials Engineering, Isfahan University of Technology, Isfahan, 84156-83111 (Iran, Islamic Republic of); Dental Materials Research Center, Isfahan University of Medical Sciences, Isfahan (Iran, Islamic Republic of); Raeissi, Keyvan [Department of Materials Engineering, Isfahan University of Technology, Isfahan, 84156-83111 (Iran, Islamic Republic of)
2013-11-15
Bio-absorbable magnesium (Mg) based alloys have been introduced as innovative orthopedic implants during recent years. It has been specified that rapid degradation of Mg based alloys in physiological environment should be restrained in order to be utilized in orthopedic trauma fixation and vascular intervention. In this developing field of healthcare materials, micro-arc oxidation (MAO), and MgF{sub 2} conversion coating were exploited as surface pre-treatment of AZ91 magnesium alloy to generate a nanostructured hydroxyapatite (n-HAp) coating via electrophoretic deposition (EPD) method. X-ray diffraction (XRD), scanning electron microscopy (SEM), Fourier transform infrared spectroscopy (FT-IR), and transmission electron microscopy (TEM) techniques were used to characterize the obtained powder and coatings. The potentiodynamic polarization tests were carried out to evaluate the corrosion behavior of the coated and uncoated specimens, and in vitro bioactivity evaluation were performed in simulated body fluid. Results revealed that the MAO/n-HAp coated AZ91 Mg alloy samples with a rough topography and lower corrosion current density leads to a lower Mg degradation rate accompanied by high bioactivity.
Effects of filter materials on microstructure and mechanical properties of AZ91
Directory of Open Access Journals (Sweden)
Wu Guohua
2010-11-01
Full Text Available The present investigation studied the effects of different kinds of ceramic foam filters (CFF incorporating gas bubbling on the microstructure and mechanical properties of virgin AZ91 alloys, and the reactions between filters and Mg melt during filtration. The results show that the purification process of CFF incorporating gas bubbling process can obviously improve the Rm and A of AZ91 alloy, especially the A. Amongst the selected four kinds of CFF, the MgO filter is the most suitable for filtrating Mg melt, and the filtration effective sequence of four kinds of filtrating materials is as follows: MgO>Al2O3>ZrO2>SiC. With MgO filter incorporating gas bubbling treatment under Ar flow rate of 2 L/min and temperature of 730 °C, the ultimate tensile strength Rm and elongation A can be improved greatly from 175.3 MPa and 2.74% to 195.4 MPa and 4.54%, respectively. No inclusions are found on the fracture surface of the sample filtrated by MgO ceramic foam filter, and the fracture mode is quasi-cleavage crack.
Tailoring degradation of AZ31 alloy by surface pre-treatment and electrospun PCL fibrous coating
Energy Technology Data Exchange (ETDEWEB)
Hanas, T. [Medical Materials Laboratory, Indian Institute of Technology Madras, Chennai 600036 (India); School of Nano Science and Technology, National Institute of Technology Calicut, Calicut, Kerala 673601 (India); Sampath Kumar, T.S., E-mail: tssk@iitm.ac.in [Medical Materials Laboratory, Indian Institute of Technology Madras, Chennai 600036 (India); Perumal, Govindaraj; Doble, Mukesh [Department of Biotechnology - Bhupat and Jyoti Mehta School of Biosciences, Indian Institute of Technology Madras, Chennai 600036 (India)
2016-08-01
AZ31 magnesium alloy was coated with polycaprolactone (PCL) nano-fibrous layer using electrospinning technique so as to control degradation in physiological environment. Before coating, the alloy was treated with HNO{sub 3} to have good adhesion between the coating and substrate. To elucidate the role of pre-treatment and coating, samples only with PCL coating as well as HNO{sub 3} treatment only were prepared for comparison. Best coating adhesion of 4B grade by ASTM D3359–09 tape test was observed for pre-treated samples. The effect of coating on in vitro degradation and biomineralization was studied using supersaturated simulated body fluid (SBF 5 ×). The weight loss and corrosion results obtained by immersion test showed that the combination of HNO{sub 3} pre-treatment and PCL coating is very effective in controlling the degradation rate and improving bioactivity. Cytotoxicity studies using L6 cells showed that PCL coated sample has better cell adhesion and proliferation compared to uncoated samples. Nano-fibrous PCL coating combined with prior acid treatment seems to be a promising method to tailor degradation rate with enhanced bioactivity of Mg alloys. - Highlights: • PCL electrospun coating on HNO{sub 3} pre-treated AZ31 alloy controls biodegradation. • Acid pre-treatment stabilizes the substrate - coating interface. • Electrospun porous coating improves biomineralization. • Coating similar to extracellular matrix enhances cell adhesion.
AZ ÖKOENERGIA-TURIZMUS LÉNYEGE ÉS JÖVÅ JE
David, Lorant; Baros, Zoltan; Bujdosó, Zoltán
2006-01-01
A megújuló energiaforrásokhoz kapcsolódó beruházások és létesítmények a világ számos részén -- elsősorban a szakértő közönséget vonzó -- turisztikai attrakcióvá váltak. Az üzemlátogatások és tájékoztatók amellett, hogy a szakembereknek kitűnő alkalmat adnak továbbképzésre és az újabb technológiai innovációk megismerésére, a téma oktatásában érdekelteknek és a laikusoknak is bemutatják a megújuló energiaforrások felhasználási lehetőségeit. A környezeti nevelés szempontjából fontos, hogy a megú...
Directory of Open Access Journals (Sweden)
Nagabhushan Kumar Kadigithala
2017-06-01
Full Text Available Friction stir welding (FSW is an efficient technique which can be used particularly for magnesium and aluminum alloys that are difficult to fusion weld. In this work AZ91D Mg alloy plates 3mm thick were friction stir welded at different process variables such as rotational speed and welding speed. The range of rotational speeds varied from 1025 to 1525 rpm, and the welding speed varied from 25 to 75 mm/min. Good quality welds were obtained under 1025 rpm of rotational speed with the welding speeds range from 25 to 75 mm/min. The microstructure of the AZ91D alloy consists of primary α-phase, eutectic α-phase and eutectic β (Mg17Al12 phase in the received condition (gravity die cast. The original dendrite grain structure completely disappeared and was transformed to fine equiaxed grains in stir zone (SZ. It was observed that there was a slight increase in hardness in SZ, because of fine recrystallized grain structure. The transverse tensile test results of weld specimens indicated constant strength irrespective of traveling speed. Fractrographic analysis of the friction stir welded specimens showed the brittle failure.
Energy Technology Data Exchange (ETDEWEB)
Cai, Y.; Wan, L.; Guo, Z. H.; Sun, C. Y.; Yang, D. J.; Zhang, Q. D.; Li, Y. L.
2017-02-01
Isothermal compression experiment of AZ80 magnesium alloy was conducted by Gleeble thermo-mechanical simulator in order to quantitatively investigate the work hardening (WH), strain rate sensitivity (SRS) and temperature sensitivity (TS) during hot processing of magnesium alloys. The WH, SRS and TS were described by Zener-Hollomon parameter (Z) coupling of deformation parameters. The relationships between WH rate and true strain as well as true stress were derived from Kocks-Mecking dislocation model and validated by our measurement data. The slope defined through the linear relationship of WH rate and true stress was only related to the annihilation coefficient Ω. Obvious WH behavior could be exhibited at a higher Z condition. Furthermore, we have identified the correlation between the microstructural evolution including β-Mg17Al12 precipitation and the SRS and TS variations. Intensive dynamic recrystallization and homogeneous distribution of β-Mg17Al12 precipitates resulted in greater SRS coefficient at higher temperature. The deformation heat effect and β-Mg17Al12 precipitate content can be regarded as the major factors determining the TS behavior. At low Z condition, the SRS becomes stronger, in contrast to the variation of TS. The optimum hot processing window was validated based on the established SRS and TS values distribution maps for AZ80 magnesium alloy.
Sealing of PEO Coated AZ91 Magnesium Alloy Using La-Based Solutions
Directory of Open Access Journals (Sweden)
Luca Pezzato
2017-01-01
Full Text Available In this work, solutions containing lanthanum salts were used for a post-treatment of sealing to increase the corrosion resistance of PEO coated AZ91 alloy. PEO coatings were produced on samples of AZ91 magnesium alloy using an alkaline solution containing sodium hydroxide, sodium phosphates, and sodium silicates. The sealing treatment was performed in a solution containing 12 g/L of La(NO33 at pH 4 at different temperatures and for different treatment times. Potentiodynamic polarization test, an EIS test, showed that the sealing treatment with solution containing lanthanum nitrate caused a remarkable increase in the corrosion resistance. The corrosion behavior was correlated with the surface morphology and elemental composition evaluated with scanning electron microscope (SEM, X-ray diffraction (XRD, and X-ray photoelectron spectroscopy (XPS. In particular, the sealing treatment at 50°C for 30 min resulted in being the most promising to increase the corrosion properties of PEO treated samples because of the formation of a homogeneous sealing layer, mainly composed of La(OH3.
Fatigue characteristics of sand-cast AZ91D magnesium alloy
Directory of Open Access Journals (Sweden)
Zhenming Li
2017-03-01
Full Text Available The fatigue characteristics of the AZ91D-T6 alloy samples taken from engine blocks have been investigated at 20 °C and elevated temperature (150 °C. The fatigue strength and cyclic stress amplitude of the alloy significantly decrease with the increase of the test temperature, although cyclic hardening occurs continuously until failure for both temperatures. With the increase of the temperature, the decreased fatigue life of the alloy tested at the same stress amplitude is mainly attributed to the decreased matrix strength and the increased hysteresis energies. Fatigue failure of the engine blocks made of AZ91D-T6 alloy is mainly controlled by casting defects. For the defect-free specimens, the crack initiation behavior is determined by the single-slip (20 °C and by environment-assisted cyclic slip (150 °C during fatigue, respectively. The low-cycle fatigue lives of the alloy can be predicted using the Coffin-Manson relation and Basquin laws, the three-parameter equation and the energy-based concepts, while the high-cycle fatigue lives of the alloy fitted well with the developed long crack life model and MSF life models.
A New Factor in American Destiny: Visions of Porfirio Díaz and the Politics of “Logical Paternalism”
Ruiz, Jason
2011-01-01
This essay interprets American representations of dictator Porfirio Díaz in relation to the “economic conquest” of Mexico that took place during his long rule (1876–1911, a period known as the “Porfiriato,” in which Americans invested more than $1 billion). No single person inspired as much attention from travelers, reporters, and photographers during the late nineteenth and early twentieth centuries as Díaz, and their visions of the President helped to shape perceptions of Mexico as a desira...
CSER 96-014: criticality safety of project W-151, 241-AZ-101 retrieval system process test
Energy Technology Data Exchange (ETDEWEB)
Vail, T.S., Fluor Daniel Hanford
1997-02-06
This Criticality Safety Evaluation Report (CSER) documents a review of the criticality safety implications of a process test to be performed in tank 241-AZ-101 (101-AZ). The process test will determine the effectiveness of the retrieval system for mobilization of solids and the practicality of the system for future use in the underground storage tanks at Hanford. The scope of the CSER extends only to the testing and operation of the mixer pumps and does not include the transfer of waste from the tank. Justification is provided that a nuclear criticality is extremely unlikely, if not impossible, in this tank.
SAFETY ANALYSIS FOR TANK 241-AZ-101 MIXER PUMP PROCESS TEST
Energy Technology Data Exchange (ETDEWEB)
HAMMOND DM; HARRIS JP; MOUETTE P
1997-06-09
This document contains the completed safety analysis which establishes the safety envelope for performing the mixer pump process test in Tank 241-AZ-101. This process test is described in TF-210-OTP-001. All equipment necessary for the mixer pump test has been installed by Project W-151. The purpose of this document is to describe and analyze the mixer pump test for Aging Waste Facility (AWF) Tank 241-AZ-101 and to address the 'yes/maybe' responses marked for evaluation questions identified in Unreviewed Safety Question Evaluation (USQE) TF-94-0266. The scope of this document is limited to the performance of the mixer pump test for Tank 241-AZ-101. Unreviewed Safety Question Determination (USQD) TF-96-0018 verified that the installation of two mixer pumps into Tank 241-AZ-101 was within the current Tank Waste Remediation System (TWRS) Authorization Basis. USQDs TF-96-0461, TF-96-0448, and TF-96-0805 verified that the installation of the in-tank video camera, thermocouples, and Ultrasonic Interface Level Analyzer (URSILLA), respectively, were within the current TWRS Authorization Basis. USQD TF-96-1041 verified that the checkout testing of the installed equipment was within the current TWRS Authorization Basis. Installation of the pumps and equipment has been completed. An evaluation of safety considerations associated with operation of the mixer pumps for the mixer pump test is provided in this document. This document augments the existing AWF authorization basis as defined in the Interim Safety Basis (Stahl 1997), and as such, will use the existing Interim Operational Safety Requirements (IOSRs) of Heubach 1996 to adequately control the mixer pump test. The hazard and accident analysis is limited to the scope and impact of the mixer pump test, and therefore does not address hazards already addressed by the current AWF authorization basis. This document does not evaluate removal of the mixer pumps. Safety considerations for removal of the pumps will be
Directory of Open Access Journals (Sweden)
Benoît Guillemette
2005-12-01
Full Text Available H2A.Z is an evolutionary conserved histone variant involved in transcriptional regulation, antisilencing, silencing, and genome stability. The mechanism(s by which H2A.Z regulates these various biological functions remains poorly defined, in part due to the lack of knowledge regarding its physical location along chromosomes and the bearing it has in regulating chromatin structure. Here we mapped H2A.Z across the yeast genome at an approximately 300-bp resolution, using chromatin immunoprecipitation combined with tiling microarrays. We have identified 4,862 small regions--typically one or two nucleosomes wide--decorated with H2A.Z. Those "Z loci" are predominantly found within specific nucleosomes in the promoter of inactive genes all across the genome. Furthermore, we have shown that H2A.Z can regulate nucleosome positioning at the GAL1 promoter. Within HZAD domains, the regions where H2A.Z shows an antisilencing function, H2A.Z is localized in a wider pattern, suggesting that the variant histone regulates a silencing and transcriptional activation via different mechanisms. Our data suggest that the incorporation of H2A.Z into specific promoter-bound nucleosomes configures chromatin structure to poise genes for transcriptional activation. The relevance of these findings to higher eukaryotes is discussed.
Ground states of linearly coupled Schrodinger systems
Directory of Open Access Journals (Sweden)
Haidong Liu
2017-01-01
Full Text Available This article concerns the standing waves of a linearly coupled Schrodinger system which arises from nonlinear optics and condensed matter physics. The coefficients of the system are spatially dependent and have a mixed behavior: they are periodic in some directions and tend to positive constants in other directions. Under suitable assumptions, we prove that the system has a positive ground state. In addition, when the L-infinity-norm of the coupling coefficient tends to zero, the asymptotic behavior of the ground states is also obtained.
Energy Technology Data Exchange (ETDEWEB)
1980-11-01
This national workshop on ground water and energy was conceived by the US Department of Energy's Office of Environmental Assessments. Generally, OEA needed to know what data are available on ground water, what information is still needed, and how DOE can best utilize what has already been learned. The workshop focussed on three areas: (1) ground water supply; (2) conflicts and barriers to ground water use; and (3) alternatives or solutions to the various issues relating to ground water. (ACR)
Directory of Open Access Journals (Sweden)
B. Silvia Zossi
Full Text Available Se estudió la concentración de compuestos azúcares y no azúcares, especialmente los que influyen en la formación del color y otros que inciden en el proceso industrial de producción de azúcar blanco directo, de las cuatro variedades comerciales de caña más difundidas en Tucumán (R. Argentina: TUCCP 77-42, LCP 85-384, CP 65-357 y RA 87-3. Estos ensayos fueron realizados durante las zafras 2004 a 2007 en caña limpia y despuntada. Los parámetros analizados fueron: extracción de jugo, Brix %, pol % en jugo y en caña, sacarosa y azúcar recuperable. Se estudiaron no azúcares inorgánicos, tales como cenizas, fosfato y sílice, y no azúcares orgánicos: fibra, almidón, compuestos antocianos y fenoles, nitrógeno amínico, ácidos cis y trans-aconítico, "indicator value" y color. De las cuatro variedades analizadas, la que mejor comportamiento presentó para producir azúcar blanco directo fue LCP 85-384, por su alto contenido en sacarosa y bajo contenido de componentes no azúcares. El segundo lugar le correspondió a la variedad RA 87-3, seguida por CP 65-357 y TUCCP 77-42.The concentration of sugar and nonsugar compounds, especially those which play a part in colour formation and others which affect direct white sugar manufacturing process, was studied in the four commercial cane varieties most widely grown in Tucumán (Argentine Republic: TUCCP 77-42, LCP 85-384, CP 65-357 and RA 87-3. Trials with clean cane were conducted during the 2004-2007 harvests. Analyzed parameters were: juice extraction, Brix %, pol % in juice and cane, sucrose and sugar recovery. Inorganic nonsugar compounds, such as ash, phosphate and silica, as well as organic ones, such as fibre, starch, anthocyanin and phenolic compounds, amino nitrogen, cis and trans-aconitic acids, indicator value and colour, were studied. Results showed that LCP 85-384 variety had the best factory performance to produce direct white sugar because of its high sucrose and low
Directory of Open Access Journals (Sweden)
Mola R.
2015-12-01
Full Text Available The paper present the results of physical simulation of the deformation of the two-layered AZ31/eutectic material using the Gleeble 3800 metallurgical processes simulator. The eutectic layer was produced on the AZ31 substrate using thermochemical treatment. The specimens of AZ31 alloy were heat treated in contact with aluminium powder at 445°C in a vacuum furnace. Depending on the heating time, Al-enriched surface layers with a thickness of 400, 700 and 1100 μm were fabricated on a substrate which was characterized by an eutectic structure composed of the Mg17Al12 phase and a solid solution of aluminium in magnesium. In the study, physical simulation of the fabricated two-layered specimens with a varying thickness of the eutectic layer were deformed using the plane strain compression test at various values of strain rates. The testing results have revealed that it is possible to deform the two-layered AZ31/eutectic material at low strain rates and small deformation values.
