WorldWideScience

Sample records for protruding main engines

  1. Turbine main engines

    CERN Document Server

    Main, John B; Herbert, C W; Bennett, A J S

    1965-01-01

    Turbine Main Engines deals with the principle of operation of turbine main engines. Topics covered include practical considerations that affect turbine design and efficiency; steam turbine rotors, blades, nozzles, and diaphragms; lubricating oil systems; and gas turbines for use with nuclear reactors. Gas turbines for naval boost propulsion, merchant ship propulsion, and naval main propulsion are also considered. This book is divided into three parts and begins with an overview of the basic mode of operation of the steam turbine engine and how it converts the pressure energy of the ingoing ste

  2. Engineering Design of KSTAR tokamak main structure

    International Nuclear Information System (INIS)

    Im, K.H.; Cho, S.; Her, N.I.

    2001-01-01

    The main components of the KSTAR (Korea Superconducting Tokamak Advanced Research) tokamak including vacuum vessel, plasma facing components, cryostat, thermal shield and magnet supporting structure are in the final stage of engineering design. Hundai Heavy Industries (HHI) has been involved in the engineering design of these components. The current configuration and the final engineering design results for the KSTAR main structure are presented. (author)

  3. Space transportation main engine reliability and safety

    Science.gov (United States)

    Monk, Jan C.

    1991-01-01

    Viewgraphs are used to illustrate the reliability engineering and aerospace safety of the Space Transportation Main Engine (STME). A technology developed is called Total Quality Management (TQM). The goal is to develop a robust design. Reducing process variability produces a product with improved reliability and safety. Some engine system design characteristics are identified which improves reliability.

  4. Space Shuttle Main Engine Public Test Firing

    Science.gov (United States)

    2000-01-01

    A new NASA Space Shuttle Main Engine (SSME) roars to the approval of more than 2,000 people who came to John C. Stennis Space Center in Hancock County, Miss., on July 25 for a flight-certification test of the SSME Block II configuration. The engine, a new and significantly upgraded shuttle engine, was delivered to NASA's Kennedy Space Center in Florida for use on future shuttle missions. Spectators were able to experience the 'shake, rattle and roar' of the engine, which ran for 520 seconds - the length of time it takes a shuttle to reach orbit.

  5. Space Shuttle main engine product improvement

    Science.gov (United States)

    Lucci, A. D.; Klatt, F. P.

    1985-01-01

    The current design of the Space Shuttle Main Engine has passed 11 certification cycles, amassed approximately a quarter million seconds of engine test time in 1200 tests and successfully launched the Space Shuttle 17 times of 51 engine launches through May 1985. Building on this extensive background, two development programs are underway at Rocketdyne to improve the flow of hot gas through the powerhead and evaluate the changes to increase the performance margins in the engine. These two programs, called Phase II+ and Technology Test Bed Precursor program are described. Phase II+ develops a two-tube hot-gas manifold that improves the component environment. The Precursor program will evaluate a larger throat main combustion chamber, conduct combustion stability testing of a baffleless main injector, fabricate an experimental weld-free heat exchanger tube, fabricate and test a high pressure oxidizer turbopump with an improved inlet, and develop and test methods for reducing temperature transients at start and shutdown.

  6. Space shuttle main engine vibration data base

    Science.gov (United States)

    Lewallen, Pat

    1986-01-01

    The Space Shuttle Main Engine Vibration Data Base is described. Included is a detailed description of the data base components, the data acquisition process, the more sophisticated software routines, and the future data acquisition methods. Several figures and plots are provided to illustrate the various output formats accessible to the user. The numerous vibration data recall and analysis capabilities available through automated data base techniques are revealed.

  7. Outer grid strap protruding spring repair apparatus

    International Nuclear Information System (INIS)

    Widener, W.H.

    1987-01-01

    This patent describes a nuclear fuel assembly grid spring repair apparatus for repairing a spring formed on an outer strap of a fuel assembly grid and having a portion protruding outwardly beyond the strap, the apparatus comprising: (a) a support frame defining an opening and having means defining a guide channel extending along the opening in a first direction; (b) means mounted on the frame and being adjustable for attaching the frame to the outer strap of the support grid so that the frame opening is aligned with the outwardly protruding spring on the outer strap; (c) an outer slide having a passageway defined therethrough and being mounted in the guide channel for reciprocable movement along the frame opening in the first direction for aligning the passageway with the outwardly protruding portion of the spring on the outer strap. The outer slide also has means defining a guide way extending along the passageway in a second direction generally orthogonal to the first direction; (d) a spring reset mechanism being operable for resetting the protruding spring to a nonprotruding position relative to the outer strap when the mechanism is aligned with the protruding portion of the spring; and (e) an inner slide supporting the spring reset mechanism and being mounted to the guide way for reciprocable movement along the passageway of the outer slide in the second direction for aligning the spring reset mechanism with the protruding portion of the spring on the outer strap

  8. Tidal flow separation at protruding beach nourishments

    NARCIS (Netherlands)

    Radermacher, M.; de Schipper, M.A.; Swinkels, Cilia M.; MacMahan, Jamie; Reniers, A.J.H.M.

    2016-01-01

    In recent years, the application of large-scale beach nourishments has been discussed, with the Sand Motor in the Netherlands as the first real-world example. Such protruding beach nourishments have an impact on tidal currents, potentially leading to tidal flow separation and the generation of tidal

  9. Main engineering features driving design concept and engineering design constraints

    International Nuclear Information System (INIS)

    Saito, Ryusei; Kobayashi, Takeshi; Yamada, Masao

    1987-09-01

    Major engineering design philosophies are described, which are essential bases for an engineering design and may have significant impacts on a reactor design concept. Those design philosophies are classified into two groups, engineering design drivers and engineering design constraints. The design drivers are featured by the fact that a designer is free to choose and the choice may be guided by his opinion, such as coil system, a mechanical configuration, a tritium breeding scenario, etc.. The design constraints may follow a natural law or engineering limit, such as material strength, coil current density, and so on. (author)

  10. Protruding and non-protruding colon carcinomas originating in gut-associated lymphoid tissue.

    Science.gov (United States)

    Rubio, Carlos A; Lindh, Claes; Björk, Jan; Törnblom, Hans; Befrits, Ragnar

    2010-07-01

    Colon carcinomas arising in gut-associated lymphoid tissue (GALTC) are termed dome carcinomas (DC) because of their protruding phenotype. Only 8 GALTC cases have been reported in the literature. A female patient, aged 53, having a familial pedigree of colon cancer, uterine cervix cancer and brain tumour developed a signet-ring carcinoma in the cecum and 10 years later endometrial cancer. While asymptomatic, a plaque-like protrusion in the colon was detected at surveillance colonoscopy. Histology demonstrated a protruding GALTC. The surgical specimen showed four additional carcinomas: 2 GALTC (non-protruding) and 2 carcinomas in lymphoid-free colonic mucosa (LFCMC). Since adenomas could not be demonstrated neither previously nor in the colectomy specimen, it is suggested that the GALTCs in this patient may have followed the GALT-carcinoma pathway.

  11. Schemes for applying active lubrication to main engine bearings

    DEFF Research Database (Denmark)

    Estupinan, Edgar Alberto; Santos, Ilmar

    2009-01-01

    -difference method. The computed bearing fluid film forces are coupled to the set of nonlinear equations that describes the dynamics of the reciprocating engine, obtained with the help of multibody dynamics (rigid components) and finite elements method (flexible components). The main equations that govern...

  12. Advanced Health Management System for the Space Shuttle Main Engine

    Science.gov (United States)

    Davidson, Matt; Stephens, John; Rodela, Chris

    2006-01-01

    Pratt & Whitney Rocketdyne, Inc., in cooperation with NASA-Marshall Space Flight Center (MSFC), has developed a new Advanced Health Management System (AHMS) controller for the Space Shuttle Main Engine (SSME) that will increase the probability of successfully placing the shuttle into the intended orbit and increase the safety of the Space Transportation System (STS) launches. The AHMS is an upgrade o the current Block II engine controller whose primary component is an improved vibration monitoring system called the Real-Time Vibration Monitoring System (RTVMS) that can effectively and reliably monitor the state of the high pressure turbomachinery and provide engine protection through a new synchronous vibration redline which enables engine shutdown if the vibration exceeds predetermined thresholds. The introduction of this system required improvements and modification to the Block II controller such as redesigning the Digital Computer Unit (DCU) memory and the Flight Accelerometer Safety Cut-Off System (FASCOS) circuitry, eliminating the existing memory retention batteries, installation of the Digital Signal Processor (DSP) technology, and installation of a High Speed Serial Interface (HSSI) with accompanying outside world connectors. Test stand hot-fire testing along with lab testing have verified successful implementation and is expected to reduce the probability of catastrophic engine failures during the shuttle ascent phase and improve safely by about 23% according to the Quantitative Risk Assessment System (QRAS), leading to a safer and more reliable SSME.

  13. Lubrication of Space Shuttle Main Engine Turbopump Bearings

    Science.gov (United States)

    Gibson, Howard; Munafo, Paul (Technical Monitor)

    2001-01-01

    The Space Shuttle has three main engines that are used for propulsion into orbit. These engines are fed propellants by four turbopumps on each engine. A main element in the turbopump is the bearings supporting the rotor that spins the turbine blades and the pump impeller. These bearings are required to spin at very high speeds, support radial and thrust loads, and have high wear resistance without the benefit of lubrication. The liquid hydrogen and oxygen propellants flow through the bearings to cool the surfaces. The volatile nature of the propellants excludes any conventional means of lubrication. Lubrication for these bearings is provided by the ball separator inside the bearing. The separator is a composite material that supplies a transfer film of lubrication to the rings and balls. New separator materials and lubrication schemes have been investigated at Marshall Space Flight Center in a bearing test rig with promising results. Hybrid bearings with silicon nitride balls have also been evaluated. The use of hybrid, silicon nitride ball bearings in conjunction -with better separator materials has shown excellent results. The work that Marshall has done is being utilized in turbopumps flying on the space shuttle fleet and will be utilized in future space travel. This result of this work is valuable for all aerospace and commercial applications where high-speed bearings are used.

  14. First-ever evening public engine test of a Space Shuttle Main Engine

    Science.gov (United States)

    2001-01-01

    Thousands of people watch the first-ever evening public engine test of a Space Shuttle Main Engine at NASA's John C. Stennis Space Center. The spectacular test marked Stennis Space Center's 20th anniversary celebration of the first Space Shuttle mission.

  15. Embedded expert system for space shuttle main engine maintenance

    Science.gov (United States)

    Pooley, J.; Thompson, W.; Homsley, T.; Teoh, W.; Jones, J.; Lewallen, P.

    1987-01-01

    The SPARTA Embedded Expert System (SEES) is an intelligent health monitoring system that directs analysis by placing confidence factors on possible engine status and then recommends a course of action to an engineer or engine controller. The technique can prevent catastropic failures or costly rocket engine down time because of false alarms. Further, the SEES has potential as an on-board flight monitor for reusable rocket engine systems. The SEES methodology synergistically integrates vibration analysis, pattern recognition and communications theory techniques with an artificial intelligence technique - the Embedded Expert System (EES).

  16. Coronary and peripheral stenting in aorto-ostial protruding stents: The balloon assisted access to protruding stent technique.

    Science.gov (United States)

    Helmy, Tarek A; Sanchez, Carlos E; Bailey, Steven R

    2016-03-01

    Treatment of aorto-ostial in-stent restenosis lesions represents a challenge for interventional cardiologists. Excessive protrusion of the stent into the aorta may lead to multiple technical problems, such as difficult catheter reengagement of the vessel ostium or inability to re-wire through the stent lumen in repeat interventions. We describe a balloon assisted access to protruding stent technique in cases where conventional coaxial engagement of an aorto-ostial protruding stent with the guide catheter or passage of the guide wire through the true lumen is not feasible. This technique is applicable both in coronary and peripheral arteries. © 2015 Wiley Periodicals, Inc.

  17. History and Benefits of Engine Level Testing Throughout the Space Shuttle Main Engine Program

    Science.gov (United States)

    VanHooser, Katherine; Kan, Kenneth; Maddux, Lewis; Runkle, Everett

    2010-01-01

    Rocket engine testing is important throughout a program s life and is essential to the overall success of the program. Space Shuttle Main Engine (SSME) testing can be divided into three phases: development, certification, and operational. Development tests are conducted on the basic design and are used to develop safe start and shutdown transients and to demonstrate mainstage operation. This phase helps form the foundation of the program, demands navigation of a very steep learning curve, and yields results that shape the final engine design. Certification testing involves multiple engine samples and more aggressive test profiles that explore the boundaries of the engine to vehicle interface requirements. The hardware being tested may have evolved slightly from that in the development phase. Operational testing is conducted with mature hardware and includes acceptance testing of flight assets, resolving anomalies that occur in flight, continuing to expand the performance envelope, and implementing design upgrades. This paper will examine these phases of testing and their importance to the SSME program. Examples of tests conducted in each phase will also be presented.

  18. Environmental optimisation of natural gas fired engines. Main report

    Energy Technology Data Exchange (ETDEWEB)

    Kvist, T. et al.

    2010-10-15

    The overall aim of the project has been to assess to which extent it is possible to reduce the emissions by adjusting the different engines examined and to determine the cost of the damage caused by emissions from natural gas combustion. However, only health and climate effects are included. The emissions of NO{sub x}, CO and UHC as well as the composition of the hydrocarbon emissions were measured for four different stationary lean-burn natural-gas fired engines installed at different combined heat and power (CHP) units in Denmark. The units were chosen to be representative of the natural gas fired engine-based power production in Denmark. The measurements showed that NO{sub x} emissions were relatively more sensitive to engine setting than UHC, CO and formaldehyde emissions. By reducing the NO{sub x} emissions to 40 % of the initial value (from 500 to 200 mg/m3(n) at 5 % O{sub 2}) the UHC emission was increased by 10 % to 50 % of the initial value. The electrical efficiency was reduced by 0.5 to 1.0 percentage point. Externalities in relation to power production are defined as the costs, which are not directly included in the price of the produced power. Health effects related to air pollution from power plants fall under this definition and usually dominate the results on external costs. For determination of these effects the exposure of the population, the impact of the exposure and the societal costs accompanying the impacts have been evaluated. As expected, it was found that when the engines are adjusted in order to reduce NO{sub x} emissions, the emission of UHC increases and vice versa. It was found that at high NO{sub x} emission levels (500 mg/m3{sub n} at 5 % O{sub 2}) the external costs related to the NO{sub x} emissions are 15 to 25 times the costs related to UHC emissions. At low NO{sub x} emission levels (200 mg/m3{sub n} at 5 % O{sub 2}) the costs related to NO{sub x} are 5 to 8 times the costs related to UHC emissions. Apparently, the harmfulness

  19. Analysis of Dynamic Inertia Forces at Main Bearing of Ship Reciprocating Engines

    Directory of Open Access Journals (Sweden)

    F. Louhenapessy Louhenapessy,

    2010-11-01

    Full Text Available During operation, a ship reciprocating engine will vibrate due to the force resulting from the cycle movement of the dynamic components. Soon or later, the vibration will cause wear of engine components. Therefore, the cause of vibration should be early identified so that the propagation of wear can be anticipated. The study modeled the ship reciprocating engine as a two stroke engine, and analyzed one of the causes of the engine vibration, i.e. the force acting on main bearing, using a numerical simulation. An experimental study was also carried out for measuring the acceleration of vibration response due to the numerical dynamic inertia force. The results showed that the dynamic inertia force acting on the main bearing is the main cause of the vibration of engine.

  20. Radial oil injection applied to main engine bearings: evaluation of injection control rules

    DEFF Research Database (Denmark)

    Estupiñan, EA; Santos, Ilmar

    2012-01-01

    , the dynamic behaviour of the main bearing of a medium-size engine is theoretically analysed when the engine operates with controllable radial oil injection and four different injection control rules. The theoretical investigation is based on a single-cylinder combustion engine model. The performance......The performance of main bearings in a combustion engine affects key functions such as durability, noise and vibration. Thus, with the aim of reducing friction losses and vibrations between the crankshaft and the bearings, the work reported here evaluates different strategies for applying...... controllable radial oil injection to main crankshaft journal bearings. In an actively lubricated bearing, conventional hydrodynamic lubrication is combined with controllable hydrostatic lubrication, where the oil injection pressures can be modified depending on the operational conditions. In this study...

  1. Public views evening engine test of a Space Shuttle Main Engine

    Science.gov (United States)

    2001-01-01

    Over the past year, more than 20,000 people came to Stennis Space Center to witness the 'shake, rattle and roar' of one of the world's most sophisticated engines. Stennis Space Center in south Mississippi is NASA's lead center for rocket propulsion testing. StenniSphere, the visitor center for Stennis Space Center, hosted more than 250,000 visitors in its first year of operation. Of those visitors, 26.4 percent were from Louisiana.

  2. Prediction of the Main Engine Power of a New Container Ship at the Preliminary Design Stage

    Science.gov (United States)

    Cepowski, Tomasz

    2017-06-01

    The paper presents mathematical relationships that allow us to forecast the estimated main engine power of new container ships, based on data concerning vessels built in 2005-2015. The presented approximations allow us to estimate the engine power based on the length between perpendiculars and the number of containers the ship will carry. The approximations were developed using simple linear regression and multivariate linear regression analysis. The presented relations have practical application for estimation of container ship engine power needed in preliminary parametric design of the ship. It follows from the above that the use of multiple linear regression to predict the main engine power of a container ship brings more accurate solutions than simple linear regression.

  3. A History of Welding on the Space Shuttle Main Engine (1975 to 2010)

    Science.gov (United States)

    Zimmerman, Frank R.; Russell, Carolyn K.

    2010-01-01

    The Space Shuttle Main Engine (SSME) is a high performance, throttleable, liquid hydrogen fueled rocket engine. High thrust and specific impulse (Isp) are achieved through a staged combustion engine cycle, combined with high combustion pressure (approx.3000psi) generated by the two-stage pump and combustion process. The SSME is continuously throttleable from 67% to 109% of design thrust level. The design criteria for this engine maximize performance and weight, resulting in a 7,800 pound rocket engine that produces over a half million pounds of thrust in vacuum with a specific impulse of 452/sec. It is the most reliable rocket engine in the world, accumulating over one million seconds of hot-fire time and achieving 100% flight success in the Space Shuttle program. A rocket engine with the unique combination of high reliability, performance, and reusability comes at the expense of manufacturing simplicity. Several innovative design features and fabrication techniques are unique to this engine. This is as true for welding as any other manufacturing process. For many of the weld joints it seemed mean cheating physics and metallurgy to meet the requirements. This paper will present a history of the welding used to produce the world s highest performance throttleable rocket engine.

  4. Main factors affecting the fixing work about nuclear engineering and its discussion

    International Nuclear Information System (INIS)

    Zhang Zhihua; Liu Yaoguan; Qian Dazhi; Liu Hangang; Xu Xianqi; Deng Yue

    2010-01-01

    Main factors to the impact of the fixing work about nuclear engineering such as project design, construction, plan program, document, preparation, order, locale management, surveillance, quality assurance system and so on were presented. These factors were analyzed and discussed in this paper. Some measures and suggestions were put forward to accelerate construction fixing plan and insure good quality. We wish provide some references and help for someone engaged with construction of nuclear engineering. (authors)

  5. Combustion Stability Characteristics of the Project Morpheus Liquid Oxygen / Liquid Methane Main Engine

    Science.gov (United States)

    Melcher, John C.; Morehead, Robert L.

    2014-01-01

    The project Morpheus liquid oxygen (LOX) / liquid methane (LCH4) main engine is a Johnson Space Center (JSC) designed 5,000 lbf-thrust, 4:1 throttling, pressure-fed cryogenic engine using an impinging element injector design. The engine met or exceeded all performance requirements without experiencing any in- ight failures, but the engine exhibited acoustic-coupled combustion instabilities during sea-level ground-based testing. First tangential (1T), rst radial (1R), 1T1R, and higher order modes were triggered by conditions during the Morpheus vehicle derived low chamber pressure startup sequence. The instability was never observed to initiate during mainstage, even at low power levels. Ground-interaction acoustics aggravated the instability in vehicle tests. Analysis of more than 200 hot re tests on the Morpheus vehicle and Stennis Space Center (SSC) test stand showed a relationship between ignition stability and injector/chamber pressure. The instability had the distinct characteristic of initiating at high relative injection pressure drop at low chamber pressure during the start sequence. Data analysis suggests that the two-phase density during engine start results in a high injection velocity, possibly triggering the instabilities predicted by the Hewitt stability curves. Engine ignition instability was successfully mitigated via a higher-chamber pressure start sequence (e.g., 50% power level vs 30%) and operational propellant start temperature limits that maintained \\cold LOX" and \\warm methane" at the engine inlet. The main engine successfully demonstrated 4:1 throttling without chugging during mainstage, but chug instabilities were observed during some engine shutdown sequences at low injector pressure drop, especially during vehicle landing.

  6. Overview of the main challenges for the engineering design of the test facilities system of IFMIF

    International Nuclear Information System (INIS)

    Molla, J.; Nakamura, K.

    2009-01-01

    High intense radiation fields were demanded to IFMIF to address the lack of information on effects in materials due to radiation fields with fusion reactor features. Such intense radiation fields will also produce a number of unwanted effects in exposed materials and components. The main difficulties to achieve a reliable engineering design of the Test Facilities System during the Engineering Validation and the Engineering Design phase of IFMIF now under development are reviewed in this paper. The most challenging activities will be the design of the high flux test module, the creep fatigue test module, the test cell and the remote handling system. The intense radiation fields in the irradiation area and the high availability required for IFMIF (70%) are the main reasons for these difficulties.

  7. Research pressure instrumentation for NASA Space Shuttle main engine, modification no. 6

    Science.gov (United States)

    Anderson, P. J.; Johnson, R. L.

    1984-01-01

    Research concerning the utilization of silicon piezoresistive strain sensing technology for space shuttle main engine applications is reported. The following specific topics were addressed: (1) transducer design and materials, (2) silicon piezoresistor characterization at cryogenic temperatures, (3) chip mounting characterization, and (4) frequency response optimization.

  8. Research pressure instrumentation for NASA Space Shuttle main engine, modification no. 5

    Science.gov (United States)

    Anderson, P. J.; Nussbaum, P.; Gustafson, G.

    1984-01-01

    Research concerning the development of pressure instrumentation for the space shuttle main engine is reported. The following specific topics were addressed: (1) transducer design and materials, (2) silicon piezoresistor characterization at cryogenic temperatures, (3) chip mounting characterization, and (4) frequency response optimization.

  9. Incipient failure detection of space shuttle main engine turbopump bearings using vibration envelope detection

    Science.gov (United States)

    Hopson, Charles B.

    1987-01-01

    The results of an analysis performed on seven successive Space Shuttle Main Engine (SSME) static test firings, utilizing envelope detection of external accelerometer data are discussed. The results clearly show the great potential for using envelope detection techniques in SSME incipient failure detection.

  10. Rocket Science: The Shuttle's Main Engines, though Old, Are not Forgotten in the New Exploration Initiative

    Science.gov (United States)

    Covault, Craig

    2005-01-01

    The Space Shuttle Main Engine (SSME), developed 30 years ago, remains a strong candidate for use in the new Exploration Initiative as part of a shuttle-derived heavy-lift expendable booster. This is because the Boeing-Rocket- dyne man-rated SSME remains the most highly efficient liquid rocket engine ever developed. There are only enough parts for 12-15 existing SSMEs, however, so one NASA option is to reinitiate SSME production to use it as a throw-away, as opposed to a reusable, powerplant for NASA s new heavy-lift booster.

  11. Thin film heat flux sensor for Space Shuttle Main Engine turbine environment

    Science.gov (United States)

    Will, Herbert

    1991-01-01

    The Space Shuttle Main Engine (SSME) turbine environment stresses engine components to their design limits and beyond. The extremely high temperatures and rapid temperature cycling can easily cause parts to fail if they are not properly designed. Thin film heat flux sensors can provide heat loading information with almost no disturbance of gas flows or of the blade. These sensors can provide steady state and transient heat flux information. A thin film heat flux sensor is described which makes it easier to measure small temperature differences across very thin insulating layers.

  12. Design considerations for a Space Shuttle Main Engine turbine blade made of single crystal material

    Science.gov (United States)

    Abdul-Aziz, A.; August, R.; Nagpal, V.

    1993-01-01

    Nonlinear finite-element structural analyses were performed on the first stage high-pressure fuel turbopump blade of the Space Shuttle Main Engine. The analyses examined the structural response and the dynamic characteristics at typical operating conditions. Single crystal material PWA-1480 was considered for the analyses. Structural response and the blade natural frequencies with respect to the crystal orientation were investigated. The analyses were conducted based on typical test stand engine cycle. Influence of combined thermal, aerodynamic, and centrifugal loadings was considered. Results obtained showed that the single crystal secondary orientation effects on the maximum principal stresses are not highly significant.

  13. Controllable Lubrication for Main Engine Bearings Using Mechanical and Piezoelectric Actuators

    DEFF Research Database (Denmark)

    Estupinan, Edgar; Santos, Ilmar

    2012-01-01

    Although mechatronic systems are nowadays implemented in a large number of systems in vehicles, active lubrication systems are still incipient in industrial applications. This study is an attempt to extend the active lubrication concept to combustion engines and gives a theoretical contribution...... equations. The global system is numerically solved using as a case study a single-cylinder combustion engine, where the conventional lubrication of the main bearing is modified by applying radial oil injection using piezo-actuated injection. The performance of such a hybrid bearing is compared...

  14. Use of an expert system data analysis manager for space shuttle main engine test evaluation

    Science.gov (United States)

    Abernethy, Ken

    1988-01-01

    The ability to articulate, collect, and automate the application of the expertise needed for the analysis of space shuttle main engine (SSME) test data would be of great benefit to NASA liquid rocket engine experts. This paper describes a project whose goal is to build a rule-based expert system which incorporates such expertise. Experiential expertise, collected directly from the experts currently involved in SSME data analysis, is used to build a rule base to identify engine anomalies similar to those analyzed previously. Additionally, an alternate method of expertise capture is being explored. This method would generate rules inductively based on calculations made using a theoretical model of the SSME's operation. The latter rules would be capable of diagnosing anomalies which may not have appeared before, but whose effects can be predicted by the theoretical model.

  15. Simulation research on operation scheme of dissymmetrical main engine of CODOG propulsion system

    Directory of Open Access Journals (Sweden)

    HUANG Bin

    2018-02-01

    Full Text Available [Objectives] How to maintain propulsion capability in a CODOG propulsion system damage situation has important significance. [Methods] A ‘Hull-Engine-CPP-Rudder’ simulation model of a CODOG marine power plant is established on Simulink using the modularized method, and a dissymmetrical main engine urgent working mode is proposed and simulated. [Results] The results show that in the dissymmetrical working mode, two different engines cannot work simultaneously at designed capacity. However, by adjusting the pitch of the CPP, one engine can work at designed capacity and the other can work at partial load capacity; under this working mode, if high speed is demanded, the gas turbine should work at designed capacity. The CPP pitch driven by diesel should be maintained at a high value near the maximum. The maximum speed of this working mode is 84.4% of the designed speed, which is higher than the speed of the single shaft working mode driven by a gas turbine. [Conclusions] The research results of this paper can provide useful references for the design of ship propulsion systems.

  16. Booster Main Engine Selection Criteria for the Liquid Fly-Back Booster

    Science.gov (United States)

    Ryan, Richard M.; Rothschild, William J.; Christensen, David L.

    1998-01-01

    The Liquid Fly-Back Booster (LFBB) Program seeks to enhance the Space Shuttle system safety performance and economy of operations through the use of an advanced, liquid propellant Booster Main Engine (BME). There are several viable BME candidates that could be suitable for this application. The objective of this study was to identify the key criteria to be applied in selecting among these BME candidates. This study involved an assessment of influences on the overall LFBB utility due to variations in the candidate rocket engines' characteristics. This includes BME impacts on vehicle system weight, perfortnance,design approaches, abort modes, margins of safety, engine-out operations, and maintenance and support concepts. Systems engineering analyses and trade studies were performed to identify the LFBB system level sensitivities to a wide variety of BME related parameters. This presentation summarizes these trade studies and the resulting findings of the LFBB design teams regarding the BME characteristics that most significantly affect the LFBB system. The resulting BME choice should offer the best combination of reliability, performance, reusability, robustness, cost, and risk for the LFBB program.

  17. Advanced Vacuum Plasma Spray (VPS) for a Robust, Longlife and Safe Space Shuttle Main Engine (SSME)

    Science.gov (United States)

    Holmes, Richard R.; Elam, Sandra K.; McKechnie, Timothy N.; Power, Christopher A.

    2010-01-01

    In 1984, the Vacuum Plasma Spray Lab was built at NASA/Marshall Space Flight Center for applying durable, protective coatings to turbine blades for the space shuttle main engine (SSME) high pressure fuel turbopump. Existing turbine blades were cracking and breaking off after five hot fire tests while VPS coated turbine blades showed no wear or cracking after 40 hot fire tests. Following that, a major manufacturing problem of copper coatings peeling off the SSME Titanium Main Fuel Valve Housing was corrected with a tenacious VPS copper coating. A patented VPS process utilizing Functional Gradient Material (FGM) application was developed to build ceramic lined metallic cartridges for space furnace experiments, safely containing gallium arsenide at 1260 degrees centigrade. The VPS/FGM process was then translated to build robust, long life, liquid rocket combustion chambers for the space shuttle main engine. A 5K (5,000 Lb. thrust) thruster with the VPS/FGM protective coating experienced 220 hot firing tests in pristine condition with no wear compared to the SSME which showed blanching (surface pulverization) and cooling channel cracks in less than 30 of the same hot firing tests. After 35 of the hot firing tests, the injector face plates disintegrated. The VPS/FGM process was then applied to spraying protective thermal barrier coatings on the face plates which showed 50% cooler operating temperature, with no wear after 50 hot fire tests. Cooling channels were closed out in two weeks, compared to one year for the SSME. Working up the TRL (Technology Readiness Level) to establish the VPS/FGM process as viable technology, a 40K thruster was built and is currently being tested. Proposed is to build a J-2X size liquid rocket engine as the final step in establishing the VPS/FGM process TRL for space flight.

  18. Phased Array Ultrasonic Evaluation of Space Shuttle Main Engine (SSME) Nozzle Weld

    Science.gov (United States)

    James, Steve; Engel, J.; Kimbrough, D.; Suits, M.; Hopson, George (Technical Monitor)

    2001-01-01

    This viewgraph presentation gives an overview of the phased array ultrasonic evaluation of the Space Shuttle Main Engine (SSME) nozzle weld. Details are given on the nondestructive testing evaluation approach, conventional shear wave and phased array techniques, and an x-ray versus phased array risk analysis. The field set-up was duplicated to the greatest extent possible in the laboratory and the phased array ultrasonic technique was developed and validated prior to weld evaluation. Results are shown for the phased array ultrasonic evaluation and conventional ultrasonic evaluation results.

  19. Characterizing Observed Limit Cycles in the Cassini Main Engine Guidance Control System

    Science.gov (United States)

    Rizvi, Farheen; Weitl, Raquel M.

    2011-01-01

    The Cassini spacecraft dynamics-related telemetry during long Main Engine (ME) burns has indicated the presence of stable limit cycles between 0.03-0.04 Hz frequencies. These stable limit cycles cause the spacecraft to possess non-zero oscillating rates for extended periods of time. This indicates that the linear ME guidance control system does not model the complete dynamics of the spacecraft. In this study, we propose that the observed limit cycles in the spacecraft dynamics telemetry appear from a stable interaction between the unmodeled nonlinear elements in the ME guidance control system. Many nonlinearities in the control system emerge from translating the linear engine gimbal actuator (EGA) motion into a spacecraft rotation. One such nonlinearity comes from the gear backlash in the EGA system, which is the focus of this paper. The limit cycle characteristics and behavior can be predicted by modeling this gear backlash nonlinear element via a describing function and studying the interaction of this describing function with the overall dynamics of the spacecraft. The linear ME guidance controller and gear backlash nonlinearity are modeled analytically. The frequency, magnitude, and nature of the limit cycle are obtained from the frequency response of the ME guidance controller and nonlinear element. In addition, the ME guidance controller along with the nonlinearity is simulated. The simulation response contains a limit cycle with similar characterstics as predicted analytically: 0.03-0.04 Hz frequency and stable, sustained oscillations. The analytical and simulated limit cycle responses are compared to the flight telemetry for long burns such as the Saturn Orbit Insertion and Main Engine Orbit Trim Maneuvers. The analytical and simulated limit cycle characteristics compare well with the actual observed limit cycles in the flight telemetry. Both have frequencies between 0.03-0.04 Hz and stable oscillations. This work shows that the stable limit cycles occur

  20. Analysis of Catalitic Reactors Usefulness to Reduce Pollution Generated by Piston Combustion Engines with Regard to Ship Main Engines

    Directory of Open Access Journals (Sweden)

    Zielińska Edyta

    2017-03-01

    Full Text Available The article presents results which indicate that the use of catalytic reactors to reduce emissions of harmful compunds contained in the exhaust gas is important in the operation of vehicle motors operation. Efforts of the shipbuilding industry to reduce the toxicity of exhaust gas emitted by the main engines have been indicated and pointed to the desirability of the use of these catalysts in maritime transport. It has been pointed out that studies of the harmful substances in exhaust gases performer at vehicle inspection stations have an impact on increasing the safety of drivers and other road users and contribute to preserving the natural environment by reducing the danger coming from cars operating on Polish roads. An opinion has been expressed that the most serious threats to the environment are emitted by car transport exhaust fumes, which are characterized by significant emission of toxic compounds excreted into the atmosphere from tailpipe emissions.

  1. Popham Beach, Maine: An example of engineering activity that saved beach property without harming the beach

    Science.gov (United States)

    Kelley, Joseph T.

    2013-10-01

    Beach and property erosion on coasts is a widespread and chronic problem. Historical approaches to this issue, including seawalls and sand replenishment, are often inappropriate or too expensive. In Maine, seawalls were banned in 1983 and replenishment is too costly to employ. Replacement of storm-damaged buildings is also not allowed, and a precedent case on Popham Beach, Maine required that the owner remove an unpermitted building from a site where an earlier structure was damaged. When the most popular park in Maine, Popham Beach State Park, experienced inlet associated erosion that threatened park infrastructure (a bathhouse), temporary measures were all that the law allowed. Because it was clear that the inlet channel causing the erosion would eventually change course, the state opted to erect a temporary seawall with fallen trees at the site. This may or may not have slowed the erosion temporarily, but reassured the public that "something was being done". Once a storm cut a new tidal inlet channel and closed off the old one, tidal water still entered the former channel and continued to threaten the bathhouse. To ultimately save the property, beach scraping was employed. Sand was scraped from the lower beach to construct a sand berm that deflected the tidal current away from the endangered property. This action created enough time for natural processes to drive the remains of the former spit onto the beach and widen it significantly. Whereas many examples of engineering practices exist that endanger instead of saving beaches, this example is one of an appropriate engineering effort to rescue unwisely located beach-front property.

  2. A History of Space Shuttle Main Engine (SSME) Redline Limits Management

    Science.gov (United States)

    Arnold, Thomas M.

    2011-01-01

    The Space Shuttle Main Engine (SSME) has several "redlines", which are operational limits designated to preclude a catastrophic shutdown of the SSME. The Space Shuttle Orbiter utilizes a combination of hardware and software to enable or disable the automated redline shutdown capability. The Space Shuttle is launched with the automated SSME redline limits enabled, but there are many scenarios which may result in the manual disabling of the software by the onboard crew. The operational philosophy for manually enabling and disabling the redline limits software has evolved continuously throughout the history of the Space Shuttle Program, due to events such as SSME hardware changes and updates to Space Shuttle contingency abort software. In this paper, the evolution of SSME redline limits management will be fully reviewed, including the operational scenarios which call for manual intervention, and the events that triggered changes to the philosophy. Following this review, improvements to the management of redline limits for future spacecraft will be proposed.

  3. A model for the Space Shuttle Main Engine High Pressure Oxidizer Turbopump shaft seal system

    Science.gov (United States)

    Paxson, Daniel E.

    1990-01-01

    A model of the High Pressure Oxidizer Turbopump (HPOTP) shaft seal system on the Space Shuttle Main Engine (SSME) is described. The model predicts the fluid properties and flow rates throughout this system for a number of conditions simulating failed seals. The results agree well with qualitative expectations and redline values but cannot be verified with actual data due to the lack thereof. The results indicate that each failure mode results in a unique distribution of properties throughout the seal system and can therefore be individually identified given the proper instrumentation. Furthermore, the detection process can be built on the principle of qualitative reasoning without the use of exact fluid property values. A simplified implementation of the model which does not include the slinger/labyrinth seal combination has been developed and will be useful for inclusion in a real-time diagnostic system.

  4. Space Shuttle main engine OPAD: The search for a hardware enhanced plume

    Science.gov (United States)

    Powers, W. T.; Cooper, A. E.; Wallace, Tim L.; Buntine, W. L.; Whitaker, K. W.

    1993-01-01

    The process of applying spectroscopy to the Space Shuttle Main Engine (SSME) for plume diagnostics, as it exists today, originated at Marshall Space Flight Center in Huntsville, Alabama, and its implementation was assured largely through the efforts of Sverdrup AEDC, in Tullahoma, Tennessee. This team continues to lead and guide efforts in the plume diagnostics arena. The process, Optical Plume Anomaly Detection (OPAD), formed the basis for various activities in the development of ground-based systems as well as the development of in-flight plume spectroscopy. OPAD currently provides and will continue to provide valuable information relative to future systems definitions, instrumentation development, code validation, and data diagnostic processing. OPAD is based on the detection of anomalous atomic and molecular species in the SSME plume using two complete, stand-alone optical spectrometers. To-date OPAD has acquired data on 44 test firings of the SSME at the Technology Test Bed (TTB) at MSFC. The purpose of this paper will be to provide an introduction to the OPAD system by discussing the process of obtaining data as well as the methods of examining and interpreting the data. It will encompass such issues as selection of instrumentation correlation of data to nominal engine operation, investigation of SSME component erosion via OPAD spectral data, necessity and benefits of plume seeding, application of artificial intelligence (AI) techniques to data analysis, and the present status of efforts to quantify specie erosion utilizing standard plume and chemistry codes as well as radiative models currently under development.

  5. Space Shuttle main engine OPAD: The search for a hardware enhanced plume

    Science.gov (United States)

    Powers, W. T.; Cooper, A. E.; Wallace, Tim L.; Buntine, W. L.; Whitaker, K. W.

    1993-11-01

    The process of applying spectroscopy to the Space Shuttle Main Engine (SSME) for plume diagnostics, as it exists today, originated at Marshall Space Flight Center in Huntsville, Alabama, and its implementation was assured largely through the efforts of Sverdrup AEDC, in Tullahoma, Tennessee. This team continues to lead and guide efforts in the plume diagnostics arena. The process, Optical Plume Anomaly Detection (OPAD), formed the basis for various activities in the development of ground-based systems as well as the development of in-flight plume spectroscopy. OPAD currently provides and will continue to provide valuable information relative to future systems definitions, instrumentation development, code validation, and data diagnostic processing. OPAD is based on the detection of anomalous atomic and molecular species in the SSME plume using two complete, stand-alone optical spectrometers. To-date OPAD has acquired data on 44 test firings of the SSME at the Technology Test Bed (TTB) at MSFC. The purpose of this paper will be to provide an introduction to the OPAD system by discussing the process of obtaining data as well as the methods of examining and interpreting the data. It will encompass such issues as selection of instrumentation correlation of data to nominal engine operation, investigation of SSME component erosion via OPAD spectral data, necessity and benefits of plume seeding, application of artificial intelligence (AI) techniques to data analysis, and the present status of efforts to quantify specie erosion utilizing standard plume and chemistry codes as well as radiative models currently under development.

  6. A neural network-based estimator for the mixture ratio of the Space Shuttle Main Engine

    Science.gov (United States)

    Guo, T. H.; Musgrave, J.

    1992-11-01

    In order to properly utilize the available fuel and oxidizer of a liquid propellant rocket engine, the mixture ratio is closed loop controlled during main stage (65 percent - 109 percent power) operation. However, because of the lack of flight-capable instrumentation for measuring mixture ratio, the value of mixture ratio in the control loop is estimated using available sensor measurements such as the combustion chamber pressure and the volumetric flow, and the temperature and pressure at the exit duct on the low pressure fuel pump. This estimation scheme has two limitations. First, the estimation formula is based on an empirical curve fitting which is accurate only within a narrow operating range. Second, the mixture ratio estimate relies on a few sensor measurements and loss of any of these measurements will make the estimate invalid. In this paper, we propose a neural network-based estimator for the mixture ratio of the Space Shuttle Main Engine. The estimator is an extension of a previously developed neural network based sensor failure detection and recovery algorithm (sensor validation). This neural network uses an auto associative structure which utilizes the redundant information of dissimilar sensors to detect inconsistent measurements. Two approaches have been identified for synthesizing mixture ratio from measurement data using a neural network. The first approach uses an auto associative neural network for sensor validation which is modified to include the mixture ratio as an additional output. The second uses a new network for the mixture ratio estimation in addition to the sensor validation network. Although mixture ratio is not directly measured in flight, it is generally available in simulation and in test bed firing data from facility measurements of fuel and oxidizer volumetric flows. The pros and cons of these two approaches will be discussed in terms of robustness to sensor failures and accuracy of the estimate during typical transients using

  7. The Effect of Acoustic Disturbances on the Operation of the Space Shuttle Main Engine Fuel Flowmeter

    Science.gov (United States)

    Marcu, Bogdan; Szabo, Roland; Dorney, Dan; Zoladz, Tom

    2007-01-01

    The Space Shuttle Main Engine (SSME) uses a turbine fuel flowmeter (FFM) in its Low Pressure Fuel Duct (LPFD) to measure liquid hydrogen flowrates during engine operation. The flowmeter is required to provide accurate and robust measurements of flow rates ranging from 10000 to 18000 GPM in an environment contaminated by duct vibration and duct internal acoustic disturbances. Errors exceeding 0.5% can have a significant impact on engine operation and mission completion. The accuracy of each sensor is monitored during hot-fire engine tests on the ground. Flow meters which do not meet requirements are not flown. Among other parameters, the device is screened for a specific behavior in which a small shift in the flow rate reading is registered during a period in which the actual fuel flow as measured by a facility meter does not change. Such behavior has been observed over the years for specific builds of the FFM and must be avoided or limited in magnitude in flight. Various analyses of the recorded data have been made prior to this report in an effort to understand the cause of the phenomenon; however, no conclusive cause for the shift in the instrument behavior has been found. The present report proposes an explanation of the phenomenon based on interactions between acoustic pressure disturbances in the duct and the wakes produced by the FFM flow straightener. Physical insight into the effects of acoustic plane wave disturbances was obtained using a simple analytical model. Based on that model, a series of three-dimensional unsteady viscous flow computational fluid dynamics (CFD) simulations were performed using the MSFC PHANTOM turbomachinery code. The code was customized to allow the FFM rotor speed to change at every time step according to the instantaneous fluid forces on the rotor, that, in turn, are affected by acoustic plane pressure waves propagating through the device. The results of the simulations show the variation in the rotation rate of the flowmeter

  8. MAIN-BELT ASTEROIDS IN THE K2 ENGINEERING FIELD OF VIEW

    International Nuclear Information System (INIS)

    Szabó, R.; Sárneczky, K.; Szabó, Gy. M.; Pál, A.; Kiss, Cs. P.; Kiss, L. L.; Csák, B.; Illés, L.; Rácz, G.

    2015-01-01

    Unlike NASA’s original Kepler Discovery Mission, the renewed K2 Mission will target the plane of the Ecliptic, observing each field for approximately 75 days. This will bring new opportunities and challenges, in particular the presence of a large number of main-belt asteroids that will contaminate the photometry. The large pixel size makes K2 data susceptible to the effects of apparent minor planet encounters. Here, we investigate the effects of asteroid encounters on photometric precision using a subsample of the K2 engineering data taken in 2014 February. We show examples of asteroid contamination to facilitate their recognition and distinguish these events from other error sources. We conclude that main-belt asteroids will have considerable effects on K2 photometry of a large number of photometric targets during the Mission that will have to be taken into account. These results will be readily applicable for future space photometric missions applying large-format CCDs, such as TESS and PLATO

  9. MAIN-BELT ASTEROIDS IN THE K2 ENGINEERING FIELD OF VIEW

    Energy Technology Data Exchange (ETDEWEB)

    Szabó, R.; Sárneczky, K.; Szabó, Gy. M.; Pál, A.; Kiss, Cs. P.; Kiss, L. L. [Konkoly Observatory, Research Centre for Astronomy and Earth Sciences, Hungarian Academy of Sciences, H-1121 Budapest, Konkoly Thege Miklós út 15-17 (Hungary); Csák, B. [Gothard-Lendület Research Team, H-9704 Szombathely, Szent Imre herceg út 112 (Hungary); Illés, L.; Rácz, G., E-mail: rszabo@konkoly.hu [Eötvös Loránd Tudományegyetem, H-1117 Pázmány Péter sétány 1/A, Budapest (Hungary)

    2015-03-15

    Unlike NASA’s original Kepler Discovery Mission, the renewed K2 Mission will target the plane of the Ecliptic, observing each field for approximately 75 days. This will bring new opportunities and challenges, in particular the presence of a large number of main-belt asteroids that will contaminate the photometry. The large pixel size makes K2 data susceptible to the effects of apparent minor planet encounters. Here, we investigate the effects of asteroid encounters on photometric precision using a subsample of the K2 engineering data taken in 2014 February. We show examples of asteroid contamination to facilitate their recognition and distinguish these events from other error sources. We conclude that main-belt asteroids will have considerable effects on K2 photometry of a large number of photometric targets during the Mission that will have to be taken into account. These results will be readily applicable for future space photometric missions applying large-format CCDs, such as TESS and PLATO.

  10. Use of probabilistic design methods for NASA applications. [to be used in design phase of Space Transportation Main Engine

    Science.gov (United States)

    Safie, Fayssal M.

    1992-01-01

    This paper presents a reliability evaluation process designed to improve the reliability of advanced launch systems. The work performed includes the development of a reliability prediction methodology to be used in the design phase of the Space Transportation Main Engine (STME). This includes prediction techniques which use historical data bases as well as deterministic and probabilistic engineering models for predicting design reliability. In summary, this paper describes a probabilistic design approach for the next-generation liquid rocket engine, the STME.

  11. A Monte Carlo study of Weibull reliability analysis for space shuttle main engine components

    Science.gov (United States)

    Abernethy, K.

    1986-01-01

    The incorporation of a number of additional capabilities into an existing Weibull analysis computer program and the results of Monte Carlo computer simulation study to evaluate the usefulness of the Weibull methods using samples with a very small number of failures and extensive censoring are discussed. Since the censoring mechanism inherent in the Space Shuttle Main Engine (SSME) data is hard to analyze, it was decided to use a random censoring model, generating censoring times from a uniform probability distribution. Some of the statistical techniques and computer programs that are used in the SSME Weibull analysis are described. The methods documented in were supplemented by adding computer calculations of approximate (using iteractive methods) confidence intervals for several parameters of interest. These calculations are based on a likelihood ratio statistic which is asymptotically a chisquared statistic with one degree of freedom. The assumptions built into the computer simulations are described. The simulation program and the techniques used in it are described there also. Simulation results are tabulated for various combinations of Weibull shape parameters and the numbers of failures in the samples.

  12. AUTOMATIC CONTROL SYSTEM FOR REGULATED HIGH TEMPERATURE MAIN COMBUSTION CHAMBER OF MANEUVERABLE AIRCRAFT MULTIMODE GAS TURBINE ENGINE

    Directory of Open Access Journals (Sweden)

    T. V. Gras’Ko

    2014-01-01

    Full Text Available The paper describes choosing and substantiating the control laws, forming the appearance the automatic control system for regulated high temperature main combustion chamber of maneuverable aircraft multimode gas turbine engine aimed at sustainable and effective functioning of main combustion chamber within a broad operation range.

  13. STS-112 final main engine is installed after welding/polishing process

    Science.gov (United States)

    2002-01-01

    KENNEDY SPACE CENTER, FLA. -- The last engine is installed in orbiter Atlantis after a welding and polishing process was undertaken on flow liners where cracks were detected. All engines were removed for inspection of flow liners. Atlantis will next fly on mission STS-112, scheduled for launch no earlier than Oct. 2.

  14. Atomic structure of the murine norovirus protruding domain and sCD300lf receptor complex.

    Science.gov (United States)

    Kilic, Turgay; Koromyslova, Anna; Malak, Virginie; Hansman, Grant S

    2018-03-21

    Human noroviruses are the leading cause of acute gastroenteritis in human. Noroviruses also infect animals such as cow, mice, cat, and dog. How noroviruses bind and enter host cells is still incompletely understood. Recently, the type I transmembrane protein CD300lf was recently identified as the murine norovirus receptor, yet it is unclear how the virus capsid and receptor interact at the molecular level. In this study, we determined the X-ray crystal structure of the soluble CD300lf (sCD300lf) and murine norovirus capsid-protruding domain complex at 2.05 Å resolution. We found that the sCD300lf binding site is located on the topside of the protruding domain and involves a network of hydrophilic and hydrophobic interactions. The sCD300lf locked nicely into a complementary cavity on the protruding domain that is additionally coordinated with a positive surface charge on the sCD300lf and a negative surface charge on the protruding domain. Five of six protruding domain residues interacting with sCD300lf were maintained between different murine norovirus strains, suggesting that the sCD300lf was capable of binding to a highly conserved pocket. Moreover, a sequence alignment with other CD300 paralogs showed that the sCD300lf interacting residues were partially conserved in CD300ld, but variable in other CD300 family members, consistent with previously reported infection selectivity. Overall, these data provide insights into how a norovirus engages a protein receptor and will be important for a better understanding of selective recognition and norovirus attachment and entry mechanisms. IMPORTANCE Noroviruses exhibit exquisite host-range specificity due to species-specific interactions between the norovirus capsid protein and host molecules. Given this strict host-range restriction it has been unclear how the viruses are maintained within a species between relatively sporadic epidemics. While much data demonstrates that noroviruses can interact with carbohydrates

  15. Progress report on R + D activities carried out in 1980 by the Hauptabteilung Ingenieurtechnik (Main Engineering Department)

    International Nuclear Information System (INIS)

    1981-02-01

    In 1980, the IT-research work covered almost the whole field of nuclear engineering. The main part of investigation was done for the following projects: Fast Breeder (PBS) , Nuclear Safety (PNS) as well as Reprocessing and Waste Treatment (PWA) . The topics treated by these four groups are specified. (GL) [de

  16. Turbulent heat transfer and nanofluid flow in a protruded ribbed square passage

    Science.gov (United States)

    Kumar, Sunil; Kothiyal, Alok Darshan; Bisht, Mangal Singh; Kumar, Anil

    In this article, turbulent heat transfer of nanofluid flow in square passage with protruded rib shape is numerically and experimentally studied over Reynolds number ranges of 4000-18000. Different nanoparticles (Al2O3, CuO, and ZnO), with different concentration (φ) range of 1-4% and different nanoparticle diameter (dnp) range of 30-45 nm are disperse in water (base fluid). Several parameters such as stream wise distance (Xs /dp) range of 1.4-2.6, span wise distance (Ys /dp) range of 1.4-2.6, ratio of protruded height to print diameter (ep /dp) range of 0.83-1.67 also studied to find the consequence on thermal and hydrodynamic characteristics. Simulations were carried out to obtain heat and fluid flow behaviour of smooth and ribbed square channel using commercial CFD software, ANSYS 15.0 (Fluent). Renormalization k - ε model was employed to assess the influence of protruded ribs on turbulent flow and velocity field. The outcome indicates that Al2O3 nanofluid has the highest value of average Nusselt number as compare to other nanofluids. The average Nusselt number increases as the concentration increases and it decreases as nanoparticle diameter increases. The thermal hydrodynamic performance parameter based on equal pumping power, average Nusselt number and average friction factor were found to be highest for Al2O3, φ = 0.04, dnp = 30 nm, Xs /dp = 1.8, Ys /dp = 1.8 and ep /dp = 1.0 . The numerical data are compared with the corresponding experimental data. Comparison between CFD and experimental analysis results showed that good agreement as the data fell within ±7.0% error band.

  17. A Methodology for Multidisciplinary Decision Making for a Surface Combatant Main Engine Selection Problem

    Science.gov (United States)

    2014-06-01

    of high speed cargo ships,” Royal Inst. of Naval Architects, London, UK, 2006. [7] Basic Principles of Ship Propulsion, MAN Diesel and Turbo ...32 2. Diesel Engines...LIST OF ACRONYMS AND ABBREVIATIONS CODAD combined diesel and diesel CODAG combined diesel and gas CODOG combined diesel or gas COGAG combined gas and

  18. Protruding ears. evaluation of outcomes and patient satisfaction. The portuguese reality in a retrospective analysis of 209 otoplasties

    Directory of Open Access Journals (Sweden)

    Ana Correia-Oliveira

    2017-12-01

    Discussion and conclusion: Corrective otoplasty of protruding ears had a direct positive impact in quality of life and self-esteem in patients; this underlies the relevance of referring these children to a specialized surgical center.

  19. Space shuttle with common fuel tank for liquid rocket booster and main engines (supertanker space shuttle)

    Science.gov (United States)

    Thorpe, Douglas G.

    1991-01-01

    An operation and schedule enhancement is shown that replaces the four-body cluster (Space Shuttle Orbiter (SSO), external tank, and two solid rocket boosters) with a simpler two-body cluster (SSO and liquid rocket booster/external tank). At staging velocity, the booster unit (liquid-fueled booster engines and vehicle support structure) is jettisoned while the remaining SSO and supertank continues on to orbit. The simpler two-bodied cluster reduces the processing and stack time until SSO mate from 57 days (for the solid rocket booster) to 20 days (for the liquid rocket booster). The areas in which liquid booster systems are superior to solid rocket boosters are discussed. Alternative and future generation vehicles are reviewed to reveal greater performance and operations enhancements with more modifications to the current methods of propulsion design philosophy, e.g., combined cycle engines, and concentric propellant tanks.

  20. Valve-Like and Protruding Calcified Intimal Flap Complicating Common Iliac Arteries Kissing Stenting

    Directory of Open Access Journals (Sweden)

    George S. Georgiadis

    2015-01-01

    Full Text Available Endovascular therapy for iliac artery chronic total occlusions is nowadays associated with low rates of procedure-related complications and improved clinical outcomes, and it is predominantly used as first-line therapy prior to aortobifemoral bypass grafting. Herein, we describe the case of a patient presenting with an ischemic left foot digit ulcer and suffering complex aortoiliac lesions, who received common iliac arteries kissing stents, illustrating at final antegrade and retrograde angiograms the early recognition of a blood flow obstructing valve-like calcified intimal flap protruding through the stent struts, which was obstructing antegrade but not retrograde unilateral iliac arterial axis blood flow. The problem was resolved by reconstructing the aortic bifurcation at a more proximal level. Completion angiogram verified normal patency of aorta and iliac vessels. Additionally, a severe left femoral bifurcation stenosis was also corrected by endarterectomy-arterioplasty with a bovine patch. Postintervention ankle brachial pressure indices were significantly improved. At the 6-month and 2-year follow-up, normal peripheral pulses were still reported without intermittent claudication suggesting the durability of the procedure. Through stent-protruding calcified intimal flap, is a very rare, but existing source of antegrade blood flow obstruction after common iliac arteries kissing stents.

  1. Is repair of the protruded meninges sufficient for treatment of meningocele?

    Science.gov (United States)

    Yun-Hai, Song; Nan, Bao; Ping-Ping, Gao; Bo, Yang; Cheng, Chen

    2015-11-01

    The present study aimed to investigate the relationship between meningocele and tethered cord syndrome, diagnosis of meningocele associated with tethered cord syndrome, and when to perform surgery and the best surgical procedure. Sixty-nine children with meningocele who were admitted to Shanghai Children's Medical Center were analyzed. The relationship between meningocele and other lesions causing tethered cord syndrome was studied by combining magnetic resonance imaging (MRI) and intraoperative findings. The MRI results and intraoperative findings showed that 67 children (97%) had associated lesions such as tight filum terminale, fibrous band tethering, spinal cord or cauda equina adhesion, diastematomyelia, arachnoid cyst, and epidermoid cyst. The protruded meninges were repaired, and the intraspinal lesions were treated at the same time. Also, the tethered spinal cord was released. No neurological injuries were observed after surgery. The rate of meningocele associated with tethered cord syndrome is very high. MRI is necessary for the diagnosis of meningocele. Active surgical treatment is recommended immediately after definite diagnosis. During surgery, the surgeon should not only repair the protruded meninges but also explore the spinal canal and release the tethered cord.

  2. Object oriented fault diagnosis system for space shuttle main engine redlines

    Science.gov (United States)

    Rogers, John S.; Mohapatra, Saroj Kumar

    1990-01-01

    A great deal of attention has recently been given to Artificial Intelligence research in the area of computer aided diagnostics. Due to the dynamic and complex nature of space shuttle red-line parameters, a research effort is under way to develop a real time diagnostic tool that will employ historical and engineering rulebases as well as a sensor validity checking. The capability of AI software development tools (KEE and G2) will be explored by applying object oriented programming techniques in accomplishing the diagnostic evaluation.

  3. Genetic algorithm to optimize the design of main combustor and gas generator in liquid rocket engines

    Science.gov (United States)

    Son, Min; Ko, Sangho; Koo, Jaye

    2014-06-01

    A genetic algorithm was used to develop optimal design methods for the regenerative cooled combustor and fuel-rich gas generator of a liquid rocket engine. For the combustor design, a chemical equilibrium analysis was applied, and the profile was calculated using Rao's method. One-dimensional heat transfer was assumed along the profile, and cooling channels were designed. For the gas-generator design, non-equilibrium properties were derived from a counterflow analysis, and a vaporization model for the fuel droplet was adopted to calculate residence time. Finally, a genetic algorithm was adopted to optimize the designs. The combustor and gas generator were optimally designed for 30-tonf, 75-tonf, and 150-tonf engines. The optimized combustors demonstrated superior design characteristics when compared with previous non-optimized results. Wall temperatures at the nozzle throat were optimized to satisfy the requirement of 800 K, and specific impulses were maximized. In addition, the target turbine power and a burned-gas temperature of 1000 K were obtained from the optimized gas-generator design.

  4. Main research activities at the Institute of Energy Process Engineering Research Centre Juelich Germany

    International Nuclear Information System (INIS)

    Achenbach, E.

    1995-06-01

    This report summarizes four lectures been held during the author's seven-week stay at the Department of High Temperature Engineering in the period from February 2nd to March 23rd in 1995 under the JAERI foreign researcher inviting program. Though the Institute of Energy Process Engineering(IEV) in the Research Centre Juelich(KFA), has recently changed the subject of research from nuclear technology of high-temperature gas-cooled reactors(HTGRs) to fuel cell technology, there are many common items of research. In particular, the following topics presented in the lectures are of mutual interest: 1)Methane-steam reforming used at JAERI as HTGR heat utilization system and applied at KFA to internal reforming in the high temperature Solid Oxide Fuel Cell(SOFC), 2)Technology and modeling of high temperature electrolysis at JAERI as the inverse process of the SOFC developed at KFA, 3)Flow simulation of branched systems treated at JAERI for the development of high temperature heat exchangers and performed at KFA with respect to the SOFC manifold system, 4)Fundamental aspects of heat and mass transfer. The report should help to create a basis of discussing the above mentioned problems and to stimulate the research work at JAERI. (author)

  5. Improvement on Main/backup Controller Switching Device of the Nozzle Throat Area Control System for a Turbofan Aero Engine

    Science.gov (United States)

    Li, Jie; Duan, Minghu; Yan, Maode; Li, Gang; Li, Xiaohui

    2014-06-01

    A full authority digital electronic controller (FADEC) equipped with a full authority hydro-mechanical backup controller (FAHMBC) is adopted as the nozzle throat area control system (NTACS) of a turbofan aero engine. In order to ensure the switching reliability of the main/backup controller, the nozzle throat area control switching valve was improved from three-way convex desktop slide valve to six-way convex desktop slide valve. Simulation results show that, if malfunctions of FAEDC occur and abnormal signals are outputted from FADEC, NTACS will be seriously influenced by the main/backup controller switching in several working states, while NTACS will not be influenced by using the improved nozzle throat area control switching valve, thus the controller switching process will become safer and smoother and the working reliability of this turbofan aero engine is improved by the controller switching device improvement.

  6. Systems-Level Energy Audit for Main Complex, Construction Engineering Research Laboratory

    National Research Council Canada - National Science Library

    Lin, Mike

    2003-01-01

    ... (Buildings 1, 2, and 3) was conducted. The goals of the audit were to review energy and water use in the current main complex building, to review and inventory energy system equipment, and to devise short- and long-term energy improvement...

  7. Main conditions and effectiveness of gas fuel use for powering of dual fuel IC self-ignition engine

    Directory of Open Access Journals (Sweden)

    Stefan POSTRZEDNIK

    2015-09-01

    Full Text Available Internal combustion engines are fuelled mostly with liquid fuels (gasoline, diesel. Nowadays the gaseous fuels are applied as driving fuel of combustion engines. In case of spark ignition engines the liquid fuel (petrol can be totally replaced by the gas fuels. This possibility in case of compression engines is essentially restricted through the higher self-ignition temperatures of the combustible gases in comparison to classical diesel oil. Solution if this problem can be achieved by using of the dual fuel system, where for ignition of the prepared fuel gas - air mixture a specified amount of the liquid fuel (diesel oil should be additionally injected into the combustion chamber. For assurance that the combustion process proceeds without mistakes and completely, some basic conditions should be satisfied. In the frame of this work, three main aspects of this problem are taken into account: a. filling efficiency of the engine, b. stoichiometry of the combustion, c. performance of mechanical parameters (torque, power. A complex analysis of these conditions has been done and some achieved important results are presented in the paper.

  8. Ultra-fine structures of Pd-Ag-HAp nanoparticle deposition on protruded TiO2 barrier layer for dental implant

    Science.gov (United States)

    Jang, Jae-Myung; Kim, Seung-Dai; Park, Tae-Eon; Choe, Han-Cheol

    2018-02-01

    The biocompatibility structure of an implant surface is of great importance to the formation of new bone tissue around the dental implant and also has a significant chemical reaction in the osseointegration process. Thus, ultra-fine Pd-Ag-HAp nanoparticles have been electrodeposited on protruded TiO2 barrier layer in mixed electrolyte solutions. Unusual protrusions patterns, which are assigned to Pd-Ag-HAp nanoparticles, can be clearly differentiated from a TiO2 nanotube oxide layer formed by an anodizing process. In the chemical bonding state, the surface characteristics of Pd/Ag/HAp compounds have been investigated by FE-SEM, EDS mapping analysis, and XPS analysis. The mapping dots of the elements including Ti, Ca, Pd, Ag, and P showed a homogeneous distribution throughout the entire surface when deposited onto the protruded TiO2 barrier layer. The XPS spectra of Ti-2p, O-1S, Pd-3d, and Ag-3d have been investigated, with the major XPS peak indicating Pd-3d. The Ag-3d level was clearly observed with further scanning of the Ca-2p region. Based on the results of the chemical states, the structural properties of the protrusion patterns were also examined after being deposited onto the barrier oxide film, resulting in the representative protrusion patterns being mainly composed of Pd-Ag-HAp compounds. The results of the soaking evaluation showed that the protrusion patterns and the protruded TiO2 barrier layer were all effective in regards to biocompatibility.

  9. Specialized data analysis for the Space Shuttle Main Engine and diagnostic evaluation of advanced propulsion system components

    Science.gov (United States)

    1993-01-01

    The Marshall Space Flight Center is responsible for the development and management of advanced launch vehicle propulsion systems, including the Space Shuttle Main Engine (SSME), which is presently operational, and the Space Transportation Main Engine (STME) under development. The SSME's provide high performance within stringent constraints on size, weight, and reliability. Based on operational experience, continuous design improvement is in progress to enhance system durability and reliability. Specialized data analysis and interpretation is required in support of SSME and advanced propulsion system diagnostic evaluations. Comprehensive evaluation of the dynamic measurements obtained from test and flight operations is necessary to provide timely assessment of the vibrational characteristics indicating the operational status of turbomachinery and other critical engine components. Efficient performance of this effort is critical due to the significant impact of dynamic evaluation results on ground test and launch schedules, and requires direct familiarity with SSME and derivative systems, test data acquisition, and diagnostic software. Detailed analysis and evaluation of dynamic measurements obtained during SSME and advanced system ground test and flight operations was performed including analytical/statistical assessment of component dynamic behavior, and the development and implementation of analytical/statistical models to efficiently define nominal component dynamic characteristics, detect anomalous behavior, and assess machinery operational condition. In addition, the SSME and J-2 data will be applied to develop vibroacoustic environments for advanced propulsion system components, as required. This study will provide timely assessment of engine component operational status, identify probable causes of malfunction, and indicate feasible engineering solutions. This contract will be performed through accomplishment of negotiated task orders.

  10. Endometrial stromal sarcoma mimicking submucosal myoma protruding to the vagina: MRI findings.

    Science.gov (United States)

    Chien, J C W; Hsieh, S C; Lee, R C; Chen, C Y; Cheng, C J; Chan, W P

    2005-01-01

    A 46-year-old woman complained of persistent abnormal vaginal bleeding over ten days. Her intrauterine device had been removed two years before. Soon after, she suffered from menorrhagia and metrorrhagia. An incidental finding of severe anemia was also noted. In this admission, our initial T2-weighted magnetic resonance imaging (MRI) revealed a well-demarcated mass predominantly in the uterine cavity. The mass was depicted by an isointense signal relative to the myometrium on T1-weighted images, high signal intensity on T2-weighted images, and slightly heterogeneous enhancement on post-contrast images. The patient refused surgery. After two years, follow-up MRI showed a pedunculated mass protruding into the upper third of the vagina with a stalk connecting to the posterior wall of the uterine cavity, simulating submucosal myoma. Histological diagnosis was compatible with low-grade endometrial stromal sarcoma.

  11. Right Valsalva Sinus Aneurysm Protruding Into the Right Ventricle: A Case Report

    Directory of Open Access Journals (Sweden)

    Ata H. Afshar

    2015-09-01

    Full Text Available A separation between the aortic media and annulus fibrosus causes a rare cardiac abnormality called sinus of Valsalva aneurysm (SVA that may be congenital or acquired. It is more prevalent in the right coronary sinus (65%-85% but it has been seen rarely in non-coronary (10%-30%or Left coronary sinus (<5%. The most common complication is rupture of the Aneurysm. We present an 80-year-old male with expanding right Valsalva sinus aneurysm and protruding into right ventricle. The conventional treatment is surgical repair under cardio-pulmonary bypass or percutaneous catheter closure. The aneurysm was successfully excised surgically under direct guidance of trans-esophageal echocardiography (TEE.

  12. Limit analysis of spherical pressure vessels with protruding nozzles and associated defects

    International Nuclear Information System (INIS)

    Goodall, I.W.; Miller, A.G.

    1981-04-01

    In order to assess the failure of a structure with a defect it is necessary to obtain both a linear elastic fracture solution and a limit analysis of the structure. In combination these solutions enable the analyst to assess structural integrity. This note deals with the second aspect and investigates the effect of a partial penetration defect on the ductile collapse load of a spherical pressure vessel with a protruding nozzle. A lower bound solution is obtained for defects of varying depth around the intersection of the sphere and the cylinder. Results are presented for a typical geometry and it is found that the solution may be simply represented by three different functions depending on the fractional ligament thickness. (author)

  13. Vibration reduction at the engine-pumps assembly of the main moderator system

    International Nuclear Information System (INIS)

    Holostencu, Adriana; Dinu, Marius

    2005-01-01

    Problem of decreasing vibrations in the main moderator motor at Cernavoda NPP - Unit 1 is presented. The moderator pumps are of centrifugal, vertical, single stage and double suction type. Each pump is provided with a main motor (690 Kw, 50 Hz, 6 KV) capable of full rotative speed and a secondary motor, also known as 'pony motor' (15 Kw, 50 Hz, 380 V) capable of a quarter of the full speed. At starting-commissioning stage of Cernavoda NPP, the vibration level in the moderator pump - motor assembly had an average value of 6 mm/s with spurious peaks up to 8 mm/s. It has to be mentioned that operation with a high vibration level may lead to: - a premature wear of the motor bearings; - extra stresses and fatigue in the material of pump and associated pipes. In order to maintain vibration speed to the design limit, the NPP personnel have started investigations since 1997. The main activities were: - verification of the vibration measuring loops; - checking the torque of the bolts that hold the motor's case; - measuring the start-up and nominal currents of the motors in order to determine any phase unbalance; - adjusting the spring hangers from the pumps discharge with simultaneous monitoring of the motor vibration level; - installation of rubber pads in the gap between the motor lugs and the existing seismic supports. None of these actions revealed deviations from the installation requirements or operating parameters. In 1999, a contract with EUROTEST S. A and Stevenson was signed, in order to find a solution to reduce the vibration level. The EUROTEST/ Stevenson action plan contains de following main activities: 1. Creating a calculus model of the moderator system, based on the design drawings provided by Cernavoda NPP; 2. Preparing and performing the vibration measurements in various points of the system; 3. Analyzing the measurements results; 4. Calibrating the calculus model created in step 1, according with the field measurements; 5. Propose a solution to reduce

  14. Welded joints engineering design of the primary circuit, surge line and main steam piping of the Angra 2 reactor

    International Nuclear Information System (INIS)

    Volta, Angelo Roberto; Couto, Jose Gonzalo Villaverde

    1995-01-01

    The erection of nuclear systems of a Nuclear Power Station is under international requests, that results in a detailed elaboration of documents for the performance of welds. NUCLEN as an engineering design company, responsible for the erection of Angra 2, developed a suitable software program for the elaboration of welding procedure qualifications, tests and examination sequence plans and heat treatment plans applied to primary circuit, surgeline and main steam piping. The paper shows the employed methodology for the elaboration of these documents, as well as the requested engineering design of welding technology and testability in order to assure the stipulated quality level, according to requirements of the specifications, codes and norms. (author). 6 refs

  15. How engineering data management and system support the main process[-oriented] functions of a large-scale project

    CERN Document Server

    Hameri, A P

    1999-01-01

    By dividing the development process into successive functional operations, this paper studies the benefits of establishing configuration management procedures and of using an engineering data management systems (EDMS) in order to execute the tasks. The underlying environment is that of CERN and the ongoing, a decade long, Large Hadron Collider (LHC)-project. By identifying the main functional groups who will use the EDMS the paper outlines the basic motivations and services provided by such a system to each process function. The implications of strict configuration management on the daily operation of each functional user group are also discussed. The main argument of the paper is that each and every user of the EDMS must act in compliance with the configuration management procedures to guarantee the overall benefits from the system. The pilot EDMS being developed at CERN, which serves as a test-bed to discover the real functional needs of the organisation of an EDMS supports the conclusions. The preliminary ...

  16. Protruding Features of Viral Capsids Are Clustered on Icosahedral Great Circles.

    Directory of Open Access Journals (Sweden)

    David P Wilson

    Full Text Available Spherical viruses are remarkably well characterized by the Triangulation (T number developed by Casper and Klug. The T-number specifies how many viral capsid proteins are required to cover the virus, as well as how they are further subdivided into pentamer and hexamer subunits. The T-number however does not constrain the orientations of these proteins within the subunits or dictate where the proteins should place their protruding features. These protrusions often take the form of loops, spires and helices, and are significant because they aid in stability of the capsid as well as recognition by the host organism. Until now there has be no overall understanding of the placement of protrusions for spherical viruses, other than they have icosahedral symmetry. We constructed a set of gauge points based upon the work affine extensions of Keef and Twarock, which have fixed relative angular locations with which to measure the locations of these features. This work adds a new element to our understanding of the geometric arrangement of spherical viral capsid proteins; chiefly that the locations of protruding features are not found stochastically distributed in an icosahedral manner across the viral surface, but instead these features are found only in specific locations along the 15 icosahedral great circles. We have found that this result holds true as the T number and viral capsids size increases, suggesting an underlying geometric constraint on their locations. This is in spite of the fact that the constraints on the pentamers and hexamer orientations change as a function of T-number, as you need to accommodate more hexamers in the same solid angle between pentamers. The existence of this angular constraint of viral capsids suggests that there is a fitness or energetic benefit to the virus placing its protrusions in this manner. This discovery may have profound impacts on identifying and eliminating viral pathogens, understanding evolutionary

  17. Automation based on knowledge modeling theory and its applications in engine diagnostic systems using Space Shuttle Main Engine vibrational data. M.S. Thesis

    Science.gov (United States)

    Kim, Jonnathan H.

    1995-01-01

    Humans can perform many complicated tasks without explicit rules. This inherent and advantageous capability becomes a hurdle when a task is to be automated. Modern computers and numerical calculations require explicit rules and discrete numerical values. In order to bridge the gap between human knowledge and automating tools, a knowledge model is proposed. Knowledge modeling techniques are discussed and utilized to automate a labor and time intensive task of detecting anomalous bearing wear patterns in the Space Shuttle Main Engine (SSME) High Pressure Oxygen Turbopump (HPOTP).

  18. From Shuttle Main Engine to the Human Heart: A Presentation to the Federal Lab Consortium for Technology Transfer

    Science.gov (United States)

    Fogarty, Jennifer A.

    2010-01-01

    A NASA engineer received a heart transplant performed by Drs. DeBakey and Noon after suffering a serious heart attack. 6 months later that engineer returned to work at NASA determined to use space technology to help people with heart disease. A relationship between NASA and Drs. DeBakey and Noon was formed and the group worked to develop a low cost, low power implantable ventricular assist device (VAD). NASA patented the method to reduce pumping damage to red blood cells and the design of a continuous flow heart pump (#5,678,306 and #5,947,892). The technology and methodology were licensed exclusively to MicroMed Technology, Inc.. In late 1998 MicroMed received international quality and electronic certifications and began clinical trials in Europe. Ventricular assist devices were developed to bridge the gap between heart failure and transplant. Early devices were cumbersome, damaged red blood cells, and increased the risk of developing dangerous blood clots. Application emerged from NASA turbopump technology and computational fluid dynamics analysis capabilities. To develop the high performance required of the Space Shuttle main engines, NASA pushed the state of the art in the technology of turbopump design. NASA supercomputers and computational fluid dynamics software developed for use in the modeling analysis of fuel and oxidizer flow through rocket engines was used in the miniaturization and optimization of a very small heart pump. Approximately 5 million people worldwide suffer from chronic heart failure at a cost of 40 billion dollars In the US, more than 5000 people are on the transplant list and less than 3000 transplants are performed each year due to the lack of donors. The success of ventricular assist devices has led to an application as a therapeutic destination as well as a bridge to transplant. This success has been attributed to smaller size, improved efficiency, and reduced complications such as the formation of blood clots and infection.

  19. Surgical management of liver hydatid disease: subadventitial cystectomy versus resection of the protruding dome.

    Science.gov (United States)

    Mohkam, Kayvan; Belkhir, Leila; Wallon, Martine; Darnis, Benjamin; Peyron, François; Ducerf, Christian; Gigot, Jean-François; Mabrut, Jean-Yves

    2014-08-01

    The aim of this study was to compare postoperative outcome and long-term results after management of liver hydatid cysts (LHC) by subadventitial cystectomy (SC) and resection of the protruding dome (RPD) in two tertiary liver surgery centers. Medical records of 52 patients who underwent SC in one center, and 27 patients who underwent RPD in another center between 1991 and 2011 were reviewed. Patients underwent long-term follow-up, including serology tests and morphological examinations. Postoperative mortality was nil. The rate of severe morbidity was 7.7 and 22% (p = 0.082), while the rate of serological clearing-up was 20 and 13.3% after SC and RPD, respectively (p = 1.000). After a mean follow-up of 41 months (1-197), four patients developed a long-term cavity-related complication (LTCRC) after RPD (including one recurrence) and none after SC (p = 0.012). All LTCRCs occurred in patients with hydatid cysts located at the liver dome; three required an invasive procedure by either puncture aspiration injection re-aspiration (N = 1) or repeat surgery (N = 2). RPD exposes to specific LTCRC, especially when hydatid cysts are located at the liver dome, while SC allows ad integrum restoration of the operated liver. Therefore, SC should be considered as the standard surgical treatment for LHC in experienced hepato-pancreato-biliary centers.

  20. Scenarios and methods that induce protruding or released CNTs after degradation of nanocomposite materials.

    Science.gov (United States)

    Hirth, Sabine; Cena, Lorenzo; Cox, Gerhard; Tomović, Zeljko; Peters, Thomas; Wohlleben, Wendel

    2013-04-01

    Nanocomposite materials may be considered as a low-risk application of nanotechnology, if the nanofillers remain embedded throughout the life-cycle of the products in which they are embedded. We hypothesize that release of free CNTs occurs by a combination of mechanical stress and chemical degradation of the polymer matrix. We experimentally address limiting cases: Mechanically released fragments may show tubular protrusions on their surface. Here we identify these protrusions unambiguously as naked CNTs by chemically resolved microscopy and a suitable preparation protocol. By size-selective quantification of fragments we establish as a lower limit that at least 95 % of the CNTs remain embedded. Contrary to classical fiber composite approaches, we link this phenomenon to matrix materials with only a few percent elongation at break, predicting which materials should still cover their CNT nanofillers after machining. Protruding networks of CNTs remain after photochemical degradation of the matrix, and we show that it takes the worst case combinations of weathering plus high-shear wear to release free CNTs in the order of mg/m 2 /year. Synergy of chemical degradation and mechanical energy input is identified as the priority scenario of CNT release, but its lab simulation by combined methods is still far from real-world validation.