Energy Technology Data Exchange (ETDEWEB)
Swiostek, J. [GKSS-Forschungszentrum Geesthacht GmbH (Germany). Inst. fuer Werkstofforschung
2008-12-04
The present study is concerned with the analysis of the influence of hydrostatic extrusion on the microstructural development and mechanical properties of extruded profiles of the AZ-series magnesium alloys. This work also deals with the correlation between the microstructure and resulting mechanical properties for the case extruded profiles. (orig.)
Formalizing and proving a typing result for security protocols in Isabelle/HOL
DEFF Research Database (Denmark)
Hess, Andreas Viktor; Modersheim, Sebastian
2017-01-01
or the positive output of a verification tool. However several of these works have used a typed model, where the intruder is restricted to "well-typed" attacks. There also have been several works that show that this is actually not a restriction for a large class of protocols, but all these results so far...... are again pen-and-paper proofs. In this work we present a formalization of such a typing result in Isabelle/HOL. We formalize a constraint-based approach that is used in the proof argument of such typing results, and prove its soundness, completeness and termination. We then formalize and prove the typing...... result itself in Isabelle. Finally, to illustrate the real-world feasibility, we prove that the standard Transport Layer Security (TLS) handshake satisfies the main condition of the typing result....
AZ-101 Mixer Pump Demonstration and Tests Data Management Analysis Plan
Energy Technology Data Exchange (ETDEWEB)
DOUGLAS, D.G.
2000-02-22
This document provides a plan for the analysis of the data collected during the AZ-101 Mixer Pump Demonstration and Tests. This document was prepared after a review of the AZ-101 Mixer Pump Test Plan (Revision 4) [1] and other materials. The plan emphasizes a structured and well-ordered approach towards handling and examining the data. This plan presumes that the data will be collected and organized into a unified body of data, well annotated and bearing the date and time of each record. The analysis of this data will follow a methodical series of steps that are focused on well-defined objectives. Section 2 of this plan describes how the data analysis will proceed from the real-time monitoring of some of the key sensor data to the final analysis of the three-dimensional distribution of suspended solids. This section also identifies the various sensors or sensor systems and associates them with the various functions they serve during the test program. Section 3 provides an overview of the objectives of the AZ-101 test program and describes the data that will be analyzed to support that test. The objectives are: (1) to demonstrate that the mixer pumps can be operated within the operating requirements; (2) to demonstrate that the mixer pumps can mobilize the sludge in sufficient quantities to provide feed to the private contractor facility, and (3) to determine if the in-tank instrumentation is sufficient to monitor sludge mobilization and mixer pump operation. Section 3 also describes the interim analysis that organizes the data during the test, so the analysis can be more readily accomplished. Section 4 describes the spatial orientation of the various sensors in the tank. This section is useful in visualizing the relationship of the Sensors in terms of their location in the tank and how the data from these sensors may be related to the data from other sensors. Section 5 provides a summary of the various analyses that will be performed on the data during the test
Directory of Open Access Journals (Sweden)
Yong Hu
2015-01-01
Full Text Available The AZ91D magnesium alloy containing rare earth Gd was prepared in this study, and the effect of semi-solid isothermal heat treatment on the microstructure of the alloy was investigated to obtain an optimum semi-solid structure. Results show that Gd can refine the microstructure of AZ91D magnesium alloy, and the optimum semi-solid AZ91D microstructure can be achieved by adding 1.5wt.% Gd. After treated at 585 °C for 30 min, the well distributed rose-shaped and near-spherical semi-solid microstructures of AZ91D+1.5wt.%Gd alloy can be obtained. The liquid phase of the semi-solid alloy consists of three components, namely, the molten pool, the “entrapped liquid” pool and the liner liquid film which separates two neighbor particles. The solid phase is composed of two phases, the primary α-Mg particles and the α-Mg phase formed in the second stage of solidification. With the increase of holding time, melting which causes the decrease of the primary α-Mg particle size is the dominant mechanism in the initial stage while coalescence and Ostwald ripening tend to be the principles later.
Wilke, Benjamin M.; Zhang, Lei
2016-06-01
Polycaprolactone (PCL) coating has been shown to increase the corrosion resistance of magnesium alloys when exposed to a simulated body fluid. A PCL dip coating was applied to AZ31 Mg alloy. Samples were immersed in both Earle's Balance Salt Solution (EBSS) and conventional simulated body fluids (c-SBF) up to 14 days. Microscopic morphology, electrochemical impedance spectroscopy, and potentiodynamic polarization tests were performed to evaluate the corrosion behavior changes of PCL coatings against immersion times in EBSS and c-SBF as compared to the uncoated AZ31 substrate. PCL-coated samples demonstrated improved corrosion resistance compared to bare AZ31 in both EBSS and c-SBF, indicating that the PCL coating exhibited good corrosion protection of AZ31 in simulated body fluid. Samples immersed in EBSS showed significantly higher electrochemical impedance values and slower corrosion progression as compared to the samples in c-SBF, because of the decreased chloride content and CO2 buffering mechanism of the EBSS.
Jarillo, José A; Piñeiro, Manuel
2015-07-01
Eukaryotic organisms have canonical histones and a number of histone variants that perform specialized functions and confer particular structural properties to the nucleosomes that contain them. The histone H2A family comprises several variants, with H2A.Z being the most evolutionarily conserved. This variant is essential in eukaryotes and has emerged as a key player in chromatin function, performing an essential role in gene transcription and genome stability. During recent years, biochemical, genetic and genomic studies have begun to uncover the role of several ATP-dependent chromatin-remodeling complexes in H2A.Z deposition and removal. These ATPase complexes are widely conserved from yeast to mammals. In Arabidopsis there are homologs for most of the subunits of these complexes, and their functions are just beginning to be unveiled. In this review, we discuss the major contributions made in relation to the biology of the H2A.Z in plants, and more specifically concerning the function of this histone variant in the transition from vegetative to reproductive development. Recent advances in the understanding of the molecular mechanisms underlying the H2A.Z-mediated modulation of the floral transition, and thermosensory flowering responses in particular, are discussed. The emerging picture shows that plants contain chromatin-remodeling complexes related to those involved in modulating the dynamics of H2A.Z in other eukaryotes, but their precise biochemical nature remains elusive. © 2015 The Authors The Plant Journal © 2015 John Wiley & Sons Ltd.
Johannes Theunisz and 'Abd al-'Azīz: a friendship in Arabic Studies in Amsterdam, 1609-1610
van Dalen, D.
2016-01-01
In the winter of 1609-1610, the Moroccan diplomat 'Abd al-'Azīz b. Muḥammad spent four months in the home of the Mennonite Hebraist and Arabist Jan Theunisz in Amsterdam. The written reflections of their discussions on religion and everyday matters present an extraordinary example of the shifting
2013-06-07
... Plan (RMP) for the Quartzsite Solar Energy Project (QSEP). The Acting Assistant Secretary for Land and...) at the following Web site: http://www.blm.gov/az/st/en/prog/energy/solar/quartzsite_solar_energy.html...: Quartzsite Solar Energy LLC, a subsidiary of Solar Reserve LLC, proposes to build the QSEP, a 100-megawatt...
Energy Technology Data Exchange (ETDEWEB)
Han, G.M. [Key Laboratory for Advanced Materials Processing Technology (Ministry of Education), School of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Han, Z.Q., E-mail: zqhan@tsinghua.edu.cn [Key Laboratory for Advanced Materials Processing Technology (Ministry of Education), School of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Luo, A.A. [Department of Materials Science and Engineering, The Ohio State University, Columbus, OH 43210 (United States); Department of Integrated Systems Engineering, The Ohio State University, Columbus, OH 43210 (United States); Liu, B.C. [Key Laboratory for Advanced Materials Processing Technology (Ministry of Education), School of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); State Key Laboratory of Automotive Safety and Energy, Department of Automotive Engineering, Tsinghua University, Beijing 100084 (China)
2015-08-25
Highlights: • Characterization of three-dimensional morphologies of precipitates using AFM. • Quantitative microstructure of aged squeeze-cast AZ91 alloy. • The non-uniform continuous precipitation during aging of squeeze-cast AZ91 alloy. • The relationship between microstructure and property of aged squeeze-cast AZ91 alloy. - Abstract: Quantitative microstructure information is critical to modeling and prediction of mechanical properties of structural components. In this study, the microstructure characteristics of aged squeeze-cast AZ91 alloy were investigated using scanning electron microscopy (SEM), transmission electron microscopy (TEM), and atomic force microscopy (AFM) analyses. Particularly, a study of the three-dimensional morphology of continuous precipitation during heat treatment was carried out using a combination of TEM and AFM. The results showed that a typical precipitate consisted of three kinds of faces, namely, broad, side, and end faces. The precipitate also presented a lath-shaped morphology with lozenge ends. Combined SEM and TEM analyses revealed quantitative information on the sizes and area number densities of precipitates after aging at different temperatures with different times. In general, the length and width of precipitates increased more rapidly than thickness during aging. The area number density initially increased and then slowly decreased because of coarsening. Furthermore, a special microstructure characteristic of the non-uniform continuous precipitation during aging was investigated using electron probe microanalysis (EPMA). The relationship between hardness response and yield strength was established.
Directory of Open Access Journals (Sweden)
Guoqiang Wang
2014-01-01
Full Text Available Effect of anisotropy in compression is studied on hot rolling of AZ31 magnesium alloy with a three-dimensional constitutive model based on the quadratic Hill48 yield criterion and nonassociated flow rule (non-AFR. The constitutive model is characterized by compressive tests of AZ31 billets since plastic deformations of materials are mostly caused by compression during rolling processes. The characterized plasticity model is implemented into ABAQUS/Explicit as a user-defined material subroutine (VUMAT based on semi-implicit backward Euler's method. The subroutine is employed to simulate square-bar rolling processes. The simulation results are compared with rolled specimens and those predicted by the von Mises and the Hill48 yield function under AFR. Moreover, strip rolling is also simulated for AZ31 with the Hill48 yield function under non-AFR. The strip rolling simulation demonstrates that the lateral spread generated by the non-AFR model is in good agreement with experimental data. These comparisons between simulation and experiments validate that the proposed Hill48 yield function under non-AFR provides satisfactory description of plastic deformation behavior in hot rolling for AZ31 alloys in case that the anisotropic parameters in the Hill48 yield function and the non-associated flow rule are calibrated by the compressive experimental results.
78 FR 60698 - Safety Zone, Lucas Oil Drag Boat Racing Series; Thompson Bay, Lake Havasu City, AZ.
2013-10-02
... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone, Lucas Oil Drag Boat Racing Series; Thompson..., AZ for the Lucas Oil Drag Boat Racing Series. This temporary safety zone is necessary to provide... rulemaking (NPRM) with respect to this rule because the logistical details of the Lucas Oil Drag Boat Racing...
Directory of Open Access Journals (Sweden)
Liuwei Zheng
2016-06-01
Full Text Available To improve the homogeneity and rolling formability of as-cast AZ91 magnesium, the effects of pre-homogenizing treatment on microstructure evolution, deformation mechanism, mechanical properties and tensile fracture morphology of hot-rolled AZ91 magnesium alloy were studied. The results showed that the amount of coarse β-Mg17Al12 phase decreases dramatically, being distributed along the grain boundaries as small strips after homogenizing. Twining plays a dominant role in the deformation mechanism of AZ91 alloys in the experimental condition, while dynamic recrystallization (DRX considerably occurred in homogenized-rolled alloys, contributed to microstructure uniformity and β-Mg17Al12 phase precipitated refinement. The tensile strength of homogenized-rolled AZ91 alloys increases dramatically with elongation declining slightly in contrast to homogenized alloys. The fracture surface of homogenized-rolled specimen exhibits more ductile fracture with the manifestation of a large amount of dimples distributing higher density in matrix, while the micro cracks are prone to initiate around the Mg/Mg17Al12 phase interface and grain boundaries owing to the fragile interface bonding of two phases.
Latif, Rindam; Dirpan, Andi; Indriani, Sylvia
2017-12-01
Good manufacturing practices (GMP) describes the requirements that an industry should follow throughout the production process starting from sorting raw materials to handling final products. The purpose of this research is to disclose each phase of GMP in making shredded fish and to assess the status of the practices implemented by the UMKM Az-zahrah in producing its product. This descriptive study is conducted by doing interview with owner followed by observation and documentation of all activities related to the production process in order to assess the status of GMP applied by the UMKM Az-zahrah. In assessing the status, we referred to Permenperin RI No.75 / M-Ind / Per / 7/2010 and KBPOM regulation no. HK 03.1.23.04.12.22007 Year 2012. The findings indicate some deviation occurred when UMKM Az-zahrah implemented it, those are (1) there is a pet in production room (2) production employees are not yet wearing work uniform (3) production room has directly access to toilet (4) there is no health label about health and nutritional claims. The status of applied GMP in the UMKM Az-zahrah is at D level (less good) with rating IV.
Effect of Mucin and Bicarbonate Ion on Corrosion Behavior of AZ31 Magnesium Alloy for Airway Stents
Directory of Open Access Journals (Sweden)
Yongseok Jang
2014-08-01
Full Text Available The biodegradable ability of magnesium alloys is an attractive feature for tracheal stents since they can be absorbed by the body through gradual degradation after healing of the airway structure, which can reduce the risk of inflammation caused by long-term implantation and prevent the repetitive surgery for removal of existing stent. In this study, the effects of bicarbonate ion (HCO3− and mucin in Gamble’s solution on the corrosion behavior of AZ31 magnesium alloy were investigated, using immersion and electrochemical tests to systematically identify the biodegradation kinetics of magnesium alloy under in vitro environment, mimicking the epithelial mucus surfaces in a trachea for development of biodegradable airway stents. Analysis of corrosion products after immersion test was performed using scanning electron microscopy (SEM, energy dispersive X-ray spectroscopy (EDX and X-ray diffraction (XRD. Electrochemical impedance spectroscopy (EIS was used to identify the effects of bicarbonate ions and mucin on the corrosion behavior of AZ31 magnesium alloys with the temporal change of corrosion resistance. The results show that the increase of the bicarbonate ions in Gamble’s solution accelerates the dissolution of AZ31 magnesium alloy, while the addition of mucin retards the corrosion. The experimental data in this work is intended to be used as foundational knowledge to predict the corrosion behavior of AZ31 magnesium alloy in the airway environment while providing degradation information for future in vivo studies.
Hu, H.-J.; Ying, Y.-L.; OU, Z.-W.; Wang, X.-Q.
2017-12-01
Wear resistance of extrusion shear-processed AZ61 magnesium samples with as-cast state and homogenization treatment state has been studied by wear tests using pin-on-disc experiments under dry sliding conditions. Wear rates and friction coefficients between AZ61 magnesium alloy and GCr15 steel have been used to evaluate wear resistances of AZ61 magnesium alloys, and obtained from dry sliding with different frequencies and loads. Scanning electron microscope (SEM) and energy dispersive X-ray spectrometer (EDS) were used to analyze microstructures before and after the wear tests to find the wear mechanisms of AZ61 magnesium samples with as-cast state and homogenization treatment state. The wear resistances of the homogeneous state samples prepared by extrusion-shear process are close to those of as cast state, which are due to the little differences of microstructures. In addition, the wear mechanisms change from mild wear to severe wear with rise of exerted loads and reciprocating frequencies.
2011-03-22
... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF AGRICULTURE Grain Inspection, Packers and Stockyards Administration Designation for the Owensboro, KY; Bloomington, IL; Iowa Falls, IA; Casa Grande, AZ; Fargo, ND; Grand Forks, ND; and Plainview, TX Areas AGENCY...
2013-07-22
... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF AGRICULTURE Grain Inspection, Packers and Stockyards Administration Opportunity for Designation in Owensboro, KY; Bloomington, IL; Iowa Falls, IA; Casa Grande, AZ; Fargo, ND; Grand Forks, ND and Plainview, TX; Areas; Request...
This report documents the activities performed during and the results obtained from the arsenic removal treatment technology demonstration project at an Arizona Water Company (AWC) facility in Sedona, AZ, commonly referred to as Valley Vista. The objectives of the project were t...
This report documents the activities performed during and the results obtained from the arsenic removal treatment technology demonstration project at the Arizona Water Company (AWC) facility in Rimrock, AZ. The objectives of the project were to evaluate: 1) the effectiveness of ...
2010-01-01
... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Special Flight Rules in the Vicinity of the Grand Canyon National Park, AZ Appendix to Subpart U of Part 93 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC AND GENERAL OPERATING RULES SPECIAL AIR TRAFFIC RULES Special Flight Rules i...
2010-01-01
... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false 2-Special Flight Rules in the Vicinity of the Grand Canyon National Park, AZ Federal Special Federal Aviation Regulation No. 50 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC AND GENERAL OPERATING RULES GENERAL OPERATING AND FLIGHT...
Microstructural evolution of die-cast and homogenized AZ91 Mg-alloys during dry sliding condition
Directory of Open Access Journals (Sweden)
Nagaraj M. Chelliah
2017-03-01
Full Text Available Microstructural evolution of die-cast and homogenized AZ91 Mg-alloys was investigated during dry sliding wear condition. Tribological tests were performed using a pin-on-disc (EN8 steel configuration with a normal load of 50 N at a constant sliding speed of 2.5 ms−1 under ambient environment. Delamination was recognized as a predominant wear mechanism in both of these materials. The die-cast AZ91 Mg-alloy exhibits lower coefficient of friction and higher wear rate. This can be ascribed to increase in the intensity of load bearing capacity of hard β-Mg17Al12 phase, and crack formation/de-cohesion at the interface between primary α-Mg and discontinuous β-Mg17Al12 phases. On the contrary, the homogenized AZ91 Mg-alloy experiences higher coefficient of friction and lower wear rate. The friction-induced microstructural evolution (supersaturated α-Mg to eutectic (α + β-Mg17Al12 tending to minimize the wear rate by providing barrier to material removal in the near surface region of homogenized AZ91 Mg-alloy. Therefore, experimental observation revealed that an inverse relationship exists between wear rate and coefficient of friction for the investigated materials. The analysis of worn surfaces and subsurfaces by electron microscopy provided evidence to delamination wear and microstructural evolution.
76 FR 51462 - Notice of Release of an Easement Restriction at Phoenix-Mesa Gateway Airport, Mesa, AZ
2011-08-18
... Gateway Airport, Mesa, AZ AGENCY: Federal Aviation Administration, DOT. ACTION: Notice of Request to... acres of property abutting Phoenix-Mesa Gateway, Mesa, Arizona, from all conditions contained in a grant..., Phoenix-Gateway Airport Authority, 5835 S. Sossaman Road, Mesa, Arizona 85212, Telephone: (480) 988-7709...