  1. A case of microdeletion of 19p13 with intellectual disability, hypertrichosis, synophrys, and protruding front teeth

    DEFF Research Database (Denmark)

    Jelsig, Anne Marie; Brasch Andersen, Charlotte; Kibæk, Maria

    2012-01-01

    We present a de novo 1.4 Mb deletion of chromosome 19p13.11-p13.12 in a 16 year old boy with intellectual disability, autistic features, microcephaly, hearing impairment, hypertrichosis, synophrys, protruding front teeth, and other dysmorphic features. By comparing our patient to reported cases...

  2. Main control system verification and validation of NPP digital I and C system based on engineering simulator

    International Nuclear Information System (INIS)

    Lin Meng; Hou Dong; Liu Pengfei; Yang Zongwei; Yang Yanhua

    2010-01-01

    Full-scope digital instrumentation and controls system (I and C) technique is being introduced in Chinese new constructed Nuclear Power Plant (NPP), which mainly includes three parts: control system, reactor protection system and engineered safety feature actuation system. For example, SIEMENS TELEPERM XP and XS distributed control system (DCS) have been used in Ling Ao Phase II NPP, which is located in Guangdong province, China. This is the first NPP project in China that Chinese engineers are fully responsible for all the configuration of actual analog and logic diagram, although experience in NPP full-scope digital I and C is very limited. For the safety, it has to be made sure that configuration is right and control functions can be accomplished before the phase of real plant testing on reactor. Therefore, primary verification and validation (V and V) of I and C needs to be carried out. Except the common and basic way, i.e. checking the diagram configuration one by one according to original design, NPP engineering simulator is applied as another effective approach of V and V. For this purpose, a virtual NPP thermal-hydraulic model is established as a basis according to Ling Ao Phase II NPP design, and the NPP simulation tools can provide plant operation parameters to DCS, accept control signal from I and C and give response. During the test, one set of data acquisition equipments are used to build a connection between the engineering simulator (software) and SIEMENS DCS I/O cabinet (hardware). In this emulation, original diagram configuration in DCS and field hardware structures are kept unchanged. In this way, firstly judging whether there are some problems by observing the input and output of DCS without knowing the internal configuration. Then secondly, problems can be found and corrected by understanding and checking the exact and complex configuration in detail. At last, the correctness and functionality of the control system are verified. This method is

  3. Internal Combustion Engines as the Main Source of Ultrafine Particles in Residential Neighborhoods: Field Measurements in the Czech Republic

    Directory of Open Access Journals (Sweden)

    Jitka Stolcpartova

    2015-11-01

    Full Text Available Ultrafine particles (UFP, diameter < 100 nm exposure has already been associated with adverse effects on human health. Spatial distribution of UFP is non-uniform; they concentrate in the vicinity of the source, e.g. traffic, because of their short lifespan. This work investigates spatial distribution of UFP in three areas in the Czech Republic with different traffic load: High traffic (Prague neighborhood—Sporilov, commuter road vicinity (Libeznice, and a small city with only local traffic (Celakovice. Size-resolved measurements of particles in the 5–500 nm range were taken with a particle classifier mounted, along with batteries, GPS and other accessories, on a handcart and pushed around the areas, making one-minute or longer stops at places of interest. Concentrations along main roads were elevated in comparison with places farther from the road; this pattern was observed in all sites, while particle number distributions both close and away from main roads had similar patterns. The absence of larger particles, the relative absence of higher concentrations of particles away from the main roads, and similar number distributions suggest that high particle number concentrations cannot be readily attributed to sources other than internal combustion engines in vehicles and mobile machinery (i.e., mowers and construction machines.

  4. Main research results in the field of nuclear power engineering of the Nuclear Reactors and Thermal Physics Institute in 2014

    International Nuclear Information System (INIS)

    Trufanov, A.A.; Orlov, Yu.I.; Sorokin, A.P.; Chernonog, V.L.

    2015-01-01

    The main results of scientific and technological activities for last years of the Nuclear Reactors and Thermal Physics Institute FSUE SSC RF - IPPE in solving problems of nuclear power engineering are presented. The work have been carried out on the following problems: justification of research and development solutions and safety of NPPs with fast reactors of new generation with sodium (BN-1200, MBIR) and lead (BREST-OD-300) coolants, justification of safety of operating and advanced NPPs with WWER reactor facilities (WWER-1000, AEhS 2006, WWER-TOI), development and benchmarking of computational codes, research and development support of Beloyarsk-3 (BN-600) and Bilibino (BN-800) NPPs operation, decommissioning of AM and BR-10 research reactors, pilot scientific studies (WWER-SKD, ITER), international scientific and technical cooperation. Problems for further investigations are charted [ru

  5. Studies and analyses of the space shuttle main engine. Failure information propagation model data base and software

    Science.gov (United States)

    Tischer, A. E.

    1987-01-01

    The failure information propagation model (FIPM) data base was developed to store and manipulate the large amount of information anticipated for the various Space Shuttle Main Engine (SSME) FIPMs. The organization and structure of the FIPM data base is described, including a summary of the data fields and key attributes associated with each FIPM data file. The menu-driven software developed to facilitate and control the entry, modification, and listing of data base records is also discussed. The transfer of the FIPM data base and software to the NASA Marshall Space Flight Center is described. Complete listings of all of the data base definition commands and software procedures are included in the appendixes.

  6. A data base and analysis program for shuttle main engine dynamic pressure measurements. Appendix B: Data base plots for SSME tests 901-290 through 901-414

    Science.gov (United States)

    Coffin, T.

    1986-01-01

    A dynamic pressure data base and data base management system developed to characterize the Space Shuttle Main Engine (SSME) dynamic pressure environment is described. The data base represents dynamic pressure measurements obtained during single engine hot firing tesets of the SSME. Software is provided to permit statistical evaluation of selected measurements under specified operating conditions. An interpolation scheme is also included to estimate spectral trends with SSME power level. Flow dynamic environments in high performance rocket engines are discussed.

  7. A data base and analysis program for shuttle main engine dynamic pressure measurements. Appendix C: Data base plots for SSME tests 902-214 through 902-314

    Science.gov (United States)

    Coffin, T.

    1986-01-01

    A dynamic pressure data base and data base management system developed to characterize the Space Shuttle Main Engine (SSME) dynamic pressure environment is reported. The data base represents dynamic pressure measurements obtained during single engine hot firing tests of the SSME. Software is provided to permit statistical evaluation of selected measurements under specified operating conditions. An interpolation scheme is included to estimate spectral trends with SSME power level. Flow Dynamic Environments in High Performance Rocket Engines are described.

  8. The influence of protruding filamentous bacteria on floc stability and solid-liquid separation in the activated sludge process.

    Science.gov (United States)

    Burger, Wilhelm; Krysiak-Baltyn, Konrad; Scales, Peter J; Martin, Gregory J O; Stickland, Anthony D; Gras, Sally L

    2017-10-15

    Filamentous bacteria can impact on the physical properties of flocs in the activated sludge process assisting solid-liquid separation or inducing problems when bacteria are overabundant. While filamentous bacteria within the flocs are understood to increase floc tensile strength, the relationship between protruding external filaments, dewatering characteristics and floc stability is unclear. Here, a quantitative methodology was applied to determine the abundance of filamentous bacteria in activated sludge samples from four wastewater treatment plants. An automated image analysis procedure was applied to identify filaments and flocs and calculate the length of the protruding filamentous bacteria (PFB) relative to the floc size. The correlation between PFB and floc behavior was then assessed. Increased filament abundance was found to increase interphase drag on the settling flocs, as quantified by the hindered settling function. Additionally, increased filament abundance was correlated with a lower gel point concentration leading to poorer sludge compactability. The floc strength factor, defined as the relative change in floc size upon shearing, correlated positively with filament abundance. This influence of external protruding filamentous bacteria on floc stability is consistent with the filamentous backbone theory, where filamentous bacteria within flocs increase floc resistance to shear-induced breakup. A qualitative correlation was also observed between protruding and internal filamentous structure. This study confirms that filamentous bacteria are necessary to enhance floc stability but if excessively abundant will adversely affect solid-liquid separation. The tools developed here will allow quantitative analysis of filament abundance, which is an improvement on current qualitative methods and the improved method could be used to assist and optimize the operation of waste water treatment plants. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. A general purpose diagnostic technique for marine diesel engines - Application on the main propulsion and auxiliary diesel units of a marine vessel

    International Nuclear Information System (INIS)

    Lamaris, V.T.; Hountalas, D.T.

    2010-01-01

    Diesel engines are widely used in marine applications (i.e. propulsion and auxiliaries) except from a few cases where gas or steam turbines are used. This is the result of their high efficiency, power concentration and reliability compared to other compatible or alternative power sources. The proper and efficient operation of the engines (main engine and diesel generator units) in marine applications is critical, and therefore techniques or systems that determine engine current condition and detect potential faults are extremely important. Furthermore, it is advantageous when such techniques can be applied on different engine configurations and provide reliable results, because on a vessel usually exist diesel engines of different type, i.e. the main propulsion unit is a large low-speed two-stroke diesel engine while the diesel generators are four-stroke medium or high speed engines. In the present work is described and evaluated for the first time the application of an improved diagnostic technique, developed by the authors, on both the main engine and the auxiliary units of a commercial marine vessel. The diagnostic technique is based on a thermodynamic simulation model. The simulation model embedded in the technique has been modified, namely an existing two-zone model is replaced by a multi-zone one. With this modification it is avoided model constant tuning with the operating conditions. This is extremely important for the diagnostic philosophy of the proposed technique. Using data from engine shop tests, the simulation model is calibrated (i.e. model constants are determined) and the engine reference condition is obtained. The simulation model is then used to estimate the current engine condition, using field measurements (i.e. cylinder pressure measurements, periphery data, etc.). From the results it is revealed that the diagnosis method provides detailed information for the operating condition of both engines and the values of parameters that cannot be

  10. A data base and analysis program for shuttle main engine dynamic pressure measurements. Appendix F: Data base plots for SSME tests 750-120 through 750-200

    Science.gov (United States)

    Coffin, T.

    1986-01-01

    A dynamic pressure data base and data base management system developed to characterize the Space Shuttle Main Engine (SSME) dynamic pressure environment is presented. The data base represents dynamic pressure measurements obtained during single engine hot firing tests of the SSME. Software is provided to permit statistical evaluation of selected measurements under specified operating conditions. An interpolation scheme is also included to estimate spectral trends with SSME power level.

  11. Intracranially protruded bilateral posterior and superior SCCs with multiple dehiscences in a patient with positional vertigo: CT and MR imaging findings and review of literature

    International Nuclear Information System (INIS)

    Kundaragi, Nischal G; Mudali, Srinivasa; Karpagam, Bulabai; Priya, Rathna

    2014-01-01

    We report a rare case of intracranially protruded posterior and superior semicircular canals beyond the margins of temporal bone with bony roof dehiscence in bilateral posterior and left superior semicircular canals in a patient with benign paroxysmal positional vertigo (BPPV)

  12. The main indicators of the health of children and adolescents in residential zone of the facility for disposal of rocket engines

    Directory of Open Access Journals (Sweden)

    Tarakanova S.Y.

    2014-12-01

    39.5%. The main cause of morbidity in children is diseases of the nervous system and mental disorders, and congenital anomalies. Conclusion. Operation of installations for the disposal of rocket engines solid fuel according to the official reporting forms medical institutions has no effect on child health.

  13. High-frequency data observations from space shuttle main engine low pressure fuel turbopump discharge duct flex joint tripod failure investigation

    Science.gov (United States)

    Zoladz, T. F.; Farr, R. A.

    1991-01-01

    Observations made by Marshall Space Flight Center (MSFC) engineers during their participation in the Space Shuttle Main Engine (SSME) low pressure fuel turbopump discharge duct flex joint tripod failure investigation are summarized. New signal processing techniques used by the Component Assessment Branch and the Induced Environments Branch during the failure investigation are described in detail. Moreover, nonlinear correlations between frequently encountered anomalous frequencies found in SSME dynamic data are discussed. A recommendation is made to continue low pressure fuel (LPF) duct testing through laboratory flow simulations and MSFC-managed technology test bed SSME testing.

  14. Applying Systems Engineering to Improve the Main Gas Turbine Exhaust System Maintenance Strategy for the CG-47 Ticonderoga Class Cruiser

    Science.gov (United States)

    2015-09-01

    national security and prosperity (U.S. Navy 2014). In perspective, oceans are the lifeblood of the planet and its entire population . The National...maintenance strategy, reliability-centered maintenance, cost, schedule, performance, growth -work, new-work, optimal fleet response plan, time-directed...76 5. Main Gas Turbine Exhaust System Growth -Work ..................77 E. RECOMMENDATIONS TO IMPROVE THE MAIN GAS TURBINE EXHAUST SYSTEM

  15. Electrokinetic desalination of protruded areas of stone avoiding the direct contact with electrodes

    DEFF Research Database (Denmark)

    Feijoo, J.; Matyscák, O.; Ottosen, Lisbeth M.

    2017-01-01

    of the sandstone highly contaminated with salts. Therefore, these results confirmed that it was possible to desalinate the sandstone using electrokinetic methods without the need to put in contact the affected areas with the equipment, reducing the possibility of altering it by manipulation.......Soluble salts are considered one of the main deterioration factors of porous building materials such as rocks, bricks or granites. The desalination treatments currently used in order to mitigate this alteration process are usually applied directly on the affected areas, which have often a low...... degree of cohesion precisely due to the deteriorating effect of the salts. The present study aimed to investigate the evaluation of a new approach based on electrokinetic techniques to desalinate rocks in monuments, specifically to desalinate carved reliefs. The procedure avoids the direct contact...

  16. Probabilistic Structural Analysis Methods for select space propulsion system components (PSAM). Volume 2: Literature surveys of critical Space Shuttle main engine components

    Science.gov (United States)

    Rajagopal, K. R.

    1992-01-01

    The technical effort and computer code development is summarized. Several formulations for Probabilistic Finite Element Analysis (PFEA) are described with emphasis on the selected formulation. The strategies being implemented in the first-version computer code to perform linear, elastic PFEA is described. The results of a series of select Space Shuttle Main Engine (SSME) component surveys are presented. These results identify the critical components and provide the information necessary for probabilistic structural analysis. Volume 2 is a summary of critical SSME components.

  17. Development of Load Characteristic for The Main Engine and Its PLC Compatible Preparation in Cooperation with The Water Brake as The Generator

    Directory of Open Access Journals (Sweden)

    Mathias Markert

    2017-09-01

    Full Text Available Water brake can be used in any application where a load brake is required on a rotational load. In the engine industry, dynamometer is used in conjunction with a power source and instrumentation to determine engine HP, Torque, and Efficiency ratings with a high degree of accuracy. Water brake are proven durable designs which use water flowing through the absorber to create a load on the engine. Only the amount of water necessary to provide the load is required.Precise load control of the dynamometer is as simple as increasing or decreasing water volume flowing through the dynamometer absorption body. The controls ensure engine load remains stable throughout the duration of the test cycle. Torque, horsepower, RPM, and water temperature are displayed on highly accurate digital instrumentation.Computers can perform both sequential control and feedback control, and typically a single computer will do both in an industrial application. Programmable logic controllers are a type of special purpose microprocessor that replaced many hardware components such as timers and drum sequencers used in relay logic type systems. They can also analyze data and create real time graphical displays for operators and run reports for operators, engineers and management.Industrial control systems are usually used in all over in control system. A distributed control system refers to a control system in which the controllers are spread throughout the system and connect by networks. Smaller automation applications can be implemented with programmable logic controllers.This thesis basically is about designing a programmable logic controller compatible for dynamometer to control speed, power and torque of main engine. To test engine performance in the laboratory, the engine is coupled to a dynamometer. In this thesis dynamometer are used to measure speed, power and torque. One of the most essential role of the control engineer is tuning of controller. Hence the

  18. Advanced Development of a Compact 5-15 lbf Lox/Methane Thruster for an Integrated Reaction Control and Main Engine Propulsion System

    Science.gov (United States)

    Hurlbert, Eric A.; McManamen, John Patrick; Sooknanen, Josh; Studak, Joseph W.

    2011-01-01

    This paper describes the advanced development and testing of a compact 5 to 15 lbf LOX/LCH4 thruster for a pressure-fed integrated main engine and RCS propulsion system to be used on a spacecraft "vertical" test bed (VTB). The ability of the RCS thruster and the main engine to operate off the same propellant supply in zero-g reduces mass and improves mission flexibility. This compact RCS engine incorporates several features to dramatically reduce mass and parts count, to ease manufacturing, and to maintain acceptable performance given that specific impulse (Isp) is not the driver. For example, radial injection holes placed on the chamber body for easier drilling, and high temperature Haynes 230 were selected for the chamber over other more expensive options. The valve inlets are rotatable before welding allowing different orientations for vehicle integration. In addition, the engine design effort selected a coil-on-plug ignition system which integrates a relay and coil with the plug electrode, and moves some exciter electronics to avionics driver board. The engine injector design has small dribble volumes to target minimum pulse widths of 20 msec. and an efficient minimum impulse bit of less than 0.05 lbf-sec. The propellants, oxygen and methane, were chosen because together they are a non-toxic, Mars-forward, high density, space storable, and high performance propellant combination that is capable of pressure-fed and pump-fed configurations and integration with life support and power subsystems. This paper will present the results of the advanced development testing to date of the RCS thruster and the integration with a vehicle propulsion system.

  19. Cold flow testing of the Space Shuttle Main Engine alternate turbopump development high pressure fuel turbine model

    Science.gov (United States)

    Gaddis, Stephen W.; Hudson, Susan T.; Johnson, P. D.

    1992-01-01

    NASA's Marshall Space Flight Center has established a cold airflow turbine test program to experimentally determine the performance of liquid rocket engine turbopump drive turbines. Testing of the SSME alternate turbopump development (ATD) fuel turbine was conducted for back-to-back comparisons with the baseline SSME fuel turbine results obtained in the first quarter of 1991. Turbine performance, Reynolds number effects, and turbine diagnostics, such as stage reactions and exit swirl angles, were investigated at the turbine design point and at off-design conditions. The test data showed that the ATD fuel turbine test article was approximately 1.4 percent higher in efficiency and flowed 5.3 percent more than the baseline fuel turbine test article. This paper describes the method and results used to validate the ATD fuel turbine aerodynamic design. The results are being used to determine the ATD high pressure fuel turbopump (HPFTP) turbine performance over its operating range, anchor the SSME ATD steady-state performance model, and validate various prediction and design analyses.

  20. Effect of main injection timing for controlling the combustion phasing of a homogeneous charge compression ignition engine using a new dual injection strategy

    International Nuclear Information System (INIS)

    Das, Pranab; Subbarao, P.M.V.; Subrahmanyam, J.P.

    2015-01-01

    Highlights: • A new dual injection concept is developed by minimum geometry modification. • The occurrence of combustion parameters strongly depend on main injection timing. • At higher load, premixed equivalence ratio dominates over main injection timing. • Retarded of main injection timing tends to retard combustion phasing. • Slightly retarded main injection timing is recommended to avoid intense knocking. - Abstract: Homogeneous charge compression ignition combustion of diesel fuel is implemented using a novel dual injection strategy. A new experimental technique is developed to modify a single cylinder direct injection diesel engine to run on homogeneous combustion mode. Effect of main injection timing is investigated covering a range from 26 to 8 crank angle degrees before top dead center with an interval of 3°. Retarded main injection timing is identified as a control strategy for delaying combustion phasing and a means of controlled combustion phasing of direct injection homogeneous charge compression ignition combustion. Two load conditions were investigated and it was observed that at higher load, start of combustion depends more on fuel air equivalence ratio than main injection timing, whereas at low load, it significantly varies with varying main injection timing. Significant improvements in smoke and oxides of nitrogen emissions are observed when compared with the baseline conventional combustion. By studying different combustion parameters, it is observed that there is an improvement in performance and emissions with marginal loss in thermal efficiency when the main injection timing is 20° before top dead center. This is identified as the optimum main injection timing for such homogeneous combustion under the same operating condition

  1. Comparison of Two Classifiers; K-Nearest Neighbor and Artificial Neural Network, for Fault Diagnosis on a Main Engine Journal-Bearing

    Directory of Open Access Journals (Sweden)

    A. Moosavian

    2013-01-01

    Full Text Available Vibration analysis is an accepted method in condition monitoring of machines, since it can provide useful and reliable information about machine working condition. This paper surveys a new scheme for fault diagnosis of main journal-bearings of internal combustion (IC engine based on power spectral density (PSD technique and two classifiers, namely, K-nearest neighbor (KNN and artificial neural network (ANN. Vibration signals for three different conditions of journal-bearing; normal, with oil starvation condition and extreme wear fault were acquired from an IC engine. PSD was applied to process the vibration signals. Thirty features were extracted from the PSD values of signals as a feature source for fault diagnosis. KNN and ANN were trained by training data set and then used as diagnostic classifiers. Variable K value and hidden neuron count (N were used in the range of 1 to 20, with a step size of 1 for KNN and ANN to gain the best classification results. The roles of PSD, KNN and ANN techniques were studied. From the results, it is shown that the performance of ANN is better than KNN. The experimental results dèmonstrate that the proposed diagnostic method can reliably separate different fault conditions in main journal-bearings of IC engine.

  2. Effects of pilot injection parameters on low temperature combustion diesel engines equipped with solenoid injectors featuring conventional and rate-shaped main injection

    International Nuclear Information System (INIS)

    D’Ambrosio, S.; Ferrari, A.

    2016-01-01

    Highlights: • The influence of the principal pilot injection parameters is discussed for low-temperature combustion systems. • Swirl-sweep and dwell-time sweep results are combined to analyze soot emissions. • The pilot injection effects are investigated in injection profiles featuring rate-shaped main injections. - Abstract: The potential of pilot injection has been assessed on a low-temperature combustion diesel engine for automotive applications, which was characterized by a reduced compression-ratio, high EGR rates and postponed main injection timings. Dwell time sweeps have been carried out for pilot injections with distinct energizing times under different representative steady-state working conditions of the medium load and speed area of the New European Driving Cycle. The results of in-cylinder analyses of the pressure, heat-release rate, temperature and emissions are presented. Combustion noise has been shown to decrease significantly when the pilot injected mass increases, while it is scarcely affected by the dwell time between the pilot and main injections. The HC, CO and fuel consumption trends, with respect to both the pilot injection dwell time and mass, are in line with those of conventional combustion systems, and in particular decreasing trends occur as the pilot injection energizing time is increased. Furthermore, a reduced sensitivity of NO_x emissions to both dwell time and pilot injected mass has been found, compared to conventional combustion systems. Finally, it has been observed that soot emissions diminish as the energizing time is shortened, and their dependence on dwell time is influenced to a great extent by the presence of local zones with reduced air-to-fuel ratios within the cylinder. A combined analysis of the results of swirl sweeps and dwell time sweeps is here proposed as a methodology for the detection of any possible interference between pilot combustion burned gases and the main injected fuel. The effect of pilot

  3. Predicting the service life of connecting rod and main bearings, taking into account different engine loads. Final report; Lebensdauervorhersage fuer Pleuel- und Hauptlager unter Beruecksichtigung unterschiedlicher Motorlastkollektive. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Berkowitz, B.; Lueneburg, B.; Liu, J.

    1994-12-31

    Connecting rod and main bearings of internal combustion engines are among the most heavily stressed components in modern engines. It was found that these engine components are increasingly reaching the limits of their strength and therefore become the components limiting engine life. However, there is no known process which makes a calculated prediction of the service life of modern connecting rod and main bearings possible, taking into account various engine loads. In this research project, a new concept for the calculated prediction of the service life of non-static highly loaded radial sliding bearings is worked out. The basis is a process of calculation which realistically determines the pressure and gap course in highly loaded sliding bearings. Apart from the viscosity depending on pressure and temperature, the elastic deformations of the system sliding bearing/conn rod are also taken into account. Calculations are done for different operating points for a complete cycle of a four stroke Diesel engine (Daimler-Benz OM 364 LA). The results are compared with the present conventional process of calculation and the effects which occur are discussed. Based on the elasto-hydrodynamic calculation, a method of calculating the service life of non-statically loaded sliding bearings, taking into account various motor loads, is worked out. (orig./HW) [Deutsch] Pleuel- und Hauptlager von Verbrennungskraftmaschinen zaehlen mit zu den spezifisch am hoechsten beanspruchten Bauteilen in modernen Motoren. Es hat sich gezeigt, dass vor allem diese Maschinenelemente zunehmend an die Grenzen ihrer Belastbarkeit stossen und so zum lebensdauerbegrenzenden Bauteil werden. Es ist jedoch kein Verfahren bekannt, das eine rechnerische Lebensdauervorhersage moderner Pleuel- und Hauptlager unter Beruecksichtigung unterschiedlicher Motorlastkollektive ermoeglicht. Im vorliegenden Forschungsvorhaben wird daher ein neuartiges Konzept zur rechnerischen Lebensdauervorhersage von instationaeren

  4. Space Shuttle Main Engine Low Pressure Oxidizer Turbo-Pump Inducer Dynamic Environment Characterization through Water Model and Hot-Fire Testing

    Science.gov (United States)

    Arellano, Patrick; Patton, Marc; Schwartz, Alan; Stanton, David

    2006-01-01

    The Low Pressure Oxidizer Turbopump (LPOTP) inducer on the Block II configuration Space Shuttle Main Engine (SSME) experienced blade leading edge ripples during hot firing. This undesirable condition led to a minor redesign of the inducer blades. This resulted in the need to evaluate the performance and the dynamic environment of the redesign, relative to the current configuration, as part of the design acceptance process. Sub-scale water model tests of the two inducer configurations were performed, with emphasis on the dynamic environment due to cavitation induced vibrations. Water model tests were performed over a wide range of inlet flow coefficient and pressure conditions, representative of the scaled operating envelope of the Block II SSME, both in flight and in ground hot-fire tests, including all power levels. The water test hardware, facility set-up, type and placement of instrumentation, the scope of the test program, specific test objectives, data evaluation process and water test results that characterize and compare the two SSME LPOTP inducers are discussed. In addition, dynamic characteristics of the two water models were compared to hot fire data from specially instrumented ground tests. In general, good agreement between the water model and hot fire data was found, which confirms the value of water model testing for dynamic characterization of rocket engine turbomachinery.

  5. Convective heat transfer enhancement by diamond shaped micro-protruded patterns for heat sinks: Thermal fluid dynamic investigation and novel optimization methodology

    International Nuclear Information System (INIS)

    Ventola, Luigi; Dialameh, Masoud; Fasano, Matteo; Chiavazzo, Eliodoro; Asinari, Pietro

    2016-01-01

    Highlights: • A novel methodology for optimal design of patterned heat sink surfaces is proposed. • Heat transfer enhancement by patterned surfaces is measured experimentally. • Role of fluid dynamics and geometrical scales on heat transfer is clarified. - Abstract: In the present work, micro-protruded patterns on flush mounted heat sinks for convective heat transfer enhancement are investigated and a novel methodology for thermal optimization is proposed. Patterned heat sinks are experimentally characterized in fully turbulent regime, and the role played by geometrical parameters and fluid dynamic scales is discussed. A methodology specifically suited for micro-protruded pattern optimization is designed, leading to 73% enhancement in thermal performance respect to commercially available heat sinks, at fixed costs. This work is expected to introduce a new methodological approach for a more systematic and efficient development of solutions for electronics cooling.

  6. Gastrointestinal Stromal Tumor of the Stomach with Narrow Stalk-Like Based, Uneven Protruding Appearance Presenting with Severe Acute Anemia despite Small Size

    Directory of Open Access Journals (Sweden)

    Tomomitsu Tahara

    2010-03-01

    Full Text Available We report the case of a 56-year-old woman who had a gastrointestinal stromal tumor (GIST of the stomach. She was admitted to our hospital for epigastric pain, nausea, and severe acute anemia (hemoglobin level 4.3 g/dl. Esophagogastroduodenoscopy revealed a narrow stalk-like based, hemorrhagic and uneven protruding lesion in the lesser curvature of the gastric upper corpus. Although the tumor was less than 2 cm in diameter and was probably a benign GIST according to histology, laparoscopy-assisted local resection was needed because the patient had continuous severe anemia and epigastric pain. Histological assessment showed that the elongated spindle-like tumor cells originated from the intrinsic muscle layer, and was shown with growth to the mucosal side, cropping out to the surface in most areas of the protruding lesion. Only a small part of the tumor was within nontumoral gastric mucosa. Most of the tumor cells demonstrated immunoreactivity for KIT and CD34 in the cytoplasm but not for αSMA, S100, and desmin. Mitotic activity (0/50 high power field and the labeling index for MIB-1 (about 1% were low. The GIST of the stomach described in this report was a rare case with a narrow stalk-like based, uneven protruding mass presenting with severe acute anemia despite small size.

  7. Developmental problems and their solution for the Space Shuttle main engine alternate liquid oxygen high-pressure turbopump: Anomaly or failure investigation the key

    Science.gov (United States)

    Ryan, R.; Gross, L. A.

    1995-05-01

    The Space Shuttle main engine (SSME) alternate high-pressure liquid oxygen pump experienced synchronous vibration and ball bearing life problems that were program threatening. The success of the program hinged on the ability to solve these development problems. The design and solutions to these problems are engirded in the lessons learned and experiences from prior programs, technology programs, and the ability to properly conduct failure or anomaly investigations. The failure investigation determines the problem cause and is the basis for recommending design solutions. For a complex problem, a comprehensive solution requires that formal investigation procedures be used, including fault trees, resolution logic, and action items worked through a concurrent engineering-multidiscipline team. The normal tendency to use an intuitive, cut-and-try approach will usually prove to be costly, both in money and time and will reach a less than optimum, poorly understood answer. The SSME alternate high-pressure oxidizer turbopump development has had two complex problems critical to program success: (1) high synchronous vibrations and (2) excessive ball bearing wear. This paper will use these two problems as examples of this formal failure investigation approach. The results of the team's investigation provides insight into the complexity of the turbomachinery technical discipline interacting/sensitivities and the fine balance of competing investigations required to solve problems and guarantee program success. It is very important to the solution process that maximum use be made of the resources that both the contractor and Government can bring to the problem in a supporting and noncompeting way. There is no place for the not-invented-here attitude. The resources include, but are not limited to: (1) specially skilled professionals; (2) supporting technologies; (3) computational codes and capabilities; and (4) test and manufacturing facilities.

  8. Model Verification and Validation Concepts for a Probabilistic Fracture Assessment Model to Predict Cracking of Knife Edge Seals in the Space Shuttle Main Engine High Pressure Oxidizer

    Science.gov (United States)

    Pai, Shantaram S.; Riha, David S.

    2013-01-01

    Physics-based models are routinely used to predict the performance of engineered systems to make decisions such as when to retire system components, how to extend the life of an aging system, or if a new design will be safe or available. Model verification and validation (V&V) is a process to establish credibility in model predictions. Ideally, carefully controlled validation experiments will be designed and performed to validate models or submodels. In reality, time and cost constraints limit experiments and even model development. This paper describes elements of model V&V during the development and application of a probabilistic fracture assessment model to predict cracking in space shuttle main engine high-pressure oxidizer turbopump knife-edge seals. The objective of this effort was to assess the probability of initiating and growing a crack to a specified failure length in specific flight units for different usage and inspection scenarios. The probabilistic fracture assessment model developed in this investigation combined a series of submodels describing the usage, temperature history, flutter tendencies, tooth stresses and numbers of cycles, fatigue cracking, nondestructive inspection, and finally the probability of failure. The analysis accounted for unit-to-unit variations in temperature, flutter limit state, flutter stress magnitude, and fatigue life properties. The investigation focused on the calculation of relative risk rather than absolute risk between the usage scenarios. Verification predictions were first performed for three units with known usage and cracking histories to establish credibility in the model predictions. Then, numerous predictions were performed for an assortment of operating units that had flown recently or that were projected for future flights. Calculations were performed using two NASA-developed software tools: NESSUS(Registered Trademark) for the probabilistic analysis, and NASGRO(Registered Trademark) for the fracture

  9. Main findings

    International Nuclear Information System (INIS)

    2014-01-01

    Licensing regimes vary from country to country. When the license regime involves several regulators and several licenses, this may lead to complex situations. Identifying a leading organisation in charge of overall coordination including preparation of the licensing decision is a useful practice. Also, if a stepwise licensing process is implemented, it is important to fix in legislation decisions and/or time points and to identify the relevant actors. There is considerable experience in civil and mining engineering that can be applied when constructing a deep geological disposal facility. Specific challenges are, however, the minimization of disturbances to the host rock and the understanding of its long-term behavior. Construction activities may affect the geo-hydraulic and geochemical properties of the various system components which are important safety features of the repository system. Clearly defined technical specifications and an effective quality management plan are important in ensuring successful repository implementation which is consistent with safety requirements. Monitoring plan should also be defined in advance. The regulatory organization should prepare itself to the licensing review before construction by allocating sufficient resources. It should increase its competence, e.g., by interacting early with the implementer and through its own R and D. This will allow the regulator to define appropriate technical conditions associated to the construction license and to elaborate a relevant inspection plan of the construction work. After construction, obtaining the operational license is the most important and crucial step. Main challenges include (a) establishing sufficient confidence so that the methods for closing the individual disposal units comply with the safety objectives and (b) addressing the issue of ageing of materials during a 50-100 years operational period. This latter challenge is amplified when reversibility/retrievability is required

  10. The simulation of the alternate turbopump development high pressure oxygen and fuel turbopumps for the space shuttle main engine using the Shaberth computer program

    Science.gov (United States)

    Mcdonald, Gary H.

    1988-01-01

    The Space Shuttle Main Engine (SSME) is basically comprised of a combustion chamber and nozzle, high and low pressure oxygen turbopumps and high and low pressure fuel turbopumps. In the current configuration, the high pressure fuel (HPTFP) and high pressure oxygen turbopumps (HPOTP) have experienced a history of ball bearing wear. The wear problem can be attributed to numerous factors including the hydrodynamic axial and radial loads caused by the flow of liquid oxygen and liquid hydrogen through the turbopump impellers and turbine. Also, friction effects between the rolling elements, races, and cage can create thermally induced bearing geometry changes. To alleviate some of the current configuration problems, an alternate turbopump development (ATD) was proposed. However, the ATD HPOTP and HPTFP are constrained to operate interchangeably with the current turbopumps, thus, the operation conditions must be similar. The ATD configuration features a major change in bearings used to support the integrated shaft, impeller, and turbine system. A single ball and single roller will replace the pump-end and turbine and duplex ball bearings. The Shaft-Bearing-Thermal (SHABERTH) computer code was used to model the ATD HPOTP and ATD HPFTP configurations. A two bearing model was used to simulate the HPOTP and HPFTP bearings and shaft geometry. From SHABERTH, a comparison of bearing reaction loads, frictional heat generation rates, and Hertz contact stresses will be attempted with analysis at the 109 percent and 65 percent power levels.

  11. Main Memory

    NARCIS (Netherlands)

    P.A. Boncz (Peter); L. Liu (Lei); M. Tamer Özsu

    2008-01-01

    htmlabstractPrimary storage, presently known as main memory, is the largest memory directly accessible to the CPU in the prevalent Von Neumann model and stores both data and instructions (program code). The CPU continuously reads instructions stored there and executes them. It is also called Random

  12. Quality assurance in electrical engineering. VDE Regional Group Frankfurt am Main, workshop from November 2-23, 1987. Qualitaetssicherung in der elektrischen Energietechnik. VDE-Bezirksverein Frankfurt am Main, Arbeitsgemeinschaft vom 2. 11. bis 23. 11. 1987

    Energy Technology Data Exchange (ETDEWEB)

    Forst, H J [ed.

    1987-01-01

    Quality assurance measures are explained at the example of an energy distributor. The VDE (German Association of Electrical Engineers) work team addresses the following articles on quality assurance to experts of energy techniques and those interested in this field. In detail, following topics are dealt with: Basic thoughts and principles of quality assurance; Quality assurance done by the producer, shown at the example of a medium-voltage power switch. Quality assurance done by the producer, shown at the example of a low-voltage power switch. Quality assurance done by the producer of electric distributing hands, shown at the example of a medium-voltage distributing band. Quality assurance by the producer of electric distributing boards, shown at the example of a low-voltage board. Quality assurance by means of maintenance measures in the electric system technique of a public utility. Quality assurance of electric systems and operational means of a public utility. Quality assurance by the operator of electric systems, shown at the example of an industrial plant. (HAG).

  13. Main Memory

    OpenAIRE

    Boncz, Peter; Liu, Lei; Özsu, M.

    2008-01-01

    htmlabstractPrimary storage, presently known as main memory, is the largest memory directly accessible to the CPU in the prevalent Von Neumann model and stores both data and instructions (program code). The CPU continuously reads instructions stored there and executes them. It is also called Random Access Memory (RAM), to indicate that load/store instructions can access data at any location at the same cost, is usually implemented using DRAM chips, which are connected to the CPU and other per...

  14. Nitrile/Buna N Material Failure Assessment for an O-Ring used on the Gaseous Hydrogen Flow Control Valve (FCV) of the Space Shuttle Main Engine

    Science.gov (United States)

    Wingard, Doug

    2006-01-01

    After the rollout of Space Shuttle Discovery in April 2005 in preparation for return-to-flight, there was a failure of the Orbiter (OV-103) helium signature leak test in the gaseous hydrogen (GH2) system. Leakage was attributed to the Flow Control Valve (FCV) in Main Engine 3. The FCV determined to be the source of the leak for OV-103 is designated as LV-58. The nitrile/Buna N rubber O-ring seal was removed from LV-58, and failure analysis indicated radial cracks providing leak paths in one quadrant. Cracks were eventually found in 6 of 9 FCV O-rings among the three Shuttle Orbiters, though none were as severe as those for LV-58, OV-103. Testing by EM10 at MSFC on all 9 FCV O- rings included: laser dimensional, Shore A hardness and properties from a dynamic mechanical analyzer (DMA) and an Instron tensile machine. The following test data was obtained on the cracked quadrant of the LV-58, OV-103 O-ring: (1) the estimated compression set was only 9.5%, compared to none for the rest of the O-ring; (2) Shore A hardness for the O.D. was higher by almost 4 durometer points than for the rest of the O-ring; and (3) DMA data showed that the storage/elastic modulus E was almost 25% lower than for the rest of the O-ring. Of the 8 FCV O-rings tested on an Instron, 4 yielded tensile strengths that were below the MIL spec requirement of 1350 psi-a likely influence of rubber cracking. Comparisons were made between values of modulus determined by DNA (elastic) and Instron (Young s). Each nitrile/Buna N O-ring used in the FCV conforms to the MIL-P-25732C specification. A number of such O-rings taken from shelf storage at MSFC and Kennedy Space Center (KSC) were used to generate a reference curve of DMA glass transition temperature (Tg) vs. shelf storage time ranging from 8 to 26 years. A similar reference curve of TGA onset temperature (of rubber weight loss) vs. shelf storage time was also generated. The DMA and TGA data for the used FCV O-rings were compared to the reference

  15. Roles of the Protruding Loop of Factor B Essential for the Localization of Lipoproteins (LolB) in the Anchoring of Bacterial Triacylated Proteins to the Outer Membrane*

    Science.gov (United States)

    Hayashi, Yumi; Tsurumizu, Ryoji; Tsukahara, Jun; Takeda, Kazuki; Narita, Shin-ichiro; Mori, Makiko; Miki, Kunio; Tokuda, Hajime

    2014-01-01

    The Lol system comprising five Lol proteins, LolA through LolE, sorts Escherichia coli lipoproteins to outer membranes. The LolCDE complex, an ATP binding cassette transporter in inner membranes, releases outer membrane-specific lipoproteins in an ATP-dependent manner, causing formation of the LolA-lipoprotein complex in the periplasm. LolA transports lipoproteins through the periplasm to LolB on outer membranes. LolB is itself a lipoprotein anchored to outer membranes, although the membrane anchor is functionally dispensable. LolB then localizes lipoproteins to outer membranes through largely unknown mechanisms. The crystal structure of LolB is similar to that of LolA, and it possesses a hydrophobic cavity that accommodates acyl chains of lipoproteins. To elucidate the molecular function of LolB, a periplasmic version of LolB, mLolB, was mutagenized at various conserved residues. Despite the lack of acyl chains, most defective mutants were insoluble. However, a derivative with glutamate in place of leucine 68 was soluble and unable to localize lipoproteins to outer membranes. This leucine is present in a loop protruding from mLolB into an aqueous environment, and no analogous loop is present in LolA. Thus, leucine 68 was replaced with other residues. Replacement by acidic, but not hydrophobic, residues generated for the first time mLolB derivatives that can accept but cannot localize lipoproteins to outer membranes. Moreover, deletion of the leucine with neighboring residues impaired the lipoprotein receptor activity. Based on these observations, the roles of the protruding loop of LolB in the last step of lipoprotein sorting are discussed. PMID:24569999

  16. Roles of the protruding loop of factor B essential for the localization of lipoproteins (LolB) in the anchoring of bacterial triacylated proteins to the outer membrane.

    Science.gov (United States)

    Hayashi, Yumi; Tsurumizu, Ryoji; Tsukahara, Jun; Takeda, Kazuki; Narita, Shin-ichiro; Mori, Makiko; Miki, Kunio; Tokuda, Hajime

    2014-04-11

    The Lol system comprising five Lol proteins, LolA through LolE, sorts Escherichia coli lipoproteins to outer membranes. The LolCDE complex, an ATP binding cassette transporter in inner membranes, releases outer membrane-specific lipoproteins in an ATP-dependent manner, causing formation of the LolA-lipoprotein complex in the periplasm. LolA transports lipoproteins through the periplasm to LolB on outer membranes. LolB is itself a lipoprotein anchored to outer membranes, although the membrane anchor is functionally dispensable. LolB then localizes lipoproteins to outer membranes through largely unknown mechanisms. The crystal structure of LolB is similar to that of LolA, and it possesses a hydrophobic cavity that accommodates acyl chains of lipoproteins. To elucidate the molecular function of LolB, a periplasmic version of LolB, mLolB, was mutagenized at various conserved residues. Despite the lack of acyl chains, most defective mutants were insoluble. However, a derivative with glutamate in place of leucine 68 was soluble and unable to localize lipoproteins to outer membranes. This leucine is present in a loop protruding from mLolB into an aqueous environment, and no analogous loop is present in LolA. Thus, leucine 68 was replaced with other residues. Replacement by acidic, but not hydrophobic, residues generated for the first time mLolB derivatives that can accept but cannot localize lipoproteins to outer membranes. Moreover, deletion of the leucine with neighboring residues impaired the lipoprotein receptor activity. Based on these observations, the roles of the protruding loop of LolB in the last step of lipoprotein sorting are discussed.

  17. Identification Of Damages Of Tribological Associations In Crankshaft And Piston Systems Of Two-Stroke Internal Combustion Engines Used As Main Propulsion In Sea-Going Vessels And Proposal Of Probabilistic Description Of Loads As Causes Of These Damages

    Directory of Open Access Journals (Sweden)

    Girtler Jerzy

    2015-04-01

    Full Text Available The article discusses damages of essential tribological associations in crankshaft and piston systems of large power two-stroke engines used as main engines, which take place during transport tasks performed by those ships. Difficulties are named which make preventing those damages impossible, despite the fact that the technical state of engines of this type is identified with the aid of complex diagnostic systems making use of advanced computer technology. It is demonstrated that one of causes of the damages is the lack of research activities oriented on recognising random properties of the loads leading to those damages. A proposal is made for the loads acting at a given time t on tribological associations in crankshaft and piston systems of internal combustion engines used as main engines to be considered as random variables Qt. At the same time the loads examined within a given time interval tr ≤ t ≤ tz would be considered stochastic processes {Q(t: t ≥ 0}. Essential properties of the loads of the abovementioned tribological associations are named and explained by formulating hypotheses which need empirical verification. Interval estimation is proposed for estimating the expected value E(Qt of the load Qt acting at time t. A relation is indicated between the mechanical load and the thermal load acting on tribological associations in the ship main engine crankshaft and piston system. A suggestion is formulated that a stochastic form of the relation between these types of load is to be searched for, rather than statistic relation, and a proposal is made to measure the intensity (strength of the stochastic relation using the Czuprow’s convergence coefficient.

  18. What affects the main engine of growth in the European economy? Industrial interconnectedness and differences in performance of business services across the EU25

    OpenAIRE

    Sobolewski, Maciej; Poniatowski, Grzegorz

    2013-01-01

    The main purpose of this study is to determine what are the main factors which stand behind the diversity in performance of business services measured by their contribution to growth in the EU Member States. We show that in addition to typical growth factors which enhance labour productivity, also the extent of interconnectedness of business services with upstream industries is important to explain service-based economic growth. The analysis yields two interesting results. Firstly, the author...

  19. Features of Load and Wear of Main Propulsion Devices on Sea-Going Ships with Piston Combustion Engines and Their Impact on Changes in Technical States of the Systems

    Directory of Open Access Journals (Sweden)

    Girtler Jerzy

    2017-12-01

    Full Text Available The paper presents the specificity of operation of propulsion systems of seagoing ships which causes the need to control the load on them, especially on their engines called main engines. The characteristics of the load on the propulsion systems, especially on the main engines as well as on the shaft lines and propellers driven by the engines, along with the process of wear in tribological joints (sliding tribological systems of the machines have been described herein. Using examples of typical types of wear (both linear and volumetric for the tribological systems of this sort, interpretation of states of their wear has been provided with regards to the wear levels defined as acceptable, unacceptable and catastrophic. The following hypotheses have been formulated: 1 hypothesis explaining necessity to consider the loads on the systems under operation as stochastic processes; 2 hypothesis explaining a possibility of considering the processes as stationary; and 3 hypothesis explaining why it can be assumed that a given technical state of any tribological system can be considered as dependent only on the directly preceding state and stochastically independent of the states that existed earlier. Accepting the hypotheses as true, a four-state continuous-time semi-Markov process has been proposed in the form of a model of changes in condition of a propulsion system (PS of any ship. The model includes the most significant states affecting safety of a ship at sea, such as: s0 - PS ability state, s1 - PS disability state due to damage to the main engine (ME, s2 - PS disability state due to damage to the shaft line (SL and s3 - PS disability state due to damage to the propeller (P. Probability of occurrence (changes of the states has also been demonstrated.

  20. Engineering design on main mechanism of a high throughput vol-oxidizer for decladding and vol-oxidation of rod-cuts

    International Nuclear Information System (INIS)

    Kim, Y. H.; Park, B. S.; Jung, J. H.; Yoon, J. S.; Kim, H. D.; Hwang, J. S.; Yoon, K. H.

    2008-01-01

    In this paper, we designed the main mechanisms for a high throughput device for the rod-cuts of a spent fuel. To design the main mechanisms, we evaluated the current mechanical (slitting, ball mill, roller straightening) and chemical methods (muffle furnace, rotary kiln). As a result, the methods for a ball drop and a rotary drum as concepts were selected at the analysis step. For an enhancement of the oxidation rate, we devised blades for the reactor as a mesh type. Also, for an enhancement of the decladding rate, we designed the ball size and the rotation of the reactor as a mesh type and devised a vacuum system for the fission products. We also designed the main mechanisms devices and tested the capacity of these devices. Mechanisms for the oxidation and recovery can simultaneously handle the rod-cuts of a spent fuel and provide an independent recovery. The results of the mechanisms designs can be used for a scale-up of a high throughput device

  1. The main directions in technology investigation of soid oxide fuel cell in Russian Federal Research Center Institute of Physics & Power Engineering (IPPE)

    Energy Technology Data Exchange (ETDEWEB)

    Ievleva, J.I.; Kolesnikov, V.P.; Mezhertisky, G.S. [and others

    1996-04-01

    The main direction of science investigations for creation of efficient solid oxide fuel cells (SOFC) in IPPE are considered in this work. The development program of planar SOFC with thin-film electrolyte is shown. General design schemes of experimental SOFC units are presented. The flow design schemes of processes for initial materials and electrodes fabrication are shown. The results of investigations for creation thin-film solid oxide electrolyte at porous cathode by magnetron sputtering from complex metal target in oxidative environment are presented.

  2. A Step by Step Approach for Evaluating the Reliability of the Main Engine Lube Oil System for a Ship's Propulsion System

    Directory of Open Access Journals (Sweden)

    Mohan Anantharaman

    2014-09-01

    Full Text Available Effective and efficient maintenance is essential to ensure reliability of a ship's main propulsion system, which in turn is interdependent on the reliability of a number of associated sub- systems. A primary step in evaluating the reliability of the ship's propulsion system will be to evaluate the reliability of each of the sub- system. This paper discusses the methodology adopted to quantify reliability of one of the vital sub-system viz. the lubricating oil system, and development of a model, based on Markov analysis thereof. Having developed the model, means to improve reliability of the system should be considered. The cost of the incremental reliability should be measured to evaluate cost benefits. A maintenance plan can then be devised to achieve the higher level of reliability. Similar approach could be considered to evaluate the reliability of all other sub-systems. This will finally lead to development of a model to evaluate and improve the reliability of the main propulsion system.

  3. Circuit engineering principles for construction of bipolar large-scale integrated circuit storage devices and very large-scale main memory

    Science.gov (United States)

    Neklyudov, A. A.; Savenkov, V. N.; Sergeyez, A. G.

    1984-06-01

    Memories are improved by increasing speed or the memory volume on a single chip. The most effective means for increasing speeds in bipolar memories are current control circuits with the lowest extraction times for a specific power consumption (1/4 pJ/bit). The control current circuitry involves multistage current switches and circuits accelerating transient processes in storage elements and links. Circuit principles for the design of bipolar memories with maximum speeds for an assigned minimum of circuit topology are analyzed. Two main classes of storage with current control are considered: the ECL type and super-integrated injection type storage with data capacities of N = 1/4 and N 4/16, respectively. The circuits reduce logic voltage differentials and the volumes of lexical and discharge buses and control circuit buses. The limiting speed is determined by the antiinterference requirements of the memory in storage and extraction modes.

  4. The main features of electrical stimulation of biological tissues by implant electrodes: study from engineering perspective and equipment development to produce

    International Nuclear Information System (INIS)

    Suarez Bagnasco, D.; Alvarez Alonso, J.; Suarez Antola, R.

    2004-08-01

    The main features of electrical stimulation of biological tissues by implant electrodes are studied.These electrodes are applied in neural prostheses and cardiac pacing.Threshold phenomena are stressed and some aspects related with implant electrode design are discussed. A fairly through theoretical research about the optimal pulse shape for electrical stimulation of biological tissues is done.The excitation functional is introduced as a criterium to identify threshold pulses of electric current. We obtain the optimal pulse shapes that minimize the energy dissipated in tissues, or the energy taken by the load seen by the pulse generator, amongst other criteria.We show how these pulse shapes can be determined from experimentally measured strength-duration (S-D) curves using rectangular pulses of current. The development of a prototype of a new equipment is described.The equipment may be used to measure S-D curves and with this information it is able to syntetize the abovementioned optimal pulse shapes. The top-down design process is presented, involving both hardware and software.The construction and assembling of the prototype, as well as the implementation of software are described.Some testing and measures with the prototype, including test with biological tissues are described and assessed

  5. Main Propulsion Test Article (MPTA)

    Science.gov (United States)

    Snoddy, Cynthia

    2010-01-01

    Scope: The Main Propulsion Test Article integrated the main propulsion subsystem with the clustered Space Shuttle Main Engines, the External Tank and associated GSE. The test program consisted of cryogenic tanking tests and short- and long duration static firings including gimbaling and throttling. The test program was conducted on the S1-C test stand (Position B-2) at the National Space Technology Laboratories (NSTL)/Stennis Space Center. 3 tanking tests and 20 hot fire tests conducted between December 21 1 1977 and December 17, 1980 Configuration: The main propulsion test article consisted of the three space shuttle main engines, flightweight external tank, flightweight aft fuselage, interface section and a boilerplate mid/fwd fuselage truss structure.

  6. Internet Search Engines

    OpenAIRE

    Fatmaa El Zahraa Mohamed Abdou

    2004-01-01

    A general study about the internet search engines, the study deals main 7 points; the differance between search engines and search directories, components of search engines, the percentage of sites covered by search engines, cataloging of sites, the needed time for sites appearance in search engines, search capabilities, and types of search engines.

  7. Air Force Civil Engineer, Volume 9, Number 2, Summer 2001

    Science.gov (United States)

    2001-01-01

    and massive concrete slabs with protruding steel segments were partially hidden by an overgrowth of vegetation . The three-story structure, which was...terms of the job you get afterward. Capt Bill Kale came to AFIT from Lajes Field, Azores, where he was the base architect with the 65th CES. Q. Why did...meet Air Force civil engineer needs. Speaking of AFIT � Capt Manuel Fernandez Capt Bill Kale Capt Laurie Richter Interviews with current and former

  8. Food Engineering

    NARCIS (Netherlands)

    Boom, R.M.; Janssen, A.E.M.

    2014-01-01

    Food engineering is a rapidly changing discipline. Traditionally, the main focus was on food preservation and stabilization, whereas trends now are on diversity, health, taste, and sustainable production. Next to a general introduction of the definition of food engineering, this article gives a

  9. Main Memory DBMS

    NARCIS (Netherlands)

    P.A. Boncz (Peter); L. Liu (Lei); M. Tamer Özsu

    2008-01-01

    htmlabstractA main memory database system is a DBMS that primarily relies on main memory for computer data storage. In contrast, normal database management systems employ hard disk based persisntent storage.

  10. The anti-tumor efficacy of 3C23K, a glyco-engineered humanized anti-MISRII antibody, in an ovarian cancer model is mainly mediated by engagement of immune effector cells.

    Science.gov (United States)

    Estupina, Pauline; Fontayne, Alexandre; Barret, Jean-Marc; Kersual, Nathalie; Dubreuil, Olivier; Le Blay, Marion; Pichard, Alexandre; Jarlier, Marta; Pugnière, Martine; Chauvin, Maëva; Chardès, Thierry; Pouget, Jean-Pierre; Deshayes, Emmanuel; Rossignol, Alexis; Abache, Toufik; de Romeuf, Christophe; Terrier, Aurélie; Verhaeghe, Lucie; Gaucher, Christine; Prost, Jean-François; Pèlegrin, André; Navarro-Teulon, Isabelle

    2017-06-06

    Ovarian cancer is the leading cause of death in women with gynecological cancers and despite recent advances, new and more efficient therapies are crucially needed. Müllerian Inhibiting Substance type II Receptor (MISRII, also named AMHRII) is expressed in most ovarian cancer subtypes and is a novel potential target for ovarian cancer immunotherapy. We previously developed and tested 12G4, the first murine monoclonal antibody (MAb) against human MISRII. Here, we report the humanization, affinity maturation and glyco-engineering steps of 12G4 to generate the Fc-optimized 3C23K MAb, and the evaluation of its in vivo anti-tumor activity. The epitopes of 3C23K and 12G4 were strictly identical and 3C23K affinity for MISRII was enhanced by a factor of about 14 (KD = 5.5 × 10-11 M vs 7.9 × 10-10 M), while the use of the EMABling® platform allowed the production of a low-fucosylated 3C23K antibody with a 30-fold KD improvement of its affinity to FcγRIIIa. In COV434-MISRII tumor-bearing mice, 3C23K reduced tumor growth more efficiently than 12G4 and its combination with carboplatin was more efficient than each monotherapy with a mean tumor size of 500, 1100 and 100 mm3 at the end of treatment with 3C23K (10 mg/kg, Q3-4D12), carboplatin (60 mg/kg, Q7D4) and 3C23K+carboplatin, respectively. Conversely, 3C23K-FcKO, a 3C23K form without affinity for the FcγRIIIa receptor, did not display any anti-tumor effect in vivo. These results strongly suggested that 3C23K mechanisms of action are mainly Fc-related. In vitro, antibody-dependent cytotoxicity (ADCC) and antibody-dependent cell phagocytosis (ADCP) were induced by 3C23K, as demonstrated with human effector cells. Using human NK cells, 50% of the maximal lysis was obtained with a 46-fold lower concentration of low-fucosylated 3C23K (2.9 ng/ml) than of 3C23K expressed in CHO cells (133.35 ng/ml). As 3C23K induced strong ADCC with human PBMC but almost none with murine PBMC, antibody-dependent cell phagocytosis (ADCP) was

  11. Safety-engineering concepts for process control in the chemical industry and in power plants. VDE Regional Association of Frankfurt/Main, VDI Regional Association of Frankfurt/Main-Darmstadt, Study Group meeting from March 9-30, 1987. Sicherheitskonzepte der Prozessleittechnik in verfahrenstechnischen Anlagen und in Kraftwerken. VDE-Bezirksverein Frankfurt am Main, VDI-Bezirksverein Frankfurt a. M. -Darmstadt Arbeitsgemeinschaft vom 9. 3. bis 30. 3. 1987

    Energy Technology Data Exchange (ETDEWEB)

    Forst, H J [ed.

    1987-01-01

    Process instrumentation and control is a task relying to a very large extent on on-line process control systems for continuous monitoring and control. Stored-program control systems are one of the smaller systems available for process measuring and control, and are currently used for enhancing the safety of chemical plants and power plants, particularly nuclear power plants. The contributions in this book deal with basic safety engineering concepts and with methods for early detection of faults or critical states of a plant or system. (DG).

  12. Maine's Employability Skills Program

    Science.gov (United States)

    McMahon, John M.; Wolffe, Karen E.; Wolfe, Judy; Brooker, Carrie

    2013-01-01

    This Practice Report describes the development and implementation of the "Maine Employability Skills Program," a model employment program developed by the Maine Division for the Blind and Visually Impaired (DBVI). The program was designed to support the efforts of the chronically unemployed or underemployed. These consumers were either…

  13. Geoenvironmental engineering

    International Nuclear Information System (INIS)

    Shin, Eun Cheol; Park, Jeong Jun

    2009-08-01

    This book deals with definition of soil and scope of clean-up of soil, trend of geoenvironmental engineering at home and foreign countries, main concern of geoenvironmental engineering in domestic and abroad, design and building of landfills such as summary, trend of landfill policy in Korea, post management of landfill facilities, stabilizing and stability of landfill, research method and soil pollution source, restoration technology of soil pollution like restoration technique of oil pollution with thermal processing.

  14. Maine highway safety plan

    Science.gov (United States)

    2010-01-01

    Each September 1, the MeBHS must provide NHTSA a comprehensive plan to reduce : traffic crashes and resulting deaths, injuries and property damage. The Highway Safety : Plan (HSP) serves as Maines application for available federal funds for these ...

  15. Maine Field Station

    Data.gov (United States)

    Federal Laboratory Consortium — In 2000 NOAA's National Marine Fisheries Service established the Maine Field Station in Orono, ME to have more direct involvement in the conservation of the living...

  16. Maine's forests 2008

    Science.gov (United States)

    George L. McCaskill; William H. McWilliams; Charles J. Barnett; Brett J. Butler; Mark A. Hatfield; Cassandra M. Kurtz; Randall S. Morin; W. Keith Moser; Charles H. Perry; Christopher W. Woodall

    2011-01-01

    The second annual inventory of Maine's forests was completed in 2008 after more than 3,160 forested plots were measured. Forest land occupies almost 17.7 million acres, which represents 82 percent of the total land area of Maine. The dominant forest-type groups are maple/beech/yellow birch, spruce/fir, white/red/jack pine, and aspen/white birch. Statewide volume...

  17. Maine Forests 2013

    Science.gov (United States)

    George L. McCaskill; Thomas Albright; Charles J. Barnett; Brett J. Butler; Susan J. Crocker; Cassandra M. Kurtz; William H. McWilliams; Patrick D. Miles; Randall S. Morin; Mark D. Nelson; Richard H. Widmann; Christopher W. Woodall

    2016-01-01

    The third 5-year annualized inventory of Maine's forests was completed in 2013 after more than 3170 forested plots were measured. Maine contains more than 17.6 million acres of forest land, an area that has been quite stable since 1960, covering more than 82 percent of the total land area. The number of live trees greater than 1 inch in diameter are approaching 24...

  18. The main requirements for research work against the challenges of "Industry - 4.0" and the analysis of ongoing work in improving the state of the material and technical base and improving the level of training of young engineers

    Directory of Open Access Journals (Sweden)

    Р. С. Турманидзе

    2017-12-01

    Full Text Available The work analyzes theoretical and practical results obtained after each of the first three world scientific - technical revolution, appreciated their role in the development of humanity, and improve the level of industry in different sectors of the economy. More discussed in detail situation on the threshold of the fourth scientific - technical revolution "industry-4". It is proved crucial in accelerating these processes, the level of training of young engineering staff and suggestions, some ideas and solutions to these problems on the example of the Georgian Technical University.

  19. Main sequence mass loss

    International Nuclear Information System (INIS)

    Brunish, W.M.; Guzik, J.A.; Willson, L.A.; Bowen, G.

    1987-01-01

    It has been hypothesized that variable stars may experience mass loss, driven, at least in part, by oscillations. The class of stars we are discussing here are the δ Scuti variables. These are variable stars with masses between about 1.2 and 2.25 M/sub θ/, lying on or very near the main sequence. According to this theory, high rotation rates enhance the rate of mass loss, so main sequence stars born in this mass range would have a range of mass loss rates, depending on their initial rotation velocity and the amplitude of the oscillations. The stars would evolve rapidly down the main sequence until (at about 1.25 M/sub θ/) a surface convection zone began to form. The presence of this convective region would slow the rotation, perhaps allowing magnetic braking to occur, and thus sharply reduce the mass loss rate. 7 refs

  20. FERMILAB: Main Injector

    International Nuclear Information System (INIS)

    Anon.

    1993-01-01

    The Fermilab Main Injector (FMI) project is the centerpiece of the Laboratory's Fermilab III programme for the 1990s. Designed to support a luminosity of at least 5x10 31 cm -2 s -1 in the Tevatron collider, it will also provide new capabilities for rare neutral kaon decay and neutrino oscillation studies. The Fermilab Main Injector 8-150 GeV synchrotron is designed to replace the existing Main Ring which seriously limits beam intensities for the Tevatron and the antiproton production target. The project has passed several significant milestones and is now proceeding rapidly towards construction. The project received a $11.65M appropriation in 1992 and has been given $15M for the current fiscal year. Through the Energy Systems Acquisition Advisory Board (ESAAB) process, the US Department of Energy (DoE) has authorized funds for construction of the underground enclosure and service building where the Main Injector will touch the Tevatron, and to the preparation of bids for remaining project construction

  1. FERMILAB: Main Injector

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1993-06-15

    The Fermilab Main Injector (FMI) project is the centerpiece of the Laboratory's Fermilab III programme for the 1990s. Designed to support a luminosity of at least 5x10{sup 31} cm{sup -2} s{sup -1} in the Tevatron collider, it will also provide new capabilities for rare neutral kaon decay and neutrino oscillation studies. The Fermilab Main Injector 8-150 GeV synchrotron is designed to replace the existing Main Ring which seriously limits beam intensities for the Tevatron and the antiproton production target. The project has passed several significant milestones and is now proceeding rapidly towards construction. The project received a $11.65M appropriation in 1992 and has been given $15M for the current fiscal year. Through the Energy Systems Acquisition Advisory Board (ESAAB) process, the US Department of Energy (DoE) has authorized funds for construction of the underground enclosure and service building where the Main Injector will touch the Tevatron, and to the preparation of bids for remaining project construction.

  2. Main facts 1995

    International Nuclear Information System (INIS)

    1996-01-01

    This report presents the main facts of the studies carried out by the Direction des Etudes et Recherches (DER) of Electricite de France: new applications of electricity, classical and nuclear thermal power plants, electrical equipment, environment protection, monitoring and plants operations

  3. Main designations and attributions

    International Nuclear Information System (INIS)

    2010-01-01

    The chapter presents the main designations and attributions of the LNMRI - Brazilian National Laboratory of Metrology of Ionizing Radiation, the Cooperative Center in Radiation Protection and Medical Preparations for Accidents with Radiation; the Treaty for fully banning of nuclear tests and the Regional Center for Training of IAEA

  4. Maine Bouguer Gravity Grid

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — A 2 kilometer Bouguer anomaly grid for the state of Maine. Number of columns is 197 and number of rows is 292. The order of the data is from the lower left to the...

  5. Main facts 1993

    International Nuclear Information System (INIS)

    1994-01-01

    This report presents the main facts of the studies carried out by the Direction des Etudes et Recherches (DER) of Electricite de France: new applications of electricity, classical and nuclear thermal power plants, electrical equipment, environment protection, network analysis, information and informatic equipment

  6. Space Shuttle Main Propulsion System Anomaly Detection: A Case Study

    Data.gov (United States)

    National Aeronautics and Space Administration — The space shuttle main engine (SSME) is part of the Main Propnlsion System (MPS) which is an extremely complex system containing several sub-systems and components,...

  7. Technology Insertion-Engineering Services Process Characterization. Task Order No. 1. Book 2 of 5. Database Documentation Book. OO-ALC MANPRA (C5 Main Landing Gear - WCD’S)

    Science.gov (United States)

    1989-12-15

    ORDER NO. 1 BOOK 2 OF 5 DATABASE DOCUMENTATION BOOK 00-ALC MANPRA *(C5 MAIN LANDING GEAR- WCD’S) CONTRACT SUMMARY REPORT , 15 DECEMBER 1989 ’.1 - CONTRACT...ORIQ 1 . T A 1~4 M E* X C I" El 1 -:11 E:XCE:EI:IIE:U RE:CORI’ RFiS CvAUiS FOREXE IN REWORK LI[MITS Ill FINAL DESTINATION 22. COOROINATION/INITIATING MCC

  8. Renovating the Main Building

    CERN Multimedia

    CERN Bulletin

    2010-01-01

    CERN's "Main Building" is exactly that. The Organization's central hub, with hundreds of staff and visitors passing through its doors every day, will soon be getting a well-earned facelift. Refurbishment work will proceed in phases, starting with the Salle des Pas Perdus, the concourse between the Council Chamber and the Main Auditorium. By the end of August, informal seating areas will be installed, electronic display panels will provide practical information and improved sound insulation will enhance conditions in the auditoria and surrounding meeting rooms.   In light green the area that will undergo the facelift. Work will start in July. The ground floor is home to the entrance to Restaurant No. 1, the bank, the post office, the travel agent, the Users Office, the Staff Association, the notice boards etc. Step up to the first floor to access CERN's largest lecture theatre, the Council Chamber and its "Pas Perdus" lobby. Everyone who works at or visits CERN i...

  9. Fermilab Main Injector plan

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1990-07-15

    The Fermilab Main Injector is the centrepiece of the 'Fermilab III' scheme to significantly upgrade the Laboratory's existing accelerator complex. The new accelerator is designed to provide increased particle beam levels to boost the collision rate in the Tevatron proton-antiproton collider (luminosity in excess of 5 x 10{sup 31} per sq cm per s) and, if approved, would provide increased flexibility in all areas of high energy physics research.

  10. Fermilab Main Injector plan

    International Nuclear Information System (INIS)

    Anon.

    1990-01-01

    The Fermilab Main Injector is the centrepiece of the 'Fermilab III' scheme to significantly upgrade the Laboratory's existing accelerator complex. The new accelerator is designed to provide increased particle beam levels to boost the collision rate in the Tevatron proton-antiproton collider (luminosity in excess of 5 x 10 31 per sq cm per s) and, if approved, would provide increased flexibility in all areas of high energy physics research

  11. Maine coast winds

    Energy Technology Data Exchange (ETDEWEB)

    Avery, Richard

    2000-01-28

    The Maine Coast Winds Project was proposed for four possible turbine locations. Significant progress has been made at the prime location, with a lease-power purchase contract for ten years for the installation of turbine equipment having been obtained. Most of the site planning and permitting have been completed. It is expect that the turbine will be installed in early May. The other three locations are less suitable for the project, and new locations are being considered.

  12. Project evaluation: main characteristics

    OpenAIRE

    Moutinho, Nuno

    2010-01-01

    — The evaluation process of real investment projects must consider not only the traditional financial approach, but also non-financial aspects. Non financial analysis can provide additional relevant information about projects. We investigate financial and non-financial areas most relevant in project appraisal. We present main critical success factors and areas of analysis that lead to the perception of project success. Finally, companies are segmented to verify its financial and non-financial...

  13. Marketing Maine Tablestock Potatoes

    OpenAIRE

    Berney, Gerald; Grajewski, Gregory; Hinman, Don; Prater, Marvin E.; Taylor, April

    2010-01-01

    The Marketing Services Division of USDA’s Agricultural Marketing Service (AMS) was asked by USDA’s Agricultural Research Service (ARS) National Program Leader and ARS’s New England Soil and Water Research Laboratory personnel to help with existing efforts to assist Maine fresh potato farmers in their search for alternative marketing strategies, and reverse the recent decline in the profitability of their operations. ARS researchers previously had conducted an exhaustive study defining possibl...

  14. Water Hammer in Pumped Sewer Mains

    DEFF Research Database (Denmark)

    Larsen, Torben

    This publication is intended for engineers seeking an introduction to the problem of water hammer in pumped pressure mains. This is a subject of increasing interest because of the development of larger and more integrated sewer systems. Consideration of water hammer is essential for structural...

  15. Summary of main points

    International Nuclear Information System (INIS)

    2006-01-01

    In conjunction with its 6. annual meeting, the WPDD in close co-operation with the FSC held a Topical session on 'Stakeholder Involvement in Decommissioning' on November 14, 2005. The session was attended by 36 participants totally representing 14 NEA member countries and 2 international organisations. Two keynote addresses were given at the Topical Session. The first one treated of what is needed for robust decisions and how to bring all stakeholders into the debate. In the second keynote address a summary was made on what have been said on stakeholder involvement in decommissioning during earlier meetings of the WPDD. The main part of the session was then devoted to views from different stakeholders regarding their role and their involvement. This part contained viewpoints from local communities (Kaevlinge in Sweden and Port Hope in Canada), authorities (Scottish Executive and CSNC) and operators (EDF from France and EWN from Germany). Case studies from the decommissioning of Dounrey in the UK and from Trojan and Main Yankee in the USA were presented in the end part of the Topical session followed by a summary and lessons learnt report by the Rapporteur. A detailed programme of the Topical session can be seen in Appendix 1

  16. TRIGA reactor main systems

    International Nuclear Information System (INIS)

    Boeck, H.; Villa, M.

    2007-01-01

    This module describes the main systems of low power (<2 MW) and higher power (≥2 MW) TRIGA reactors. The most significant difference between the two is that forced reactor cooling and an emergency core cooling system are generally required for the higher power TRIGA reactors. However, those TRIGA reactors that are designed to be operated above 3 MW also use a TRIGA fuel that is specifically designed for those higher power outputs (3 to 14 MW). Typical values are given for the respective systems although each TRIGA facility will have unique characteristics that may only be determined by the experienced facility operators. Due to the inherent wide scope of these research reactor facilities construction and missions, this training module covers those systems found at most operating TRIGA reactor facilities but may also discuss non-standard equipment that was found to be operationally useful although not necessarily required. (author)

  17. Software engineering

    CERN Document Server

    Thorin, Marc

    1985-01-01

    Software Engineering describes the conceptual bases as well as the main methods and rules on computer programming. This book presents software engineering as a coherent and logically built synthesis and makes it possible to properly carry out an application of small or medium difficulty that can later be developed and adapted to more complex cases. This text is comprised of six chapters and begins by introducing the reader to the fundamental notions of entities, actions, and programming. The next two chapters elaborate on the concepts of information and consistency domains and show that a proc

  18. Myanmar Language Search Engine

    OpenAIRE

    Pann Yu Mon; Yoshiki Mikami

    2011-01-01

    With the enormous growth of the World Wide Web, search engines play a critical role in retrieving information from the borderless Web. Although many search engines are available for the major languages, but they are not much proficient for the less computerized languages including Myanmar. The main reason is that those search engines are not considering the specific features of those languages. A search engine which capable of searching the Web documents written in those languages is highly n...

  19. Challenges of the ILC Main Linac

    International Nuclear Information System (INIS)

    Ross, Marc

    2007-01-01

    With the completion of the ILC Reference Design Report (RDR), we begin the next phase of the project - development of the Engineering Design. Our strategy and priorities come from the identification, contained in the RDR, of scientific and engineering challenges of the ILC. First among these is the cost of the main linac which, including the associated earthworks and cooling/power systems, amounts to 60% of the ILC total cost. Next is the challenge to reach the highest practical gradient since this R and D has the largest cost leverage of any of the ongoing programs. Finally, we have to understand the beam dynamics and beam tuning processes in the main linac, as we will not have the opportunity to do full (or even large) scale tests of these before the linac is constructed.

  20. Engineering Encounters: Engineering Adaptations

    Science.gov (United States)

    Gatling, Anne; Vaughn, Meredith Houle

    2015-01-01

    Engineering is not a subject that has historically been taught in elementary schools, but with the emphasis on engineering in the "Next Generation Science Standards," curricula are being developed to explicitly teach engineering content and design. However, many of the scientific investigations already conducted with students have…

  1. Da "Search engines" a "Shop engines"

    OpenAIRE

    Lupi, Mauro

    2001-01-01

    The change occuring related to “search engines” is going towards e-commerce, transforming all the main search engines into information and commercial suggestion conveying means, basing their businnes on this activity. In a next future we will find two main series of search engines: from one side, the portals that will offer a general orientation guide being convoying means for services and to-buy products; from the other side, vertical portals able to offer information and products on specifi...

  2. Total Quality Management in Space Shuttle Main Engine manufacturing

    Science.gov (United States)

    Ding, J.

    1992-01-01

    The Total Quality Management (TQM) philosophy developed in the Marshall Space Flight Center (MSFC) is briefly reviewed and the ongoing TQM implementation effort which is being pursued through the continuous improvement (CI) process is discussed. TQM is based on organizational excellence which integrates the new supportive culture with the technical tools necessary to identify, assess, and correct manufacturing processes. Particular attention is given to the prime contractor's change to the organizational excellence management philosophy in SSME manufacturing facilities.

  3. Diesel Engine Tribology

    DEFF Research Database (Denmark)

    Christiansen, Christian Kim

    Recent years have seen an increase in the wear rate of engine bearings, subsequently followed by bearing failure, for the large two-stroke diesel engines used for ship propulsion. Here, the engine bearings include main, big end and crosshead bearings, with the bearing type used being the journal...... bearing, belonging to the class of ‘hydrodynamic bearings’. This implies that the load carrying capacity is generated by a relative movement of the involved components, i.e. avelocity-driven operation. For the engine application, the velocity stems from the engine RPM. However, to comply with the latest...

  4. Engineering Encounters: Reverse Engineering

    Science.gov (United States)

    McGowan, Veronica Cassone; Ventura, Marcia; Bell, Philip

    2017-01-01

    This column presents ideas and techniques to enhance your science teaching. This month's issue shares information on how students' everyday experiences can support science learning through engineering design. In this article, the authors outline a reverse-engineering model of instruction and describe one example of how it looked in our fifth-grade…

  5. Electron microscopy for Engineers

    International Nuclear Information System (INIS)

    Jones, I P

    2009-01-01

    This paper reviews the application of (mainly) Transmission Electron Microscopy (TEM) in an engineering context. The first two sections are TEM and chemical in nature; the final three sections are more general and include aspects of Scanning Electron Microscopy (SEM).

  6. Diesel Engine Technician

    Science.gov (United States)

    Tech Directions, 2010

    2010-01-01

    Diesel engine technicians maintain and repair the engines that power transportation equipment such as heavy trucks, trains, buses, and locomotives. Some technicians work mainly on farm machines, ships, compressors, and pumps. Others work mostly on construction equipment such as cranes, power shovels, bulldozers, and paving machines. This article…

  7. Civil engineering work

    International Nuclear Information System (INIS)

    Cousyn, Rene; Goubin, Jean.

    1977-01-01

    Although it does not require a specifically new technicality, the Civil Engineering site of a nuclear power plant is a complex work. Considering as an example the power plant currently in construction at Tricastin, the authors describe the main Civil Engineering work and task organization applied to carry it out [fr

  8. Emerging Engine Control Technologies

    DEFF Research Database (Denmark)

    Hendricks, Elbert; Chevalier, Alain

    1996-01-01

    In earlier work published by the author and co-authors, a dynamic model called a Mean Value Engine Model (MVEM) was developed. This model is physically based and is intended mainly for control applications. It is especially well suited to embedded model applications in engine controllers, susch...

  9. Radiation engineering formation begin

    International Nuclear Information System (INIS)

    Nechaev, A.F.; Starykh, V.B.; Yanovskaya, N.S.