This report documents the activities performed and the results obtained from the first six months of the EPA arsenic removal technology demonstration project at the Arizona Water Company (AWC) facility in Sedona, AZ, commonly referred to as Valley Vista. The main objective of the...
This report documents the activities performed during and the results obtained from the first six months of the arsenic removal treatment technology demonstration project at Rimrock, AZ. The objectives of the project are to evaluate the effectiveness of AdEdge Arsenic Package Uni...
Artocarpus altilis proving its worth in toxic metal removal from the ...
African Journals Online (AJOL)
Artocarpus altilis proving its worth in toxic metal removal from the environment. PO Okolo, EEI Irabor, TP Abugu. Abstract. Nuts of breadfruit tree (Artocarpus altilis) obtained from Ugbowo Campus of University of Benin, Benin City, were dehusked and the husk thoroughly washed with distilled water, air-dried, pulverized and ...
Using eternity variables to specify and prove a serializable database interface
Hesselink, Wim H.
Eternity variables are introduced to specify and verify serializability of transactions of a distributed database. Eternity variables are a new kind of auxiliary variables. They do not occur in the implementation but are used in specification and verification. Elsewhere it has been proved that
The Secret Prover : Proving Possession of Arbitrary Files While not Giving Them Away
Teepe, Wouter
2005-01-01
The Secret Prover is a Java application which allows a user (A) to prove to another user (B), that A possesses a file. If B also possesses this file B will get convinced, and if B does not possess this file B will gain no information on (the contents of) this file. This is the first implementation
Maya, Rippi; Sumarmo, Utari
2011-01-01
This paper reports findings of a post test experimental control group design conducted to investigate the role of modified Moore learning approach on improving students' mathematical understanding and proving abilities. Subjects of study were 56 undergraduate students of one state university in Bandung, who took advanced abstract algebra course.…
Diepeveen, N.F.B.; Jarquin-Laguna, A.
2014-01-01
In this paper the results are presented of experiments to prove an innovative concept for passive torque control of variable speed wind turbines using fluid power technology. It is demonstrated that by correctly configuring the hydraulic drive train, the wind turbine rotor operates at or near
Evaluation of microstructural effects on the corrosion behaviour of AZ91D magnesium alloy
DEFF Research Database (Denmark)
Ambat, Rajan; Aung, Naing Naing; Zhou, W.
2000-01-01
The effect of microconstituents on the corrosion and electrochemical behaviour of AZ91D alloy prepared by die-casting and ingot casting route has been investigated in 3.5% NaCl solution at pH 7.25. The experimental techniques used include constant immersion technique, in-situ corrosion monitoring......, and potentiodynamic polarisation experiments. Surface examination and analytical studies were carried out using optical and scanning electron microscopy, EDX and XRD. The corrosion behaviour of microconstituents namely primary alpha, eutectic alpha and beta phases was significantly different. Goring of aluminum...... phase offered marginally lower corrosion rate and better passivation compared with the ingot. In die-cast and ingot, hydrogen evolution took place preferentially on beta phase. XRD pattern of non-corroded and corroded surface revealed the removal of beta phase from alloy surface during corrosion...
Effect of surface treatment on wear behavior of magnesium alloy AZ31
Directory of Open Access Journals (Sweden)
Y. Fouad
2011-03-01
Full Text Available In the present study, wear test has been performed on wrought magnesium alloy AZ31 samples. The test samples were in different conditions as; in the as cast alloy or after undergoing different surface treatment of the wrought alloy. The surface treatments included ball burnishing, swaging and shot peening. The shot peening is done at two main pressure loads; 0.1 and 0.3 bars, while other parameters are held constant. The test results show that the wear worst results were observed in the as cast sample at pressure load 0.3 bars, while the shot peening sample has the worst wear rate among all samples at pressure load of 0.1 bars. On the other hand, the hardness test showed that the swaged sample has the highest hardness value among all samples.
HIGH STRAIN RATE BEHAVIOUR OF AN AZ31 + 0.5 Ca MAGNESIUM ALLOY
Directory of Open Access Journals (Sweden)
Josef Pešička
2012-01-01
Full Text Available The paper reports behaviour of magnesium alloy AZ31 (nominal composition 3 % Al - 1 % Zn – balance Mg with an addition of 0.5 wt. % Ca at high strain rates. Samples were prepared by the squeeze cast technology. Dynamic compression Hopkinson tests were performed at room temperature with impact velocities ranging from 11.2 to 21.9 m.s-1. A rapid increase of the flow stress and the strain rate sensitivity was observed at high strain rates. Transmission electron microscopy showed extremely high dislocation density and mechanical twins of two types. Adiabatic shear banding is discussed as the reason for the observed behaviour at high strain rates.
Influence of processing on microstructure and mechanical properties of magnesium alloy AZ91
Directory of Open Access Journals (Sweden)
Libor Pantělejev
2016-06-01
Full Text Available This paper deals with differences of mechanical characteristics and fracture surface morphology of AZ91 magnesium alloy in extruded state and after subsequent equal channel angular pressing (ECAP. According to the results, the tensile properties were not controlled by grain size only as values of the tensile strength and 0.2 proof stress were similar for both alloys despite having average grain size 15.9 μm for the extruded alloy and 1.2 μm for the ECAPed alloy. In contrast, microhardness seemed to be dependnt solely on the grain size. Fractographic analysis has shown changes in the damage mode from quasi-cleavage fracture in extruded state to rather ductile fracture with dimple morphology in exECAPed state during tensile loading.
Data acquisition and PV module power production in upgraded TEP/AzRISE solar test yard
Bennett, Whit E.; Fishgold, Asher D.; Lai, Teh; Potter, Barrett G.; Simmons-Potter, Kelly
2017-08-01
The Tucson Electric Power (TEP)/University of Arizona AzRISE (Arizona Research Institute for Solar Energy) solar test yard is continuing efforts to improve standardization and data acquisition reliability throughout the facility. Data reliability is ensured through temperature-insensitive data acquisition devices with battery backups in the upgraded test yard. Software improvements allow for real-time analysis of collected data, while uploading to a web server. Sample data illustrates high fidelity monitoring of the burn-in period of a polycrystalline silicon photovoltaic module test string with no data failures over 365 days of data collection. In addition to improved DAQ systems, precision temperature monitoring has been implemented so that PV module backside temperatures are routinely obtained. Weather station data acquired at the test yard provides local ambient temperature, humidity, wind speed, and irradiance measurements that have been utilized to enable characterization of PV module performance over an extended test period
En memoria de un científico mexicano: Francisco Díaz Covarrubias
Hermosillo-Villalobos, Juan J.
1989-01-01
Texto en torno al ingeniero y científico mexicano Francisco Díaz Covarrubias en conmemoración al centenario de su deceso. Covarrubias cursó la carrera de ingeniero topógrafo en el Colegio de Minería en la Ciudad de México, recibiendo los máximos horones en 1853. Algunas de sus principales aportaciones fueron el levantamiento de un Atlas del Valle de México, la fundación y su trabajo como director del Observatorio Astronómico Nacional, y la realización de la expedición a Japón en diciembre de ...
Mechanical properties of high-pressure die-casting AZ91 magnesium alloy
Directory of Open Access Journals (Sweden)
K.N. Braszczyńska-Malik
2008-12-01
Full Text Available Results of mechanical properties of high-pressure die-casting AZ91 magnesium alloy are presented. Performed examinations allowed to determine influence of plunger velocity in the first and second stage and intensification pressure on the ultimate tensile strength (UTS, yield strength (YS, elongation (A5 and Agt, Brinell hardness (HB and impact strength (IS of samples cast on 320 tone cold chamber machine. Obtained results revealed the highest properties at median used parameters and also the most powerful effect of plunger velocity in the first stage. The maximum values of mechanical properties obtained from the performed experiments were: UTS 250 MPa, YS 160 MPa, A5 7%, 70 HB, IS 7 J.
Effect of cenospheres addition on microstructure and properties of AZ91D alloy
Directory of Open Access Journals (Sweden)
Zhi-qiu Huang
2015-11-01
Full Text Available The cenospheres/AZ91D composites were fabricated by melt stir method. The phases, microstructure and tensile fracture morphology of the composites were analyzed using XRD, Olympus metallurgical microscopy and SEM methods. The thermal expansion coefficient (CTE and tensile properties were measured. The results showed that the cenospheres distribute uniformly in the Mg alloy matrix and refine the matrix microstructure. Mg2Si and MgO were found in addition to α-Mg and β-Mg17Al12 phases using XRD. The CTE of the composites reduced after the cenospheres are added. The yield strength of the composites increases significantly with an increase in the mass fraction and a decrease in the size of the cenospheres. The tensile strength of the composites achieves maximum when the mass fraction of cenospheres is 9wt.% and the size of cenospheres is 80 μm. The fracture mechanism of the composites is cleavage fracture.
Corrosion of magnesium alloy AZ31 screws is dependent on the implantation site
Energy Technology Data Exchange (ETDEWEB)
Willbold, E. [Laboratory for Biomechanics and Biomaterials, Department of Orthopaedic Surgery, Hannover Medical School, Anna-von-Borries-Strasse 1-7, D - 30625 Hannover (Germany); Kaya, A.A. [Mugla University, Engineering Faculty, Metallurgy and Materials Engineering Department, Mugla (Turkey); Kaya, R.A. [MedicalPark Hospital, Kueltuer Sok No:1, 34160 Bahcelievler, Istanbul (Turkey); Beckmann, F. [Helmholtz-Zentrum Geesthacht, Institute of Materials Research, Max-Planck-Str.1, D - 21502 Geesthacht (Germany); Witte, F., E-mail: witte.frank@mh-hannover.de [Laboratory for Biomechanics and Biomaterials, Department of Orthopaedic Surgery, Hannover Medical School, Anna-von-Borries-Strasse 1-7, D - 30625 Hannover (Germany)
2011-12-15
The corrosion of biodegradable materials is a crucial issue in implant development. Among other materials, magnesium and magnesium based alloys are one of the most promising candidates. Since the corrosion of biodegradable materials depends on different physiological parameters like pH or ion concentrations, the corrosion might be different in different biological environments. To investigate this issue, we produced screws from magnesium alloy AZ31 and implanted them into the hip bone of 14 sheep. After 3 and 6 months, the screws were explanted and analyzed with synchrotron-radiation based micro-computed tomography and hard tissue histology. We found considerable differences in the corrosion behavior of the magnesium screws with respect to its original tissue location. However, we could detect a normal immunological tissue response.
Chitosan coatings crosslinked with genipin for corrosion protection of AZ31 magnesium alloy sheets.
de Y Pozzo, Ludmila; da Conceição, Thiago F; Spinelli, Almir; Scharnagl, Nico; Pires, Alfredo T N
2018-02-01
In this study, coatings of chitosan crosslinked with genipin were prepared on sheets of AZ31 magnesium alloy and their corrosion protection properties were characterized by means of potentiodynamic polarization and electrochemical impedance spectroscopy (EIS). The coatings were also characterized by means of FTIR and XPS. It was observed that the crosslinking process decreases the corrosion current and shifts the corrosion potential of the alloy to less negative values. The EIS analysis demonstrated that the crosslinking process increases the maximum impedance after short and long exposure times. The superior performance of the crosslinked coatings is related to a lower degree of swelling, as observed in the swelling tests carried out on free-standing films. Copyright © 2017 Elsevier Ltd. All rights reserved.
Influence of inorganic acid pickling on the corrosion resistance of magnesium alloy AZ31 sheet
DEFF Research Database (Denmark)
Nwaogu, Ugochukwu Chibuzoh; Blawert, C.; Scharnagl, N.
2009-01-01
the corrosion resistance of the alloy. The cleaning efficiency of the three acids used and the corrosion protection mechanisms were found to be remarkably different. Best corrosion results were obtained with nitric acid, followed closely by phosphoric acid. Only the sulphuric acid failed more or less when......Surface contaminants as a result of thermo-mechanical processing of magnesium alloys, e.g. sheet rolling, can have a negative effect on the corrosion resistance of magnesium alloys. Especially contaminants such as Fe, Ni and Cu, left on the surface of magnesium alloys result in the formation...... of micro-galvanic couples and can therefore increase corrosion attack on these alloys. Due to this influence they should be removed to obtain good corrosion resistance. In this study, the effect of inorganic acid pickling on the corrosion behaviour of a commercial AZ31 magnesium alloy sheet...
Durability of AZ31 magnesium biodegradable alloys polydopamine aided: Part 1
Directory of Open Access Journals (Sweden)
Tullio Monetta
2017-12-01
Full Text Available The use of magnesium alloys, as a biodegradable medical device, is an interesting challenge for the biomaterials field. Its rapid degradation and the release of hydrogen, when exposed to biological fluids, are the main drawbacks for clinical applications. In this work, a coating made of polydopamine (PDOPA, is used as an intermediate layer to decrease the degradation rate of AZ31 magnesium alloy/polymeric coating system, when exposed to Hank's solution. Experimental results highlighted: (i the formation of a thin PDOPA layer, (ii an increased adhesion in the organic coating/metallic substrate system, (iii a decrease of two orders of magnitude of the corrosion rate when the PDOPA film is used together with an external organic coating, (iv the efficacy in the use of PDODA due to the synergistic effect of both, physical and chemical, interactions between the PDOPA layer and the organic coating.
Comparison of Electrochemical Methods for the Evaluation of Cast AZ91 Magnesium Alloy
Tkacz, Jakub; Minda, Jozef; Fintová, Stanislava; Wasserbauer, Jaromír
2016-01-01
Linear polarization is a potentiodynamic method used for electrochemical characterization of materials. Obtained values of corrosion potential and corrosion current density offer information about material behavior in corrosion environments from the thermodynamic and kinetic points of view, respectively. The present study offers a comparison of applications of the linear polarization method (from −100 mV to +200 mV vs. EOCP), the cathodic polarization of the specimen (−100 mV vs. EOCP), and the anodic polarization of the specimen (+100 mV vs. EOCP), and a discussion of the differences in the obtained values of the electrochemical characteristics of cast AZ91 magnesium alloy. The corrosion current density obtained by cathodic polarization was similar to the corrosion current density obtained by linear polarization, while a lower value was obtained by anodic polarization. Signs of corrosion attack were observed only in the case of linear polarization including cathodic and anodic polarization of the specimen. PMID:28774046
Tang, Weiqin; Li, Dayong; Zhang, Shaorui; Peng, Yinghong
2013-12-01
As a light-weight structural material, magnesium alloys show good potential in improving the fuel efficiency of vehicles and reducing CO2 emissions. However, it is well known that polycrystalline Mg alloys develop pronounced crystallographic texture and plastic anisotropy during rolling, which leads to earing phenomenon during deep drawing of the rolled sheets. It is vital to predict this phenomenon accurately for application of magnesium sheet metals. In the present study, a crystal plasticity model for AZ31 magnesium alloy that incorporates both slip and twinning is established. Then the crystal plasticity model is implemented in the commercial finite element software ABAQUS/Explicit through secondary development interface (VUMAT). Finally, the stamping process of a cylindrical cup is simulated using the developed crystal plasticity finite element model, and the predicting method is verified by comparing with experimental results from both earing profile and deformation texture.
A two-step superplastic forging forming of semi-continuously cast AZ70 magnesium alloy
Directory of Open Access Journals (Sweden)
Pan Wang
2015-03-01
Full Text Available A two-step technology combined forging with superplastic forming has been developed to enhance the forgeability of semi-continuously cast AZ70 magnesium alloy and realize the application of the as-cast magnesium alloy in large deformation bullet shell. In the first step, fine-grained microstructure preforms that are suitable for superplastic forming were obtained by reasonably designing the size of the initial blanks with the specific height-to-diameter ratio, upsetting the blanks and subsequent annealing. In the second step, the heat treated preforms were forged into the end products at the superplastic conditions. The end products exhibit high quality surface and satisfied microstructure. Consequently, this forming technology that not only avoids complicating the material preparation but also utilizes higher strain rate superplastic provides a near net-shaped novel method on magnesium forging forming technology using as-cast billet.
Initial deposition mechanism of electroless nickel plating on AZ91D magnesium alloys
Energy Technology Data Exchange (ETDEWEB)
Song, Y.; Shan, D.; Han, E. [Chinese Academy of Sciences, Environmental Corrosion Center, Inst. of Metal Research, Shenyang (China)
2006-04-15
The pretreatment processes and initial deposition mechanism of electroless nickel plating on AZ91D magnesium alloy were investigated by scanning electron microscopy (SEM) and energy dispersive X-ray (EDX). The results showed that alkaline cleaning could remove the greases and oils from the substrate surface. Acid etching could wipe off the metal chippings and oxides. The hydrofluoric acid activating process which could improve the adhesion of coating to substrate played a key role in the subsequent process of electroless nickel plating. The nickel coating was deposited preferentially on the primary {alpha} phase and then spread to the eutectic {alpha} phase and {beta} phase. The nickel initially nucleated on the primary {alpha} phase by a replacement reaction, then grew depending on the autocatalysis function of nickel. The coating on the {beta} phase displayed better adhesion than that on the {alpha} phase due to the nails fixing effect. (author)
Grain boundary sliding mechanism during high temperature deformation of AZ31 Magnesium alloy
Energy Technology Data Exchange (ETDEWEB)
Roodposhti, Peiman Shahbeigi, E-mail: pshahbe@ncsu.edu [North Carolina State University (United States); University of Connecticut (United States); Sarkar, Apu; Murty, Korukonda Linga [North Carolina State University (United States); Brody, Harold [University of Connecticut (United States); Scattergood, Ronald [North Carolina State University (United States)
2016-07-04
High temperature tensile creep tests were conducted on AZ31 Magnesium alloy at low stress range of 1–13 MPa to clarify the existence of grain boundary sliding (GBS) mechanism during creep deformation. Experimental data within the GBS regime shows the stress exponent is ~2 and the activation energy value is close to that for grain boundary diffusion. Analyses of the fracture surface of the sample revealed that the GBS provides many stress concentrated sites for diffusional cavities formation and leads to premature failure. Scanning electron microscopy images show the appearances of both ductile and brittle type fracture mechanism. X-ray diffraction line profile analysis (based on Williamson-Hall technique) shows a reduction in dislocation density due to dynamic recovery (DRV). A correlation between experimental data and Langdon's model for GBS was also demonstrated.