    1993-01-01

    The main problems of the military-industrial complex and atomic industry conversion and the ways for their realization are discussed. Development of radiation engineering is considered as one of trends of atomic industry conversion. Rates of radiation engineering development are assumed to be determined by commercial but not governmental structures. 9 refs

  10. Additively Manufactured Main Fuel Valve Housing

    Science.gov (United States)

    Eddleman, David; Richard, Jim

    2015-01-01

    Selective Laser Melting (SLM) was utilized to fabricate a liquid hydrogen valve housing typical of those found in rocket engines and main propulsion systems. The SLM process allowed for a valve geometry that would be difficult, if not impossible to fabricate by traditional means. Several valve bodies were built by different SLM suppliers and assembled with valve internals. The assemblies were then tested with liquid nitrogen and operated as desired. One unit was also burst tested and sectioned for materials analysis. The design, test results, and planned testing are presented herein.

  11. Water Hammer in Pumped Sewer Mains

    DEFF Research Database (Denmark)

    Larsen, Torben

    of transients in pumped pipeline systems. This present publication can be understood as the second and revised edition of the pamphlet ”Transients in pumped sewer mains” (2006) which was published as a technical report by The EVA committee under The Danish Water Pollution Committee (The Danish Society......This publication is intended for students and engineers seeking an introduction to the problem of water transients in pumped sewer and water mains. This is a subject of increasing interest because of the development of larger and more integrated systems. Consideration of transients is essential...

  12. Diagnosing in building main pipelines

    Energy Technology Data Exchange (ETDEWEB)

    Telegin, L.G.; Gorelov, A.S.; Kurepin, B.N.; Orekhov, V.I.; Vasil' yev, G.G.; Yakovlev, Ye. I.

    1984-01-01

    General principles are examined for technical diagnosis in building main pipelines. A technique is presented for diagnosis during construction, as well as diagnosis of the technical state of the pipeline-construction machines and mechanisms. The survey materials could be used to set up construction of main pipelines.

  13. Maine Agricultural Foods. Project SEED.

    Science.gov (United States)

    Beaulieu, Peter; Ossenfort, Pat

    This paper describes an activity-based program that teaches students in grades 4-12 about the importance of Maine agriculture in their lives. Specifically, the goal is to increase student awareness of how the foods they eat are planted, harvested, and processed. The emphasis is on crops grown in Maine such as potatoes, broccoli, peas, blueberries,…

  14. Engineer Ethics

    International Nuclear Information System (INIS)

    Lee, Dae Sik; Kim, Yeong Pil; Kim, Yeong Jin

    2003-03-01

    This book tells of engineer ethics such as basic understanding of engineer ethics with history of engineering as a occupation, definition of engineering and specialized job and engineering, engineer ethics as professional ethics, general principles of ethics and its limitation, ethical theory and application, technique to solve the ethical problems, responsibility, safety and danger, information engineer ethics, biotechnological ethics like artificial insemination, life reproduction, gene therapy and environmental ethics.

  15. Mechanical engineers data handbook

    CERN Document Server

    Carvill, James

    1994-01-01

    This text provides the student and professional mechanical engineer with a reference text of an essentially practical nature. It is uncluttered by text, and extensive use of illustrations and tables provide quick and clear access to information. It alsoincludes examples of detailed calculations on many of the applications of technology used by mechanical and production engineers, draughtsmen and engineering designers.Although mainly intended for those studying and practising mechanical engineering, a glance at the contents will show that it is also useful to those in related br

  16. Left main percutaneous coronary intervention.

    Science.gov (United States)

    Teirstein, Paul S; Price, Matthew J

    2012-10-23

    The introduction of drug-eluting stents and advances in catheter techniques have led to increasing acceptance of percutaneous coronary intervention (PCI) as a viable alternative to coronary artery bypass graft (CABG) for unprotected left main disease. Current guidelines state that it is reasonable to consider unprotected left main PCI in patients with low to intermediate anatomic complexity who are at increased surgical risk. Data from randomized trials involving patients who are candidates for either treatment strategy provide novel insight into the relative safety and efficacy of PCI for this lesion subset. Herein, we review the current data comparing PCI with CABG for left main disease, summarize recent guideline recommendations, and provide an update on technical considerations that may optimize clinical outcomes in left main PCI. Copyright © 2012 American College of Cardiology Foundation. Published by Elsevier Inc. All rights reserved.

  17. Main: FEB3 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available nt to sterilization and rinsing - One of the main components of biofilms is polysaccharides - Some pit-formi...ng bacteria such as Sphingomonas species A1 possess superchannels that directly incorporate and decompose polysaccharides - Detai...e entrance of the superchannel have been elucidated - We have obtained the crystals of ABC importer complexe...of water pipes and dental plaque are examples of biofilms. One of the main components of biofilms is polysac

  18. Decontamination of main coolant pumps

    International Nuclear Information System (INIS)

    Roofthooft, R.

    1988-01-01

    Last year a number of main coolant pumps in Belgian nuclear power plants were decontaminated. A new method has been developed to reduce the time taken for decontamination and the volume of waste to be treated. The method comprises two phases: Oxidation with permanganate in nitric acid and dissolution in oxalic acid. The decontamination of main coolant pumps can now be achieved in less than one day. The decontamination factors attained range between 15 and 150. (orig.) [de

  19. Nanotechnology for chemical engineers

    CERN Document Server

    Salaheldeen Elnashaie, Said; Hashemipour Rafsanjani, Hassan

    2015-01-01

    The book describes the basic principles of transforming nano-technology into nano-engineering with a particular focus on chemical engineering fundamentals. This book provides vital information about differences between descriptive technology and quantitative engineering for students as well as working professionals in various fields of nanotechnology. Besides chemical engineering principles, the fundamentals of nanotechnology are also covered along with detailed explanation of several specific nanoscale processes from chemical engineering point of view. This information is presented in form of practical examples and case studies that help the engineers and researchers to integrate the processes which can meet the commercial production. It is worth mentioning here that, the main challenge in nanostructure and nanodevices production is nowadays related to the economic point of view. The uniqueness of this book is a balance between important insights into the synthetic methods of nano-structures and nanomaterial...

  20. New Main Ring control system

    International Nuclear Information System (INIS)

    Seino, K.; Anderson, L.; Ducar, R.; Franck, A.; Gomilar, J.; Hendricks, B.; Smedinghoff, J.

    1990-03-01

    The Fermilab Main Ring control system has been operational for over sixteen years. Aging and obsolescence of the equipment make the maintenance difficult. Since the advent of the Tevatron, considerable upgrades have been made to the controls of all the Fermilab accelerators except the Main Ring. Modernization of the equipment and standardization of the hardware and software have thus become inevitable. The Tevatron CAMAC serial system has been chosen as a basic foundation in order to make the Main Ring control system compatible with the rest of the accelerator complex. New hardware pieces including intelligent CAMAC modules have been designed to satisfy unique requirements. Fiber optic cable and repeaters have been installed in order to accommodate new channel requirements onto the already saturated communication medium system. 8 refs., 2 figs

  1. Problems in event based engine control

    DEFF Research Database (Denmark)

    Hendricks, Elbert; Jensen, Michael; Chevalier, Alain Marie Roger

    1994-01-01

    Physically a four cycle spark ignition engine operates on the basis of four engine processes or events: intake, compression, ignition (or expansion) and exhaust. These events each occupy approximately 180° of crank angle. In conventional engine controllers, it is an accepted practice to sample...... the engine variables synchronously with these events (or submultiples of them). Such engine controllers are often called event-based systems. Unfortunately the main system noise (or disturbance) is also synchronous with the engine events: the engine pumping fluctuations. Since many electronic engine...... problems on accurate air/fuel ratio control of a spark ignition (SI) engine....

  2. Engineering opportunities in nuclear engineering

    International Nuclear Information System (INIS)

    Walton, D.G.

    1980-01-01

    The pattern of education and training of Nuclear Engineers in the UK is outlined under the headings; degree courses for professional engineers, postgraduate courses, education of technician engineers. Universities which offer specific courses are stated and useful addresses listed. (UK)

  3. Ecological Engineering and Civil Engineering works

    NARCIS (Netherlands)

    Van Bohemen, H.D.

    2004-01-01

    This thesis provides a survey of the research results of the relationship between on the one hand the construction, management and maintenance of civil engineering works, and on the other hand the environment, nature and landscape, with the main focus on motorways and coastal protection. The growing

  4. Main: FBB2 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available ion of the c-ring - A subunit packing model of E. coli c-ring has been proposed - The main chain secondary s...tructure of thermophile c-ring has been obtained ATP synthase is a general term for an enzyme that can synth

  5. Main: FEA5 [TP Atlas

    Lifescience Database Archive (English)

    Full Text Available al or an anti-cancer drug, is the main cause of hospital-acquired infection - Dru...e will elucidate the entire structure of the transport machinery in action to understand its functions in detail. FEA5.csml ...

  6. Residential Energy Efficiency Potential: Maine

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, Eric J [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

    2017-11-02

    Energy used by Maine single-family homes that can be saved through cost-effective improvements. Prepared by Eric Wilson and Noel Merket, NREL, and Erin Boyd, U.S. Department of Energy Office of Energy Policy and Systems Analysis.

  7. CENTRE OF THE MAIN INTERESTS

    Directory of Open Access Journals (Sweden)

    DIANA DELEANU

    2013-05-01

    Full Text Available The centre of the main interests of the debtor is a legal tool meant to settle conflicts that can arise between jurisdictions in cross-border insolvencies, based on the principles of mutual recognition and co-operation.

  8. Engineering Institute

    Science.gov (United States)

    Projects Past Projects Publications NSEC » Engineering Institute Engineering Institute Multidisciplinary engineering research that integrates advanced modeling and simulations, novel sensing systems and new home of Engineering Institute Contact Institute Director Charles Farrar (505) 665-0860 Email UCSD EI

  9. ONKALO - Main drawings in 2007

    International Nuclear Information System (INIS)

    2008-05-01

    The first overall site characterisation programme for a Finnish repository of spent nuclear fuel was introduced in 1982. This programme already suggested that the site confirmation for a detailed repository design and safety assessment should include characterisation performed in an underground rock characterisation facility (URCF). This idea was confirmed during the detailed site characterisation. International views have also emphasised the importance of underground characterisation before the final decision to construct the repository is taken. The underground rock characterisation facility (ONKALO) is excavated at Olkiluoto in the municipality of Eurajoki. ONKALO should be constructed to allow characterisation work for site confirmation without jeopardising long-term safety of the repository site. It should also be possible to link ONKALO later to the repository as to a part of it. The construction of ONKALO was started in 2004 and will be completed in 2014. The characterisation work has started in ONKALO and will focus on the disposal depth. In the main drawings stage, ONKALO was described at the level of detail needed for a construction permit in 2003. This meant description of the location, final structures and final systems. This summary report describes the development of design to updated main drawings in 2007 at the same level of detail (no temporary arrangements are described). The main changes are the added exhaust air shaft and advancing the controlled area's inlet air shaft to the ONKALO phase. Also the layout and the depth of the characterisation levels have been updated according to the current bedrock information. Some buildings on the surface will house sets of equipment directly connected with underground facility and this equipment is described in this report. No buildings or other equipment are described in this report, because they are not directly connected with the underground facility. The main element of ONKALO is a system of

  10. A main sequence for quasars

    Science.gov (United States)

    Marziani, Paola; Dultzin, Deborah; Sulentic, Jack W.; Del Olmo, Ascensión; Negrete, C. A.; Martínez-Aldama, Mary L.; D'Onofrio, Mauro; Bon, Edi; Bon, Natasa; Stirpe, Giovanna M.

    2018-03-01

    The last 25 years saw a major step forward in the analysis of optical and UV spectroscopic data of large quasar samples. Multivariate statistical approaches have led to the definition of systematic trends in observational properties that are the basis of physical and dynamical modeling of quasar structure. We discuss the empirical correlates of the so-called “main sequence” associated with the quasar Eigenvector 1, its governing physical parameters and several implications on our view of the quasar structure, as well as some luminosity effects associated with the virialized component of the line emitting regions. We also briefly discuss quasars in a segment of the main sequence that includes the strongest FeII emitters. These sources show a small dispersion around a well-defined Eddington ratio value, a property which makes them potential Eddington standard candles.

  11. A Main Sequence for Quasars

    Directory of Open Access Journals (Sweden)

    Paola Marziani

    2018-03-01

    Full Text Available The last 25 years saw a major step forward in the analysis of optical and UV spectroscopic data of large quasar samples. Multivariate statistical approaches have led to the definition of systematic trends in observational properties that are the basis of physical and dynamical modeling of quasar structure. We discuss the empirical correlates of the so-called “main sequence” associated with the quasar Eigenvector 1, its governing physical parameters and several implications on our view of the quasar structure, as well as some luminosity effects associated with the virialized component of the line emitting regions. We also briefly discuss quasars in a segment of the main sequence that includes the strongest FeII emitters. These sources show a small dispersion around a well-defined Eddington ratio value, a property which makes them potential Eddington standard candles.

  12. At ISR Main Control Room

    CERN Multimedia

    1983-01-01

    After 13 years the exploitation of the Intersecting Storage Rings as a beam-beam collider went to an end. In this last year the demands were very exacting, both in terms of operating time and diversified running conditions (Annual Report 1983 p. 123). Before dismantelement the photographer made a last tour, see photos 8310889X --> 8310667X. This photo shows the Main Control Room.

  13. Mechanical engineering

    CERN Document Server

    Darbyshire, Alan

    2010-01-01

    Alan Darbyshire's best-selling text book provides five-star high quality content to a potential audience of 13,000 engineering students. It explains the most popular specialist units of the Mechanical Engineering, Manufacturing Engineering and Operations & Maintenance Engineering pathways of the new 2010 BTEC National Engineering syllabus. This challenging textbook also features contributions from specialist lecturers, ensuring that no stone is left unturned.

  14. Information Engineering and Applications

    CERN Document Server

    Ma, Yan; International Conference on Information Engineering and Applications (IEA) 2011

    2012-01-01

    The International Conference on Information Engineering and Applications (IEA) 2011 will be held on October 21-24, 2011, in Chongqing, China. It is organized by Chongqing Normal University, Chongqing University, Shanghai Jiao Tong University, Nanyang Technological University, the University of Michigan, Chongqing University of Arts and Sciences, and sponsored by the National Natural Science Foundation of China. The objective of IEA 2011 is to facilitate an exchange of information on best practices for the latest research advances in the area of information engineering and intelligence applications, which mainly includes computer science and engineering, informatics, communications and control, electrical engineering, information computing, business intelligence and management. IEA 2011 will provide a forum for engineers and scientists in academia, industry, and government to address the most innovative research and development including technical challenges, social and economic issues, and to present and disc...

  15. Detonation Jet Engine. Part 2--Construction Features

    Science.gov (United States)

    Bulat, Pavel V.; Volkov, Konstantin N.

    2016-01-01

    We present the most relevant works on jet engine design that utilize thermodynamic cycle of detonative combustion. Detonation engines of various concepts, pulse detonation, rotational and engine with stationary detonation wave, are reviewed. Main trends in detonation engine development are discussed. The most important works that carried out…

  16. Introduction to Waste Engineering

    DEFF Research Database (Denmark)

    Christensen, Thomas Højlund

    2011-01-01

    Solid waste management as introduced in Chapter 1.1 builds in many ways on engineering. Waste engineering here means the skills and ability to understand quantitatively how a waste management system works in such a detail that waste management can be planned, facilities can be designed and sited......) regional plans for waste management, including (3) the selection of main management technologies and siting of facilities, (4) the design of individual technological units and, for example, (5) the operation of recycling schemes within a municipality. This chapter gives an introduction to waste engineering...

  17. Introduction to environmental engineering

    Science.gov (United States)

    Šalić, Anita; Zelić, Bruno

    2018-02-01

    Nowadays we can easily say that environmental engineering is truly an interdisciplinary science. Combining biology, ecology, geology, geography, mathematics, chemistry, agronomy, medicine, economy, etc. environmental engineering strives to use environmental understanding and advancements in technology to serve mankind by decreasing production of environmental hazards and the effects of those hazards already present in the soil, water, and air. Major activities of environmental engineer involve water supply, waste water and solid management, air and noise pollution control, environmental sustainability, environmental impact assessment, climate changes, etc. And all this with only one main goal - to prevent or reduce undesirable impacts of human activities on the environment. To ensure we all have tomorrow.

  18. Integrated Main Propulsion System Performance Reconstruction Process/Models

    Science.gov (United States)

    Lopez, Eduardo; Elliott, Katie; Snell, Steven; Evans, Michael

    2013-01-01

    The Integrated Main Propulsion System (MPS) Performance Reconstruction process provides the MPS post-flight data files needed for postflight reporting to the project integration management and key customers to verify flight performance. This process/model was used as the baseline for the currently ongoing Space Launch System (SLS) work. The process utilizes several methodologies, including multiple software programs, to model integrated propulsion system performance through space shuttle ascent. It is used to evaluate integrated propulsion systems, including propellant tanks, feed systems, rocket engine, and pressurization systems performance throughout ascent based on flight pressure and temperature data. The latest revision incorporates new methods based on main engine power balance model updates to model higher mixture ratio operation at lower engine power levels.

  19. Influence of Voltage on Main Characteristics of Electric Lighting Lamps

    Directory of Open Access Journals (Sweden)

    V. B. Kozlovskaya

    2009-01-01

    Full Text Available An analysis and systemization of data on influence of voltage value on main lighting engineering, electric and economic characteristics of incandescent lamps, gaseous-discharge lamps of low and high pressure have been made in the paper.Analytical and graphical dependences have been obtained that ensure to evaluate quantitative changes of corresponding lamp characteristics at voltage deviation from nominal value.

  20. KEK Engineering Department -activity report FY 2003

    International Nuclear Information System (INIS)

    2005-03-01

    This report includes all kinds of activities of the Engineering Department of KEK from 2002 to 2003 FY. There are fourteen chapters, which contain KEK Prize for engineering, KEK meeting of engineering technologies, Engineering Seminar, COACK (Component Oriented Advanced Control Kernel) for cooperation R and D project, Forum on engineering technologies from 1998 to 2003 FY, Engineering Department Symposium, service trainings, Engineering Department research study, English training, training for professional worker, training for technical expert, report on joint training for technical expert, training for middle school students, and the Engineering Department system and the main events from 1971 to 2003. (S.Y. )

  1. JWST-MIRI spectrometer main optics design and main results

    Science.gov (United States)

    Navarro, Ramón; Schoenmaker, Ton; Kroes, Gabby; Oudenhuysen, Ad; Jager, Rieks; Venema, Lars

    2017-11-01

    MIRI ('Mid InfraRed Instrument') is the combined imager and integral field spectrometer for the 5-29 micron wavelength range under development for the James Webb Space Telescope JWST. The flight acceptance tests of the Spectrometer Main Optics flight models (SMO), part of the MIRI spectrometer, are completed in the summer of 2008 and the system is delivered to the MIRI-JWST consortium. The two SMO arms contain 14 mirrors and form the MIRI optical system together with 12 selectable gratings on grating wheels. The entire system operates at a temperature of 7 Kelvin and is designed on the basis of a 'no adjustments' philosophy. This means that the optical alignment precision depends strongly on the design, tolerance analysis and detailed knowledge of the manufacturing process. Because in principle no corrections are needed after assembly, continuous tracking of the alignment performance during the design and manufacturing phases is important. The flight hardware is inspected with respect to performance parameters like alignment and image quality. The stability of these parameters is investigated after exposure to various vibration levels and successive cryogenic cool downs. This paper describes the philosophy behind the acceptance tests, the chosen test strategy and reports the results of these tests. In addition the paper covers the design of the optical test setup, focusing on the simulation of the optical interfaces of the SMO. Also the relation to the SMO qualification and verification program is addressed.

  2. Engine Modelling for Control Applications

    DEFF Research Database (Denmark)

    Hendricks, Elbert

    1997-01-01

    In earlier work published by the author and co-authors, a dynamic engine model called a Mean Value Engine Model (MVEM) was developed. This model is physically based and is intended mainly for control applications. In its newer form, it is easy to fit to many different engines and requires little...... engine data for this purpose. It is especially well suited to embedded model applications in engine controllers, such as nonlinear observer based air/fuel ratio and advanced idle speed control. After a brief review of this model, it will be compared with other similar models which can be found...

  3. Sixth Israel materials engineering conference IMEC VI

    International Nuclear Information System (INIS)

    Anon.

    1993-02-01

    Works on material engineering are presented. The main material types are: metals, alloys, superalloys, coatings, ceramics, composites, electronic materials,organic polymers and thin films. The following engineering aspects are presented: metallurgy, mechanical and physical properties, crystal structure and corrosion

  4. Main ring transition crossing simulations

    International Nuclear Information System (INIS)

    Kourbanis, I.; Ng, King-Yuen.

    1990-10-01

    We used ESME to simulate transition crossing in the Main Ring (MR). For the simulations, we followed the MR 29 cycle used currently for bar p production with a flat top of 120 GeV. In Sect. II, some inputs are discussed. In Sect. III, we present simulations with space charge turned off so that the effect of nonlinearity can be studied independently. When space charge is turned on in Sect. IV, we are faced with the problem of statistical errors due to binning, an analysis of which is given in the Appendices. Finally in Sects. V and VI, the results of simulations with space charge are presented and compared with the experimental measurements. 7 refs., 6 figs

  5. Improvement of main control room

    International Nuclear Information System (INIS)

    Chae, Sung Ki; Ham, Chang Sik; Kwon, Ki Chun

    1991-07-01

    Information display system, advanced alarm system and fiber optical communication system were developed to improve the main control room in nuclear power plant. Establishing the new hierachical information structure of plant operation data, plant overview status board(POSB) and digital indicator(DI) were designed and manufactured. The prototype advanced alarm system which employed the new alarm logics and algorithm compared with the conventional alarm system were developed and its effectiveness was proved. Optical communication system which has multi-drop feature and capability of upgrading to large-scale system by using BITBUS communication protocol which is proven technology, were developed. Reliability of that system was enhanced by using distributed control. (Author)

  6. The role of Main Institutions

    DEFF Research Database (Denmark)

    Persson, H Thomas R; Chabanet, Didier; Rakar, Fredrik

    2017-01-01

    ), in many countries the need emerged to understand the best methods to promote their establishment and continued success. In order to understand these issues, to contribute to the academic debate on SEs and to give useful policy advice on a truly enabling ecosystem, in November 2013 a consortium of 11...... Entrepreneurship”; to identify the “New Generation” of Social Entrepreneurs; to build an “Evolutionary Theory of Social Entrepreneurship”; to provide effective policy advices to stakeholders. In order to pursue and achieve these research objectives, the consortium implemented a complex research design...... in the social economy; - In the fifth chapter the authors address the role of the main institutions in developing (or hindering) social enterprises; - In the sixth chapter, stakeholder network maps are used to identify four ‘ecosystem types’ across the 10 partner countries; - The seventh chapter gives...

  7. Engineering Cartilage

    Science.gov (United States)

    ... Research Matters NIH Research Matters March 3, 2014 Engineering Cartilage Artistic rendering of human stem cells on ... situations has been a major goal in tissue engineering. Cartilage contains water, collagen, proteoglycans, and chondrocytes. Collagens ...

  8. Governing Engineering

    DEFF Research Database (Denmark)

    Buch, Anders

    2012-01-01

    Most people agree that our world face daunting problems and, correctly or not, technological solutions are seen as an integral part of an overall solution. But what exactly are the problems and how does the engineering ‘mind set’ frame these problems? This chapter sets out to unravel dominant...... perspectives in challenge per-ception in engineering in the US and Denmark. Challenge perception and response strategies are closely linked through discursive practices. Challenge perceptions within the engineering community and the surrounding society are thus critical for the shaping of engineering education...... and the engineering profession. Through an analysis of influential reports and position papers on engineering and engineering education the chapter sets out to identify how engineering is problematized and eventually governed. Drawing on insights from governmentality studies the chapter strives to elicit the bodies...

  9. Industrial Engineering

    DEFF Research Database (Denmark)

    Karlsson, Christer

    2015-01-01

    Industrial engineering is a discipline that is concerned with increasing the effectiveness of (primarily) manufacturing and (occasionally).......Industrial engineering is a discipline that is concerned with increasing the effectiveness of (primarily) manufacturing and (occasionally)....

  10. Governing Engineering

    DEFF Research Database (Denmark)

    Buch, Anders

    2011-01-01

    Abstract: Most people agree that our world faces daunting problems and, correctly or not, technological solutions are seen as an integral part of an overall solution. But what exactly are the problems and how does the engineering ‘mind set’ frame these problems? This chapter sets out to unravel...... dominant perspectives in challenge perception in engineering in the US and Denmark. Challenge perception and response strategies are closely linked through discursive practices. Challenge perceptions within the engineering community and the surrounding society are thus critical for the shaping...... of engineering education and the engineering profession. Through an analysis of influential reports and position papers on engineering and engineering education the chapter sets out to identify how engineering is problematized and eventually governed. Drawing on insights from governmentality studies the chapter...

  11. Computer Engineers.

    Science.gov (United States)

    Moncarz, Roger

    2000-01-01

    Looks at computer engineers and describes their job, employment outlook, earnings, and training and qualifications. Provides a list of resources related to computer engineering careers and the computer industry. (JOW)

  12. Engineering _ litteraturliste

    DEFF Research Database (Denmark)

    Sillasen, Martin Krabbe; Daugbjerg, Peer; Nielsen, Keld

    2017-01-01

    Litteraturliste udarbejdet som grundlag for artiklen ”Engineering – svaret på naturfagenes udfordringer?”......Litteraturliste udarbejdet som grundlag for artiklen ”Engineering – svaret på naturfagenes udfordringer?”...

  13. Internal combustion engine

    Science.gov (United States)

    Baker, Quentin A.; Mecredy, Henry E.; O'Neal, Glenn B.

    1991-01-01

    An improved engine is provided that more efficiently consumes difficult fuels such as coal slurries or powdered coal. The engine includes a precombustion chamber having a portion thereof formed by an ignition plug. The precombustion chamber is arranged so that when the piston is proximate the head, the precombustion chamber is sealed from the main cylinder or the main combustion chamber and when the piston is remote from the head, the precombustion chamber and main combustion chamber are in communication. The time for burning of fuel in the precombustion chamber can be regulated by the distance required to move the piston from the top dead center position to the position wherein the precombustion chamber and main combustion chamber are in communication.

  14. Main injector synchronous timing system

    International Nuclear Information System (INIS)

    Blokland, W.; Steimel, J.

    1998-01-01

    The Synchronous Timing System is designed to provide sub-nanosecond timing to instrumentation during the acceleration of particles in the Main Injector. Increased energy of the beam particles leads to a small but significant increase in speed, reducing the time it takes to complete a full turn of the ring by 61 nanoseconds (or more than 3 rf buckets). In contrast, the reference signal, used to trigger instrumentation and transmitted over a cable, has a constant group delay. This difference leads to a phase slip during the ramp and prevents instrumentation such as dampers from properly operating without additional measures. The Synchronous Timing System corrects for this phase slip as well as signal propagation time changes due to temperature variations. A module at the LLRF system uses a 1.2 Gbit/s G-Link chip to transmit the rf clock and digital data (e.g. the current frequency) over a single mode fiber around the ring. Fiber optic couplers at service buildings split off part of this signal for a local module which reconstructs a synchronous beam reference signal. This paper describes the background, design and expected performance of the Synchronous Timing System. copyright 1998 American Institute of Physics

  15. Main injector synchronous timing system

    International Nuclear Information System (INIS)

    Blokland, Willem; Steimel, James

    1998-01-01

    The Synchronous Timing System is designed to provide sub-nanosecond timing to instrumentation during the acceleration of particles in the Main Injector. Increased energy of the beam particles leads to a small but significant increase in speed, reducing the time it takes to complete a full turn of the ring by 61 nanoseconds (or more than 3 rf buckets). In contrast, the reference signal, used to trigger instrumentation and transmitted over a cable, has a constant group delay. This difference leads to a phase slip during the ramp and prevents instrumentation such as dampers from properly operating without additional measures. The Synchronous Timing System corrects for this phase slip as well as signal propagation time changes due to temperature variations. A module at the LLRF system uses a 1.2 Gbit/s G-Link chip to transmit the rf clock and digital data (e.g. the current frequency) over a single mode fiber around the ring. Fiber optic couplers at service buildings split off part of this signal for a local module which reconstructs a synchronous beam reference signal. This paper describes the background, design and expected performance of the Synchronous Timing System

  16. Main technical topics in 1999

    International Nuclear Information System (INIS)

    2000-01-01

    This Safety Authority annual report strives to present current organizational provisions and future trends in nuclear safety supervision in France and to describe the most outstanding occurrences during the past year. A first part presents nine documents concerning the main topics of 1999: aging of nuclear installations, the Offsite Emergency Plans (PPI), the impact of nuclear activities on man and the environment, the criticality hazards, EDF in 1999, the EPR project, the Andra in 1999, the transport incidents, the nuclear safety in eastern Europe. The second part presents the missions and actions of the Nuclear Installations Safety in the domains of the liabilities, the organization of the nuclear safety control, the regulations of the INB, the public information, the international relations, the crisis management, the radioactive materials transportation, the radioactive wastes. The equipment, the radiation protection and the exploitation of the pressurized water reactors are also treated just as the experimental reactors, the fuel cycle installations and the the nuclear installations dismantling. (A.L.B.)

  17. Main challenges of residential areas

    Directory of Open Access Journals (Sweden)

    Oana Luca

    2017-06-01

    Full Text Available The present article is a position paper aiming to initiate a professional debate related to the aspects related to the urban dysfunctions leading to the wear of the residential areas. The paper proposes a definition of the wear process, identify the main causes leading to its occurrence and propose a number of solutions to neutralise the dysfunctions. The three wearing phases of residential areas components are emphasized, exploring their lifecycle. In order to perform the study of urban wear, the status of the residential areas components can be established and monitored, and also the variables of the function that can mathematically model the specific wear process may be considered. The paper is considered a first step for the model adjustment, to be tested and validated in the following steps. Based on the mathematical method and model, there can be created, in a potential future research, the possibility of determining the precarity degree for residential areas/neighbourhoods and cities, by minimising the subjective component of the analyses preceding the decision for renovation or regeneration.

  18. Research in auditing: main themes

    Directory of Open Access Journals (Sweden)

    Marcelo Porte

    Full Text Available ABSTRACT The passage of the Sarbanes-Oxley Act (SOX was a turning point in auditing and in auditors practice for the academic world. Research concerning the characterization of academic production related to auditing is in its third decade. Its analysis is accomplished by means of definition of keywords, abstracts or title, and information on thematic association within the academic production itself in auditing is undisclosed. In order to revise this gap in auditing literature, this study identified the main themes in auditing and their association in post-SOX era by analyzing the content of objectives and hypothesis of 1,650 publications in Web of Science (2002-2014. The findings in this study extended those from the study by Lesage and Wechtler (2012 from 16 auditing thematic typologies to 22. The results demonstrate that the themes audit report & financial statement users, corporate governance, audit market, external audit, socio-economic data of the company, international regulation, and fraud risk & audit risk were the most addressed in the publications about auditing. Corporate governance has a broader association with the other themes in the area. Future researches may use these themes and relate them to the methodologies applied to audit studies.

  19. Main: 1FHF [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available oat Peroxidase; Glycine Max Molecule: Seed Coat Peroxidase; Chain: A, B, C; Engineered: Yes Oxidoreductase 1...LFPIVFGVIFDASFTDPRIGASLMRLHFHDCFVQGCDGSVLLNNTDTIESEQDALPNINSIRGLDVVNDIKTAVENSCPDTVSCADILAI

  20. Computational engineering

    CERN Document Server

    2014-01-01

    The book presents state-of-the-art works in computational engineering. Focus is on mathematical modeling, numerical simulation, experimental validation and visualization in engineering sciences. In particular, the following topics are presented: constitutive models and their implementation into finite element codes, numerical models in nonlinear elasto-dynamics including seismic excitations, multiphase models in structural engineering and multiscale models of materials systems, sensitivity and reliability analysis of engineering structures, the application of scientific computing in urban water management and hydraulic engineering, and the application of genetic algorithms for the registration of laser scanner point clouds.

  1. Architectural Engineers

    DEFF Research Database (Denmark)

    Petersen, Rikke Premer

    engineering is addresses from two perspectives – as an educational response and an occupational constellation. Architecture and engineering are two of the traditional design professions and they frequently meet in the occupational setting, but at educational institutions they remain largely estranged....... The paper builds on a multi-sited study of an architectural engineering program at the Technical University of Denmark and an architectural engineering team within an international engineering consultancy based on Denmark. They are both responding to new tendencies within the building industry where...... the role of engineers and architects increasingly overlap during the design process, but their approaches reflect different perceptions of the consequences. The paper discusses some of the challenges that design education, not only within engineering, is facing today: young designers must be equipped...

  2. Tissue engineering

    CERN Document Server

    Fisher, John P; Bronzino, Joseph D

    2007-01-01

    Increasingly viewed as the future of medicine, the field of tissue engineering is still in its infancy. As evidenced in both the scientific and popular press, there exists considerable excitement surrounding the strategy of regenerative medicine. To achieve its highest potential, a series of technological advances must be made. Putting the numerous breakthroughs made in this field into a broad context, Tissue Engineering disseminates current thinking on the development of engineered tissues. Divided into three sections, the book covers the fundamentals of tissue engineering, enabling technologies, and tissue engineering applications. It examines the properties of stem cells, primary cells, growth factors, and extracellular matrix as well as their impact on the development of tissue engineered devices. Contributions focus on those strategies typically incorporated into tissue engineered devices or utilized in their development, including scaffolds, nanocomposites, bioreactors, drug delivery systems, and gene t...

  3. Main physical problems of superhigh energy accelerators

    International Nuclear Information System (INIS)

    Lapidus, L.I.

    1979-01-01

    A survey is given of the state and prospects for the scientific researches to be carried out at the largest charged particle accelerators now under construction. The fundamental problems of the elementary particle physics are considered which can be solved on the base of experiments at high-energy accelerators. The problems to be solved involve development of the theory of various quark number, accurate determination of the charged and neutral intermediate vector boson masses in the Weinberg-Salam theory, the problem of production of t-quark, W -+ - and Z deg bosons, Higgs mesons and investigation of their interactions, examination of quark and lepton spectra, studies on the effects of strong interactions. As a result of the investigations on hadrons at maximum momentum transfers, the data on space-time structure at short distances can be obtained. It is emphasized that there are no engineering barriers to the construction of such accelerators. The main problem lies in financial investment. A conclusion is drawn that the next generation of accelerators will be developed on the base of cooperation between many countries [ru

  4. Contribution of TECNATOM engineering to the exploitation of NNPPs

    International Nuclear Information System (INIS)

    Bros, J.; Rivero, N.; Jimenez, A.

    1997-01-01

    The evolution of TECNATOM engineering is described. TECNATOM has developed works in power generation, specially the nuclear, and its main objectives were to improve the safety, availability and economy of these facilities. The main areas of TECNATOM are: Inspection and Engineering inspection, Simulation Engineering and Operation Engineering. (Author)

  5. Right Upper Lobe Shadow and Tracheobronchopathia Osteochondroplastica Confined to Right Main Bronchus: A Case Report and Literature Review

    Directory of Open Access Journals (Sweden)

    Stylianos A. Michaelides

    2015-01-01

    Full Text Available Tracheobronchopathia osteochondroplastica (TO is a well documented benign entity of endoscopic interest. We describe a case of 76-year-old patient who presented with fever, cough, purulent sputum during the past four days, and presence of an ovoid shadow in right upper zone of his chest X-ray. Medical history included diagnosis of colon diverticuli identified by colonoscopy 3 months ago. Chest CT revealed a compact elongated lesion containing air-bronchogram stripes. Bronchoscopy showed normal upper airways and trachea but presence of unequal sized mucosal nodules, protruding into the lumen, along the entire length of the right main bronchial mucosa. No other abnormal findings were detected. Moreover, brushing and washing smears from the apical segment of right upper lobe (RUL, where the compact lesion was located, were negative for malignancy. Biopsy from the mucosal nodules of right main bronchus showed presence of cartilaginous tissue in continuity through thin pedicles with submucosal cartilage. This finding posed the diagnosis of TO while RUL lesion was cleared by antibiotic treatment. Case is reported because, to our knowledge, it represents a unique anatomic location of TO which was confined exclusively in the right main bronchus mucosa without affecting trachea.

  6. Viewing engineering offshoring in a network perspective

    DEFF Research Database (Denmark)

    Hansen, Zaza Nadja Lee; Zhang, Yufeng; Ahmed-Kristensen, Saeema

    2013-01-01

    of how to effectively manage engineering offshoring activities in a context of global engineering networks. The main research question, therefore, is: “Can offshoring of engineering tasks be explained and managed using the concept of Global Engineering Networks (GEN)?” Effective approaches to handling...... of large multinational corporations in Denmark were carried out. Data gathering was mainly documentary studies and interviews. The main data analysis approaches were coding (Strauss and Corbin) and pattern-matching (Yin). The dataset was analysed using the GEN framework suggested by Zhang et al. and Zhang...... by extending the GEN framework to address complications within engineering offshoring. This strengthens both academic fields, and will be able to help engineering managers to develop appropriate engineering network configurations for offshore engineering operations....

  7. Protruding organic surfaces triggered by in-plane electric fields

    NARCIS (Netherlands)

    Liu, D.; Tito, N.B.; Broer, D.J.

    2017-01-01

    Coatings with a dynamic surface topography are of interest for applications in haptics, soft robotics, cell growth in biology, hydro- and air dynamics and tribology. Here we propose a design for creating oscillating surface topographies in thin liquid crystal polymer network coatings under an

  8. Hepatobiliary cystadenoma can protrude and grow into the bile ducts.

    Science.gov (United States)

    Gadzijev, E M; Pleskovic, A; Stanisavljevic, D; Ferlan-Marolt, V; Trotovsek, B

    1998-01-01

    To evaluate the phenomenon and the potential reasons for protrusion and growth of hepatobiliary cystadenoma into the extrahepatic bile ducts in our patients, accomplished by a review of the data regarding hepatobiliary cystadenomas published elsewhere. In a retrospective open study conducted over the last eight years, five patients with hepatobiliary cystadenoma and one patient with hepatobiliary cystadenocarcinoma were operated on. All the patients were females aged between 25 to 61 years. Diagnostic procedures, laboratory, operative and histopathological findings and treatment were evaluated. Most of our patients were found to have hepatobiliary cystadenoma located in the left surgical liver. In three out of five patients with HBC mesenchymal stroma was histologically detected. In two of the three, protrusion and growth into the extrahepatic bile ducts was found. Considering the pathogenesis, location and the morphology of HBC, the mesenchymal stroma may present the competent potential for intraductal progression of the tumor. Radical excision should be performed for successful treatment of hepatobiliary cystadenomas, because of the potential for reoccurrence.

  9. Thermal analysis of protruding surfaces in the JET divertor

    Czech Academy of Sciences Publication Activity Database

    Corre, Y.; Bunting, P.; Coenen, J.W.; Gaspar, J.; Iglesias, D.; Matthews, G.F.; Balboa, I.; Coffey, I.; Dejarnac, Renaud; Firdaouss, M.; Gauthier, E.; Jachmich, S.; Krieger, K.; Pitts, R.A.; Rack, M.; Silburn, S.A.

    2017-01-01

    Roč. 57, č. 6 (2017), č. článku 066009. ISSN 0029-5515 EU Projects: European Commission(XE) 633053 - EUROfusion Institutional support: RVO:61389021 Keywords : IR thermography * heat flux * tungsten melting Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics) Impact factor: 3.307, year: 2016 http://iopscience.iop.org/article/10.1088/1741-4326/aa687e/meta

  10. Engineering mechanics

    CERN Document Server

    Gross, Dietmar; Schröder, Jörg; Wall, Wolfgang A; Rajapakse, Nimal

    Statics is the first volume of a three-volume textbook on Engineering Mechanics. The authors, using a time-honoured straightforward and flexible approach, present the basic concepts and principles of mechanics in the clearest and simplest form possible to advanced undergraduate engineering students of various disciplines and different educational backgrounds. An important objective of this book is to develop problem solving skills in a systematic manner. Another aim of this volume is to provide engineering students as well as practising engineers with a solid foundation to help them bridge the gap between undergraduate studies on the one hand and advanced courses on mechanics and/or practical engineering problems on the other. The book contains numerous examples, along with their complete solutions. Emphasis is placed upon student participation in problem solving. The contents of the book correspond to the topics normally covered in courses on basic engineering mechanics at universities and colleges. Now in i...

  11. Invisible Engineers

    Science.gov (United States)

    Ohashi, Hideo

    Questionnaire to ask “mention three names of scientists you know” and “three names of engineers you know” was conducted and the answers from 140 adults were analyzed. The results indicated that the image of scientists is represented by Nobel laureates and that of engineers by great inventors like Thomas Edison and industry founders like Soichiro Honda. In order to reveal the image of engineers among young generation, questionnaire was conducted for pupils in middle and high schools. Answers from 1,230 pupils were analyzed and 226 names mentioned as engineers were classified. White votes reached 60%. Engineers who are neither big inventors nor company founders collected less than 1% of named votes. Engineers are astonishingly invisible from young generation. Countermeasures are proposed.

  12. Global engineering

    International Nuclear Information System (INIS)

    Plass, L.

    2001-01-01

    This article considers the challenges posed by the declining orders in the plant engineering and contracting business in Germany, the need to remain competitive, and essential preconditions for mastering the challenge. The change in engineering approach is illustrated by the building of a methanol plant in Argentina by Lurgi with the basic engineering completed in Frankfurt with involvement of key personnel from Poland, completely engineered subsystems from a Brazilian subsupplier, and detailed engineering work in Frankfurt. The production of methanol from natural gas using the LurgiMega/Methanol process is used as a typical example of the industrial plant construction sector. The prerequisites for successful global engineering are listed, and error costs in plant construction, possible savings, and process intensification are discussed

  13. Human engineering

    International Nuclear Information System (INIS)

    Yang, Seong Hwan; Park, Bum; Gang, Yeong Sik; Gal, Won Mo; Baek, Seung Ryeol; Choe, Jeong Hwa; Kim, Dae Sung

    2006-07-01

    This book mentions human engineering, which deals with introduction of human engineering, Man-Machine system like system design, and analysis and evaluation of Man-Machine system, data processing and data input, display, system control of man, human mistake and reliability, human measurement and design of working place, human working, hand tool and manual material handling, condition of working circumstance, working management, working analysis, motion analysis working measurement, and working improvement and design in human engineering.

  14. Engineering Electromagnetics

    International Nuclear Information System (INIS)

    Kim, Se Yun

    2009-01-01

    This book deals with engineering electromagnetics. It contains seven chapters, which treats understanding of engineering electromagnetics such as magnet and electron spin, current and a magnetic field and an electromagnetic wave, Essential tool for engineering electromagnetics on rector and scalar, rectangular coordinate system and curl vector, electrostatic field with coulomb rule and method of electric images, Biot-Savart law, Ampere law and magnetic force, Maxwell equation and an electromagnetic wave and reflection and penetration of electromagnetic plane wave.

  15. Information engineering

    Energy Technology Data Exchange (ETDEWEB)

    Hunt, D.N.

    1997-02-01

    The Information Engineering thrust area develops information technology to support the programmatic needs of Lawrence Livermore National Laboratory`s Engineering Directorate. Progress in five programmatic areas are described in separate reports contained herein. These are entitled Three-dimensional Object Creation, Manipulation, and Transport, Zephyr:A Secure Internet-Based Process to Streamline Engineering Procurements, Subcarrier Multiplexing: Optical Network Demonstrations, Parallel Optical Interconnect Technology Demonstration, and Intelligent Automation Architecture.

  16. Software engineering

    CERN Document Server

    Sommerville, Ian

    2010-01-01

    The ninth edition of Software Engineering presents a broad perspective of software engineering, focusing on the processes and techniques fundamental to the creation of reliable, software systems. Increased coverage of agile methods and software reuse, along with coverage of 'traditional' plan-driven software engineering, gives readers the most up-to-date view of the field currently available. Practical case studies, a full set of easy-to-access supplements, and extensive web resources make teaching the course easier than ever.

  17. Mechanical Engineering | Classification | College of Engineering & Applied

    Science.gov (United States)

    Engineering Concentration on Ergonomics M.S. Program in Computer Science Interdisciplinary Concentration on Energy Doctoral Programs in Engineering Non-Degree Candidate Departments Biomedical Engineering Biomedical Engineering Industry Advisory Council Civil & Environmental Engineering Civil &

  18. Biomedical Engineering | Classification | College of Engineering & Applied

    Science.gov (United States)

    Engineering Concentration on Ergonomics M.S. Program in Computer Science Interdisciplinary Concentration on Energy Doctoral Programs in Engineering Non-Degree Candidate Departments Biomedical Engineering Biomedical Engineering Industry Advisory Council Civil & Environmental Engineering Civil &

  19. Materials Science & Engineering | Classification | College of Engineering &

    Science.gov (United States)

    Biomedical Engineering Concentration on Ergonomics M.S. Program in Computer Science Interdisciplinary Concentration on Energy Doctoral Programs in Engineering Non-Degree Candidate Departments Biomedical Engineering Biomedical Engineering Industry Advisory Council Civil & Environmental Engineering Civil &

  20. Electrical Engineering | Classification | College of Engineering & Applied

    Science.gov (United States)

    Engineering Concentration on Ergonomics M.S. Program in Computer Science Interdisciplinary Concentration on Energy Doctoral Programs in Engineering Non-Degree Candidate Departments Biomedical Engineering Biomedical Engineering Industry Advisory Council Civil & Environmental Engineering Civil &

  1. Engineering tribology

    CERN Document Server

    Stachowiak, Gwidon; Batchelor, A W; Batchelor, Andrew W

    2005-01-01

    As with the previous edition, the third edition of Engineering Tribology provides a thorough understanding of friction and wear using technologies such as lubrication and special materials. Tribology is a complex topic with its own terminology and specialized concepts, yet is vitally important throughout all engineering disciplines, including mechanical design, aerodynamics, fluid dynamics and biomedical engineering. This edition includes updated material on the hydrodynamic aspects of tribology as well as new advances in the field of biotribology, with a focus throughout on the engineering ap

  2. Crossing geometry for Main Ring on Doubler collisions

    International Nuclear Information System (INIS)

    Diebold, R.

    1977-01-01

    There are two basic methods for bringing about Main Ring on Doubler collisions: the transposed, and kissing geometries. Examples of both are discussed assuming maximum momenta of 250 on 1000 GeV/c. The magnets required to bring the beams into small-angle collision are substantial in both cases. Detailed engineering work will be required to distinguish a substantial cost advantage of one geometry over the other

  3. Main: 2AAK [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available Molecule: Ubiquitin Conjugating Enzyme; Chain: Null; Synonym: Ubc1; Engineered: Yes Ubiquitin Conjugation 6....TPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMYSESKREYNRRVRDVVEQSWTAD arabi_2AAK.jpg ...

  4. 49 CFR 236.16 - Electric lock, main track releasing circuit.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Electric lock, main track releasing circuit. 236... Rules and Instructions: All Systems General § 236.16 Electric lock, main track releasing circuit. When an electric lock releasing circuit is provided on the main track to permit a train or an engine to...

  5. Tsunami engineering study in India

    Digital Repository Service at National Institute of Oceanography (India)

    Mandal, S.

    ronmental Laboratory at NOAA, USA has the tsunami - research program ( http://www.pmel.noaa.gov/tsunami/). Th e t sunami research group is part of the Civi l Engineering Department at the Universit y of Southern California where undergra - duate... the engineering point of view. The Tsunami Engineering Labor a tory at the graduate School of Engineering, Tohoku Unive r sit y (http://www.tsunami.civil.tohoku.a c.jp/ hokusai2/main/eng/index.html) offers r e- se arch programmes on tsunami. The Uni - versity...

  6. Beginning software engineering

    CERN Document Server

    Stephens, Rod

    2015-01-01

    Beginning Software Engineering demystifies the software engineering methodologies and techniques that professional developers use to design and build robust, efficient, and consistently reliable software. Free of jargon and assuming no previous programming, development, or management experience, this accessible guide explains important concepts and techniques that can be applied to any programming language. Each chapter ends with exercises that let you test your understanding and help you elaborate on the chapter's main concepts. Everything you need to understand waterfall, Sashimi, agile, RAD, Scrum, Kanban, Extreme Programming, and many other development models is inside!

  7. Fluids engineering

    International Nuclear Information System (INIS)

    Anon.

    1991-01-01

    Fluids engineering has played an important role in many applications, from ancient flood control to the design of high-speed compact turbomachinery. New applications of fluids engineering, such as in high-technology materials processing, biotechnology, and advanced combustion systems, have kept up unwaining interest in the subject. More accurate and sophisticated computational and measurement techniques are also constantly being developed and refined. On a more fundamental level, nonlinear dynamics and chaotic behavior of fluid flow are no longer an intellectual curiosity and fluid engineers are increasingly interested in finding practical applications for these emerging sciences. Applications of fluid technology to new areas, as well as the need to improve the design and to enhance the flexibility and reliability of flow-related machines and devices will continue to spur interest in fluids engineering. The objectives of the present seminar were: to exchange current information on arts, science, and technology of fluids engineering; to promote scientific cooperation between the fluids engineering communities of both nations, and to provide an opportunity for the participants and their colleagues to explore possible joint research programs in topics of high priority and mutual interest to both countries. The Seminar provided an excellent forum for reviewing the current state and future needs of fluids engineering for the two nations. With the Seminar ear-marking the first formal scientific exchange between Korea and the United States in the area of fluids engineering, the scope was deliberately left broad and general

  8. Biomedical Engineering

    CERN Document Server

    Suh, Sang C; Tanik, Murat M

    2011-01-01

    Biomedical Engineering: Health Care Systems, Technology and Techniques is an edited volume with contributions from world experts. It provides readers with unique contributions related to current research and future healthcare systems. Practitioners and researchers focused on computer science, bioinformatics, engineering and medicine will find this book a valuable reference.

  9. Genetic Engineering

    Science.gov (United States)

    Phillips, John

    1973-01-01

    Presents a review of genetic engineering, in which the genotypes of plants and animals (including human genotypes) may be manipulated for the benefit of the human species. Discusses associated problems and solutions and provides an extensive bibliography of literature relating to genetic engineering. (JR)

  10. Corrosion Engineering.

    Science.gov (United States)

    White, Charles V.

    A description is provided for a Corrosion and Corrosion Control course offered in the Continuing Engineering Education Program at the General Motors Institute (GMI). GMI is a small cooperative engineering school of approximately 2,000 students who alternate between six-week periods of academic study and six weeks of related work experience in…

  11. Requirements in engineering projects

    CERN Document Server

    Fernandes, João M

    2016-01-01

    This book focuses on various topics related to engineering and management of requirements, in particular elicitation, negotiation, prioritisation, and documentation (whether with natural languages or with graphical models). The book provides methods and techniques that help to characterise, in a systematic manner, the requirements of the intended engineering system.  It was written with the goal of being adopted as the main text for courses on requirements engineering, or as a strong reference to the topics of requirements in courses with a broader scope. It can also be used in vocational courses, for professionals interested in the software and information systems domain.   Readers who have finished this book will be able to: - establish and plan a requirements engineering process within the development of complex engineering systems; - define and identify the types of relevant requirements in engineering projects; - choose and apply the most appropriate techniques to elicit the requirements of a giv...

  12. Tinkering at the main-ring lattice

    Energy Technology Data Exchange (ETDEWEB)

    Ohnuma, S.

    1982-08-23

    To improve production of usable antiprotons using the proton beam from the main ring and the lossless injection of cooled antiprotons into the main ring, modifications of the main ring lattice are recommended.

  13. Engineering surveying

    CERN Document Server

    Schofield, W

    2001-01-01

    The aim of Engineering Surveying has always been to impart and develop a clear understanding of the basic topics of the subject. The author has fully revised the book to make it the most up-to-date and relevant textbook available on the subject.The book also contains the latest information on trigonometric levelling, total stations and one-person measuring systems. A new chapter on satellites ensures a firm grasp of this vitally important topic.The text covers engineering surveying modules for civil engineering students on degree courses and forms a reference for the engineering surveying module in land surveying courses. It will also prove to be a valuable reference for practitioners.* Simple clear introduction to surveying for engineers* Explains key techniques and methods* Details reading systems and satellite position fixing

  14. Emotional engineering

    CERN Document Server

    In an age of increasing complexity, diversification and change, customers expect services that cater to their needs and to their tastes. Emotional Engineering vol 2. describes how their expectations can be satisfied and managed throughout the product life cycle, if producers focus their attention more on emotion. Emotional engineering provides the means to integrate products to create a new social framework and develops services beyond product realization to create of value across a full lifetime.  14 chapters cover a wide range of topics that can be applied to product, process and industry development, with special attention paid to the increasing importance of sensing in the age of extensive and frequent changes, including: • Multisensory stimulation and user experience  • Physiological measurement • Tactile sensation • Emotional quality management • Mental model • Kansei engineering.   Emotional Engineering vol 2 builds on Dr Fukuda’s previous book, Emotional Engineering, and provides read...

  15. Engineering Research in Irish Economic Development

    Science.gov (United States)

    Kelly, John

    2011-01-01

    This article summarizes the main findings and recommendations of a report published in December 2010 by the Irish Academy of Engineering (IAE). The report, representing the views of a committee of distinguished Irish engineers from a wide range of disciplines, addresses the role of engineering research in Ireland's economic development and the…

  16. How to Develop an Engineering Design Task

    Science.gov (United States)

    Dankenbring, Chelsey; Capobianco, Brenda M.; Eichinger, David

    2014-01-01

    In this article, the authors provide an overview of engineering and the engineering design process, and describe the steps they took to develop a fifth grade-level, standards-based engineering design task titled "Getting the Dirt on Decomposition." Their main goal was to focus more on modeling the discrete steps they took to create and…

  17. Engineering and Sustainability: Attitudes and Actions

    Directory of Open Access Journals (Sweden)

    Marc A. Rosen

    2013-01-01

    Full Text Available The results of an extensive survey of engineers and engineering students suggest there is a strong focus on the implementation of sustainability concepts, actions and measures in engineering. The main sustainable technology priorities are using less energy and natural resources, reducing emissions and material wastes, and utilizing renewable, recyclable and recycled materials. Sustainable engineering within organizations is mainly driven by regulatory requirements, rising energy costs and client demand, but challenges to sustainable engineering like economics need to be addressed to increase the incorporation of sustainability in engineering. Nonetheless, about two-thirds of practicing engineers have worked on sustainable products and processes, and over half of engineering students are involved with sustainable design in their studies.

  18. Glycosylation Engineering

    DEFF Research Database (Denmark)

    Clausen, Henrik; Wandall, Hans H.; Steentoft, Catharina

    2017-01-01

    Knowledge of the cellular pathways of glycosylation across phylogeny provides opportunities for designing glycans via genetic engineering in a wide variety of cell types including bacteria, fungi, plant cells, and mammalian cells. The commercial demand for glycosylation engineering is broad......, including production of biological therapeutics with defined glycosylation (Chapter 57). This chapter describes how knowledge of glycan structures and their metabolism (Parts I–III of this book) has led to the current state of glycosylation engineering in different cell types. Perspectives for rapid...

  19. Engineering mathematics

    CERN Document Server

    Bird, John

    2014-01-01

    A practical introduction to the core mathematics required for engineering study and practiceNow in its seventh edition, Engineering Mathematics is an established textbook that has helped thousands of students to succeed in their exams.John Bird's approach is based on worked examples and interactive problems. This makes it ideal for students from a wide range of academic backgrounds as the student can work through the material at their own pace. Mathematical theories are explained in a straightforward manner, being supported by practical engineering examples and applications in order to ensure

  20. Engineering mathematics

    CERN Document Server

    Stroud, K A

    2013-01-01

    A groundbreaking and comprehensive reference that's been a bestseller since it first debuted in 1970, the new seventh edition of Engineering Mathematics has been thoroughly revised and expanded. Providing a broad mathematical survey, this innovative volume covers a full range of topics from the very basic to the advanced. Whether you're an engineer looking for a useful on-the-job reference or want to improve your mathematical skills, or you are a student who needs an in-depth self-study guide, Engineering Mathematics is sure to come in handy time and time again.

  1. Software engineering

    CERN Document Server

    Sommerville, Ian

    2016-01-01

    For courses in computer science and software engineering The Fundamental Practice of Software Engineering Software Engineering introduces readers to the overwhelmingly important subject of software programming and development. In the past few years, computer systems have come to dominate not just our technological growth, but the foundations of our world's major industries. This text seeks to lay out the fundamental concepts of this huge and continually growing subject area in a clear and comprehensive manner. The Tenth Edition contains new information that highlights various technological updates of recent years, providing readers with highly relevant and current information. Sommerville's experience in system dependability and systems engineering guides the text through a traditional plan-based approach that incorporates some novel agile methods. The text strives to teach the innovators of tomorrow how to create software that will make our world a better, safer, and more advanced place to live.

  2. Harmonic engine

    Science.gov (United States)

    Bennett, Charles L [Livermore, CA

    2009-10-20

    A high efficiency harmonic engine based on a resonantly reciprocating piston expander that extracts work from heat and pressurizes working fluid in a reciprocating piston compressor. The engine preferably includes harmonic oscillator valves capable of oscillating at a resonant frequency for controlling the flow of working fluid into and out of the expander, and also preferably includes a shunt line connecting an expansion chamber of the expander to a buffer chamber of the expander for minimizing pressure variations in the fluidic circuit of the engine. The engine is especially designed to operate with very high temperature input to the expander and very low temperature input to the compressor, to produce very high thermal conversion efficiency.

  3. Engineering personnel

    International Nuclear Information System (INIS)

    Paskievici, W.

    The expansion of nuclear power is taxing human, material, and capital resources in developed and developing countries. This paper explores the human resources as represented by employment, graduation statistics, and educational curricula for nuclear engineers. (E.C.B.)

  4. Green Engineering

    Science.gov (United States)

    Green Engineering is the design, commercialization and use of processes and products that are feasible and economical while reducing the generation of pollution at the source and minimizing the risk to human health and the environment.

  5. Coastal Engineering

    NARCIS (Netherlands)

    Van der Velden, E.T.J.M.

    1989-01-01

    Introduction, waves, sediment transport, littoral transport, lonshore sediment transport, onshore-offshore sediment transport, coastal changes, dune erosion and storm surges, sedimentation in channels and trenches, coastal engineering in practice.

  6. Crack widths in concrete with fibers and main reinforcement

    DEFF Research Database (Denmark)

    Christensen, Frede; Ulfkjær, Jens Peder; Brincker, Rune

    2015-01-01

    The main object of the research work presented in this paper is to establish design tools for concrete structures where main reinforcement is combined with addition of short discrete steel fibers. The work is concerned with calculating and measuring crack widths in structural elements subjected...... to bending load. Thus, the aim of the work is to enable engineers to calculate crack widths for flexural concrete members and analyze how different combinations of amounts of fibers and amounts of main reinforcement can meet a given maximum crack width requirement. A mathematical model including...... the ductility of the fiber reinforced concrete (FRC) is set up and experimental work is conducted in order to verify the crack width model. The ductility of the FRC is taken into account by using the stress crack width relation. The constitutive model for the FRC is based on the idea that the initial part...

  7. Microwave engineering

    CERN Document Server

    Pozar, David M

    2012-01-01

    The 4th edition of this classic text provides a thorough coverage of RF and microwave engineering concepts, starting from fundamental principles of electrical engineering, with applications to microwave circuits and devices of practical importance.  Coverage includes microwave network analysis, impedance matching, directional couplers and hybrids, microwave filters, ferrite devices, noise, nonlinear effects, and the design of microwave oscillators, amplifiers, and mixers. Material on microwave and RF systems includes wireless communications, radar, radiometry, and radiation hazards. A large

  8. Reliability Engineering

    International Nuclear Information System (INIS)

    Lee, Sang Yong

    1992-07-01

    This book is about reliability engineering, which describes definition and importance of reliability, development of reliability engineering, failure rate and failure probability density function about types of it, CFR and index distribution, IFR and normal distribution and Weibull distribution, maintainability and movability, reliability test and reliability assumption in index distribution type, normal distribution type and Weibull distribution type, reliability sampling test, reliability of system, design of reliability and functionality failure analysis by FTA.

  9. Systems Engineering

    OpenAIRE

    Vaughan, William W.

    2016-01-01

    The term “systems engineering” when entered into the Google search page, produces a significant number of results, evidence that systems engineering is recognized as being important for the success of essentially all products. Since most readers of this item will be rather well versed in documents concerning systems engineering, I have elected to share some of the points made on this subject in a document developed by the European Cooperation for Space Standardization (ECSS), a component of t...

  10. 75 FR 27863 - Savings Bank of Maine, MHC and Savings Bank of Maine, Gardiner, Maine; Approval of Conversion...

    Science.gov (United States)

    2010-05-18

    ... DEPARTMENT OF THE TREASURY Office of Thrift Supervision [AC-38: OTS Nos. 06947 and H 4709] Savings Bank of Maine, MHC and Savings Bank of Maine, Gardiner, Maine; Approval of Conversion Application Notice is hereby given that on May 7, 2010, the Office of Thrift Supervision approved the application of...

  11. Main: 1QRR [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available Molecule: Sulfolipid Biosynthesis (Sqd1) Protein; Chain: A; Engineered: Yes Isomerase A.M.Mulichak, M.J.Thei...IASIHDRISRWKALTGKSIELYVGDICDFEFLAESFKSFEPDSVVHFGEQRSAPYSMIDRSRAVYTQHNNVIGTLNVLFAIKEFGEECHLVKLGTMGEYGTPNIDIEE...LNRFCVQAAVGHPLTVYGKGGQTRGYLDIRDTVQCVEIAIANPAKAGEFRVFNQFTEQFSVNELASLVTKAGSKLGLDVKKMTVPNPRVEAEEHYYNAKHTKLMELGLEPHYLSDSLLDSLLNFAVQFKDRVDTKQIMPSVSWKKIGVKTKSMTT arabi_1QRR.jpg ...

  12. Engineering Musculoskeletal Tissue Interfaces

    Directory of Open Access Journals (Sweden)

    Ece Bayrak

    2018-04-01

    Full Text Available Tissue engineering aims to bring together biomaterials, cells, and signaling molecules within properly designed microenvironments in order to create viable treatment options for the lost or malfunctioning tissues. Design and production of scaffolds and cell-laden grafts that mimic the complex structural and functional features of tissues are among the most important elements of tissue engineering strategy. Although all tissues have their own complex structure, an even more complex case in terms of engineering a proper carrier material is encountered at the tissue interfaces, where two distinct tissues come together. The interfaces in the body can be examined in four categories; cartilage-bone and ligament-bone interfaces at the knee and the spine, tendon-bone interfaces at the shoulder and the feet, and muscle-tendon interface at the skeletal system. These interfaces are seen mainly at the soft-to-hard tissue transitions and they are especially susceptible to injury and tear due to the biomechanical inconsistency between these tissues where high strain fields are present. Therefore, engineering the musculoskeletal tissue interfaces remain a challenge. This review focuses on recent advancements in strategies for musculoskeletal interface engineering using different biomaterial-based platforms and surface modification techniques.

  13. Hire a Milwaukee Engineer | College of Engineering & Applied Science

    Science.gov (United States)

    Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

  14. Introduction to tissue engineering and application for cartilage engineering.

    Science.gov (United States)

    de Isla, N; Huseltein, C; Jessel, N; Pinzano, A; Decot, V; Magdalou, J; Bensoussan, D; Stoltz, J-F

    2010-01-01

    Tissue engineering is a multidisciplinary field that applies the principles of engineering, life sciences, cell and molecular biology toward the development of biological substitutes that restore, maintain, and improve tissue function. In Western Countries, tissues or cells management for clinical uses is a medical activity governed by different laws. Three general components are involved in tissue engineering: (1) reparative cells that can form a functional matrix; (2) an appropriate scaffold for transplantation and support; and (3) bioreactive molecules, such as cytokines and growth factors that will support and choreograph formation of the desired tissue. These three components may be used individually or in combination to regenerate organs or tissues. Thus the growing development of tissue engineering needs to solve four main problems: cells, engineering development, grafting and safety studies.

  15. Welding engineering manual for constructing engineers. Pt. 2

    International Nuclear Information System (INIS)

    Neumann, A.

    1986-01-01

    The manual is a real treasure trove of knowledge and experience for the statics expert, the constructing engineer, and the welding engineer, who have to do with design and dimensioning of welding engineering work for steel structures, bridges, boilers, vessels, and pipes. Many practical examples are given together with numerous data that provide helpful information for the task of technical and economic design and dimensioning. Determination of efficient and appropriate cross-sectional dimensions and materials is the main goal of the manual. Structural steel engineering and installations subject to monitoring and inspection such as boilers, pipings, pressure vessels, and nuclear installations are the subject fields dealt with in separate chapters. The dimensioning rules presented are based on the regulations and technical codes valid in the GDR and the FRG. The catalogue of technical rules of the FRG concerning structural steel engineering and installations as above are given in supplementary chapters. (orig./HP) [de

  16. 30 CFR 57.6160 - Main facilities.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Main facilities. 57.6160 Section 57.6160...-Underground Only § 57.6160 Main facilities. (a) Main facilities used to store explosive material underground... facilities will not prevent escape from the mine, or cause detonation of the contents of another storage...

  17. Springer handbook of mechanical engineering

    Energy Technology Data Exchange (ETDEWEB)

    Grote, Karl-Heinrich [Magdeburg Univ. (Germany). Dept. of Mechanical Engineering; Antonsson, Erik K. (eds.) [California Inst. of Technology (CALTEC), Pasadena, CA (United States). Dept. of Mechanical Engineering

    2009-07-01

    Mechanical Engineering is a professional engineering discipline which involves the application of principles of physics, design, manufacturing and maintenance of mechanical systems. It requires a solid understanding of the key concepts including mechanics, kinematics, thermodynamics and energy. Mechanical engineers use these principles and others in the design and analysis of automobiles, aircrafts, heating and cooling systems, industrial equipment and machinery. In addition to these main areas, specialized fields are necessary to prepare future engineers for their positions in industry, such as mechatronics and robotics, transportation and logistics, fuel technology, automotive engineering, biomechanics, vibration, optics and others. Accordingly, the Springer Handbook of Mechanical Engineering devotes its contents to all areas of interest for the practicing engineer as well as for the student at various levels and educational institutions. Authors from all over the world have contributed with their expertise and support the globally working engineer in finding a solution for today's mechanical engineering problems. Each subject is discussed in detail and supported by numerous figures and tables. DIN standards are retained throughout and ISO equivalents are given where possible. The text offers a concise but detailed and authoritative treatment of the topics with full references. (orig.)

  18. Software engineering beyond the project

    DEFF Research Database (Denmark)

    Dittrich, Yvonne

    2014-01-01

    Context The main part of software engineering methods, tools and technologies has developed around projects as the central organisational form of software development. A project organisation depends on clear bounds regarding scope, participants, development effort and lead-time. What happens when...... of traditional software engineering, but makes perfect sense, considering that the frame of reference for product development is not a project but continuous innovation across the respective ecosystem. The article provides a number of concrete points for further research....

  19. Engineering physics

    CERN Document Server

    Mukherji, Uma

    2015-01-01

    ENGINEERING PHYSICS is designed as a textbook for first year engineering students of a two semester course in Applied Physics according to new revised syllabus. However the scope of this book is not only limited to undergraduate engineering students and science students, it can also serve as a reference book for practicing scientists.Advanced technological topics like LCD, Squid, Maglev system, Electron microscopes, MRI, Photonics - Photonic fibre, Nano-particles, CNT, Quantum computing etc., are explained with basic underlying principles of Physics.This text explained following topics with numerous solved, unsolved problems and questions from different angles. Part-I contains crystal structure, Liquid crystal, Thermo-electric effect, Thermionic emission, Ultrasonic, Acoustics, semiconductor and magnetic materials. Whereas Part-2 contains Optics, X-rays, Electron optics, Dielectric materials, Quantum Physics and Schrodinger wave equation, Laser, Fibre-optics and Holography, Radio-activity, Super-conductivity,...

  20. Music engineering

    CERN Document Server

    Brice, Richard

    2001-01-01

    Music Engineering is a hands-on guide to the practical aspects of electric and electronic music. It is both a compelling read and an essential reference guide for anyone using, choosing, designing or studying the technology of modern music. The technology and underpinning science are introduced through the real life demands of playing and recording, and illustrated with references to well known classic recordings to show how a particular effect is obtained thanks to the ingenuity of the engineer as well as the musician. In addition, an accompanying companion website containing over 50 specially chosen tracks for download, provides practical demonstrations of the effects and techniques described in the book. Written by a music enthusiast and electronic engineer, this book covers the electronics and physics of the subject as well as the more subjective aspects. The second edition includes an updated Digital section including MPEG3 and fact sheets at the end of each chapter to summarise the key electronics and s...

  1. Engineering surveying

    CERN Document Server

    Schofield, W

    2007-01-01

    Engineering surveying involves determining the position of natural and man-made features on or beneath the Earth's surface and utilizing these features in the planning, design and construction of works. It is a critical part of any engineering project. Without an accurate understanding of the size, shape and nature of the site the project risks expensive and time-consuming errors or even catastrophic failure.Engineering Surveying 6th edition covers all the basic principles and practice of this complex subject and the authors bring expertise and clarity. Previous editions of this classic text have given readers a clear understanding of fundamentals such as vertical control, distance, angles and position right through to the most modern technologies, and this fully updated edition continues that tradition.This sixth edition includes:* An introduction to geodesy to facilitate greater understanding of satellite systems* A fully updated chapter on GPS, GLONASS and GALILEO for satellite positioning in surveying* Al...

  2. Engineering Optics

    CERN Document Server

    Iizuka, Keigo

    2008-01-01

    Engineering Optics is a book for students who want to apply their knowledge of optics to engineering problems, as well as for engineering students who want to acquire the basic principles of optics. It covers such important topics as optical signal processing, holography, tomography, holographic radars, fiber optical communication, electro- and acousto-optic devices, and integrated optics (including optical bistability). As a basis for understanding these topics, the first few chapters give easy-to-follow explanations of diffraction theory, Fourier transforms, and geometrical optics. Practical examples, such as the video disk, the Fresnel zone plate, and many more, appear throughout the text, together with numerous solved exercises. There is an entirely new section in this updated edition on 3-D imaging.

  3. Isolators Including Main Spring Linear Guide Systems

    Science.gov (United States)

    Goold, Ryan (Inventor); Buchele, Paul (Inventor); Hindle, Timothy (Inventor); Ruebsamen, Dale Thomas (Inventor)

    2017-01-01

    Embodiments of isolators, such as three parameter isolators, including a main spring linear guide system are provided. In one embodiment, the isolator includes first and second opposing end portions, a main spring mechanically coupled between the first and second end portions, and a linear guide system extending from the first end portion, across the main spring, and toward the second end portion. The linear guide system expands and contracts in conjunction with deflection of the main spring along the working axis, while restricting displacement and rotation of the main spring along first and second axes orthogonal to the working axis.

  4. WAsP engineering 2000

    DEFF Research Database (Denmark)

    Mann, J.; Ott, Søren; Jørgensen, B.H.

    2002-01-01

    This report summarizes the findings of the EFP project WAsP Engineering Version 2000. The main product of this project is the computer program WAsP Engineering which is used for the estimation of extreme wind speeds, wind shears, profiles, and turbulencein complex terrain. At the web page http......://www.waspengineering.dk more information of the program can be obtained and a copy of the manual can be downloaded. The reports contains a complete description of the turbulence modelling in moderately complexterrain, implemented in WAsP Engineering. Also experimental validation of the model together with comparison...... with spectra from engineering codes is done. Some shortcomings of the linear flow model LINCOM, which is at the core of WAsP Engineering, ispointed out and modifications to eliminate the problem are presented. The global database of meteorological "reanalysis" data from NCAP/NCEP are used to estimate...

  5. Biochemistry engineering

    International Nuclear Information System (INIS)

    Jang, Ho Nam

    1993-01-01

    This deals with biochemistry engineering with nine chapters. It explains bionics on development and prospect, basics of life science on classification and structure, enzyme and metabolism, fundamentals of chemical engineering on viscosity, shear rate, PFR, CSTR, mixing, dispersion, measurement and response, Enzyme kinetics, competitive inhibition, pH profile, temperature profile, stoichiometry and fermentation kinetics, bio-reactor on Enzyme-reactor and microorganism-reactor, measurement and processing on data acquisition and data processing, separation and purification, waste water treatment and economics of bionics process.

  6. Micro Engineering

    DEFF Research Database (Denmark)

    Alting, Leo; Kimura, F.; Hansen, Hans Nørgaard

    2003-01-01

    The paper addresses the questions of how micro products are designed and how they are manufactured. Definitions of micro products and micro engineering are discussed and the presentation is aimed at describing typical issues, possibilities and tools regarding design of micro products. The implica......The paper addresses the questions of how micro products are designed and how they are manufactured. Definitions of micro products and micro engineering are discussed and the presentation is aimed at describing typical issues, possibilities and tools regarding design of micro products...

  7. Engineering tribology

    CERN Document Server

    Stachowiak, Gwidon

    2014-01-01

    Engineering Tribology, 4th Edition is an established introductory reference focusing on the key concepts and engineering implications of tribology. Taking an interdisciplinary view, the book brings together the relevant knowledge from different fields needed to achieve effective analysis and control of friction and wear. Updated to cover recent advances in tribology, this new edition includes new sections on ionic and mesogenic lubricants, surface texturing, and multiscale characterization of 3D surfaces and coatings. Current trends in nanotribology are discussed, such as those relating to

  8. Corrosion engineering

    Energy Technology Data Exchange (ETDEWEB)

    Fontana, M.G.

    1986-01-01

    This book emphasizes the engineering approach to handling corrosion. It presents corrosion data by corrosives or environments rather than by materials. It discusses the corrosion engineering of noble metals, ''exotic'' metals, non-metallics, coatings, mechanical properties, and corrosion testing, as well as modern concepts. New sections have been added on fracture mechanics, laser alloying, nuclear waste isolation, solar energy, geothermal energy, and the Statue of Liberty. Special isocorrosion charts, developed by the author, are introduced as a quick way to look at candidates for a particular corrosive.

  9. Failure Analysis of Main Flame Deflector Nelson Studs

    Science.gov (United States)

    Long, Victoria

    2009-01-01

    NASA Structures engineers submitted two Nelson refractory studs from the main flame deflector at Launch Complex (LC) 39 A for analysis when they were observed to be missing a significant amount of material after launch. The damaged stud and an unused comparative stud were analyzed by macroscopic and microscopic examination along with metallographic evaluation of the microstructure. The stud lost material due to a combination of erosion and corrosion. Plain carbon steel readily forms an oxide layer in the coastal launch environment at Kennedy Space Center. The blast during a launch removes this brittle oxide layer, which then forms again post-launch, thereby further removing material. No indications of melting were observed.

  10. MAIN TRENDS OF BIOFUELS PRODUCTION IN UKRAINE

    Directory of Open Access Journals (Sweden)

    Myroslav PANCHUK

    2017-12-01

    Full Text Available The analysis of biological resources for biofuels production in Ukraine has been carried out, and it has been shown that usage of alternative energy sources has great potential for substantially improving energy supply of the state and solving environmental problems. The directions of development and new technologies of obtaining motor fuels from biomass are systematized. It has been established that usage of different types of biofuels and their mixtures for feeding internal combustion engines involves application of modified engines in terms of structure and algorithms and usage of traditional designs of cars without significant structural changes. Moreover, the impact of biofuels on the efficient operation of the engine requires further integrated research.

  11. Engineering Obsolescence

    DEFF Research Database (Denmark)

    Cohn, Marisa

    2014-01-01

    Editor's Note: In this contribution to the series on Hackers, Makers, and Engineers, she tells us about her research on relationships to technological change in a long-lived NASA-ESA software infrastructure project. Her research considers how people live alongside technological change, inhabit...

  12. Combustion engineering

    CERN Document Server

    Ragland, Kenneth W

    2011-01-01

    Introduction to Combustion Engineering The Nature of Combustion Combustion Emissions Global Climate Change Sustainability World Energy Production Structure of the Book   Section I: Basic Concepts Fuels Gaseous Fuels Liquid Fuels Solid Fuels Problems Thermodynamics of Combustion Review of First Law Concepts Properties of Mixtures Combustion StoichiometryChemical EnergyChemical EquilibriumAdiabatic Flame TemperatureChemical Kinetics of CombustionElementary ReactionsChain ReactionsGlobal ReactionsNitric Oxide KineticsReactions at a Solid SurfaceProblemsReferences  Section II: Combustion of Gaseous and Vaporized FuelsFlamesLaminar Premixed FlamesLaminar Flame TheoryTurbulent Premixed FlamesExplosion LimitsDiffusion FlamesGas-Fired Furnaces and BoilersEnergy Balance and EfficiencyFuel SubstitutionResidential Gas BurnersIndustrial Gas BurnersUtility Gas BurnersLow Swirl Gas BurnersPremixed-Charge Engine CombustionIntroduction to the Spark Ignition EngineEngine EfficiencyOne-Zone Model of Combustion in a Piston-...

  13. Progress in IFMIF Engineering Validation and Engineering Design Activities

    International Nuclear Information System (INIS)

    Heidinger, R.; Knaster, J.; Matsumoto, H.; Sugimoto, M.; Mosnier, A.; Arbeiter, F.; Baluc, N.; Cara, P.; Chel, S.; Facco, A.; Favuzza, P.; Heinzel, V.; Ibarra, A.; Massaut, V.; Micciche, G.; Nitti, F.S.; Theile, J.