Alelopatía en Saccharum spp. (caña de azúcar
Directory of Open Access Journals (Sweden)
R. A. Arévalo
2011-01-01
6 Aminoácidos no proteicos, 7 Lactonas no saturadas, 8 ácidos orgánicos, alcoholes alifáticos, aldehídos y cetonas, 9 ácidos grasos, naftoquinonas, antraquinonas, y complejos de quinonas, 10 Coumarina. Los mecanismos de acción en la mayoría de los aleloquímicos son aún desconocidos. Las plantas arvenses, como Cypro-Cyperus rotundus L.; Rooex-Rottboellia exaltata L. f. causan alelopatía en caña de azúcar. Las plantas de Cucsa- Cucumis sativus L. son afectadas por efectos alelopáticos de plantas de Rooex. Las coberturas utilizadas en la agricultura sostenible tienen propiedades alelopáticas. Las respuestas de las plantas cultivadas a los aleloquímicos pueden ser susceptibles, tolerantes o resistentes. La alelopatía tiene gran potencial para el manejo de plagas en la agricultura.
Initiation of fatigue cracks in AZ91 Mg alloy processed by ECAP
Fintová, S.; Kunz, L.
2014-08-01
Mechanism of fatigue crack initiation was investigated in ultrafine-grained (UFG) magnesium alloy AZ91 processed by equal channel angular pressing (ECAP). Fatigue behaviour of UFG material was compared to the behaviour of material in an initial as-cast state. Focused ion beam technique (FIB) was applied to reveal the surface relief and early fatigue cracks. Two substantially different mechanisms of crack initiation were observed in UFG structure, which can be characterized as bimodal even after 6 ECAP passes by route Bc. The bimodality consists in a coexistence of very fine grained areas with higher content of Mg17Al12 particles and areas exhibiting somewhat larger grains and lower density of particles. The fatigue cracks which initiate in areas of larger grains are related to the cyclic slip bands; this initiation mechanism is similar to that observed in cast alloy. The second initiation mechanism is related to the grain boundary cracking which takes place predominantly in the fine grained areas.
Searching for fixed point combinators by using automated theorem proving: A preliminary report
Energy Technology Data Exchange (ETDEWEB)
Wos, L.; McCune, W.
1988-09-01
In this report, we establish that the use of an automated theorem- proving program to study deep questions from mathematics and logic is indeed an excellent move. Among such problems, we focus mainly on that concerning the construction of fixed point combinators---a problem considered by logicians to be significant and difficult to solve, and often computationally intensive and arduous. To be a fixed point combinator, THETA must satisfy the equation THETAx = x(THETAx) for all combinators x. The specific questions on which we focus most heavily ask, for each chosen set of combinators, whether a fixed point combinator can be constructed from the members of that set. For answering questions of this type, we present a new, sound, and efficient method, called the kernel method, which can be applied quite easily by hand and very easily by an automated theorem-proving program. For the application of the kernel method by a theorem-proving program, we illustrate the vital role that is played by both paramodulation and demodulation---two of the powerful features frequently offered by an automated theorem-proving program for treating equality as if it is ''understood.'' We also state a conjecture that, if proved, establishes the completeness of the kernel method. From what we can ascertain, this method---which relies on the introduced concepts of kernel and superkernel---offers the first systematic approach for searching for fixed point combinators. We successfully apply the new kernel method to various sets of combinators and, for the set consisting of the combinators B and W, construct an infinite set of fixed point combinators such that no two of the combinators are equal even in the presence of extensionality---a law that asserts that two combinators are equal if they behave the same. 18 refs.
Energy Technology Data Exchange (ETDEWEB)
Laleh, M., E-mail: laleh.m.1992@gmail.com [Department of Materials Engineering, Faculty of Engineering, Tarbiat Modares University, P.O. Box 14115-143, Tehran (Iran, Islamic Republic of); Kargar, Farzad, E-mail: farzad.kargar@gmail.com [Department of Materials Engineering, Faculty of Engineering, Tarbiat Modares University, P.O. Box 14115-143, Tehran (Iran, Islamic Republic of)
2011-09-15
Highlights: > Nanostructured surface layers were produced on AZ91D magnesium alloy by using SMAT. > Thickness of the deformed layer increased with increasing of the balls size. > Top surface microhardness for all of the SMATed samples increased significantly. > SMAT increased the surface roughness; increase in balls diameter increased the roughness. > SMAT using 2 mm balls increased the corrosion resistance significantly. - Abstract: Surface distinct deformed layers with thicknesses up to 150 {mu}m, with grain size in the top most surface is in the nanometer scale, were produced on AZ91D magnesium alloy using surface mechanical attrition treatment (SMAT). Effects of different ball size on the properties of the SMATed samples were investigated. The microstructural, grain size, hardness and roughness features of the treated surfaces were characterized using optical microscopy (OM), scanning electron microscopy (SEM), X-ray diffraction (XRD), micro-indenter and digital roughness meter, respectively. Corrosion behavior of the samples was evaluated using potentiodynamic polarization and electrochemical impedance spectroscopy (EIS) techniques. It is found that the ball diameter does not have a significant effect on the top surface grain size, but the thickness of the deformed layer increases with increase of ball size, from 50 {mu}m for 2 mm balls to 150 {mu}m for 5 mm balls. For all of the SMATed samples, the top surface microhardness value increased significantly and did not show any obvious change for samples treated with different balls. Corrosion studies show that the corrosion resistance of the sample treated with 2 mm balls is higher than that of those treated with 3 mm and 5 mm balls. This can be mainly attributed to the surface roughness and defects density of the samples, which are higher for the SMATed samples with 3 mm and 5 mm balls compared with that of sample SMATed with 2 mm balls.
Software configuration management plan, 241-AY and 241-AZ tank farm MICON automation system
Energy Technology Data Exchange (ETDEWEB)
Hill, L.F.
1997-10-30
This document establishes a Computer Software Configuration Management Plan (CSCM) for controlling software for the MICON Distributed Control System (DCS) located at the 241-AY and 241-AZ Aging Waste Tank Farm facilities in the 200 East Area. The MICON DCS software controls and monitors the instrumentation and equipment associated with plant systems and processes. A CSCM identifies and defines the configuration items in a system (section 3.1), controls the release and change of these items throughout the system life cycle (section 3.2), records and reports the status of configuration items and change requests (section 3.3), and verifies the completeness and correctness of the items (section 3.4). All software development before initial release, or before software is baselined, is considered developmental. This plan does not apply to developmental software. This plan applies to software that has been baselined and released. The MICON software will monitor and control the related instrumentation and equipment of the 241-AY and 241-AZ Tank Farm ventilation systems. Eventually, this software may also assume the monitoring and control of the tank sludge washing equipment and other systems as they are brought on line. This plan applies to the System Cognizant Manager and MICON Cognizant Engineer (who is also referred to herein as the system administrator) responsible for the software/hardware and administration of the MICON system. This document also applies to any other organizations within Tank Farms which are currently active on the system including system cognizant engineers, nuclear operators, technicians, and control room supervisors.
Archaeological studies at Drill Hole U20az Pahute Mesa, Nye county, Nevada. [Contains bibliography
Energy Technology Data Exchange (ETDEWEB)
Simmons, A.H.; Hemphill, M.L.; Henton, G.H.; Lockett, C.L.; Nials, F.L.; Pippin, L.C.; Walsh, L.
1991-07-01
During the summer of 1987, the Quaternary Sciences Center (formerly Social Science Center) of the Desert Research Institute (DRI), University of Nevada System, conducted data recovery investigations at five archaeological sites located near Drill Hole U20az on the Nevada Test Site in southern Nevada. These sites were among 12 recorded earlier during an archaeological survey of the drill hole conducted as part of the environmental compliance activities of the Department of Energy (DOE). The five sites discussed in this report were considered eligible for the National Register of Historic Places and were in danger of being adversely impacted by construction activities or by effects of the proposed underground nuclear test. Avoidance of these sites was not a feasible alternative; thus DRI undertook a data recovery program to mitigate expected adverse impacts. DRI's research plan included controlled surface collections and excavation of the five sites in question, and had the concurrence of the Nevada Division of Historic Preservation and Archaeology and the Advisory Council of Historic Preservation. Of the five sites investigated, the largest and most complex, 26Ny5207, consists of at least three discrete artifact concentrations. Sites 26Ny5211 and 26Ny5215, both yielded considerable assemblages. Site 26Ny5206 is very small and probably is linked to 26Ny5207. Site 26Ny5205 contained a limited artifact assemblage. All of the sites were open-air occurrences, and, with one exception contained no or limited subsurface cultural deposits. Only two radiocarbon dates were obtained, both from 26Ny5207 and both relatively recent. While the investigations reported in the volume mitigate most of the adverse impacts from DOE activities at Drill Hole U20az, significant archaeological sites may still exist in the general vicinity. Should the DOE conduct further activities in the region, additional cultural resource investigations may be required. 132 refs., 71 figs., 44 tabs.
Directory of Open Access Journals (Sweden)
Manuel FERRAZ LORENZO
2013-09-01
Full Text Available The purpose of this article is to explain the operational guidelines of the Canarian workers movement in the early Twentieth Century in connection with integral educational proposals. For this purpose, we have taken advantage of the articles published in the press by on of the leading exponents of the movement, a member of the anarchist school of thought, José Cabrera Diaz, whose curriculum vitae indicates his importance. He was a journalist, trades union leader and an outand- out defender of rationalist education and of the creation of people's schools, the purpose of which was to eradicate —by combating illiteracy and ignorance— the abusive quasi-feudal practices of the «caciques» that existed in the Canarian Archipiélago.El objetivo de este artículo consiste en exponer las líneas de trabajo del movimiento obrero en Canarias a comienzos de siglo, en lo concerniente a sus propuestas educativas de tipo integral. Para ello nos hemos servido de los trabajos publicados en prensa de uno de sus máximos representantes, inserto en la corriente de pensamiento anarquista: José Cabrera Díaz, cuyo curriculum lo dice todo. Periodista, líder sindical y, además, defensor a ultranza de la educación racionalista y de la creación de escuelas populares, destinadas a erradicar —desde la alfabetización y cultura— las prácticas caciquiles existentes en el Archipiélago.
Electrical Subsurface Grounding Analysis
Energy Technology Data Exchange (ETDEWEB)
J.M. Calle
2000-11-01
The purpose and objective of this analysis is to determine the present grounding requirements of the Exploratory Studies Facility (ESF) subsurface electrical system and to verify that the actual grounding system and devices satisfy the requirements.
Constructivist Grounded Theory?
National Research Council Canada - National Science Library
Barney G. Glaser, PhD, Hon. PhD
2012-01-01
AbstractI refer to and use as scholarly inspiration Charmaz’s excellent article on constructivist grounded theory as a tool of getting to the fundamental issues on why grounded theory is not constructivist...
Constructivist Grounded Theory?
Glaser, Barney G.
2007-01-01
In meinem Beitrag greife ich zurück auf den ausgezeichneten und inspirierenden Artikel von CHARMAZ zu konstruktivistischer Grounded Theory, um an diesem Beispiel zu diskutieren, dass und warum die Grounded Theory kein konstruktivistisches Unterfangen ist. Ich versuche zu zeigen, dass "konstruktivistische Daten" bzw. konstruktivistische Anwendungen der Grounded Theory, sofern sie überhaupt existieren bzw. sinnvoll sein könnten, nur einen verschwindend kleinen Teil der Grounded Theory ausmachen...
Constructivist Grounded Theory?
Directory of Open Access Journals (Sweden)
Barney G. Glaser, PhD, Hon. PhD
2012-06-01
Full Text Available AbstractI refer to and use as scholarly inspiration Charmaz’s excellent article on constructivist grounded theory as a tool of getting to the fundamental issues on why grounded theory is not constructivist. I show that constructivist data, if it exists at all, is a very, very small part of the data that grounded theory uses.
Communication, concepts and grounding
van der Velde, Frank; van der Velde, F.
2015-01-01
This article discusses the relation between communication and conceptual grounding. In the brain, neurons, circuits and brain areas are involved in the representation of a concept, grounding it in perception and action. In terms of grounding we can distinguish between communication within the brain
Directory of Open Access Journals (Sweden)
Rippi Maya
2011-07-01
Full Text Available This paper reports findings of a post test experimental control group design conducted to investigate the role of modified Moore learning approach on improving students’ mathematical understanding and proving abilities. Subject of study were 56 undergradute students of one state university in Bandung, who took advanced abstract algebra course. Instrument of study were a set test of mathematical understanding ability, a set test of mathematical proving ability, and a set of students’ opinion scale on modified Moore learning approach. Data were analyzed by using two path ANOVA. The study found that proof construction process was more difficult than mathematical understanding task for all students, and students still posed some difficulties on constructing mathematical proof task. The study also found there were not differences between students’ abilities on mathematical understanding and on proving abilities of the both classes, and both abilities were classified as mediocre. However, in modified Moore learning approach class there were more students who got above average grades on mathematical understanding than those of conventional class. Moreover, students performed positive opinion toward modified Moore learning approach. They were active in questioning and solving problems, and in explaining their works in front of class as well, while students of conventional teaching prefered to listen to lecturer’s explanation. The study also found that there was no interaction between learning approach and students’ prior mathematics ability on mathematical understanding and proving abilities, but there were quite strong association between students’ mathematical understanding and proving abilities.Keywords: modified Moore learning approach, mathematical understanding ability, mathematical proving ability. DOI: http://dx.doi.org/10.22342/jme.2.2.751.231-250
Proving and Improving Wave Models in the Arctic Ocean and its MIZ
2015-09-30
scale, the Greenland Sea Odden which is important for deep convection. The increased open water area present in the autumn Arctic Ocean , particularly...263(5144), 218–221, doi:10.1126/science.263.5144.218. Hunkins, K. (1966), Ekman drift currents in the Arctic Ocean , Deep Sea Res., 13(4), 607–620...1 DISTRIBUTION STATEMENT A. Approved for public release; distribution is unlimited. Proving and Improving Wave Models in the Arctic Ocean
Potential Discrepancies in Radar Signature Predictions for Ground Vehicles
2004-06-01
class of ground targets of interest for millimeter (MSRC) at Aberdeen Proving Ground (AIG), MD. wave radar applications . We summarize the unclassified...radar rays/wavelength in the shooting and bouncing ray ( SBR ) signatures. method. This represents a typical time for far-field calculations and the actual...eueteesuiu utibuc otiuin.We The virtual models include material descriptions but reduce these spurious multi-bounce contributions. When we remove the rubber
Cooney, Adeline
2011-01-01
This paper explores ways to enhance and demonstrate rigour in a grounded theory study. Grounded theory is sometimes criticised for a lack of rigour. Beck (1993) identified credibility, auditability and fittingness as the main standards of rigour for qualitative research methods. These criteria were evaluated for applicability to a Straussian grounded theory study and expanded or refocused where necessary. The author uses a Straussian grounded theory study (Cooney, In press) to examine how the revised criteria can be applied when conducting a grounded theory study. Strauss and Corbin (1998b) criteria for judging the adequacy of a grounded theory were examined in the context of the wider literature examining rigour in qualitative research studies in general and grounded theory studies in particular. A literature search for 'rigour' and 'grounded theory' was carried out to support this analysis. Criteria are suggested for enhancing and demonstrating the rigour of a Straussian grounded theory study. These include: cross-checking emerging concepts against participants' meanings, asking experts if the theory 'fit' their experiences, and recording detailed memos outlining all analytical and sampling decisions. IMPLICATIONS FOR RESEARCH PRACTICE: The criteria identified have been expressed as questions to enable novice researchers to audit the extent to which they are demonstrating rigour when writing up their studies. However, it should not be forgotten that rigour is built into the grounded theory method through the inductive-deductive cycle of theory generation. Care in applying the grounded theory methodology correctly is the single most important factor in ensuring rigour.
Rice husk ash with high carbon content proves favourable for soil stabilization
Pham, P.V.; van der Star, WRL; van Paassen, L.A.; Ye, G.
2015-01-01
Rice husk ash is a promising pozzolanic material produced from rice husk burning and has significant potential a sustainable replacement for cement in construction and ground improvement applications. In this study the effect of burning conditions on the ash reactivity and its potential for soil
Divide and conquer method for proving gaps of frustration free Hamiltonians
DEFF Research Database (Denmark)
Kastoryano, Michael J.; Lucia, Angelo
2017-01-01
Providing system-size independent lower bounds on the spectral gap of local Hamiltonian is in general a hard problem. For the case of finite-range, frustration free Hamiltonians on a spin lattice of arbitrary dimension, we show that a property of the ground state space is sufficient to obtain suc...
Energy Technology Data Exchange (ETDEWEB)
Wang, Jiali, E-mail: wangjialicsu@yahoo.cn [Center for Translational Medicine Research and Development, Institute of Biomedical and Health Engineering, Chinese Academy of Sciences, Shenzhen 518055 (China); Musculoskeletal Research Laboratory, Department of Orthopaedics and Traumatology, The Chinese University of Hong Kong, Hong Kong SAR (China); Qin, Ling [Center for Translational Medicine Research and Development, Institute of Biomedical and Health Engineering, Chinese Academy of Sciences, Shenzhen 518055 (China); Musculoskeletal Research Laboratory, Department of Orthopaedics and Traumatology, The Chinese University of Hong Kong, Hong Kong SAR (China); Wang, Kai [School of Humanities and Social Sciences, Hunan University of Chinese Medicine, Changsha 410208 (China); Wang, Jue; Yue, Ye [Center for Translational Medicine Research and Development, Institute of Biomedical and Health Engineering, Chinese Academy of Sciences, Shenzhen 518055 (China); Li, Yangde [Guangdong Innovation Team for Biodegradable Magnesium and Medical Implants, E-ande, Dongguan 523660 (China); Tang, Jian [Center for Translational Medicine Research and Development, Institute of Biomedical and Health Engineering, Chinese Academy of Sciences, Shenzhen 518055 (China); Li, Weirong [Guangdong Innovation Team for Biodegradable Magnesium and Medical Implants, E-ande, Dongguan 523660 (China)
2013-10-01
Magnesium alloys have been advocated as potential artificial bone materials due to their biocompatibility and biodegradability. The understanding of their corrosive mechanism in physiological environments is therefore essential for making application-orientated designs. Thus, this in vitro study was designed to assess the effects of CO{sub 2} on corrosive behavior of AZ31D to mimic in vivo special ingredient. Electrochemical technologies accompanied with Scanning electron microscope, Fourier transform infrared, X-ray diffraction, Energy dispersive spectroscopy and hydrogen evolution measurement were employed to analyze corrosive rates and mechanisms of AZ31D. Moreover, the biocompatibility of AZ31D was assessed with a direct cell attachment assay and an indirect cytotoxicity test in different diluted extracts. The ion concentrations in extracts were measured using inductively coupled plasma mass spectrometry to offer explanations on the differences of cell viability in the indirect test. The results of the direct cytotoxicity assay showed that the corrosive rate of AZ31D was too rapid to allow for cell adhesion. Extracts diluted less than 20 times would cause adverse effects on cell proliferation, likely due to excessive ions and gas release. Moreover, the presence of CO{sub 2} did not cause significant differences on corrosive behavior of AZ31D according to the results of electrochemical testing and hydrogen evolution measurement. This might be caused by the simultaneous process of precipitation and dissolution of MgCO{sub 3} due to the penetration role of CO{sub 2}. This analysis of corrosive atmospheres on the degradation behavior of magnesium alloys would contribute to the design of more scientific in vitro testing systems in the future. - Highlights: • We evaluate the effects of CO{sub 2} on corrosion behavior of magnesium alloys. • We assess the feasibility of commercial AZ31D alloy as potential implants. • CO{sub 2} is not the key factor to minimize
Daniel Bello Gil; Emilia Carrera Bocourt; Yuset Díaz Maqueira
2006-01-01
Se desarrolló un procedimiento para determinar la concentración de azúcares reductores totales en jugos mezclados de caña de azúcar por el método del ácido 3,5 dinitro salicílico (DNS). Se evaluaron dos procedimientos para la preparación del reactivo del DNS: en frío y en caliente. Se realizó un análisis comparativo con el método de Eynon- Lane para diferentes diluciones del jugo. El método del DNS en frío mostró menores desviaciones que el método de Eynon-Lane y que el método del DNS en cali...