    2013-01-01

    Highlights: ► The IFMIF/EVEDA project has entered into the crucial phase of concluding the Interim IFMIF Engineering Design Report. ► The IFMIF plant configuration has been established with the definition of five IFMIF facilities and of their interfaces. ► Three major prototypes of the IFMIF main systems have been designed and are being manufactured, commissioned and operated. -- Abstract: The International Fusion Materials Irradiation Facility (IFMIF) Engineering Design and Engineering Validation Activities (EVEDA) are being developed in a joint project in the framework of the Broader Approach (BA) Agreement between EU and Japan. This project has now entered into a crucial phase as the engineering design of IFMIF is now being formulated in a series of 3 subsequent phases for delivering an Interim IFMIF Engineering Design Report (IIEDR) by mid of 2013. Content of these phases is explained, including the plant configuration detailing the 5 IFMIF facilities and their systems. Together with the Engineering Design Activities, prototyping sub-projects are pursued in the Engineering Validation Activities which consist of the design, manufacturing and testing of the following prototypical systems: Linear IFMIF Prototype Accelerator (LIPAc), EVEDA Lithium Test Loop (ELTL), and High Flux Test Module (HFTM) with the prototypical helium cooling loop (HELOKA). Highlights are described from recent experiments in the Engineering Validation Activities

  14. Engineering Change Management Method Framework in Mechanical Engineering

    Science.gov (United States)

    Stekolschik, Alexander

    2016-11-01

    Engineering changes make an impact on different process chains in and outside the company, and lead to most error costs and time shifts. In fact, 30 to 50 per cent of development costs result from technical changes. Controlling engineering change processes can help us to avoid errors and risks, and contribute to cost optimization and a shorter time to market. This paper presents a method framework for controlling engineering changes at mechanical engineering companies. The developed classification of engineering changes and accordingly process requirements build the basis for the method framework. The developed method framework comprises two main areas: special data objects managed in different engineering IT tools and process framework. Objects from both areas are building blocks that can be selected to the overall business process based on the engineering process type and change classification. The process framework contains steps for the creation of change objects (both for overall change and for parts), change implementation, and release. Companies can select singleprocess building blocks from the framework, depending on the product development process and change impact. The developed change framework has been implemented at a division (10,000 employees) of a big German mechanical engineering company.

  15. Biocommodity Engineering.

    Science.gov (United States)

    Lynd; Wyman; Gerngross

    1999-10-01

    The application of biotechnology to the production of commodity products (fuels, chemicals, and materials) offering benefits in terms of sustainable resource supply and environmental quality is an emergent area of intellectual endeavor and industrial practice with great promise. Such "biocommodity engineering" is distinct from biotechnology motivated by health care at multiple levels, including economic driving forces, the importance of feedstocks and cost-motivated process engineering, and the scale of application. Plant biomass represents both the dominant foreseeable source of feedstocks for biotechnological processes as well as the only foreseeable sustainable source of organic fuels, chemicals, and materials. A variety of forms of biomass, notably many cellulosic feedstocks, are potentially available at a large scale and are cost-competitive with low-cost petroleum whether considered on a mass or energy basis, and in terms of price defined on a purchase or net basis for both current and projected mature technology, and on a transfer basis for mature technology. Thus the central, and we believe surmountable, impediment to more widespread application of biocommodity engineering is the general absence of low-cost processing technology. Technological and research challenges associated with converting plant biomass into commodity products are considered relative to overcoming the recalcitrance of cellulosic biomass (converting cellulosic biomass into reactive intermediates) and product diversification (converting reactive intermediates into useful products). Advances are needed in pretreatment technology to make cellulosic materials accessible to enzymatic hydrolysis, with increased attention to the fundamental chemistry operative in pretreatment processes likely to accelerate progress. Important biotechnological challenges related to the utilization of cellulosic biomass include developing cellulase enzymes and microorganisms to produce them, fermentation of

  16. Main propulsion system design recommendations for an advanced Orbit Transfer Vehicle

    Science.gov (United States)

    Redd, L.

    1985-01-01

    Various main propulsion system configurations of an advanced OTV are evaluated with respect to the probability of nonindependent failures, i.e., engine failures that disable the entire main propulsion system. Analysis of the life-cycle cost (LCC) indicates that LCC is sensitive to the main propulsion system reliability, vehicle dry weight, and propellant cost; it is relatively insensitive to the number of missions/overhaul, failures per mission, and EVA and IVA cost. In conclusion, two or three engines are recommended in view of their highest reliability, minimum life-cycle cost, and fail operational/fail safe capability.

  17. Nomenclature for Engineered Bamboo

    Directory of Open Access Journals (Sweden)

    Xianmiao Liu

    2015-12-01

    Full Text Available In recent years, there has been a rapid rise in the development of engineered bamboo materials, which have the potential to play an important role as alternatives to conventional building materials. Despite the growing diversity of bamboo products available on the market, the international standardization of both bamboo products and their constituent elements is limited, and a lack of universal nomenclature is recognized as one of the main constraints on developing standards. Similar or identical terminology is used interchangeably to describe different bamboo elements, processes, or products across sectors and continents. In some cases, translated colloquial names are misleading and scientifically inaccurate, which forms a barrier to global collaboration and research, creates ambiguity, and potentially limits trade. The present work aims to address this gap by proposing a set of appropriate terms in English that accurately describe and differentiate between currently produced engineered bamboo products and their constituent elements, accompanied by parallel terms in Chinese and Spanish. From these, new categories of engineered bamboo building materials are proposed for the Harmonized System of product codes. This paper highlights current ambiguities and provides terminology together with clear definitions of the main primary elements, processing steps, and products.

  18. Welding in nuclear engineering

    International Nuclear Information System (INIS)

    1982-01-01

    The 3rd international conference 'Welding in nuclear engineering', organized in 1978 by the Deutscher Verband fuer Schweisstechnik e.V., was, like the two foregoing conferences in 1970 and 1974, an absolute success. The noteworthy echo to this meeting in the international technical world - the number of 650 participants from 26 countries is self-evidence - and this fact, was for the Deutscher Verband fuer Schweisstechnik e.V. occasion and at the same time an obligation now to follow in the same way, the meeting that was started 12 years ago, by organizing the international conference 'Welding in nuclear engineering'. The conference this year offers in addition to the two plenary session lectures, 34 short reports and a further 28 single contributions in the form of two poster-sessions. Unfortunately, it was again not possible to accept all the papers submitted because the conference was limited to 2 days only. Nevertheless, the papers will offer a representative cross-section through the total range of welding engineering. In particular, the poster session, which take place for the first time within the scope of a meeting organized by the Working Group 'Welding in Nuclear Engineering', should contribute to the aim that this time again the discussions will form the main point of the conference. (orig./RW) [de

  19. On civil engineering disasters and their mitigation

    Science.gov (United States)

    Xie, Lili; Qu, Zhe

    2018-01-01

    Civil engineering works such as buildings and infrastructure are the carriers of human civilization. They are, however, also the origins of various types of disasters, which are referred to in this paper as civil engineering disasters. This paper presents the concept of civil engineering disasters, their characteristics, classification, causes, and mitigation technologies. Civil engineering disasters are caused primarily by civil engineering defects, which are usually attributed to improper selection of construction site, hazard assessment, design and construction, occupancy, and maintenance. From this viewpoint, many so-called natural disasters such as earthquakes, strong winds, floods, landslides, and debris flows are substantially due to civil engineering defects rather than the actual natural hazards. Civil engineering disasters occur frequently and globally and are the most closely related to human beings among all disasters. This paper emphasizes that such disasters can be mitigated mainly through civil engineering measures, and outlines the related objectives and scientific and technological challenges.

  20. Main: 1JH6 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available sterase; Chain: A, B; Engineered: Yes Hydrolase 3.1.4.- (Cyclic Phosphodiesterase) A.Hofmann, M.Grella, I.Bo...tos, W.Filipowicz, A.Wlodawer A.Hofmann, M.Grella, I.Botos, W.Filipowicz, A.Wloda

  1. Quiet engine program flight engine design study

    Science.gov (United States)

    Klapproth, J. F.; Neitzel, R. E.; Seeley, C. T.

    1974-01-01

    The results are presented of a preliminary flight engine design study based on the Quiet Engine Program high-bypass, low-noise turbofan engines. Engine configurations, weight, noise characteristics, and performance over a range of flight conditions typical of a subsonic transport aircraft were considered. High and low tip speed engines in various acoustically treated nacelle configurations were included.

  2. Engineering department annual progress report 1 January -31 December 1978

    International Nuclear Information System (INIS)

    1979-07-01

    A representative survey of the activities of the Engineering Department during 1978 is given followed by brief presentation of selected activities. Main activity areas are structural mechanics, engineering services, and technical support service and logistics. (author)

  3. Envera Variable Compression Ratio Engine

    Energy Technology Data Exchange (ETDEWEB)

    Charles Mendler

    2011-03-15

    the compression ratio can be raised (to as much as 18:1) providing high engine efficiency. It is important to recognize that for a well designed VCR engine cylinder pressure does not need to be higher than found in current production turbocharged engines. As such, there is no need for a stronger crankcase, bearings and other load bearing parts within the VCR engine. The Envera VCR mechanism uses an eccentric carrier approach to adjust engine compression ratio. The crankshaft main bearings are mounted in this eccentric carrier or 'crankshaft cradle' and pivoting the eccentric carrier 30 degrees adjusts compression ratio from 9:1 to 18:1. The eccentric carrier is made up of a casting that provides rigid support for the main bearings, and removable upper bearing caps. Oil feed to the main bearings transits through the bearing cap fastener sockets. The eccentric carrier design was chosen for its low cost and rigid support of the main bearings. A control shaft and connecting links are used to pivot the eccentric carrier. The control shaft mechanism features compression ratio lock-up at minimum and maximum compression ratio settings. The control shaft method of pivoting the eccentric carrier was selected due to its lock-up capability. The control shaft can be rotated by a hydraulic actuator or an electric motor. The engine shown in Figures 3 and 4 has a hydraulic actuator that was developed under the current program. In-line 4-cylinder engines are significantly less expensive than V engines because an entire cylinder head can be eliminated. The cost savings from eliminating cylinders and an entire cylinder head will notably offset the added cost of the VCR and supercharging. Replacing V6 and V8 engines with in-line VCR 4-cylinder engines will provide high fuel economy at low cost. Numerous enabling technologies exist which have the potential to increase engine efficiency. The greatest efficiency gains are realized when the right combination of advanced and new

  4. Engineering Review Information System

    Science.gov (United States)

    Grems, III, Edward G. (Inventor); Henze, James E. (Inventor); Bixby, Jonathan A. (Inventor); Roberts, Mark (Inventor); Mann, Thomas (Inventor)

    2015-01-01

    A disciplinal engineering review computer information system and method by defining a database of disciplinal engineering review process entities for an enterprise engineering program, opening a computer supported engineering item based upon the defined disciplinal engineering review process entities, managing a review of the opened engineering item according to the defined disciplinal engineering review process entities, and closing the opened engineering item according to the opened engineering item review.

  5. Study on the task categorization of main control room in NPP

    International Nuclear Information System (INIS)

    Fang Zhou; Ma Zhicai; Ma Xusheng; Zheng Mingguang

    2005-01-01

    The paper states the importance and trendy requirements of Main Control Room (MCR) in nuclear power plant and introduces how to implement the human factor engineering principle in the design of advanced main control room. It mainly focuses on the purpose and functions, strategy and methodology, scope and contents of the MCR task categorization. The preliminary MCR task categorization is performed according to these principles. (authors)

  6. Main approaches to the study of loss

    Directory of Open Access Journals (Sweden)

    Burina E. A.

    2016-07-01

    Full Text Available this article presents the main approaches to the concepts of grief and loss study. The article describes the contribution of E. Lindemann, Z. Freud, J. Bowlby, F.E. Vasiluk, and E. Kubler-Ross. The research also contains the main forms of grief and some stadial models within the scope of problematics.

  7. Nitrogen chronology of massive main sequence stars

    NARCIS (Netherlands)

    Köhler, K.; Borzyszkowski, M.; Brott, I.; Langer, N.; de Koter, A.

    2012-01-01

    Context. Rotational mixing in massive main sequence stars is predicted to monotonically increase their surface nitrogen abundance with time. Aims. We use this effect to design a method for constraining the age and the inclination angle of massive main sequence stars, given their observed luminosity,

  8. Riigikogu maine ja armastus / Aune Past

    Index Scriptorium Estoniae

    Past, Aune, 1954-

    2007-01-01

    Autor arutleb Riigikogu maine üle, toetudes TÜ ajakirjanduse ja kommunikatsiooni osakonna 2007. aastal tehtud uuringu tulemustele. Riigikogu liikmete maine paraneks, kui neil endil oleks selge, mis eesmärgil Toompeale mindi ja sellest siis ka rahvale kõneldaks

  9. Robot engineering

    International Nuclear Information System (INIS)

    Jung, Seul

    2006-02-01

    This book deals with robot engineering, giving descriptions of robot's history, current tendency of robot field, work and characteristic of industrial robot, essential merit and vector, application of matrix, analysis of basic vector, expression of Denavit-Hartenberg, robot kinematics such as forward kinematics, inverse kinematics, cases of MATLAB program, and motion kinematics, robot kinetics like moment of inertia, centrifugal force and coriolis power, and Euler-Lagrangian equation course plan, SIMULINK position control of robots.

  10. Robot engineering

    Energy Technology Data Exchange (ETDEWEB)

    Jung, Seul

    2006-02-15

    This book deals with robot engineering, giving descriptions of robot's history, current tendency of robot field, work and characteristic of industrial robot, essential merit and vector, application of matrix, analysis of basic vector, expression of Denavit-Hartenberg, robot kinematics such as forward kinematics, inverse kinematics, cases of MATLAB program, and motion kinematics, robot kinetics like moment of inertia, centrifugal force and coriolis power, and Euler-Lagrangian equation course plan, SIMULINK position control of robots.

  11. Planetary engineering

    Science.gov (United States)

    Pollack, James B.; Sagan, Carl

    1991-01-01

    Assuming commercial fusion power, heavy lift vehicles and major advances in genetic engineering, the authors survey possible late-21st century methods of working major transformations in planetary environments. Much more Earthlike climates may be produced on Mars by generating low freezing point greenhouse gases from indigenous materials; on Venus by biological conversion of CO2 to graphite, by canceling the greenhouse effect with high-altitude absorbing fine particles, or by a sunshield at the first Lagrangian point; and on Titan by greenhouses and/or fusion warming. However, in our present state of ignorance we cannot guarantee a stable endstate or exclude unanticipated climatic feedbacks or other unintended consequences. Moreover, as the authors illustrate by several examples, many conceivable modes of planetary engineering are so wasteful of scarce solar system resources and so destructive of important scientific information as to raise profound ethical issues, even if they were economically feasible, which they are not. Global warming on Earth may lead to calls for mitigation by planetary engineering, e.g., emplacement and replenishment of anti-greenhouse layers at high altitudes, or sunshields in space. But here especially we must be concerned about precision, stability, and inadvertent side-effects. The safest and most cost-effective means of countering global warming - beyond, e.g., improved energy efficiency, CFC bans and alternative energy sources - is the continuing reforestation of approximately 2 times 107 sq km of the Earth's surface. This can be accomplished with present technology and probably at the least cost.

  12. Planetary engineering

    Science.gov (United States)

    Pollack, James B.; Sagan, Carl

    Assuming commercial fusion power, heavy lift vehicles and major advances in genetic engineering, the authors survey possible late-21st century methods of working major transformations in planetary environments. Much more Earthlike climates may be produced on Mars by generating low freezing point greenhouse gases from indigenous materials; on Venus by biological conversion of CO2 to graphite, by canceling the greenhouse effect with high-altitude absorbing fine particles, or by a sunshield at the first Lagrangian point; and on Titan by greenhouses and/or fusion warming. However, in our present state of ignorance we cannot guarantee a stable endstate or exclude unanticipated climatic feedbacks or other unintended consequences. Moreover, as the authors illustrate by several examples, many conceivable modes of planetary engineering are so wasteful of scarce solar system resources and so destructive of important scientific information as to raise profound ethical issues, even if they were economically feasible, which they are not. Global warming on Earth may lead to calls for mitigation by planetary engineering, e.g., emplacement and replenishment of anti-greenhouse layers at high altitudes, or sunshields in space. But here especially we must be concerned about precision, stability, and inadvertent side-effects. The safest and most cost-effective means of countering global warming - beyond, e.g., improved energy efficiency, CFC bans and alternative energy sources - is the continuing reforestation of approximately 2 times 107 sq km of the Earth's surface. This can be accomplished with present technology and probably at the least cost.

  13. Web Engineering

    Energy Technology Data Exchange (ETDEWEB)

    White, Bebo

    2003-06-23

    Web Engineering is the application of systematic, disciplined and quantifiable approaches to development, operation, and maintenance of Web-based applications. It is both a pro-active approach and a growing collection of theoretical and empirical research in Web application development. This paper gives an overview of Web Engineering by addressing the questions: (a) why is it needed? (b) what is its domain of operation? (c) how does it help and what should it do to improve Web application development? and (d) how should it be incorporated in education and training? The paper discusses the significant differences that exist between Web applications and conventional software, the taxonomy of Web applications, the progress made so far and the research issues and experience of creating a specialization at the master's level. The paper reaches a conclusion that Web Engineering at this stage is a moving target since Web technologies are constantly evolving, making new types of applications possible, which in turn may require innovations in how they are built, deployed and maintained.

  14. Engineering grand challenges and the attributes of the global engineer

    DEFF Research Database (Denmark)

    Guerra, Aida; Ulseth, Ron; Jonhson, Bart

    2017-01-01

    Technology has been changing world in ways never imagined. The ever-evolving society and rapid development posed different demands and challenges to the engineering profession. Addressing these challenges means to re-vision and reform the ways we educate future engineers and the attributes need...... to be enhanced. This paper reports a literature review with aim to (1) understand the different stakeholders’ perspectives, namely students, educators, and employers, (2) understand the profile of the global engineer (i.e. knowledge, competences and skills), and (3) outline and discuss learning strategies....... As a result, the paper presents the main gaps in the existing knowledge, formulates research hypothesis, and proposes a research design for a follow up empirical study to investigate further the engineering grand challenges, the attributes needed to solve them, and the learning environments required....

  15. Performance and driveline analyses of engine capacity in range extender engine hybrid vehicle

    Science.gov (United States)

    Praptijanto, Achmad; Santoso, Widodo Budi; Nur, Arifin; Wahono, Bambang; Putrasari, Yanuandri

    2017-01-01

    In this study, range extender engine designed should be able to meet the power needs of a power generator of hybrid electrical vehicle that has a minimum of 18 kW. Using this baseline model, the following range extenders will be compared between conventional SI piston engine (Baseline, BsL), engine capacity 1998 cm3, and efficiency-oriented SI piston with engine capacity 999 cm3 and 499 cm3 with 86 mm bore and stroke square gasoline engine in the performance, emission prediction of range extender engine, standard of charge by using engine and vehicle simulation software tools. In AVL Boost simulation software, range extender engine simulated from 1000 to 6000 rpm engine loads. The highest peak engine power brake reached up to 38 kW at 4500 rpm. On the other hand the highest torque achieved in 100 Nm at 3500 rpm. After that using AVL cruise simulation software, the model of range extended electric vehicle in series configuration with main components such as internal combustion engine, generator, electric motor, battery and the arthemis model rural road cycle was used to simulate the vehicle model. The simulation results show that engine with engine capacity 999 cm3 reported the economical performances of the engine and the emission and the control of engine cycle parameters.

  16. Main: 1LR5 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available Aux311; Zea Mays Molecule: Auxin Binding Protein 1; Chain: A, B, C, D; Engineered: Yes; Mutation: Yes Protei...-.|EMBL; L08425; AAA33430.1; -.|PIR; S16262; S16262.|PDB; 1LR5; X-ray; A/B/C/D=39-201.|PDB; 1LRH; X-ray; A/B/C/D=39-201.|Mai

  17. Main: 1QN6 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available itiation Factor Tfiid-1; Chain: A, B; Synonym: Tata-Box Factor 1, Tata Sequence-Binding Protein 1, Tbp1; Eng...ineered: Yes; Molecule: Dna (5'-D(*Gp*Cp*Tp*Ap*Tp*Ap*Ap*Tp*Ap*Gp*Gp*Gp*Cp*A)-3'); Chai...n: C, E; Molecule: Dna (5'-D(*Tp*Gp*Cp*Cp*Cp*Tp*Ap*Tp*Tp*Ap*Tp*Ap*Gp*C)-3'); Chain: D, F Tata Box-Bindi

  18. Main: 1QNB [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available itiation Factor Tfiid-1; Chain: A, B; Synonym: Tata-Box Factor 1, Tata Sequence-Binding Protein 1, Tbp1; Eng...ineered: Yes; Molecule: Dna (5'-D(*Gp*Cp*Tp*Ap*Tp*Ap*Ap*Ap*Tp*Gp*Gp*Gp*Cp*A)-3'); Chai...n: C, E; Molecule: Dna (5'-D(*Tp*Gp*Cp*Cp*Cp*Ap*Tp*Tp*Tp*Ap*Tp*Ap*Gp*C)-3'); Chain: D, F Tata Box-Bindi

  19. Main: 1QN5 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available itiation Factor Tfiid-1; Chain: A, B; Synonym: Tata-Box Factor 1, Tata Sequence-Binding Protein 1, Tbp1; Eng...ineered: Yes; Molecule: Dna (5'-D(*Gp*Cp*Tp*Ap*Tp*Ap*Ap*Gp*Ap*Gp*Gp*Gp*Cp*A)-3'); Chai...n: C, E; Molecule: Dna (5'-D(*Tp*Gp*Cp*Cp*Cp*Tp*Cp*Tp*Tp*Ap*Tp*Ap*Gp*C)-3'); Chain: D, F Tata Box-Bindi

  20. Main: 1EQK [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1EQK イネ Rice Oryza sativa L. Cysteine Proteinase Inhibitor-I Oryza Sativa Molecule: Oryzacystatin-I; Chai...n: A; Engineered: Yes Hydrolase Inhibitor K.Nagata, N.Kudo, K.Abe, S.Arai, M.Tanokura ...K.Nagata, N.Kudo, K.Abe, S.Arai, M.Tanokura Three-Dimensional Solution Structure Of Oryzacystatin-I, A Cyste

  1. Main: 1QNA [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available itiation Factor Tfiid-1; Chain: A, B; Synonym: Tata-Box Factor 1, Tata Sequence-Binding Protein 1, Tbp1; Eng...ineered: Yes; Molecule: Dna (5'-D(*Gp*Cp*Tp*Tp*Tp*Ap*Ap*Ap*Ap*Gp*Gp*Gp*Cp*A)-3'); Chai...n: C, E; Molecule: Dna (5'-D(*Tp*Gp*Cp*Cp*Cp*Tp*Tp*Tp*Tp*Ap*Ap*Ap*Gp*C)-3'); Chain: D, F Tata Box-Bindi

  2. COBRA System Engineering Processes to Achieve SLI Strategic Goals

    Science.gov (United States)

    Ballard, Richard O.

    2003-01-01

    The COBRA Prototype Main Engine Development Project was an endeavor conducted as a joint venture between Pratt & Whitney and Aerojet to conduct risk reduction in LOX/LH2 main engine technology for the NASA Space Launch Initiative (SLI). During the seventeen months of the project (April 2001 to September 2002), approximately seventy reviews were conducted, beginning with the Engine Systems Requirements Review (SRR) and ending with the Engine Systems Interim Design Review (IDR). This paper discusses some of the system engineering practices used to support the reviews and the overall engine development effort.

  3. Designed by Engineers: An analysis of interactionaries with engineering students

    Directory of Open Access Journals (Sweden)

    Henrik Artman

    2014-12-01

    Full Text Available The aim of this study is to describe and analyze learning taking place in a collaborative design exercise involving engineering students. The students perform a time-constrained, open-ended, complex interaction design task, an “interactionary”. A multimodal learning perspective is used. We have performed detailed analyses of video recordings of the engineering students, including classifying aspects of interaction. Our results show that the engineering students carry out and articulate their design work using a technology-centred approach and focus more on the function of their designs than on aspects of interaction. The engineering students mainly make use of ephemeral communication strategies (gestures and speech rather than sketching in physical materials. We conclude that the interactionary may be an educational format that can help engineering students learn the messiness of design work. We further identify several constraints to the engineering students’ design learning and propose useful interventions that a teacher could make during an interactionary. We especially emphasize interventions that help engineering students-retain aspects of human-centered design throughout the design process. This study partially replicates a previous study which involved interaction design students.

  4. CTR plasma engineering studies

    International Nuclear Information System (INIS)

    Miley, G.H.

    1990-01-01

    The main focus of the work by the Fusion Plasma Engineering Group at the University during the prior contract year involved a study of fusion ash (helium) effects on burn efficiency and on potential ways to control ash buildup. This work has wide application to a variety of fusion reactor concepts, but the immediate application for the present work is in the ARIES tokamak reactor design study now being undertaken by a national design team headed by the UCLA. The examples presented here largely deal with the ARIES-I design which is a D-T device operating in the first instability regime

  5. Hillshades for the main 8 Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — These hillshade datasets were derived from USGS 7.5' DEM Quads for the main 8 Hawaiian Islands. Individual DEM quads were first converted to a common datum, and...

  6. Nuclear power station main control room habitability

    International Nuclear Information System (INIS)

    Paschal, W.B.; Knous, W.S.

    1989-01-01

    The main control room at a nuclear power station must remain habitable during a variety of plant conditions and postulated events. The control room habitability requirement and the function of the heating, ventilating, air-conditioning, and air treatment system are to control environmental factors, such as temperature, pressure, humidity, radiation, and toxic gas. Habitability requirements provide for the safety of personnel and enable operation of equipment required to function in the main control room. Habitability as an issue has been gaining prominence with the Advisor Committee of Reactor Safeguards and the Nuclear Regulatory Commission since the incident at Three Mile Island. Their concern is the ability of the presently installed habitability systems to control the main control room environment after an accident. This paper discusses main control room HVAC systems; the concern, requirements, and results of NRC surveys and notices; and an approach to control room habitability reviews

  7. Seasonal Composite Chlorophyll Concentrations - Gulf of Maine

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This personal geodatabase contains raster images of chlorophyll concentrations in the Gulf of Maine. These raster images are seasonal composites, and were calculated...

  8. Collins' bypass for the main ring

    International Nuclear Information System (INIS)

    Ohnuma, S.

    1982-01-01

    Design of the bypass for the main ring at Fermilab is discussed. Specific design features discussed include space, path length, geometric closure, matching of betatron functions, and external dispersion. Bypass parameters are given

  9. Monthly Composite Chlorophyll Concentrations - Gulf of Maine

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This personal geodatabase contains raster images of chlorophyll concentrations in the Gulf of Maine. These raster images are monthly composites, and were calculated...

  10. 2015 City of Portland, Maine, Lidar

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — 2015 City of Portland Maine Lidar Data Acquisition and Processing Woolpert Order No. 75564 Contractor: Woolpert, Inc. This task is for a high resolution data set of...

  11. 2016 USGS Lidar DEM: Maine QL2

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Product: These are Digital Elevation Model (DEM) data for Franklin, Oxford, Piscataquis, and Somerset Counties, Maine as part of the required deliverables for the...

  12. Materials Science and Engineering |

    Science.gov (United States)

    Engineering? What Is Materials Science and Engineering? MSE combines engineering, physics and chemistry to solve problems in nanotechnology, biotechnology, information technology, energy, manufacturing, and more ,' which could replace steel. Materials Science and Mechanical Engineering Professors work together to

  13. Readings in artificial intelligence and software engineering

    CERN Document Server

    Rich, Charles

    1986-01-01

    Readings in Artificial Intelligence and Software Engineering covers the main techniques and application of artificial intelligence and software engineering. The ultimate goal of artificial intelligence applied to software engineering is automatic programming. Automatic programming would allow a user to simply say what is wanted and have a program produced completely automatically. This book is organized into 11 parts encompassing 34 chapters that specifically tackle the topics of deductive synthesis, program transformations, program verification, and programming tutors. The opening parts p

  14. 23rd International Conference on Systems Engineering

    CERN Document Server

    Zydek, Dawid; Chmaj, Grzegorz

    2015-01-01

    This collection of proceedings from the International Conference on Systems Engineering, Las Vegas, 2014 is orientated toward systems engineering, including topics like aerospace, power systems, industrial automation and robotics, systems theory, control theory, artificial intelligence, signal processing, decision support, pattern recognition and machine learning, information and communication technologies, image processing, and computer vision as well as its applications. The volume’s main focus is on models, algorithms, and software tools that facilitate efficient and convenient utilization of modern achievements in systems engineering.

  15. DIC-CAM recipe for reverse engineering

    Science.gov (United States)

    Romero-Carrillo, P.; Lopez-Alba, E.; Dorado, R.; Diaz-Garrido, F. A.

    2012-04-01

    Reverse engineering (RE) tries to model and manufacture an object from measurements one of a reference object. Modern optical measurement systems and computer aided engineering software have improved reverse engineering procedures. We detail the main RE steps from 3D digitalization by Digital Image Correlation to manufacturing. The previous description is complemented with an application example, which portrays the performance of RE. The differences between original and manufactured objects are less than 2 mm (close to the tool radius).

  16. Advances in Computer Science and Engineering

    CERN Document Server

    Second International Conference on Advances in Computer Science and Engineering (CES 2012)

    2012-01-01

    This book includes the proceedings of the second International Conference on Advances in Computer Science and Engineering (CES 2012), which was held during January 13-14, 2012 in Sanya, China. The papers in these proceedings of CES 2012 focus on the researchers’ advanced works in their fields of Computer Science and Engineering mainly organized in four topics, (1) Software Engineering, (2) Intelligent Computing, (3) Computer Networks, and (4) Artificial Intelligence Software.

  17. Molecular clusters of the main group elements

    CERN Document Server

    Driess, Matthias

    2008-01-01

    ""To summarize, Molecular Clusters of the Main Group Elements is certainly not a popular science book, nor is it a textbook; it is a very good, up-to-date collection of articles for the specialist. Als Fazit bleibt: Molecular Clusters of the Main Group Elements ist sicher kein populissenschaftliches Werk, auch kein Lehrbuch, aber eine gelungene, hoch aktuelle Zusammenstellung fen interessierten Fachmann."" -Michael Ruck, TU Dresden, Angewandte Chemie, 2004 - 116/36 + International Edition 2004 - 43/36

  18. Revisiting Reuse in Main Memory Database Systems

    OpenAIRE

    Dursun, Kayhan; Binnig, Carsten; Cetintemel, Ugur; Kraska, Tim

    2016-01-01

    Reusing intermediates in databases to speed-up analytical query processing has been studied in the past. Existing solutions typically require intermediate results of individual operators to be materialized into temporary tables to be considered for reuse in subsequent queries. However, these approaches are fundamentally ill-suited for use in modern main memory databases. The reason is that modern main memory DBMSs are typically limited by the bandwidth of the memory bus, thus query execution ...

  19. Engineering education research in European Journal of Engineering Education and Journal of Engineering Education: citation and reference discipline analysis

    Science.gov (United States)

    Wankat, Phillip C.; Williams, Bill; Neto, Pedro

    2014-01-01

    The authors, citations and content of European Journal of Engineering Education (EJEE) and Journal of Engineering Education (JEE) in 1973 (JEE, 1975 EJEE), 1983, 1993, 2003, and available 2013 issues were analysed. Both journals transitioned from house organs to become engineering education research (EER) journals, although JEE transitioned first. In this process the number of citations rose, particularly of education and psychology sources; the percentage of research articles increased markedly as did the number of reference disciplines. The number of papers per issue, the number of single author papers, and the citations of science and engineering sources decreased. EJEE has a very broad geographic spread of authors while JEE authors are mainly US based. A 'silo' mentality where general engineering education researchers do not communicate with EER researchers in different engineering disciplines is evident. There is some danger that EER may develop into a silo that does not communicate with technically oriented engineering professors.

  20. Engineering justice transforming engineering education and practice

    CERN Document Server

    Leydens, Jon A

    2018-01-01

    Using social justice as a catalyst for curricular transformation, Engineering Justice presents an examination of how politics, culture, and other social issues are inherent in the practice of engineering. It aims to align engineering curricula with socially just outcomes, increase enrollment among underrepresented groups, and lessen lingering gender, class, and ethnicity gaps by showing how the power of engineering knowledge can be explicitly harnessed to serve the underserved and address social inequalities. This book is meant to transform the way educators think about engineering curricula through creating or transforming existing courses to attract, retain, and motivate engineering students to become professionals who enact engineering for social justice. Engineering Justice offers thought-provoking chapters on: why social justice is inherent yet often invisible in engineering education and practice; engineering design for social justice; social justice in the engineering sciences; social justice in human...

  1. Signals in Communication Engineering History

    Science.gov (United States)

    Consonni, Denise; Silva, Magno T. M.

    2010-01-01

    This paper is a study of various electric signals, which have been employed throughout the history of communication engineering in its two main landmarks: the telegraph and the telephone. The signals are presented in their time and frequency domain representations. The historical order has been followed in the presentation: wired systems, spark…

  2. Model-based Software Engineering

    DEFF Research Database (Denmark)

    Kindler, Ekkart

    2010-01-01

    The vision of model-based software engineering is to make models the main focus of software development and to automatically generate software from these models. Part of that idea works already today. But, there are still difficulties when it comes to behaviour. Actually, there is no lack in models...

  3. Introduction to human factors engineering

    International Nuclear Information System (INIS)

    Derfuss, Ch.

    2010-01-01

    Some of the main aspects of human factors engineering are discussed. The following topics are considered: Integration into the design process; Identification and application of human-centered design requirements; Design of error-tolerant systems; Iterative process consisting of evaluations and feedback loops; Participation of operators/users; Utilization of an interdisciplinary design/ evaluation team; Documentation of the complete HFE-process: traceability

  4. Moral Fantasy in Genetic Engineering.

    Science.gov (United States)

    Boone, C. Keith

    1984-01-01

    Discusses the main ethical issues generated by the new genetics and suggests ways to think about them. Concerns include "playing God," violation of the natural order of the universe, and abuse of genetic technology. Critical distinctions for making difficult decisions about genetic engineering issues are noted. (DH)

  5. Young engineers of South Africa

    CSIR Research Space (South Africa)

    Beyers, R

    2007-04-01

    Full Text Available The Young Engineers of South Africa Programme (YESA) also endorses the e-Education and the Science and Technology White Papers. The main focus area will be on Information Communication Technologies (ICT) in education and the way that they can impact...

  6. Artificial Intelligence in Civil Engineering

    Directory of Open Access Journals (Sweden)

    Pengzhen Lu

    2012-01-01

    Full Text Available Artificial intelligence is a branch of computer science, involved in the research, design, and application of intelligent computer. Traditional methods for modeling and optimizing complex structure systems require huge amounts of computing resources, and artificial-intelligence-based solutions can often provide valuable alternatives for efficiently solving problems in the civil engineering. This paper summarizes recently developed methods and theories in the developing direction for applications of artificial intelligence in civil engineering, including evolutionary computation, neural networks, fuzzy systems, expert system, reasoning, classification, and learning, as well as others like chaos theory, cuckoo search, firefly algorithm, knowledge-based engineering, and simulated annealing. The main research trends are also pointed out in the end. The paper provides an overview of the advances of artificial intelligence applied in civil engineering.

  7. Women withdrawers in engineering studies : identity formation and learning culture as gendered barriers for persistence?

    OpenAIRE

    Wolffram, Andrea; Derboven, Wibke; Winker, Gabriele

    2009-01-01

    Scholarship on women in engineering education mainly focuses on the question of how to attract more women to this subject. The topic concerning women in engineering education is here guided by the question of why women leave engineering studies. The paper aims to examine the main conflicts women encounter in engineering education and to derive implications for interventions suited for strengthening institutional bonding forces.

  8. Stirling Engine Controller

    Science.gov (United States)

    Blaze, Gina M.

    2004-01-01

    and also safely shutdown the engines. The test will last for a period of 8000 to 9000 hours. Other types of tests that have been performed are: performance mapping, controller development, launch environment, and vibration emissions testing. Currently, the thermo-mechanical system branch is housing a RG-350, a stirling convertor. The convertor was used in previous tests such as a Hall Thruster test, world s first integrated test of a dynamic power system with electric propulsion. Another test performed was to conclude if free piston stirling convertors can be synchronized for vibration balancing, with no thermodynamic or electrical connections and not cause both to shutdown if one failed. The ability to reduce vibration by synchronizing convertor operation but still be able to operate when one partner fails is pertinent in space and terrestrial applications. The convertor is now being brought back into operation and a controller is in the process of being developed. This convertor will be used as a testbed for new controllers. I worked with Mary Ellen Roth on the electric engineering aspects of the RG-350. My main goal was to enhance the data collection process. I worked on different aspects of the RG-350, with a main focus on the engine controller. I drew a schematic of the wire connections in the engine controller, using PCB Express, so that a plan could be devised to connect the power meter properly between the output of the engine and the engine controller. I measured the power using two different instruments: Valhalla Scientific power meter and Ohio Semitronics power measurement device. The convertor is connected to an Agilent 34970A Data Acquisition/Switch Unit, which allows the user to measure, record, and monitor voltage, current, frequency, and temperature. I assisted in preparing the Data Acquisition for general operation. I also helped test a panel of transducers, which will be placed in the rack that powers and monitors the convertor.

  9. Rail Engineering and Education Symposium Materials.

    Science.gov (United States)

    2016-05-26

    The objective of this project is to develop curricular materials for the Rail Engineering and Education : Symposia held in the summers of 2012 and 2014. : Description of Activities : The main approach to accomplish the activity is to develop and deli...

  10. Economic engineering applied to the fishery industry

    National Research Council Canada - National Science Library

    Zugarramurdi, Aurora; Parin, Maria A; Lupin, Hector M

    1995-01-01

    .... The main topics discussed are: production engineering, capital investment costs, production costs, micro-economic analysis of production, analysis and selection of alternatives, profitability and quality and safety economics...