Directory of Open Access Journals (Sweden)
Jeffers, Clara F.
2011-07-01
Full Text Available El presente artículo pretende mostrar la evidencia que confirma cuál de las dos primeras ediciones de la Historia verdadera de la conquista de la Nueva España de Bernal Díaz del Castillo es, en realidad, la primera. Las dos tienen pies de imprenta muy parecidos -Madrid, Imprenta del Reino- y ambas llevan la fecha de 1632, o bien en la portada o en la suma de la tasa. A través de la evidencia bibliográfica comprobamos que la edición con la portada calcográfica es la primera edición, y la edición con la portada tipográfica es una edición contrahecha posterior. Este artículo es fruto de una investigación realizada como trabajo de fin del máster titulado "Crónicas americanas en la Biblioteca Histórica "Marques de Valdecilla".The following article uses bibliographical evidence to prove which of the two first editions of Historia verdadera de la conquista de la Nueva España by Bernal Díaz del Castillo is the true first edition and which is a posterior illegal edition. Both have the date 1632 either in their imprint or in their legal preliminaries, but this article will show that the illegal edition was printed at a later date. This article is the result of research carried out during the course of investigation related to the Master's Thesis "Crónicas americanas en la Biblioteca Histórica "Marques de Valdecilla".
On asymptotic stability in energy space of ground states of NLS in 2D
Cuccagna, Scipio; Tarulli, Mirko
2009-01-01
We transpose work by K.Yajima and by T.Mizumachi to prove dispersive and smoothing estimates for dispersive solutions of the linearization at a ground state of a Nonlinear Schr\\"odinger equation (NLS) in 2D. As an application we extend to dimension 2D a result on asymptotic stability of ground states of NLS proved in the literature for all dimensions different from 2.
On asymptotic stability in energy space of ground states of NLS in 2D
Cuccagna, Scipio; Tarulli, Mirko
2009-07-01
We transpose work by K.Yajima and by T.Mizumachi to prove dispersive and smoothing estimates for dispersive solutions of the linearization at a ground state of a Nonlinear Schr\\"odinger equation (NLS) in 2D. As an application we extend to dimension 2D a result on asymptotic stability of ground states of NLS proved in the literature for all dimensions different from 2.
McKeown, N. K.; Noe Dobrea, E. Z.; Bishop, J. L.; Silver, E. A.
2009-03-01
One hypothesis for clay formation at Mawrth Vallis is an altered ash-fall, like bentonites in the Painted Desert, AZ. We compare lab, field, and aerial data to determine if silicate spectral features are accurately captured in aerial datasets.
Los amargos beneficios del dulce. Azúcar, Cuba y deuda ecológica
Directory of Open Access Journals (Sweden)
Rodrigo y Alharilla, Martín
2006-06-01
Full Text Available This article is placed within the paradigm of environmental history. From a focus that is both macrohistorical and inductive, it offers a reflection upon the link between the deforestation registered in Cuba as a result of the expansion of sugar cane cultivation, and the transfer of part of the gains produced by sugar towards economies in other latitudes, particularly towards Catalonia. The study analyzes first of all the establishment of sugar cane “haciendas” in the old Cuban province of Las Villas during the second third of the 19th century. It then inquires into the life trajectory of several “hacienda” owners of the region, who in the last period of their lives settled down in Catalonia, where they transferred a large part of the capital they had accumulated on the island. Finally, the essay points at evidence that suggests that the proposed analysis may be applied to other regions in Cuba as well as to Puerto Rico.
El artículo se situa en el paradigma de la historia ambiental. A partir de un enfoque a la vez microhistórico e inductivo, ofrece una reflexión sobre el vínculo existente entre la deforestación registrada en Cuba por efecto de la expansión del cultivo de la caña de azúcar y la transferencia de parte de las ganancias producidas por el azúcar a economías de otras latitudes, particularmente hacia Cataluña. Se analiza, en primer lugar, el proceso de implantación de las haciendas cañeras en la antigua provincia cubana de Las Villas, durante el segundo tercio del siglo XIX, y, a continuación, la trayectoria vital de varios hacendados de la región, los cuales acabaron instalándose en la etapa final de su vida en Cataluña, adonde trasladaron buena parte de los capitales acumulados en la isla. Por último, se apuntan diferentes evidencias que sugieren que el análisis planteado podría realizarse igualmente para otras regiones de Cuba así como para Puerto Rico.
Evaluation of self-healing ability of Ce–V conversion coating on AZ31 magnesium alloy
Directory of Open Access Journals (Sweden)
Xiao Jiang
2016-09-01
Full Text Available This study investigated the influence of cerium nitrate in vanadate solutions on the properties of Ce–V conversion coatings on AZ31 magnesium alloys, and evaluated the self-healing behavior of the Ce–V conversion coating for AZ31 magnesium alloy. The results showed that the additions of cerium nitrate prevented pentavalent vanadium from reducing to tetravalent vanadium in the coatings during conversion reaction process. Adding appropriate cerium nitrate to vanadate solution led to a thicker coating with a more compact CeVO4 layer. The corrosion behavior of the Ce–V conversion coating was investigated by the electrochemical tests and the scratch immersion test in 3.5 wt.% NaCl solution. The self-healing ability of the coating was confirmed from all tests. The surface analysis revealed that the self-healing effect of the Ce–V conversion coating was only provided by the release and migration of vanadium compounds.
Directory of Open Access Journals (Sweden)
T. Reguła
2010-04-01
Full Text Available The main aim of this paper is to evaluate the effects of hot working (extrusion and hest treatment on room temperature mechanical properties of magnesium-based AZ91 alloy. The results were compared with as-cast condition. The examined material had been obtained by gravity casting to permanent moulds and subsequently subjected to heat treatment and/or processed by extrusion at 648 K. Microstructural and mechanical properties of properly prepared specimens were studied. Rm, Rp02 and A5 were determined from tensile tests. Brinell hardness tests were also conducted. The research has shown that hot working of AZ91 alloy provides high mechanical properties unattainable by cast material subjected to heat-treatment. The investigated alloy subjected to hot working and subsequently heat-treated has doubled its strength and considerably improved the elongation - compared with the as-cast material.
Girón, L.; Aperador, W.; Tirado, L.; Franco, F.; Caicedo, J. C.
2017-08-01
The anodized AZ31B magnesium alloys were synthesized via electrodeposition processes. The aim of this work was to determine the electrochemical behavior of magnesium alloys by using anodized alloys as a protective coating. The anodized alloys were characterized by x-ray diffraction, exhibiting the crystallography orientation for Mg and MgO phases. The x-ray photoelectron spectroscopy was used to determine the chemical composition of anodized magnesium alloys. By using electrochemical impedance spectroscopy and Tafel curves, it was possible to estimate the electrochemical behavior of anodized AZ31B magnesium alloys in Hank's balanced salt solution (HBSS). Scanning electron microscopy was performed to analyze chemical changes and morphological surface changes on anodized Mg alloys due to the reaction in HBSS/anodized magnesium surface interface. Electrochemical behavior in HBSS indicates that the coatings may be a promising material for biomedical industry.
Directory of Open Access Journals (Sweden)
Zuzanka Trojanová
2018-01-01
Full Text Available Deformation behaviour of rolled AZ31 sheets that were subjected to the accumulative roll bonding was investigated. Substantially refined microstructure of samples was achieved after the first and second pass through the rolling mill. Sheets texture was investigated using an X-ray diffractometer. Samples for tensile tests were cut either parallel or perpendicular to the rolling direction. Tensile tests were performed at temperatures ranging from room temperature up to 300 °C. Tensile plastic anisotropy, different from the anisotropy observed in AZ31 sheets by other authors, was observed. This anisotropy decreases with an increasing number of rolling passes and increasing deformation temperature. Grain refinement and texture are the crucial factors influencing the deformation behaviour.
Hadadzadeh, Amir; Wells, Mary; Essadiqi, Elhachmi
A 2-D coupled thermal-fluid-stress model was developed and used to simulate the twin roll casting (TRC) of an AZ31 magnesium alloy using the commercial software package, ALSIM. The model was used to predict the fluid flow, temperature distribution and mechanical behavior of AZ31 magnesium alloy in the roll bite. An important parameter in controlling the TRC process is the set-back distance; the distance between the nozzle entry to the kissing point of the rolls. There are two approaches to increase the set-back: 1) increasing the entry thickness and 2) decreasing the final strip thickness. In this study the effect of set-back distance and casting speed on the thermo-mechanical behavior of the strip during TRC has been studied. The thermo-mechanical behavior of the strip has a significant effect on the final quality as defect formation depends on such behavior.
Directory of Open Access Journals (Sweden)
Nabeel H. Alharthi
2018-01-01
Full Text Available All manufacturing engineers are faced with a lot of difficulties and high expenses associated with grinding processes of AZ61. For that reason, manufacturing engineers waste a lot of time and effort trying to reach the required surface roughness values according to the design drawing during the turning process. In this paper, an artificial neural network (ANN modeling is used to estimate and optimize the surface roughness (Ra value in cutting conditions of AZ61 magnesium alloy. A number of ANN models were developed and evaluated to obtain the most successful one. In addition to ANN models, traditional regression analysis was also used to build a mathematical model representing the equation required to obtain the surface roughness. Predictions from the model were examined against experimental data and then compared to the ANN model predictions using different performance criteria such as the mean absolute error, mean square error, and coefficient of determination.
Directory of Open Access Journals (Sweden)
DENG Xiaohu
2017-06-01
Full Text Available A 2-D CA model has been developed to simulate two-stage hot deformation processing of magnesium (Mg alloy. Based on the fact that Mg has an HCP crystal structure with six-fold symmetry, the model employs hexagonal CA lattice. The physically-based model has integrated the effects of individual metallurgical phenomena related with the hot deformation, including dynamic recrystallization (DRX, static recovery, static recrystallization (SRX, meta-dynamic recrystallization (MDRX and grain growth, etc. The model is validated by simulating single-stage and two-stage hot compression tests of AZ31B. The effects of temperature, strain rate, the interval and pre-strain on stress-strain curves are investigated. The calculated results are compared with the available experimental findings in AZ31B Mg alloy, and the simulated results agree well with the experimental results and theoretical models.
Energy Technology Data Exchange (ETDEWEB)
Hansen, E
2005-03-31
The objective of this task is to characterize and report specified physical properties and pH of simulant high level waste (HLW) melter feeds (MF) processed through the scaled melters at Vitreous State Laboratories (VSL). The HLW MF simulants characterized are VSL AZ102 straight hydroxide melter feed, VSL AZ102 straight hydroxide rheology adjusted melter feed, VSL AY102/C106 straight hydroxide melter feed, VSL AY102/C106 straight hydroxide rheology adjusted melter feed, and Savannah River National Laboratory (SRNL) AY102/C106 precipitated hydroxide processed sludge blended with glass former chemicals at VSL to make melter feed. The physical properties and pH were characterized using the methods stated in the Waste Treatment Plant (WTP) characterization procedure (Ref. 7).
Energy Technology Data Exchange (ETDEWEB)
Aleksanin, S., E-mail: Aleksanin@arcerm.spb.ru [Nikiforov Russian Center of Emergency and Radiation Medicine EMERCOM of Russia, (NRCERM) ul. Akademika Lebedeva 4/2, 194044 St. Petersburg (Russian Federation); Slozina, N., E-mail: NataliaSlozina@peterlink.ru [Nikiforov Russian Center of Emergency and Radiation Medicine EMERCOM of Russia, (NRCERM) ul. Akademika Lebedeva 4/2, 194044 St. Petersburg (Russian Federation); Neronova, E.; Smoliakov, E. [Nikiforov Russian Center of Emergency and Radiation Medicine EMERCOM of Russia, (NRCERM) ul. Akademika Lebedeva 4/2, 194044 St. Petersburg (Russian Federation)
2011-09-15
Russian citizens who were irradiated because of radiation disasters, nuclear weapons testing and some other sources have a right to some social support and financial compensation. In order to get this compensation people have to prove that they were irradiated. As it is, not all victims for a variety of reasons have formal documents. Thus they apply for cytogenetic investigation to prove irradiation months, years and even decades after irradiation. Since 1992 the cytogenetic investigations related to radiation exposure were performed in NRCERM for more than 700 people. At the beginning of this investigation FISH method was not certified as a biodosimenty test in Russia. Only dicentric analysis was approved as a proof of irradiation. It is known that the rate of dicentrics decrease in time, but the residual level of cytogenetical markers could be revealed a long time after a radiation accident. Thus the dicentric analysis was performed for the people who applied for biological indication of radiation exposure at that time. Rates of dicentrics exceeding control levels were revealed in half the people who applied for radiation conformation. Now FISH method is certified in Russia and both cytogenetic tests of biodosimetry (dicentrics and FISH) are available for all comers. Increased levels of translocations were found in 8 cases (the dose rate from 0.16 to 0.64 Gy). On the basis of the results of cytogenetic tests official documents were supplied to these people and they were entitled to apply for radiation exposure compensation. Thus cytogenetic tests are very effective and in some cases the only possible way for the victims to prove irradiation exposure and to apply for radiation exposure compensation a long time after an accident.
Proving Unlawful Discrimination in Capital Cases: In Quest of an Adequate Standard of Proof
Directory of Open Access Journals (Sweden)
Gregor Maučec
2017-08-01
Full Text Available In spite of some early judicial, political and scholarly discussions, as well as more recent scientific explorations of the topic, problems and concerns with proving discrimination in individual capital cases continue to be among the most debatable issues in human rights and criminal justice. In general, domestic courts (in particular US courts seem to remain relatively perfunctory and hostile to individual discrimination challenges in capital trials. They normally require capital defendants alleging discrimination to prove something which is virtually impossible to prove. On the other hand, numerous capital defence attorneys, legal commentators and even some of the trial judges themselves lay strictures on the existing judicial approach which almost routinely rejects discrimination claims in capital cases. They contend that appropriate modifications in current legislative arrangements and mechanical adjudication policy and practice are urgent and indispensable for more equitable resolutions and for a truly even-handed criminal justice system. In particular, there are concerns regarding the adequate distribution of the burden of proof between the litigants. Moreover, no clear or uniform approach to this conundrum can be identified in the international jurisprudence. This article seeks to provide some definite answers to open and conceptual questions posed in an attempt to legally define ‘the minimum core content’ of the evidentiary standard – as implicitly contained in the relevant international human rights treaties’ provisions – to be applied in capital sentencing discrimination cases. Additionally, part of this same standard of proof can also qualify as a general principle of international law, particularly in relation to impartial, unbiased and non-discriminatory approaches and decision-making by the judges and jurors involved in complex capital cases.
[Introduction to grounded theory].
Wang, Shou-Yu; Windsor, Carol; Yates, Patsy
2012-02-01
Grounded theory, first developed by Glaser and Strauss in the 1960s, was introduced into nursing education as a distinct research methodology in the 1970s. The theory is grounded in a critique of the dominant contemporary approach to social inquiry, which imposed "enduring" theoretical propositions onto study data. Rather than starting from a set theoretical framework, grounded theory relies on researchers distinguishing meaningful constructs from generated data and then identifying an appropriate theory. Grounded theory is thus particularly useful in investigating complex issues and behaviours not previously addressed and concepts and relationships in particular populations or places that are still undeveloped or weakly connected. Grounded theory data analysis processes include open, axial and selective coding levels. The purpose of this article was to explore the grounded theory research process and provide an initial understanding of this methodology.
Airport Ground Staff Scheduling
DEFF Research Database (Denmark)
Clausen, Tommy
travels safely and efficiently through the airport. When an aircraft lands, a significant number of tasks must be performed by different groups of ground crew, such as fueling, baggage handling and cleaning. These tasks must be complete before the aircraft is able to depart, as well as check......-in and security services. These tasks are collectively known as ground handling, and are the major source of activity with airports. The business environments of modern airports are becoming increasingly competitive, as both airports themselves and their ground handling operations are changing to private...... ownership. As airports are in competition to attract airline routes, efficient and reliable ground handling operations are imperative for the viability and continued growth of both airports and airlines. The increasing liberalization of the ground handling market prompts ground handling operators...
A Simple Application of Lightweight Fusion to Proving the Equivalence of Abstract Machines
DEFF Research Database (Denmark)
Danvy, Olivier; Millikin, Kevin
2007-01-01
We show how Ohori and Sasano's recent lightweight fusion by fixed-point promotion provides a simple way to prove the equivalence of the two standard styles of specification of abstract machines: (1) as a transition function together with a `driver loop' implementing the iteration of this transition...... function; and (2) as a function directly iterating upon a configuration until reaching a final state, if ever. The equivalence hinges on the fact that the latter style of specification is a fused version of the former one. The need for such a simple proof is motivated by our recent work on syntactic...... correspondences between reduction semantics and abstract machines, using refocusing...
Energy Technology Data Exchange (ETDEWEB)
Ricco, G. [Consiglio Nazionale delle Ricerche, Bari (Italy). Istituto Nazionale di Ricerca sulle Acque; Tomei, M.C. [Consiglio Nazionale delle Ricerche, Rome (Italy). Istituto Nazionale di Ricerca sulle Acque
1999-10-01
In this paper an experimental procedure to evaluate the biomass characterization parameters by utilizing respirometric tests is presented. Beside, a procedure for data analysis based on the kinetic, stoichiometric and mass balance equations describing the system in the various operating conditions required for the evaluation of the different parameters is proposed. Finally, the results of a first example of application to the sludge characterization of a civil waste water treatment plant are reported. [Italian] Viene presentato un primo esempio applicativo relativo alla caratterizzazione di un fango attivo proveniente da un impianto di trattamento di reflui civili utilizzando il modello cinetico di Monod con l'impiego di prove respirometriche.
Proving the correctness of unfold/fold program transformations using bisimulation
DEFF Research Database (Denmark)
Hamilton, Geoff W.; Jones, Neil
2011-01-01
proofs show the original and transformed programs are contextually equivalent, i.e., have the same termination behaviour in all closed contexts. Contextual equivalence can, however, be difficult to establish directly. Gordon and Howe use an alternative approach: to represent a program's behaviour...... to describe contextually, due to use of non-local information. We show that weak bisimulation on labelled transition systems gives an elegant framework to prove contextual equivalence of original and transformed programs. One reason is that folds can be seen in the context of corresponding unfolds....
How to prove the validity of a complex ballot encryption to the voter and the public
Joaquim, Rui
2014-01-01
One crucial aspect of any verifiable electronic voting system that uses encryption is the proof that the vote encryption is well-formed, i.e. the proof that the vote encryption encrypts a valid vote accordingly to the race specification. It makes no sense accepting an encrypted vote if, at the end of the election, the vote cannot be included in the tally because it is badly formed. Proving the validity of a complex vote encryption, without revealing the vote, is a hard problem. This paper...
Seismic proving test of ultimate piping strength (current status of preliminary tests)
Energy Technology Data Exchange (ETDEWEB)
Suzuki, K.; Namita, Y.; Abe, H.; Ichihashi, I. [Seismic Engineering Center, NUPEC, Tokyo (Japan); Suzuki, K. [Tokyo Metropolitan Universtity, Hachioji (Japan); Ishiwata, M. [Hitachi, Ltd., Hitachi (Japan); Fujiwaka, T. [Ishikawajima-Harima Heavy Industries Co., Ltd., Yokohama (Japan); Yokota, H. [Mitsubishi Heavy Industries Ltd., Kobe (Japan)
2001-07-01
In 1998 Fiscal Year, the 6 year program of piping tests was initiated with the following objectives: i) to clarify the elasto-plastic response and ultimate strength of nuclear piping, ii) to ascertain the seismic safety margin of the current seismic design code for piping, and iii) to assess new allowable stress rules. In order to resolve extensive technical issues before proceeding on to the seismic proving test of a large-scale piping system, a series of preliminary tests of materials, piping components and simplified piping systems is intended. In this paper, the current status of the material tests and the piping component tests is reported. (author)
Energy Technology Data Exchange (ETDEWEB)
Jang, Yongseok [Engineering Research Center for Revolutionizing Metallic Biomaterials (ERC-RMB), North Carolina A and T State University, Greensboro, NC, 27411 (United States); Tan, Zongqing [Internal Medicine, College of Medicine, University of Cincinnati, OH 45211 (United States); Jurey, Chris [Luke Engineering, Wadsworth, OH 44282 (United States); Collins, Boyce [Engineering Research Center for Revolutionizing Metallic Biomaterials (ERC-RMB), North Carolina A and T State University, Greensboro, NC, 27411 (United States); Badve, Aditya [Business and Biology, The University of North Carolina at Chapel Hill, NC 27514 (United States); Dong, Zhongyun [Internal Medicine, College of Medicine, University of Cincinnati, OH 45211 (United States); Park, Chanhee; Kim, Cheol Sang [Department of Bio-nano System Engineering, Chonbuk National University, Jeonju, Jeonbuk 561-756 (Korea, Republic of); Sankar, Jagannathan [Engineering Research Center for Revolutionizing Metallic Biomaterials (ERC-RMB), North Carolina A and T State University, Greensboro, NC, 27411 (United States); Yun, Yeoheung, E-mail: yyun@ncat.edu [Engineering Research Center for Revolutionizing Metallic Biomaterials (ERC-RMB), North Carolina A and T State University, Greensboro, NC, 27411 (United States)
2014-12-01
This study was conducted to identify the differences between corrosion rates, corrosion types, and corrosion products in different physiological environments for AZ31 magnesium alloy and plasma electrolytic oxidation (PEO) treated AZ31 magnesium alloy. In vitro and in vivo tests were performed in Hank's Balanced Salt Solution (HBSS) and mice for 12 weeks, respectively. The corrosion rates of both AZ31 magnesium alloy and PEO treated AZ31 magnesium alloy were calculated based on DC polarization curves, volume of hydrogen evolution, and the thickness of corrosion products formed on the surface. Micro X-ray computed tomography (Micro-CT), scanning electron microscopy (SEM), energy dispersive X-ray spectroscopy (EDX) and X-ray diffraction (XRD) were used to analyze morphological and chemical characterizations of corrosion products. The results show that there is more severe localized corrosion after in vitro test in HBSS; however, the thicknesses of corrosion products formed on the surface for AZ31 magnesium alloy and PEO treated AZ31 magnesium alloy in vivo were about 40% thicker than the thickness of corrosion products generated in vitro. The ratio of Ca and P (Ca/P) in the corrosion products also differed. The Ca deficient region and higher content of Al in corrosion product than AZ31 magnesium alloy were identified after in vivo test in contrast with the result of in vitro test. - Highlights: • Effects of plasma electrolytic oxidation on AZ31 in vitro and in vivo • Retardation of degradation via plasma electrolytic oxidation in vitro and in vivo • Differentiation of in vitro and in vivo corrosion types and products.
Puopolo, G; Cimmino, A; Palmieri, M C; Giovannini, O; Evidente, A; Pertot, I
2014-10-01
To investigate low molecular weight compounds produced in vitro by Lysobacter capsici AZ78 and their toxic activity against sporangia of plant pathogenic oomycetes. Assays carried out in vitro showed that L. capsici AZ78 drastically inhibits the growth of plant pathogenic oomycetes. Accordingly, the preventive application of culture filtrates of L. capsici AZ78 on grapevine and tomato plants reduced the infections, respectively, caused by Plasmopara (Pl.) viticola and Phytophthora infestans. The subsequent chemical analysis of the culture filtrates of L. capsici AZ78 by spectroscopic (essentially 1D and 2D (1)H NMR and (13)C NMR and ESI MS spectra) and optical methods led to the identification of the 2,5-diketopiperazine cyclo(L-Pro-L-Tyr) that inhibited the development of P. infestans sporangia in vitro and on tomato leaves. Furthermore, a genomic region with high sequence identity with genes coding for a hybrid polyketide synthase and nonribosomal peptide synthetase was detected in L. capsici AZ78. Lysobacter capsici AZ78 produces cyclo(L-Pro-L-Tyr) in vitro that was effective in killing the sporangia of P. infestans and Pl. viticola in vitro. Moreover, this low molecular weight compound prevents the occurrence of late blight lesions when applied on tomato leaves. The application of L. capsici AZ78 cells or its own culture filtrates effectively controls both P. infestans and Pl. viticola. Cyclo(L-Pro-L-Tyr) produced by L. capsici AZ78 is toxic against sporangia of both these oomycetes. These data enforce the potential in the use of Lysobacter members for the control of plant pathogenic oomycetes and provide the basis for the development of new low-impact fungicides based on cyclo(L-Pro-L-Tyr). © 2014 The Society for Applied Microbiology.
Electrical grounding prong socket
Leong, Robert
1991-01-01
The invention is a socket for a grounding prong used in a three prong electrical plug and a receptacle for the three prong plug. The socket being sufficiently spacious to prevent the socket from significantly stretching when a larger, U-shaped grounding prong is inserted into the socket, and having a ridge to allow a snug fit when a smaller tubular shape grounding prong is inserted into the socket.
Evaluación de la mezcla de ametrina + clomazone en caña de azúcar
Directory of Open Access Journals (Sweden)
Valent\\u00EDn A. Esqueda
2001-01-01
Full Text Available caña de azúcar. Se estableció un experimento en el Rancho Casablanca, Municipio de Puente Nacional, en el estado de Veracruz, México, para evaluar la toxicidad ocasionada por la mezcla de los herbicidas ametrina + clomazone a las variedades de caña de azúcar MEX-79-431, MEX-69-290, MEX-68- P23 y CP-72-2086. Se evaluaron cuatro tratamientos de control de malezas: 1. Ametrina + clomazone (1200 + 800 g/ha, 2. Ametrina + clomazone (1800 + 1200 g/ha, 3. Ametrina + 2,4-D (1225 + 650 g/ha y 4. Testigo limpio. Los herbicidas se aplicaron cuando la caña de azúcar tenía entre dos y cuatro hojas. La mezcla de ametrina + clomazone ocasionó blanqueamiento del follaje en todas las variedades de caña de azú- car. El área con blanqueamiento, varió entre el 36,3 y 47,5% con la dosis mas alta de esta mezcla; entre el 25 y 39,4%, con la dosis menor y prácticamente desapareció a los 45 días despu és de la aplicación. A su vez, la mezcla de ametrina + 2,4- D no ocasionó blanqueamiento. La toxicidad ocasionada por la mezcla de ametrina + clomazone no afectó el número de hojas por planta, el número de tallos en 2 m lineales y la altura de las plantas. Tampoco fueron afectados el rendimiento de tallos y el contenido de sacarosa
Wei, Zhongling; Tian, Peng; Liu, Xuanyong; Zhou, Bangxin
2015-02-01
Magnesium and its alloys have large potential as degradable and absorbable biomaterials because of their mechanical properties and biocompatibility. However, their corrosion resistance is usually inadequate especially in physiological environment, which limits their broad applications in biomedical areas. In this work, plasma electrolytic oxidized/poly(l-lactide) (PEO/PLLA) composite coating was successfully fabricated on biodegradable AZ31 alloy by combing PEO process and sealing with PLLA. The microstructure, elemental composition, and phase composition of the PEO/PLLA composite coating were investigated. The in vitro degradation of the PEO/PLLA composite coating in simulated body fluid (SBF) was also systematically evaluated. The results revealed that the PEO/PLLA composite coating improved the corrosion resistance of AZ31 alloy significantly. The corrosion potential shifted from -1.663V to more positive position -1.317 V and the corrosion current density was reduced with six-order of magnitude. The Mg(2+) ions, hydrogen release, and pH value change of solution caused by degradation were all decreased significantly. Moreover, the PEO process played a critical role in sustaining the integrity of the implant in long-term service. The result of hemolysis test showed that the PEO/PLLA composite coating vested AZ31 alloy a low hemolysis ratio (0.806 ± 0.771)%, which is much lower than the safe value of 5% according to ISO 10993-4. For the cytocompatibility test, compared with bare AZ31 alloy and PEO coating, MC3T3-E1 cells showed much better adhesion and proliferation on the PEO/PLLA composite coating with nearly 4-fold increase of cells after 7-day cultivation, indicating that the PEO/PLLA composite coating has good biocompatibility for biomedical applications. © 2014 Wiley Periodicals, Inc.
Magnesium alloy AZ63A reinforcement by alloying with gallium and using high-disperse ZrO2 particles
Directory of Open Access Journals (Sweden)
J. Khokhlova
2016-12-01
Full Text Available The aim of this work was to obtain an experimental magnesium alloy by remelting standard AZ63A alloy with addition of gallium ligatures and ZrO2 particles. This allowed reinforcement of alloy and increase its hardness and Young's modulus. The chemical analysis of this alloy shows two types of structures which are evenly distributed in volume. Thus we can conclude that reinforcing effect is the result of formation of intermetallic phase Mg5-Ga2.
Energy Technology Data Exchange (ETDEWEB)
Hou, Dewen [College of Materials Science and Engineering, Chongqing University, Chongqing 400044 (China); National Engineering Research Center for Magnesium Alloys, Chongqing University, Chongqing 400044 (China); Liu, Tianmo, E-mail: tmliu@cqu.edu.cn [College of Materials Science and Engineering, Chongqing University, Chongqing 400044 (China); National Engineering Research Center for Magnesium Alloys, Chongqing University, Chongqing 400044 (China); Chen, Huicong; Shi, Dongfeng; Ran, Chunhua; Pan, Fusheng [College of Materials Science and Engineering, Chongqing University, Chongqing 400044 (China); National Engineering Research Center for Magnesium Alloys, Chongqing University, Chongqing 400044 (China)
2016-04-13
The twinning and slipping modes of a rolled AZ31 magnesium alloy sheet were investigated through in situ compressive tests. A method based on scanning electron microscopy and electron backscattered diffraction measurements was used to identify activated twinning and slip systems. {10-12} tensile twins were present, but only occasionally. Contraction twins were not observed. Post deformation examination revealed the dominance of pyramidal
En híbrida mezcolanza: Exile and Cultural Anxiety in Alirio Díaz Guerra’s Lucas Guevara
Directory of Open Access Journals (Sweden)
Jeffrey Browitt
2005-03-01
Full Text Available The novel Lucas Guevara, written by the Colombian exile, Alirio Díaz Guerra, was first published in New York in 1914. It is considered to be the earliest novel about Latin American immigration to the United States written in Spanish. This fact alone merits its study. A second edition was published in 2001 along with a critical-biographical introduction, which presents the novel as the precursor of a developing genre of Hispanic immigrant literature centred on the naïve Latin American migrant who arrives in the United States inspired by the opportunities which the metropolis supposedly affords, but who nevertheless suffers a series of misfortunes because of the inability to adapt to the new culture. On the level of overt content, the novel is a lachrymose, stereotypical and conventional denunciation of the supposed evils of an amoral US society and the libertine and materialistic values underpinning it. But on a much deeper level, a picture emerges of Díaz Guerra himself as a displaced, disenchanted intellectual exile who suffers (or has suffered an acute cultural and class anxiety in the transition from a patrician Arcadia to the heart of capitalist, industrial modernity. Through a reading of the narrative voice, and by extension the implied author, we witness his difficult coming to terms with a highly-charged New York society (in comparison to his homeland, not only because of the sexual liberation brought on by secular modernization, but also because of the close proximity of volatile, eroticised bodies on the over-crowded Lower East Side of New York, the scene of the novel and Díaz Guerra’s point of entry into the United States. The novel also provides an occasion to contrast how Díaz Guerra deals with the condition of exile, in contrast to that most emblematic of Latin American political refugees, José Martí.
A New Factor in American Destiny: Visions of Porfirio Díaz and the Politics of “Logical Paternalism”
Directory of Open Access Journals (Sweden)
Jason Ruiz
2011-12-01
Full Text Available This essay interprets American representations of dictator Porfirio Díaz in relation to the “economic conquest” of Mexico that took place during his long rule (1876–1911, a period known as the “Porfiriato,” in which Americans invested more than $1 billion. No single person inspired as much attention from travelers, reporters, and photographers during the late nineteenth and early twentieth centuries as Díaz, and their visions of the President helped to shape perceptions of Mexico as a desirable field in which to expand US capitalism and influence. Travelers clamored to meet him and his sophisticated young wife, and their travelogues were rich with descriptions of such encounters. Reporters, dazzled by the rapid transformation of Mexico during his 35-year rule, described Díaz in such terms as “the Mexican Wizard” and “the maker of modern Mexico” until the very end of his regime. Photographers, working in a relatively new medium, amassed a huge body of works devoted to the dictator; even at an advanced age late in his rule, the President’s image adorned postcards and commemorative cartes-de-visite that posited him in heroic and hypermasculine terms (not unlike those of his US counterpart, Theodore Roosevelt. Ultimately, this essay argues that representations like these reflected American desires for a Mexican body politic that was amenable to economic and social transformation under the inextricable banners of “progress” and US capitalism. Prevailing images of Díaz and his family suggested that Mexico was as friendly to foreign investors as it was to foreign visitors.
Jago, Mark
2011-01-01
Grounding is a powerful metaphysical concept; yet there is widespread scepticism about the intelligibility of the notion. In this paper, I propose an account of an entity’s nature or essence, which I then use to provide grounding conditions for that entity. I claim that an understanding of an entity’s nature, together with an account of how logically complex entities are grounded, provides all we need to understand how that entity is grounded. This approach not only allows us to say what grou...
Directory of Open Access Journals (Sweden)
Zuo Yubo
2013-01-01
Full Text Available Intensive melt shearing has a significant grain refining effect on some light alloys. However, the persistence of the grain refining effect during isothermal holding and remelting is still unclear, although it is very important for the practical application. In this study, intensive melt shearing was achieved in a twin-screw mechanism to investigate its grain refining effect on AZ91D magnesium alloy. The refinement mechanism was discussed and the persistence of grain refinement after remelting and isothermal holding was also studied. A Zeiss imaging system with polarized light was used for quantitative measurement of grain size. The results show that the intensive melt shearing has a significant grain refining effect on AZ91D magnesium alloy. With the application of intensive melt shearing, the grain size of AZ91D magnesium alloy can be reduced from 530 μm (for a typical as-cast microstructure to 170 μm, which is about 70% size reduction. The grain refinement achieved by the intensive melt shearing can be partially kept after isothermal holding and remelting. It is believed that the refinement effect was mainly due to the finer and well dispersed oxide particles formed by high intensive shearing. The smaller size of oxide particles and their slow motion velocity in the sheared melt could make important contributions to the remained grain refinement.
Salleh, M. N. M.; Ishak, M.; Aiman, M. H.; Idris, S. R. A.; Romlay, F. R. M.
2017-09-01
AZ31B magnesium alloy have been hugely applied in the aerospace, automotive, and electronic industries. However, welding thin sheet AZ31B was challenging due to its properties which is easily to evaporated especially using conventional fusion welding method such as metal inert gas (MIG). Laser could be applied to weld this metal since it produces lower heat input. The application of fiber laser welding has been widely since this type of laser could produce better welding product especially in the automotive sectors. Low power fiber laser was used to weld this non-ferrous metal where pulse wave (PW) mode was used. Double fillet lap joint was applied to weld as thin as 0.6 mm thick of AZ31B and the effect of pulsed energy on the strength was studied. Bond width, throat length, and penetration depth also was studied related to the pulsed energy which effecting the joint. Higher pulsed energy contributes to the higher fracture load with angle of irradiation lower than 3 °
Directory of Open Access Journals (Sweden)
Ming Qian, Da Li and Chang Jin
2008-01-01
Full Text Available Blown-powder laser surface alloying was performed on the magnesium alloy AZ91D with Al–Si alloy powder to improve corrosion resistance. Characterization by scanning electron microscopy (SEM, energy dispersive spectroscopy (EDS and x-ray diffraction (XRD analysis revealed that intermetallic compounds (IMCs of Mg2Si, Al12Mg17 and Al3Mg2 were formed in the matrix of α-Mg and Al solid solutions in Al–Si alloyed layers. The anodic polarization test in 3.5% NaCl aqueous solution showed that preferential corrosion occurred in the α-Mg matrix of the AZ91D base metal. The Al–Si alloyed layers exhibited a lower corrosion rate and a higher polarization resistance than AZ91D. The compactly dispersed dendritic Mg2Si phase, and the dendritic and angular phases of Al12Mg17 and Al3Mg2 in the alloyed microstructure were observed to be corrosion-resistant, constituting a barrier that retards corrosion. Corrosion initiated at the interface between IMCs and the solid solution matrix, and at substructures of the matrix, subsequently pervaded into the surrounding microstructure.
Temporal regulation of foregut development by HTZ-1/H2A.Z and PHA-4/FoxA.
Directory of Open Access Journals (Sweden)
Dustin L Updike
2006-09-01
Full Text Available The histone variant H2A.Z is evolutionarily conserved and plays an essential role in mice, Drosophila, and Tetrahymena. The essential function of H2A.Z is unknown, with some studies suggesting a role in transcriptional repression and others in activation. Here we show that Caenorhabditis elegans HTZ-1/H2A.Z and the remodeling complex MYS-1/ESA1-SSL-1/SWR1 synergize with the FoxA transcription factor PHA-4 to coordinate temporal gene expression during foregut development. We observe dramatic genetic interactions between pha-4 and htz-1, mys-1, and ssl-1. A survey of transcription factors reveals that this interaction is specific, and thus pha-4 is acutely sensitive to reductions in these three proteins. Using a nuclear spot assay to visualize HTZ-1 in living embryos as organogenesis proceeds, we show that HTZ-1 is recruited to foregut promoters at the time of transcriptional onset, and this recruitment requires PHA-4. Loss of htz-1 by RNAi is lethal and leads to delayed expression of a subset of foregut genes. Thus, the effects of PHA-4 on temporal regulation can be explained in part by recruitment of HTZ-1 to target promoters. We suggest PHA-4 and HTZ-1 coordinate temporal gene expression by modulating the chromatin environment.
Energy Technology Data Exchange (ETDEWEB)
Arrabal, R., E-mail: raularrabal@quim.ucm.es [Departamento de Ciencia de Materiales, Facultad de Ciencias Quimicas, Universidad Complutense, 28040 Madrid (Spain); Matykina, E.; Pardo, A.; Merino, M.C. [Departamento de Ciencia de Materiales, Facultad de Ciencias Quimicas, Universidad Complutense, 28040 Madrid (Spain); Paucar, K. [Gabinete de Corrosion, Facultad de Ingenieria Quimica y Textil, Universidad Nacional de Ingenieria, Cod. Postal 25, Lima (Peru); Mohedano, M.; Casajus, P. [Departamento de Ciencia de Materiales, Facultad de Ciencias Quimicas, Universidad Complutense, 28040 Madrid (Spain)
2012-02-15
Highlights: Black-Right-Pointing-Pointer Mg alloys with additions of Nd and Gd were exposed to high humidity atmosphere. Black-Right-Pointing-Pointer The increase of Nd or Gd diminished the effect of micro-galvanic couples. Black-Right-Pointing-Pointer Corrosion resistance of the AM50 alloy improved with the addition of Nd or Gd by 43%. Black-Right-Pointing-Pointer Nd and Gd had no significant effect on the corrosion resistance of the AZ91D alloy. - Abstract: AM50 and AZ91D alloys modified with rare earths (RE) were evaluated under atmospheric conditions. Nd and Gd additions resulted in formation of Al{sub 2}RE and Al-Mn-RE compounds and reduction of the fraction of {beta}-phase. According to surface potential maps, RE-containing intermetallics were more noble than the {beta}-phase, but less than Al-Mn inclusions. As a result, the action of micro-galvanic couples depended on the added amount of RE and the initial alloy microstructure. Nd or Gd additions improved the corrosion resistance of the AM50 alloy by up to 43%, but had no significant effect on the corrosion resistance of the AZ91D alloy.
Factores de competitividad de la agroindustria de la caña de azúcar en México
Directory of Open Access Journals (Sweden)
Noé Aguilar Rivera
2011-01-01
Full Text Available La industria azucarera de México integra actividades agrícolas de crecimiento, cosecha y transporte de caña a la producción de azúcar estándar y refinada, con otros productos y subproductos. Para competir en una economía global, es importante establecer criterios de desempeño para reducir costos de producción en términos de competitividad técnica, productividad y eficiencia en aspectos como rendimientos, caña de azúcar y agroindustrial por hectárea y de fábrica. En este artículo se discuten algunos indicadores de competitividad económica y técnica de la industria de caña de azúcar mexicana, con metodologías de benchmarking y diamante de Porter. Los resultados mostraron que son numerosos los factores técnicos y económicos que limitan el crecimiento, debido a que la industria mexicana se ha mantenido no competitiva y requiere mejorar e innovar en la reducción de costos, sobre todo en materia prima, cosecha y transporte. También está la diversificación, con base en los subproductos, como residuos de cosecha, bagazo, melazas, lodo de filtros y vinazas; esto es de gran importancia como fuente renovable de energía y materias primas.
Tomada, Selena; Puopolo, Gerardo; Perazzolli, Michele; Musetti, Rita; Loi, Nazia; Pertot, Ilaria
2016-01-01
Bacterial cells can display different types of motility, due to the presence of external appendages such as flagella and type IV pili. To date, little information on the mechanisms involved in the motility of the Lysobacter species has been available. Recently, L. capsici AZ78, a biocontrol agent of phytopathogenic oomycetes, showed the ability to move on jellified pea broth. Pea broth medium improved also the biocontrol activity of L. capsici AZ78 against Plasmopara viticola under greenhouse conditions. Noteworthy, the quantity of pea residues remaining on grapevine leaves fostered cell motility in L. capsici AZ78. Based on these results, this unusual motility related to the composition of the growth medium was investigated in bacterial strains belonging to several Lysobacter species. The six L. capsici strains tested developed dendrite-like colonies when grown on jellified pea broth, while the development of dendrite-like colonies was not recorded in the media commonly used in motility assays. To determine the presence of genes responsible for biogenesis of the flagellum and type IV pili, the genome of L. capsici AZ78 was mined. Genes encoding structural components and regulatory factors of type IV pili were upregulated in L. capsici AZ78 cells grown on the above-mentioned medium, as compared with the other tested media. These results provide new insight into the motility mechanism of L. capsici members and the role of type IV pili and pea compounds on the epiphytic fitness and biocontrol features of L. capsici AZ78.
Directory of Open Access Journals (Sweden)
Selena Tomada
2016-07-01
Full Text Available Bacterial cells can display different types of motility, due to the presence of external appendages such as flagella and type IV pili. To date, little information on the mechanisms involved in the motility of the Lysobacter species has been available. Recently, L. capsici AZ78, a biocontrol agent of phytopathogenic oomycetes, showed the ability to move on jellified pea broth. Pea broth medium improved also the biocontrol activity of L. capsici AZ78 against Plasmopara viticola under greenhouse conditions. Noteworthy, the quantity of pea residues remaining on grapevine leaves fostered cell motility in L. capsici AZ78. Based on these results, this unusual motility related to the composition of the growth medium was investigated in bacterial strains belonging to several Lysobacter species. The six L. capsici strains tested developed dendrite-like colonies when grown on jellified pea broth, while the development of dendrite-like colonies was not recorded in the media commonly used in motility assays. To determine the presence of genes responsible for biogenesis of the flagellum and type IV pili, the genome of L. capsici AZ78 was mined. Genes encoding structural components an d regulatory factors of type IV pili were upregulated in L. capsici AZ78 cells grown on the above-mentioned medium, as compared with the other tested media. These results provide new insight into the motility mechanism of L. capsici members and the role of type IV pili and pea compounds on the epiphytic fitness and biocontrol features of L. capsici AZ78.
Directory of Open Access Journals (Sweden)
Juan Manuel Vargas Ramírez
2014-06-01
Full Text Available Los métodos de almacenamiento de largo plazo son necesarios para preservar los azúcares fermentables en la remolacha y permitir el funcionamiento exitoso a lo largo del año en las plantas procesadoras para la obtención de etanol. Se estudió el almacenamiento anaeróbico de la remolacha azucarera como una alternativa al almacenamiento convencional en pilas a la intemperie utilizado actualmente en fábricas de azúcar de remolacha. Los resultados experimentales indican una pérdida de <15% en el total de los azúcares fermentables en la remolacha azucarera almacenada anaeróbicamente durante 14 semanas a 4 °C. Después de 14 semanas de almacenamiento, 99 ± 4% de los azúcares fermentables iniciales fueron preservados en la remolacha almacenada en condiciones aeróbicas a 4 °C. El almacenamiento aeróbico y anaeróbico de remolacha azucarera a 25 ° C conserva 82 ± 9 y 48 ± 11% del contenido de azúcar fermentable, respectivamente. Los azúcares fermentables y etanol en exudados contribuyeron insignificantemente (<3% para el rendimiento del etanol global de remolacha azucarera después del almacenamiento.
Puopolo, Gerardo; Tomada, Selena; Sonego, Paolo; Moretto, Marco; Engelen, Kristof; Perazzolli, Michele; Pertot, Ilaria
2016-01-01
Lysobacter capsici AZ78 has considerable potential for biocontrol of phytopathogenic microorganisms. However, lack of information about genetic cues regarding its biological characteristics may slow down its exploitation as a biofungicide. In order to obtain a comprehensive overview of genetic features, the L. capsici AZ78 genome was sequenced, annotated and compared with the phylogenetically related pathogens Stenotrophomonas malthophilia K729a and Xanthomonas campestris pv. campestris ATCC 33913. Whole genome comparison, supported by functional analysis, indicated that L. capsici AZ78 has a larger number of genes responsible for interaction with phytopathogens and environmental stress than S. malthophilia K729a and X. c. pv. campestris ATCC 33913. Genes involved in the production of antibiotics, lytic enzymes and siderophores were specific for L. capsici AZ78, as well as genes involved in resistance to antibiotics, environmental stressors, fungicides and heavy metals. The L. capsici AZ78 genome did not encompass genes involved in infection of humans and plants included in the S. malthophilia K729a and X. c. pv. campestris ATCC 33913 genomes, respectively. The L. capsici AZ78 genome provides a genetic framework for detailed analysis of other L. capsici members and the development of novel biofungicides based on this bacterial strain.
Energy Technology Data Exchange (ETDEWEB)
Yoon, Sang Won; Choi, Myung Chan; Chang, Young-Wook; Noh, Si-Tae [Hanyang University, Ansan (Korea, Republic of); Kwon, Soon Kil [Agency for Defense Development, Daejeon (Korea, Republic of)
2015-02-15
A new energetic thermoplastic elastomer based on the azidated polybutadiene(Az-PBD)/ethylene vinyl acetate copolymer (EVA) blends was prepared, and structure and properties of the blends were investigated by SEM, DSC, DMA, tensile testing and combustion test. The Az-PBD was synthesized via a two-step process involving the addition reaction of commercially available 1,2-PBD with Br{sub 2} and subsequent nucleophilic substitution reaction of the brominated PBD with NaN{sub 3}. EVA/Az-PBD with 90/10, 80/20, 70/30 (wt/wt) was prepared by a solution blending. SEM, DSC, and DMA results revealed that the blends are partially compatible and Az-PBD is dispersed in continuous EVA matrix. Tensile test showed that modulus and tension set increased while elongation-at-break of the blends decreased with increasing Az-PBD content in the blends, but all the blends showed a elongation at break as high as 700% and a tension set of less than 5%, indicating that the blends are typically elastomeric. Combustion test showed that, with increasing Az-PBD content in the blend, higher energy can be released.
Ebbesen, Morten F; Bienk, Konrad; Deleuran, Bent W; Howard, Kenneth A
2014-01-01
We recently synthesized a hydrophilic polymer, poly(N-(2-hydroxypropyl)methacrylamide-co-N-(3-azidopropyl)methacrylamide), p(HPMA-co-AzMA), by RAFT polymerization using a novel azide-containing methacrylamide monomer that through a post modification strategy using click chemistry enabled facile preparation of a panel of versatile and well-defined bioconjugates. In this work we screen a panel of different molecular weight (Mw) fluorescently tagged p(HPMA-co-AzMA) in healthy mice, by live bioimaging, to select an extended circulatory half-life material for investigating joint accumulation in a murine collagen antibody-induced arthritis model. Fluorescence image analysis revealed half-lifes of HPMA-co-AzMA) of 15, 36 and 54 kDa, respectively, with ~10% polymer retained in the blood after 24 h for the highest Mw. p(HPMA-co-AzMA) of 54 kDa showed enhanced accumulation in the joints of the arthritic mouse model with a bioavailability (AUC = 1783% · h) ~12 times higher (P = 0.01) than healthy control (AUC = 148% · h). p(HPMA-co-AzMA) of 54 kDa exhibited extended circulatory half-life and preferential accumulation in inflamed joints of a murine model of rheumatoid arthritis (RA). This combined with well-defined polymer size and versatility for conjugation of a range of biomolecules promotes p(HPMA-co-AzMA) for potential applications in the delivery of drugs for treatment of RA.
Directory of Open Access Journals (Sweden)
Spasić Vidoje
2015-01-01
Full Text Available The multifaceted process of identifying and proving the infringement of intellectual property rights is further complicated and aggravated in the so-called analogue environment. The development of Information Technologies has given rise to a new set of problems. The digital technology has facilitated the infringement of intellectual property rights and additionally aggravated the process of proving these infringements. Hence, it is the duty of digital forensics to identify relevant (valid evidence and present it in the court of law, which is not an easy task. In that course, the problems are twofold: legal and technical. First of all, the legislation in many countries is not adjusted to resolving the issues constantly emerging in the digital environment and there are apparent differences in the manner of regulating these issues. On the other hand, there is no standardized and unified technology which would provide for a uniform qualification and comprehensive treatment of these issues. Moreover, the place of commission of these criminal offences as a rule does not coincide with the place of occurring legal consequences. Yet, in spite of all these difficulties, there are technological methods and tools which facilitate the detection of cybercrime and provide evidence for securing relevant punishment. In the time to come, the developments in this area are expected to be aimed at strengthening the protection of legitimate interests of holders of intellectual property rights.
Directory of Open Access Journals (Sweden)
Kemal ALDAŞ
2014-09-01
Full Text Available Bu çalışmada AZ91 magnezyum alaşımının farklı parametreler altında işlenmesi ile oluşan kesme kuvvetlerinin deneysel tabanlı teorik bir model ile tahmin edilmesi sunulmuştur. Modelleme için gerekli deneyler kuru işleme ortamında ve işleme devri ilerleme hızı ve 4 farklı matkap ucunun tam faktöriyel deney tasarımı kullanarak gerçekleştirilmiştir. Deneyler sonucunca elde edilen veriler Genetic Expression yazılımı ile modellenerek kesme kuvveti tahmini için formulasyon oluşturulmuştur. Bu formulasyon kullanılarak deneyde kullanılan parametrelerin kesme kuvveti üzerindeki etkileri detaylı olarak analiz edilmiştir
Evolution of rheocast microstructure of AZ31 alloy in semisolid state
Directory of Open Access Journals (Sweden)
Xing Bo
2013-07-01
Full Text Available Semisolid rheoforming (SSR is a promising technology for the production of Mg wrought alloy in foundry settings. In order to realize SSR, it is necessary to characterize the grain structure evolution during slurry preparation. In this paper, slurry of AZ31 alloy was produced by a novel rheocast process known as self-inoculation method (SIM. Interrupted quenching technology was applied to investigate the primary α-Mg evolution during continuous cooling and isothermal holding. Results indicate that the initial microstructure of slurry produced by SIM is a mixture of irregular grains, which becomes ideally globular when the slurry slowly cools to 620 ℃ and isothermally held for at least 30 s. The local solute diffusion leads to dendritic fragmentation and forms separated particles. During prolonged holding, the particle surface gradually becomes smooth because of protuberance melting and groove advancement. Coarsening of α-Mg grains in isothermal holding was analyzed using Lifshitz-Slyozov-Wagner theory. Results suggest that coalescence is most likely the dominant coarsening mechanism in the early stage while Ostwald ripening tends to be the principal one later. The EDS results indicate that a longer holding time leads to Al solute element segregation at the grain boundaries, but Zn distribution within liquid matrix has no obvious change.
A Revisited Study of the Processing Map and Optimized Workability of AZ61 Magnesium Alloy
Zhou, X.; Liu, R. R.; Zhou, H. T.; Jiang, W. X.
2017-05-01
The hot deformation behavior of AZ61 magnesium alloy was studied by hot compression testing in the temperature range from 250 to 400 °C with strain rates from 10-3 to 1 s-1. Typical flow stress/true strain curves with the features of dynamic recrystallization (DRX) have been obtained. According to the flow stress curves, the processing maps were constructed via the dynamic material model (DMM). The maps exhibit a domain of DRX at temperatures between 330 and 370 °C and strain rates ranging from 10-3 to 10-2 s-1. The corresponding extrusion deformation was carried out in this DRX region. Gleeble 3500, optical microscopy (OM) and transmission electron microscopy (TEM) were used to characterize the microstructure evolution. The microstructure detection of this DRX region shows that the average grain size decreases with decreasing extrusion temperature. TEM observation further indicated that there are irregularly shaped subgrains with a high dislocation density, a dislocation network, the feature of dislocation pileup and an appearance of twin formation in the alloy hot-extruded using the parameters determined by our constructed processing maps.
Modification and upgrade of AzRISE/TEP solar photovoltaic test yard
Bennett, Whit; Fishgold, Asher; Lai, Teh; Elwood, Teri; Potter, Barrett G.; Simmons-Potter, Kelly
2016-09-01
The University of Arizona AzRISE (Arizona Research Institute for Solar Energy) and Tucson Electric Power solar test yard is currently undergoing renovations to upgrade and standardize the data acquisition capabilities throughout the yard. Test yard improvements have enabled increased data collection reliability through state-of-the-art and environmentallyrobust data logging and real-time analysis. Enhanced capabilities include 10 msec max. data resolution, precision PV backside temperature monitoring of both individual and strings of modules, measurement of both AC and DC outputs as well as GHI and POA irradiance, active data backup to eliminate data intermittency, and robust Ethernet connectivity for data collection. An on-site weather station, provides wind speed and direction, relative humidity, and air temperature data. The information collected is accessed remotely via web server and includes raw performance and environmental conditions as well as extracted figures of performance for systems under test. Complementing the UA's existing accelerated environmental-testing chamber, the new test yard acquisition capabilities have enabled high fidelity system and sub-system-level operational testing under a range of field-level test conditions. The combined facilities, thus, provide a full-spectrum testing resource for photovoltaic performance and degradation analysis. Specific measurement characteristics and sample data collected from a polysilicon module test string are utilized to illustrate test yard capabilities.
Formation of Structure and Properties in Casting Processes on the Example of AZ91 Magnesium Alloy
Directory of Open Access Journals (Sweden)
Augustyn B.
2014-06-01
Full Text Available Contemporary materials engineering requires the use of materials characterised by high mechanical properties, as these precisely properties determine the choice of material for parts of machinery and equipment. Owing to these properties it is possible to reduce the weight and, consequently, the consumption of both material and energy. Trying to meet these expectations, the designers are increasingly looking for solutions in the application of magnesium alloys as materials offering a very beneficial strength-to-weight ratio. However, besides alloying elements, the properties are to a great extent shaped by the solidification conditions and related structure. The process of structure formation depends on the choice of casting method forced by the specific properties of casting or by the specific intended use of final product. The article presents a comparison of AZ91 magnesium alloys processed by different casting technologies. A short characteristic was offered for materials processed by the traditional semi-continuous casting process, which uses the solidification rates comprised in a range of 5 - 20°C/s, and for materials made in the process of Rapid Solidification, where the solidification rate can reach 106 °C/s. As a result of the casting process, a feedstock in the form of billets and thin strips was obtained and was subjected next to the process of plastic forming. The article presents the results of structural analysis of the final product. The mechanical properties of the ø7 mm extruded rods were also evaluated and compared.
EnviroAtlas - Phoenix, AZ - One Meter Resolution Urban Land Cover Data (2010)
The EnviroAtlas Phoenix, AZ land cover (LC) data and map were generated from USDA NAIP (National Agricultural Imagery Program) four band (red, green, blue and near-infrared) aerial photography taken from June through September, 2010 at 1 m spatial resolution. Seven land cover classes were mapped: water, impervious surfaces, soil and barren land, trees and forest, shrubs, grass and herbaceous non-woody vegetation, and agriculture. An accuracy assessment using a completely random sampling of 598 land cover reference points yielded an overall accuracy of 69.2%. The area mapped includes the entirety of the Central Arizona-Phoenix Long-Term Ecological Research (CAP-LTER) area, which was classified by the Environmental Remote Sensing and Geoinformatics Lab (ERSG) at Arizona State University. The land cover dataset also includes an area of approximately 625 square kilometers which is located north of Phoenix. This section was classified by the EPA land cover classification team. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (https://www.epa.gov/enviroatlas) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data (https://edg.epa.gov/data/Public/ORD/EnviroAtlas) or as an EnviroAtlas map service. Additional descriptive information about each at
EnviroAtlas -Phoenix, AZ- One Meter Resolution Urban Land Cover Data (2010) Web Service
This EnviroAtlas web service supports research and online mapping activities related to EnviroAtlas (https://www.epa.gov/enviroatlas). The EnviroAtlas Phoenix, AZ land cover data and map were generated from USDA NAIP (National Agricultural Imagery Program) four band (red, green, blue and near-infrared) aerial photography taken from June through September, 2010 at 1 m spatial resolution. Seven land cover classes were mapped: water, impervious surfaces, soil and barren land, trees and forest, shrubland, grass and herbaceous non-woody vegetation, and agriculture. An accuracy assessment using a completely random sampling of 598 land cover reference points yielded an overall accuracy of 69.2%. The area mapped includes the entirety of the Central Arizona-Phoenix Long-Term Ecological Research (CAP-LTER) area, which was classified by the Environmental Remote Sensing and Geoinformatics Lab (ERSG) at Arizona State University. The land cover dataset also includes an area of approximately 625 square kilometers which is located north of Phoenix. This section was classified by the EPA land cover classification team. This dataset was produced by the US EPA to support research and online mapping activities related to EnviroAtlas. EnviroAtlas (https://www.epa.gov/enviroatlas) allows the user to interact with a web-based, easy-to-use, mapping application to view and analyze multiple ecosystem services for the contiguous United States. The dataset is available as downloadable data
Microstructure and tensile properties of thixo-diecast AZ91D magnesium alloy
Directory of Open Access Journals (Sweden)
Ai Xiulan
2013-09-01
Full Text Available The thixo-diecasting (TDC process is the combination of semi-solid billet preparation technology and die casting technology. The TDC process not only keeps the characteristics of thixo-forming but also has high efficiency and low cost. In the present work, the microstructures and mechanical properties of an AZ91D magnesium alloy prepared by the thixo-diecasting (TDC process were characterized in as-cast condition. The TDC alloy produced exhibits a unique microstructure containing α-Mg solid solution and β-Mg17Al12 intermetallic compound, and there are some small droplets and a small gray globule with eutectic structure in the primary α-Mg grains. The ultimate tensile strength and elongation of the TDC alloy also increase in comparison with other processes, such as thixocasting. Fracture surface observation shows that a crack mainly originates from the brittle fracture of the eutectic phases. The deformation of ductile α-Mg phase provides the TDC alloy with the main strain.
Fibre Laser Cutting and Chemical Etching of AZ31 for Manufacturing Biodegradable Stents
Directory of Open Access Journals (Sweden)
Ali Gökhan Demir
2013-01-01
Full Text Available The use of magnesium-alloy stents shows promise as a less intrusive solution for the treatment of cardiovascular pathologies as a result of the high biocompatibility of the material and its intrinsic dissolution in body fluids. However, in addition to requiring innovative solutions in material choice and design, these stents also require a greater understanding of the manufacturing process to achieve the desired quality with improved productivity. The present study demonstrates the manufacturing steps for the realisation of biodegradable stents in AZ31 magnesium alloy. These steps include laser microcutting with a Q-switched fibre laser for the generation of the stent mesh and subsequent chemical etching for the cleaning of kerf and surface finish. Specifically, for the laser microcutting step, inert and reactive gas cutting conditions were compared. The effect of chemical etching on the reduction in material thickness, as well as on spatter removal, was also evaluated. Prototype stents were produced, and the material composition and surface quality were characterised. The potentialities of combining nanosecond laser microcutting and chemical etching are shown and discussed.
Effect of solution treatment on microstructure and hardness of rheo-forming AZ91-Y alloy
Directory of Open Access Journals (Sweden)
Zhi-wei Wang
2016-11-01
Full Text Available The microstructure and hardness of rheo-forming AZ91-Y alloy before and after solution treatment (ST have been investigated by means of optical microscope (OM, scanning electron microscope (SEM equipped with energy dispersive spectroscopy (EDS, X-ray diffraction (XRD and Vickers. The experimental results showed that the β-Mg17Al12 phase of alloy was nearly dissolved after ST for 5 min. With the increasing of ST duration to 28 h, both the primary and secondarily solidified α-Mg grains faded away. At the same time, the alloy exhibited a much smoother surface due to the diffusion of solute atoms (Al. During ST, the thermal stable phase of Al2Y produced by ultrasonic vibration retained its size and morphology. As the ST duration was increased, the alloy hardness decreased sharply at first, and then gradually reached a minimum level. The alloy’s appropriate ST duration at 410 °C was approximately 28 h.
A study of strontium doped calcium phosphate coatings on AZ31
Energy Technology Data Exchange (ETDEWEB)
Singh, Satish S., E-mail: sss42@pitt.edu [Department of Chemical and Petroleum Engineering, University of Pittsburgh, Pittsburgh, PA 15261 (United States); Roy, Abhijit, E-mail: abr20@pitt.edu [Department of Bioengineering, University of Pittsburgh, Pittsburgh, PA 15261 (United States); Lee, Boeun E.; Ohodnicki, John; Loghmanian, Autrine [Department of Bioengineering, University of Pittsburgh, Pittsburgh, PA 15261 (United States); Banerjee, Ipsita [Department of Chemical and Petroleum Engineering, University of Pittsburgh, Pittsburgh, PA 15261 (United States); Department of Bioengineering, University of Pittsburgh, Pittsburgh, PA 15261 (United States); Kumta, Prashant N., E-mail: pkumta@pitt.edu [Department of Chemical and Petroleum Engineering, University of Pittsburgh, Pittsburgh, PA 15261 (United States); Department of Bioengineering, University of Pittsburgh, Pittsburgh, PA 15261 (United States); Center for Craniofacial Regeneration, University of Pittsburgh, Pittsburgh, PA 15261 (United States); Department of Mechanical Engineering and Materials Science, University of Pittsburgh, PA 15261 (United States)
2014-07-01
Calcium phosphate (CaP) coatings have been studied to tailor the uncontrolled non-uniform corrosion of Mg based alloys while simultaneously enhancing bioactivity. The use of immersion techniques to deposit CaP coatings is attractive due to the ability of the approach to coat complex structures. In the current study, AZ31 substrates were subjected to various pretreatment conditions prior to depositing Sr{sup 2+} doped and undoped CaP coatings. It was hypothesized that the bioactivity and corrosion protection of CaP coatings could be improved by doping with Sr{sup 2+}. Heat treatment to elevated temperatures resulted in the diffusion of alloying elements, Mg and Zn, into the pretreated layer. Sr{sup 2+} doped and undoped CaP coatings formed on the pretreated substrates consisted of biphasic mixtures of β-tricalcium phosphate (β-TCP) and hydroxyapatite (HA). Electrochemical corrosion experiments indicated that the extent of Sr{sup 2+} doping and pretreatment both influenced the corrosion protection. Cytotoxicity was evaluated with MC3T3-E1 mouse preosteoblasts and human mesenchymal stem cells (hMSCs). For both cell types, proliferation decreased upon increasing the Sr{sup 2+} concentration. However, both osteogenic gene and protein expression significantly increased upon increasing Sr{sup 2+} concentration. These results suggest that Sr{sup 2+} doped coatings are capable of promoting osteogenic differentiation on degradable Mg alloys, while also enhancing corrosion protection, in comparison to undoped CaP coatings.
The Effects of Carbon Nanotubes on the Mechanical and Wear Properties of AZ31 Alloy
Directory of Open Access Journals (Sweden)
Mingyang Zhou
2017-12-01
Full Text Available Carbon nanotube (CNT-reinforced AZ31 matrix nanocomposites were successfully fabricated using a powder metallurgy method followed by hot extrusion. The influence of CNTs on microstructures, mechanical properties, and wear properties were systematically investigated by optical microscope (OM, scanning electron microscope (SEM, X-ray diffraction (XRD, hardness test, tensile test, and wear test. The results revealed that the nanocomposites showed a slightly smaller grain size compared with the matrix and uniform distribution that CNTs could achieve at proper content. As a result, the addition of CNTs could weaken basal plane texture. However, the yield strength and ultimate tensile strength of the composites were enhanced as the amount of CNTs increased up to 2.0 wt. %, reaching maximum values of 241 MPa (+28.2% and 297 MPa (+6.1%, respectively. The load transfer mechanism, Orowan mechanism, and thermal mismatch mechanism played important roles in the enhancement of the yield strength, and several classical models were employed to predict the theoretical values. The effect of CNT content on the friction coefficient and weight loss of the nanocomposites was also studied. The relationships between the amount of CNTs, the friction coefficient, and weight loss could be described by the exponential decay model and the Boltzmann model, respectively.
In vivo response of AZ31 alloy as biliary stents: a 6 months evaluation in rabbits
Liu, Yang; Zheng, Shengmin; Li, Nan; Guo, Huahu; Zheng, Yufeng; Peng, Jirun
2017-01-01
Mg-based metallic materials have been making continuing progress as vascular stents. However, the research of Mg-based materials as non-vascular stents is still at its primary stage. AZ31 stents hereby were implanted into the common bile duct of rabbits for 6 months. The results revealed an existence of 93.82 ± 1.36% and 30.89 ± 2.46% of the original volume after 1 and 3 month, respectively. Whole blood tests indicated an inflammation decreasing to normal level after 3 month implantation. A benign host response was observed via H&E staining. Nonuniform corrosion at the two ends of the stents was observed and considered the results of flow or local inflammation. Moreover, the application of Mg-based materials for different stenting treatment were reviewed and compared. Esophagus was hypothesized most destructive, whilst blood vessel and bile duct considered similar and less destructive. Trachea and nasal cavity were thought to be mildest.
LSP/MAO composite bio-coating on AZ80 magnesium alloy for biomedical application.
Xiong, Ying; Hu, Qiang; Song, Renguo; Hu, Xiaxia
2017-06-01
A composite bio-coating was fabricated on AZ80 magnesium (Mg) alloy by using micro-arc oxidation (MAO) under the pretreatment of laser shock peening (LSP) in order to improve the bio-corrosion resistance and the mechanical integrity. LSP treatment could induce grain refinement and compressive residual stress field on the surface of material. MAO bio-coating was grown in alkaline electrolyte with hydroxyapatite (HA, Ca10(PO4)6(OH)2) to improve the biological properties of the material. The microstructure, element and phase composition for untreated based material (BM) and treated samples (LSP layer, MAO bio-coating and LSP/MAO composite bio-coating) were investigated by transmission electron microscopy (TEM), scanning electron microscope (SEM), energy dispersion spectroscopy (EDS) and X-ray diffraction (XRD). Electrochemical tests and slow strain rate tensile (SSRT) tests were used to evaluate the corrosion resistance and the stress corrosion susceptibility in simulated body fluid (SBF). The results indicated that LSP/MAO composite bio-coating can not only improve the corrosion resistance of Mg alloy substrate evidently but also increase the mechanical properties in SBF compared to LSP layer and MAO bio-coating. Mg alloy treated by LSP/MAO composite technique should be better suited as biodegradable orthopedic implants. Copyright © 2017 Elsevier B.V. All rights reserved.
The cold-rolling behaviour of AZ31 tubes for fabrication of biodegradable stents.
Zhang, Yaowu; Kent, Damon; Wang, Gui; StJohn, David; Dargusch, Matthew S
2014-11-01
Mg alloys are receiving considerable attention for biomedical stents due to their combination of good mechanical properties and high biodegradability. Cold rolling is necessary to process Mg alloy tubes before final drawing and fabrication of the magnesium stents. In this paper, cold-rolled tubes were subjected to a cross-sectional reduction rate (ε) of up to 19.7%, and were further processed at various ratios of wall-thickness to diameter reduction (Q) from 0 to 2.24 with a constant ε of 19.7%. The results show that the cold-rolled tubes exhibited a rise in ultimate tensile strength (UTS), yield strength (YS), and a reduction in elongation as ε increased from 5.5% to 19.7%. UTS, YS and elongation decreased when Q was increased from 0 to 2.24. Mechanical twinning was observed and analysed. Extension twins increased with increasing ε and were almost saturated at a ε of 16.5%. Extension twins play an important role in determining the evolution of mechanical behaviour in the case of increasing ε, whilst contraction/double twins and secondary extension twins have a large effect on mechanical behaviour in the case of varying Q. The results indicate that the proportions and types of twins play a major role in determining the mechanical behaviour of the AZ31 tubes. Copyright © 2014 Elsevier Ltd. All rights reserved.
On numerical modeling of low-head direct chill ingot caster for magnesium alloy AZ31
Directory of Open Access Journals (Sweden)
Mainul Hasan
2014-12-01
Full Text Available A comprehensive 3D turbulent CFD study has been carried out to simulate a Low-Head (LH vertical Direct Chill (DC rolling ingot caster for the common magnesium alloy AZ31. The model used in this study takes into account the coupled laminar/turbulent melt flow and solidification aspects of the process and is based on the control-volume finite-difference approach. Following the aluminum/magnesium DC casting industrial practices, the LH mold is taken as 30 mm with a hot top of 60 mm. The previously verified in-house code has been modified to model the present casting process. Important quantitative results are obtained for four casting speeds, for three inlet melt pouring temperatures (superheats and for three metal-mold contact heat transfer coefficients for the steady state operational phase of the caster. The variable cooling water temperatures reported by the industry are considered for the primary and secondary cooling zones during the simulations. Specifically, the temperature and velocity fields, sump depth and sump profiles, mushy region thickness, solid shell thickness at the exit of the mold and axial temperature profiles at the center and at three strategic locations at the surface of the slab are presented and discussed.
Semi-continuous casting of magnesium alloy AZ91 using a filtered melt delivery system
Directory of Open Access Journals (Sweden)
Mainul Hasan
2015-12-01
Full Text Available A 3-D numerical simulation of an industrial-sized slab caster for magnesium alloy AZ91 has been carried out for the steady state operational phase of the caster. The simulated model consists of an open-top melt delivery system fitted with a porous filter near the hot-top. The melt flow through the porous filter was modeled on the basis of Brinkmann-Forchimier-Extended non-Darcy model for turbulent flow. An in-house 3-D CFD code was modified to account for the melt flow through the porous filter. Results are obtained for four casting speeds namely, 40, 60, 80, and 100 mm/min. The metal-mold contact region as well as the convective heat transfer coefficient at the mold wall were also varied. In addition to the above, the Darcy number for the porous media was also changed. All parametric studies were performed for a fixed inlet melt superheat of 64 °C. The results are presented pictorially in the form of temperature and velocity fields. The sump depth, mushy region thickness, solid shell thickness at the exit of the mold and axial temperature profiles are also presented and correlated with the casting speed through regression analysis.