  11. Synthetic biology and metabolic engineering.

    Science.gov (United States)

    Stephanopoulos, Gregory

    2012-11-16

    Metabolic engineering emerged 20 years ago as the discipline occupied with the directed modification of metabolic pathways for the microbial synthesis of various products. As such, it deals with the engineering (design, construction, and optimization) of native as well as non-natural routes of product synthesis, aided in this task by the availability of synthetic DNA, the core enabling technology of synthetic biology. The two fields, however, only partially overlap in their interest in pathway engineering. While fabrication of biobricks, synthetic cells, genetic circuits, and nonlinear cell dynamics, along with pathway engineering, have occupied researchers in the field of synthetic biology, the sum total of these areas does not constitute a coherent definition of synthetic biology with a distinct intellectual foundation and well-defined areas of application. This paper reviews the origins of the two fields and advances two distinct paradigms for each of them: that of unit operations for metabolic engineering and electronic circuits for synthetic biology. In this context, metabolic engineering is about engineering cell factories for the biological manufacturing of chemical and pharmaceutical products, whereas the main focus of synthetic biology is fundamental biological research facilitated by the use of synthetic DNA and genetic circuits.

  12. Software Engineering Education: Some Important Dimensions

    Science.gov (United States)

    Mishra, Alok; Cagiltay, Nergiz Ercil; Kilic, Ozkan

    2007-01-01

    Software engineering education has been emerging as an independent and mature discipline. Accordingly, various studies are being done to provide guidelines for curriculum design. The main focus of these guidelines is around core and foundation courses. This paper summarizes the current problems of software engineering education programs. It also…

  13. Microprocessor engineering

    CERN Document Server

    Holdsworth, B

    2013-01-01

    Microprocessor Engineering provides an insight in the structures and operating techniques of a small computer. The book is comprised of 10 chapters that deal with the various aspects of computing. The first two chapters tackle the basic arithmetic and logic processes. The third chapter covers the various memory devices, both ROM and RWM. Next, the book deals with the general architecture of microprocessor. The succeeding three chapters discuss the software aspects of machine operation, while the last remaining three chapters talk about the relationship of the microprocessor with the outside wo

  14. Building Process and Architectural Planning Characteristics of Daehan Hospital Main Building

    Directory of Open Access Journals (Sweden)

    Geauchul LEE

    2016-04-01

    Full Text Available This paper explores the introduction process of Daehan Hospital from Japan as the modern medical facility in Korea, and the architectural planning characteristics as a medical facility through the detailed building process of Daehan Hospital main building. The most noticeable characteristic of Daehan Hospital is that it was designed and constructed not by Korean engineers but by Japanese engineers. Therefore, Daehan Hospital was influenced by Japanese early modern medical facility, and Japanese engineers modeled Daehan Hospital main building on Tokyo Medical School main building which was constructed in 1876 as the first national medical school and hospital. The architectural type of Tokyo Medical School main building was a typical school architecture in early Japanese modern period which had a middle corridor and a pseudo Western-style tower, but Tokyo Medical School main building became the model of a medical facility as the symbol of the medical department in Tokyo Imperial University. This was the introduction and transplantation process of Japanese modern ‘model’ like as other modern systems and technologies during the Korean modern transition period. However, unlike Tokyo Medical School main building, Daehan Hospital main building was constructed not as a wooden building but as a masonry building. Comparing with the function of Daehan Hospital main building, its architectural form and construction costs was excessive scale, which was because Japanese Resident-General of Korea had the intention of ostentation that Japanese modernity was superior to Korean Empire.

  15. [Building Process and Architectural Planning Characteristics of Daehan Hospital Main Building].

    Science.gov (United States)

    Lee, Geauchul

    2016-04-01

    This paper explores the introduction process of Daehan Hospital from Japan as the modern medical facility in Korea, and the architectural planning characteristics as a medical facility through the detailed building process of Daehan Hospital main building. The most noticeable characteristic of Daehan Hospital is that it was designed and constructed not by Korean engineers but by Japanese engineers. Therefore, Daehan Hospital was influenced by Japanese early modern medical facility, and Japanese engineers modeled Daehan Hospital main building on Tokyo Medical School main building which was constructed in 1876 as the first national medical school and hospital. The architectural type of Tokyo Medical School main building was a typical school architecture in early Japanese modern period which had a middle corridor and a pseudo Western-style tower, but Tokyo Medical School main building became the model of a medical facility as the symbol of the medical department in Tokyo Imperial University. This was the introduction and transplantation process of Japanese modern 'model' like as other modern systems and technologies during the Korean modern transition period. However, unlike Tokyo Medical School main building, Daehan Hospital main building was constructed not as a wooden building but as a masonry building. Comparing with the function of Daehan Hospital main building, its architectural form and construction costs was excessive scale, which was because Japanese Resident-General of Korea had the intention of ostentation that Japanese modernity was superior to Korean Empire.

  16. Applications of human factors engineering in the digital HMI

    International Nuclear Information System (INIS)

    Zhou Bingjian

    2014-01-01

    In order to prevent and minimize human errors in the digital main control room, the principles of human factors engineering must be complied strictly in the design process of digital human-machine interface. This paper briefly describes the basic human factors engineering principles of designing main control room, introduces the main steps to implement the human factors engineering verification and validation of main control room, including HSI task support verification, human factors engineering design verification and integrated system validation. Meanwhile, according to the new digital human-machine interface characteristics, the development models of human error are analyzed. (author)

  17. Ontological engineering versus metaphysics

    Science.gov (United States)

    Tataj, Emanuel; Tomanek, Roman; Mulawka, Jan

    2011-10-01

    It has been recognized that ontologies are a semantic version of world wide web and can be found in knowledge-based systems. A recent time survey of this field also suggest that practical artificial intelligence systems may be motivated by this research. Especially strong artificial intelligence as well as concept of homo computer can also benefit from their use. The main objective of this contribution is to present and review already created ontologies and identify the main advantages which derive such approach for knowledge management systems. We would like to present what ontological engineering borrows from metaphysics and what a feedback it can provide to natural language processing, simulations and modelling. The potential topics of further development from philosophical point of view is also underlined.

  18. IAEA activities and main achievements on human resource management and training of nuclear power plant personnel

    International Nuclear Information System (INIS)

    Kossilov, A.

    2002-01-01

    The Nuclear Power Engineering Section is responsible for implementation of the Agency's sub-programme on Engineering and Management Support for Competitive Nuclear Power. The objectives of the sub-programme is to increase Member State capabilities in utilizing the best engineering and management practices for improving NPP performance and competitiveness, optimizing plant service life and decommissioning and strengthening nuclear power infrastructure. NPES' main activities cover: Nuclear power infrastructure, Knowledge management, Personal training and qualification, Quality Management and QA, NPP life management including databases, Modern NPP control and instrumentation, and NPP performance management

  19. Engineering Encounters: Teaching Educators about Engineering

    Science.gov (United States)

    Tank, Kristina M.; Raman, D. Raj; Lamm, Monica H.; Sundararajan, Sriram; Estapa, Anne

    2017-01-01

    This column presents ideas and techniques to enhance science teaching. This month's issue describes preservice elementary teachers learning engineering principles from engineers. Few elementary teachers have experience with implementing engineering into the classroom. While engineering professional development opportunities for inservice teachers…

  20. Main building fire drill safely concluded

    CERN Document Server

    CERN Bulletin

    2015-01-01

    Last week, a simulated fire in the stairwell of the Main Building put CERN’s emergency response procedures to the test.   Firefighters descend the stairwell in the Main Building as the simulated fire rises.   At 2 p.m. on 22 September, alarms sounded around CERN’s Main Building as an evacuation exercise got underway. A simulated fire in the  stairwell, complete with very realistic smoke, led to the evacuation of one of the busiest places at CERN. The Main Building complex includes the Carlson Wagonlit travel agency, the post office, UBS, Uniqa, the Users Office, the Staff Association and the Novae restaurant as well as the Main Auditorium, the Council Chamber and the Charpak meeting room. It was impressive to see how quickly the smoke propagated in the staircase as well as into the corridors, and equally impressive to see how smoothly, quickly and efficiently the evacuation proceeded. The...

  1. Guide to the Main Ring DO overpass

    International Nuclear Information System (INIS)

    Turkot, F.

    1985-01-01

    The DO overpass is a modification of the beam orbit in Main Ring in order to better accommodate a Tevatron collider detector at DO. The orbit is moved up approx. 51 inches over most of the long straight section at DO, thus making the Main Ring the world's first non-planar proton synchrotron. A similar overpass, but with four times the displacement, is planned for the CDF detector at the BO straight section. The nominal separation between the beam orbit in the Main Ring and the orbit in the Tevatron is 25.5 inches. Early in the design study of a detector that would utilize the Tevatron is a anti pp collider, it was apparent that a larger separation at the detector was highly desirable. In 1981, Tom Collins proposed a specific lattice geometry in the Main Ring for achieving larger separation, called ''the screw beam''. His proposal has served as the basis for the design of both the BO and DO overpasses. The main purpose of this report is to describe in some detail the implementation of the DO overpass. Topics to be covered include: (a) geometry of the overpass orbit, (b) the new hardware in the tunnel, (c) the power supply system, (d) the control facility, (e) accelerator beam dynamics ramifications, and (f) commissioning experience. A secondary purpose is to provide a fairly complete ''bibliography'' to the sources of information on the overpass. 17 refs., 17 figs

  2. Main: 1LR4 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1LR4 トウモロコシ Corn Zea mays L. Casein Kinase Ii, Alpha Chain Name=Ack2; Zea Mays Mole...cule: Protein Kinase Ck2; Chain: A; Synonym: Casein Kinase Ii, Alpha Chain; Engineered: Yes Transferase 2.7....ray; A=2-326.|PDB; 1M2Q; X-ray; A=2-328.|PDB; 1M2R; X-ray; A=2-328.|PDB; 1OM1; X-ray; A=1-332.|Mai

  3. Main: 1UT7 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1UT7 シロイヌナズナ Arabidopsis Arabidopsis thaliana (L.) Heynh. Nac-Domain Containing Pro... Meristem Protein; Synonym: Nam, Anac, Abscisic Acid Responsive Nac, Dicyanoaurate Derivative; Chain: A, B; ...Fragment: Dna-Binding Nac Domain, Residues 1-168; Engineered: Yes; Other_details:...A.Ernst, A.N.Olsen, K.Skriver, S.Larsen, L.Lo Leggio Structure Of The Conserved Domain Of Anac, A Member Of ... Transcription Factor, Dna Binding, Abscisic Acid Response, Arabidopsis Thaliana, Crystal Structure, Nac Domai

  4. A review of free-piston engine history and applications

    Energy Technology Data Exchange (ETDEWEB)

    Mikalsen, R.; Roskilly, A.P. [School of Marine Science and Technology, University of Newcastle upon Tyne, Newcastle upon Tyne NE1 7RU (United Kingdom)

    2007-10-15

    This document reviews the history of free-piston internal combustion engines, from the air compressors and gas generators used in the mid-20th century through to recent free-piston hydraulic engines and linear electric generators. Unique features of the free-piston engine are presented and their effects on engine operation are discussed, along with potential advantages and disadvantages compared to conventional engines. The paper focuses mainly on developed engines where operational data has been reported. Finally, the potential of the free-piston engine is evaluated and the most promising designs identified. (author)

  5. Elements of earthquake engineering and structural dynamics. 2. ed.

    International Nuclear Information System (INIS)

    Filiatrault, A.

    2002-01-01

    This book is written for practising engineers, senior undergraduate and junior structural-engineering students, and university educators. Its main goal is to provide basic knowledge to structural engineers who have no previous knowledge about earthquake engineering and structural dynamics. Earthquake engineering is a multidisciplinary science. This book is not limited to structural analysis and design. The basics of other relevant topics (such as geology, seismology, and geotechnical engineering) are also covered to ensure that structural engineers can interact efficiently with other specialists during a construction project in a seismic zone

  6. Three-dimensional tolerance investigation on main ITER components

    International Nuclear Information System (INIS)

    Reich, J.; Chiocchio, S.; Cordier, J.-J.; Gallix, R.; Guerin, O.; Halcrow, T.

    2009-01-01

    ITER has to focus on all processes that ensure the permanent consistency between the requirements of ITER and the performance attributes of its components. This includes integration tolerance studies. One of the main goals of this work is to establish a sufficient tolerance scheme for all main components. The investigation in sufficient tolerance studies at a very early stage of the project will result in cost savings during the installation process. Due to the complexity of the ITER components and their several interfaces to their surroundings, it is advantageous to perform tolerance studies with a specialised tool like 'three-dimensional control systems' (3DCS) that is compatible with the ITER CATIA-V5 CAD engineering system and Enovia PRC environment. On single components (e.g. Magnet TF Coils) detailed two-dimensional tolerance schemes have been developed from the beginning. Using them as a starting point, functional or key interface tolerances have to be defined. Furthermore the tolerance studies have to consider the different configurations of each component (e.g. manufacturing stages, assembly plan, integration with surrounding, operation conditions). Especially for assembly it is necessary to analyse the final ranges which have to be achieved during the installation process. From the integration point of view, the key tolerances of all main in-cryostat ITER components have to be brought together in a complete and consistent manner.

  7. Main Coast Winds - Final Scientific Report

    Energy Technology Data Exchange (ETDEWEB)

    Jason Huckaby; Harley Lee

    2006-03-15

    The Maine Coast Wind Project was developed to investigate the cost-effectiveness of small, distributed wind systems on coastal sites in Maine. The restructuring of Maine's electric grid to support net metering allowed for the installation of small wind installations across the state (up to 100kW). The study performed adds insight to the difficulties of developing cost-effective distributed systems in coastal environments. The technical hurdles encountered with the chosen wind turbine, combined with the lower than expected wind speeds, did not provide a cost-effective return to make a distributed wind program economically feasible. While the turbine was accepted within the community, the low availability has been a negative.

  8. Transition crossing in the main injector

    International Nuclear Information System (INIS)

    Wei, J.

    1990-01-01

    This report summarizes the study of various longitudinal problems pertaining to the transition-energy crossing in the proposed Fermi Lab Main Injector. The theory indicates that the beam loss and bunch-area growth are mainly caused by the chromatic non-linear effect, which is enhanced by the space-charge force near transition. Computer simulation using the program TIBETAN shows that a ''γ T jump'' of about 1.5 unit within 1 ms is adequate to achieve a ''clean'' crossing in the currently proposed h=588 scenario. 19 refs., 4 figs

  9. The Fermilab Main Injector Technical Design Handbook

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    1994-08-01

    This report contains a description of the design, cost estimate, and construction schedule of the Fermilab Main Injector (FMI) Project. The technical, cost, and schedule baselines for the FMI Project have already been established and may be found in the Fermilab Main Injector Title I Design Report, issued in August 1992. This report updates and expands upon the design and schedule for construction of all subsystem components and associated civil construction described in the Title I Design Report. The facilities described have been designed in conformance with DOE 6430.1A, "United States Department of Energy General Design Criteria."

  10. Current Russian patriotism: matter, features, main directions

    Directory of Open Access Journals (Sweden)

    Lutovinov Vladimir Ilich

    2013-11-01

    Full Text Available The article considers understanding and the main point of patriotism as one of high cultural values. The main approaches that reveal different sides of this phenomenon, its role and importance in a history of Russia in the 21st century are inferred from the analysis of viewpoints of Russian thinkers and contemporary researchers. The patriotism formation problems in Russian society and their condition are defined, the need of patriotic level rise as one of the conditions for great Russia rebirth is substantiated.

  11. Bunch coalescing in the Fermilab Main Ring

    International Nuclear Information System (INIS)

    Wildman, D.; Martin, P.; Meisner, K.; Miller, H.W.

    1987-01-01

    A new RF system has been installed in the Fermilab Main Ring to coalesce up to 13 individual bunches of protons or antiprotons into a single high-intensity bunch. The coalescing process consists of adiabatically reducing the h=1113 Main Ring RF voltage from 1 MV to less than 1 kV, capturing the debunched beam in a linearized h=53 and h=106 bucket, rotating for a quarter of a synchrotron oscillation period, and then recapturing the beam in a single h=1113 bucket. The new system is described and the results of recent coalescing experiments are compared with computer-generated particle tracking simulations

  12. An engineering context for software engineering

    OpenAIRE

    Riehle, Richard D.

    2008-01-01

    New engineering disciplines are emerging in the late Twentieth and early Twenty-first Century. One such emerging discipline is software engineering. The engineering community at large has long harbored a sense of skepticism about the validity of the term software engineering. During most of the fifty-plus years of software practice, that skepticism was probably justified. Professional education of software developers often fell short of the standard expected for conventional engineers; so...

  13. Are women engineers in Lebanon prepared for the challenges of an engineering profession?

    Science.gov (United States)

    Baytiyeh, Hoda

    2013-08-01

    This study investigates the status of women engineers in the Middle East, considering women engineers in Lebanon as a case study. The author investigated the following questions: What are the influences behind females' decisions to choose engineering as their major course of study? What are the motives behind this decision? What are the perceptions of females regarding the essential skills for a successful engineering career? An online survey consisting of Likert-scale items was completed by 327 female engineers who graduated from universities in Lebanon and now work in various locations around the world. A genuine interest in the field appeared to be the main influence in the participants' decisions to choose engineering profession. The potential for professional growth was the leading motivator for choosing engineering. Although participants reported that they possessed adequate theoretical knowledge and technical skills before graduation, in the actual practice of engineering, they noted weaknesses in creativity and innovation.

  14. Maine Tidal Power Initiative: Environmental Impact Protocols For Tidal Power

    Energy Technology Data Exchange (ETDEWEB)

    Peterson, Michael Leroy [Univ. of Maine, Orono, ME; Zydlewski, Gayle Barbin [Univ. of Maine, Orono, ME; Xue, Huijie [Univ. of Maine, Orono, ME; Johnson, Teresa R. [Univ. of Maine, Orono, ME

    2014-02-02

    The Maine Tidal Power Initiative (MTPI), an interdisciplinary group of engineers, biologists, oceanographers, and social scientists, has been conducting research to evaluate tidal energy resources and better understand the potential effects and impacts of marine hydro-kinetic (MHK) development on the environment and local community. Project efforts include: 1) resource assessment, 2) development of initial device design parameters using scale model tests, 3) baseline environmental studies and monitoring, and 4) human and community responses. This work included in-situ measurement of the environmental and social response to the pre-commercial Turbine Generator Unit (TGU®) developed by Ocean Renewable Power Company (ORPC) as well as considering the path forward for smaller community scale projects.

  15. Mechanical engineering

    International Nuclear Information System (INIS)

    1988-01-01

    The Mechanical Engineering Division provides the other NAC divisions with design and construction services. Items of special mechanical significance are discussed here. The projects which received major design attention during the past year were: a coupling capacitor for SPC2; a bending magnet and solenoid for ECR ion source; a scanner for outer orbits of the SSC; a scattering chamber for an experimental beamline; a beam swinger; a rotary target magazine for isotope production; a robot arm for isotope production; an isotope transport system and a target cooling system for isotope production. The major projects that were under construction are: a magnetic spectrometer; a second injector cyclotron (SPC2) and extensions to the high-energy beamlines. 4 figs

  16. Engineering viscoelasticity

    CERN Document Server

    Gutierrez-Lemini, Danton

    2014-01-01

    Engineering Viscoelasticity covers all aspects of the thermo- mechanical response of viscoelastic substances that a practitioner in the field of viscoelasticity would need to design experiments, interpret test data, develop stress-strain models, perform stress analyses, design structural components, and carry out research work. The material in each chapter is developed from the elementary to the advanced, providing the background in mathematics and mechanics that are central to understanding the subject matter being presented. The book examines how viscoelastic materials respond to the application of loads, and provides practical guidelines to use them in the design of commercial, military and industrial applications. This book also: ·         Facilitates conceptual understanding by progressing in each chapter from elementary to challenging material ·         Examines in detail both differential and integral constitutive equations, devoting full chapters to each type and using both forms in ...

  17. Engineering electromagnetics

    CERN Document Server

    Thomas, David T; Hartnett, James P; Hughes, William F

    1973-01-01

    The applications involving electromagnetic fields are so pervasive that it is difficult to estimate their contribution to the industrial output: generation of electricity, power transmission lines, electric motors, actuators, relays, radio, TV and microwave transmission and reception, magnetic storage, and even the mundane little magnet used to hold a paper note on the refrigerator are all electromagnetic in nature. One would be hard pressed to find a device that works without relaying on any electromagnetic principle or effect. This text provides a good theoretical understanding of the electromagnetic field equations but also treats a large number of applications. In fact, no topic is presented unless it is directly applicable to engineering design or unless it is needed for the understanding of another topic. In electrostatics, for example, the text includes discussions of photocopying, ink-jet printing, electrostatic separation and deposition, sandpaper production, paint spraying, and powder coating. In ma...

  18. Regenerative engineering

    CERN Document Server

    Laurencin, Cato T

    2013-01-01

    Regenerative Engineering: The Future of Medicine Saadiq F. El-Amin III , MD , PhD; Joylene W.L. Thomas, MD ; Ugonna N. Ihekweazu, MD ; Mia D. Woods, MS; and Ashim Gupta, MSCell Biology Gloria Gronowicz, PhD and Karen Sagomonyants, DMDStem Cells and Tissue Regeneration Kristen Martins-Taylor, PhD; Xiaofang Wang, MD , PhD; Xue-Jun Li, PhD; and Ren-He Xu, MD , PhDIntroduction to Materials Science Sangamesh G. Kumbar, PhD and Cato T. Laurencin, MD , PhDBiomaterials A. Jon Goldberg, PhD and Liisa T. Kuhn, PhDIn Vitro Assessment of Cell-Biomaterial Interactions Yong Wang, PhDHost Response to Biomate

  19. Main principles of development stationary training facilities

    International Nuclear Information System (INIS)

    Tsiptsyura, R.D.

    1986-01-01

    The designation of stationary training facilities is shown and the main requirements for them are formulated. When considering the above-mentioned requirements, special attention was paid to obligatory correspondence between training experience and practical skill of an operator. It is shown, that the switchboard block is the major unit of the training facility, which should develop skills and habits of an operator

  20. Live insertion method used for main renewal

    International Nuclear Information System (INIS)

    Solkowitz, M.

    1992-01-01

    Baltimore Gas and Electric's pilot project using the live insertion method to replace a cast iron main provided excellent results. Its use on Eastern Avenue, a major state highway, was cost effective, provided gas service to customers during the work, required relatively short construction time and resulted in only minor traffic disruptions. Gas service transfers to the new main were done at customer convenience and resulted in outages of only a few hours per customer. This paper reports that the project involved inserting a 6-in. plastic line inside an existing 10-in. cast iron main. Miller Pipeline Corp., Indianapolis, supplier of the Insertec left-angle R right-angle live insertion method was contracted for the job. Miller technicians assisted BG and E forces by providing a load analysis of the main, a pushing machine and related supplies, foaming equipment and pipe cutting tools. Company forces were responsible for all preparatory work, including opening all excavations, installing bypasses, and fusing and testing the plastic pipe. Service transfers and renewals were also completed by company employees

  1. Maine Project against Bullying. Final Report.

    Science.gov (United States)

    Saufler, Chuck; Gagne, Cyndi

    Noting that bullying among primary school-age children has become recognized as an antecedent to more violent behavior in later grades, the 3-year Maine Project Against Bullying examined currently available research on bullying and evaluated books, curricula, media materials, and programs to identify resources and strategies which can be applied…

  2. Modern Portfolio Theory: Some Main Results

    OpenAIRE

    Müller, Heinz H.

    2017-01-01

    This article summarizes some main results in modern portfolio theory. First, the Markowitz approach is presented. Then the capital asset pricing model is derived and its empirical testability is discussed. Afterwards Neumann-Morgenstern utility theory is applied to the portfolio problem. Finally, it is shown how optimal risk allocation in an economy may lead to portfolio insurance

  3. Enhancing training in the main control room

    International Nuclear Information System (INIS)

    McGuigan, K.; O'Leary, K.; Canavan, K.

    2004-01-01

    In 2003 Pickering B Nuclear of Ontario Power Generation installed a Desktop Simulator (DTS) in the Main Control Room (MCR) for training purposes. This paper will outline why this training enhancement was undertaken and the approach taken to secure its use in an active MCR environment while minimizing distractions to plant operations. (author)

  4. Main successes, achievements. Paths of development

    Directory of Open Access Journals (Sweden)

    A. A. Kubanova

    2015-01-01

    Full Text Available The article provides the overview of incidence of sexually transmitted infections and skin disorders over time in Russian Federation in 2004-2014 with its main positive tendencies; results of reorganisation of bed capacity of dermatovenerologic medical organizations; dermatovenerologic bed rates.

  5. Main facts 1995; Faits marquants 1995

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-11-01

    This report presents the main facts of the studies carried out by the Direction des Etudes et Recherches (DER) of Electricite de France: new applications of electricity, classical and nuclear thermal power plants, electrical equipment, environment protection, monitoring and plants operations.

  6. D.E.R. 91 main facts

    International Nuclear Information System (INIS)

    Schmidt, N.

    1991-01-01

    This report presents the main facts of the studies carried out by the Direction des Etudes et Recherches (DER) of Electricite de France: New applications of electricity, classical and nuclear thermal power plants, electrical equipment, environment protection, network analysis, information and informatic equipment

  7. VINKA, ten years on. Main scientific results

    International Nuclear Information System (INIS)

    1979-01-01

    The VINKA facility in the TRITON swimming-pool reactor at Fontenay-aux-Roses allows the irradiation of solids at low temperatures in order to study crystalline defects. After ten years of operation the main scientific results obtained in the fields of creep and growth (chapter I), point defects (chapter II), amorphisation (chapter III) and dechanneling of particles (chapter IV) are summarised [fr

  8. Results on Fermilab main injector dipole measurements

    International Nuclear Information System (INIS)

    Brown, B.C.; Baiod, R.; DiMarco, J.; Glass, H.D.; Harding, D.J.; Martin, P.S.; Mishra, S.; Mokhtarani, A.; Orris, D.F.; russell, O.A.; Tompkins, J.C.; Walbridge, D.G.C.

    1995-06-01

    Measurements of the Productions run of Fermilab Main Injector Dipole magnets is underway. Redundant strength measurements provide a set of data which one can fit to mechanical and magnetic properties of the assembly. Plots of the field contribution from the steel supplement the usual plots of transfer function (B/I) vs. I in providing insight into the measured results

  9. D.E.R. 92 - Main facts

    International Nuclear Information System (INIS)

    1992-01-01

    This report presents the main facts of the studies carried out by the Direction des Etudes et Recherches (DER) of Electricite de France: new applications of electricity, classical and nuclear thermal power plants, electrical equipment, environment protection, network analysis, information and informatic equipment

  10. Analysis of main dynamic parameters of split power transmission

    Directory of Open Access Journals (Sweden)

    A. Janulevičius

    2008-06-01

    Full Text Available The review carried out had shown one basic approach of split power transmission to the organization of drive which is applied to stepless transmissions of tractors and parallel hybrid cars. In the split power transmission the power split device uses a planetary gear. Tractor engine power in the split power transmission is transmitted to the drive shaft via a mechanical and hydraulic path. The theoretical analysis of main parameters of the split power transmission of the tractor is presented. The angular velocity of sun and coronary gears of the differential set is estimated by solution of the system of equations in which one equation is made for planetary differential gear, and another – for hydrostatic drive. The analysis of the transmission gear-ratio dependencies on the ratio of hydraulic machines capacities is carried out. Dependence of the variation of angular velocity of the coronary and the sun gears on the ground speed of the tractor is presented. Dependence of sum shaft torque and its constituents, carried by mechanical and hydraulic lines, on sum shaft angular velocity and ground speed of tractor and engine speed is also presented.

  11. Intersubjective management in aerospace engineering

    Directory of Open Access Journals (Sweden)

    Arpentieva Mariam

    2017-01-01

    Full Text Available This article presents a postnonclassical approach to create the science of management processes organization in a developing society, the focus of which is “the man of culture”, i.e. the man, not just adhering to cultural norms, but also creating new concepts and products of culture. This science is proposed to be called Evergetics. The purpose of the study is the analysis science of management processes organization in a developing aerospace engineering and other industrial areas of society. The authors describe the main aspects and procedures evergetics management in aerospace engineering. They uses the comparison method, compares classical and modern approaches and technologies of management. In evergetics management model each member of society or organization is interested in augmenting his cultural heritage he is producing, which entails a raise of stability in process of engineering actions and a raise cultural potential of the society as a whole and, as a consequence, an increase in the proportion of moral and ethical managerial decisions and corresponding to them benevolent actions in organizational life. Summarize the article’s main findings, authors may in some main conclusions about necessity evergetics model and intersubjective technologies in the creation and development of aerospace engineering.

  12. Main: 1UHT [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 85c Name=Dl3285c; Synonyms=At4g14490, At4g14490; Arabidopsis Thaliana Molecule: Expressed Protein; Chain: A;... Fragment: Forkhead Associated Domain, Fha Domain; Synonym: Hypothetical Protein; Engineered: Yes Structural..., T.Terada, T.Yabuki, M.Aoki, T.Matsuda, E.Seki, H.Hirota, M.Yoshida, A.Tanaka, T.Osanai, K.Shinozaki, M.Sek....Matsuda, E.Seki, H.Hirota, M.Yoshida, A.Tanaka, T.Osanai, K.Shinozaki, M.Seki, T....Kigawa, S.Yokoyama Solution Structure Of The Fha Domain Of Arabidopsis Thaliana Hypothetical Protein To Be Published Fha Domai

  13. Ferbane Nursing Home, Main Street, Ferbane, Offaly.

    LENUS (Irish Health Repository)

    Shanahan, Fergus

    2012-02-03

    Mechanisms underlying the conditioning influence of the intestinal flora on mucosal homeostasis, including development and function of immune responses, are attracting increasing scientific scrutiny. The intestinal flora is a positive asset to host defense, but some of its components may, in genetically susceptible hosts, become a risk factor for development of inflammatory bowel disease (IBD). It follows that strategies to enhance assets or offset microbial liabilities represent a therapeutic option; therein lies the rationale for manipulation of the flora in IBD. In addition, the diversity of regulatory signalling among the flora and host epithelum, lymphoid tissue, and neuromuscular apparatus is an untapped reservoir from which novel therapeutics may be mined. Moreover, the capacity to engineer food-grade or commensal bacteria to deliver therapeutic molecules to the intestinal mucosa promises to extend the scope of microbial manipulation for the benefit of mankind.

  14. Reactor Engineering Division annual report

    International Nuclear Information System (INIS)

    Hirota, Jitsuya; Asaoka, Takumi; Suzuki, Tomoo; Mitani, Hiroshi; Akino, Fujiyoshi

    1977-09-01

    Research activities in the Division of Reactor Engineering in fiscal 1976 are described. Works of the division concern mainly the development of multi-purpose Very High Temperature Gas Cooled Reactor, fusion reactor engineering, and the development of Liquid Metal Fast Breeder Reactor in Power Reactor and Nuclear Fuel Development Corporation. Contents of the report are nuclear data and group constants, theoretical method and code development, integral experiment and analysis, shielding, heat transfer and fluid dynamics, reactor and nuclear instrumentation, dynamics analysis and control method development, fusion reactor technology, and activities of the Committee on Reactor Physics. (auth.)

  15. Performances Study of a Hybrid Rocket Engine

    Directory of Open Access Journals (Sweden)

    Adrian-Nicolae BUTURACHE

    2018-06-01

    Full Text Available This paper presents a study which analyses the functioning and performances optimization of a hybrid rocket engine based on gaseous oxygen and polybutadiene polymer (HTPB. Calculations were performed with NASA CEA software in order to obtain the parameters resulted following the combustion process. Using these parameters, the main parameters of the hybrid rocket engine were optimized. Using the calculus previously stated, an experimental rocket engine producing 100 N of thrust was pre-dimensioned, followed by an optimization of the rocket engine as a function of several parameters. Having the geometry and the main parameters of the hybrid rocket engine combustion process, numerical simulations were performed in the CFX – ANSYS commercial software, which allowed visualizing the flow field and the jet expansion. Finally, the analytical calculus was validated through numerical simulations.

  16. Condition monitoring of main coolant pumps, Dhruva

    International Nuclear Information System (INIS)

    Prasad, V.; Satheesh, C.; Acharya, V.N.; Tikku, A.C.; Mishra, S.K.

    2002-01-01

    Full text: Dhruva is a 100 MW research reactor with natural uranium fuel, heavy water as moderator and primary coolant. Three Centrifugal pumps circulate the primary coolant across the core and the heat exchangers. Each pump is coupled to a flywheel (FW) assembly in order to meet operational safety requirements. All the 3 main coolant pump (MCP) sets are required to operate during operation of the reactor. The pump-sets are in operation since the year 1984 and have logged more than 1,00,000 hrs. Frequent breakdowns of its FW bearings were experienced during initial years of operation. Condition monitoring of these pumps, largely on vibration based parameters, was initiated on regular basis. Break-downs of main coolant pumps reduced considerably due to the fair accurate predictions of incipient break-downs and timely maintenance efforts. An effort is made in this paper to share the experience

  17. Alarm system for ABWR main control panels

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Yuji; Saito, Koji [Toshiba Corp., Yokohoma (Japan)

    1997-09-01

    TOSHIBA has developed integrated digital control and instrumentation system for ABWR, which is the third-generation man machine interface system for main control room that we call A-PODIA (Advanced PODIA). A-Podia has been introduced the first actual ABWR plant in Japan. in A-PODIA, TOSHIBA has realized improvement of alarm system that all operator crews in the control room can recognize plant anomalies easily. The alarm system can recognize essential alarms for plant safety easily and understand annunciators with each integrated annunciators and their prioritized color easily by classifying alarms into plant-level essential annunciators, system-level integrated annunciators and equipment level individual annunciators with hierarchical structure. This paper describes conventional alarm system and the design philosophy, alarm system design and operation of ``Alarm System for ABWR Main Control Panels``. (author). 5 refs, 8 figs, 1 tab.

  18. Organization structure. Main activities of the Division

    International Nuclear Information System (INIS)

    2008-01-01

    In this chapter the organization structure as well as main activities of the Division for radiation safety, NPP decommissioning and radioactive waste management are presented. This Division of the VUJE, a.s. consists of the following sections and departments: Section for economic and technical services; Section for radiation protection of employees; Department for management of emergency situations and risk assessment; Department for implementation of nuclear power facilities decommissioning and RAW management; Department for personnel and environmental dosimetry; Department for preparation of NPP decommissioning; Department for RAW treatment technologies; Department for chemical regimes and physico-chemical analyses; Department for management of nuclear power facilities decommissioning and RAW management. Main activities of this Division are presented.

  19. Chromaticity compensation scheme for the Main Injector

    International Nuclear Information System (INIS)

    Bogacz, S.A.

    1993-05-01

    The current Main Injector lattice is studied in the context of full chromaticity compensation in the presence of the eddy current, saturation and the end-pack sextupole fields generated by the dipole magnets. Two families of correcting sextupole magnets are placed to compensate these fields and to adjust the chromaticity (in both planes) to some desired value. Variation of the dipole induced sextupole fields with the B-field (changing along a ramp) are modeled according to recent experimental measurements of the Main Injector dipole magnet Analysis of the required sextupole strengths is carried out along two realistic momentum ramps. The results of our calculation give quantitative insight into the requisite performance of the sextupole magnets

  20. Installation Strategy for the LHC Main Dipoles

    CERN Multimedia

    Fartoukh, Stephane David

    2004-01-01

    All positions in the LHC machine are not equivalent in terms of beam requirements on the geometry and the field quality of the main dipoles. In the presence of slightly or strongly out-of tolerance magnets, a well-defined installation strategy will therefore contribute to preserve or even optimize the performance of the machine. Based on the present status of the production, we have anticipated a list of potential issues (geometry, transfer function, field direction and random b3) which, combined by order of priority, have been taken into account to define a simple but efficient installation algorithm for the LHC main dipoles. Its output is a prescription for installing the available dipoles in sequence while reducing to an absolute minimum the number of holes required by geometry or FQ issues.

  1. The LHC Main Quadrupoles during Series Fabrication

    CERN Document Server

    Tortschanoff, Theodor; Durante, M; Hagen, P; Klein, U; Krischel, D; Payn, A; Rossi, L; Schellong, B; Schmidt, P; Simon, F; Schirm, K-M; Todesco, E

    2006-01-01

    By the end of August 2005 about 320 of the 400 main LHC quadrupole magnets have been fabricated and about 220 of them assembled into their cold masses, together with corrector magnets. About 130 of them have been cold tested in their cryostats and most of the quadrupoles exceeded their nominal excitation, i.e. 12,000 A, after no more than two training quenches. During this series fabrication, the quality of the magnets and cold masses was thoroughly monitored by means of warm magnetic field measurements, of strict geometrical checking, and of various electrical verifications. A number of modifications were introduced in order to improve the magnet fabrication, mainly correction of the coil geometry for achieving the specified field quality and measures for avoiding coil insulation problems. Further changes concern the electrical connectivity and insulation of instrumentation, and of the corrector magnets inside the cold masses. The contact resistances for the bus-bar connections to the quench protection diode...

  2. The double main sequence of Omega Centauri

    Science.gov (United States)

    Bedin, L. R.; Piotto, G.; Anderson, J.; King, I. R.; Cassisi, S.; Momany, Y.

    Recent, high precision photometry of Omega Centauri, the biggest Galactic globular cluster, has been obtained with Hubble Space Telescope (HST). The color magnitude diagram reveals an unexpected bifurcation of colors in the main sequence (MS). The newly found double MS, the multiple turnoffs and subgiant branches, and other sequences discovered in the past along the red giant branch of this cluster add up to a fascinating but frustrating puzzle. Among the possible explanations for the blue main sequence an anomalous overabundance of helium is suggested. The hypothesis will be tested with a set of FLAMES@VLT data we have recently obtained (ESO DDT program), and with forthcoming ACS@HST images. Based on observations with the NASA/ESA Hubble Space Telescope, obtained at the Space Telescope Science Institute, which is operated by AURA, Inc., under NASA contract NAS 5-26555.

  3. Alarm system for ABWR main control panels

    International Nuclear Information System (INIS)

    Kobayashi, Yuji; Saito, Koji

    1997-01-01

    TOSHIBA has developed integrated digital control and instrumentation system for ABWR, which is the third-generation man machine interface system for main control room that we call A-PODIA (Advanced PODIA). A-Podia has been introduced the first actual ABWR plant in Japan. in A-PODIA, TOSHIBA has realized improvement of alarm system that all operator crews in the control room can recognize plant anomalies easily. The alarm system can recognize essential alarms for plant safety easily and understand annunciators with each integrated annunciators and their prioritized color easily by classifying alarms into plant-level essential annunciators, system-level integrated annunciators and equipment level individual annunciators with hierarchical structure. This paper describes conventional alarm system and the design philosophy, alarm system design and operation of ''Alarm System for ABWR Main Control Panels''. (author). 5 refs, 8 figs, 1 tab

  4. Emplacement engineering

    Energy Technology Data Exchange (ETDEWEB)

    Hill, Ernest E [Lawrence Radiation Laboratory, University of California, Livermore, CA (United States)

    1970-05-01

    Emplacement Engineering can be defined as that portion of a nuclear explosive project that is concerned with the emplacement of the explosive. This definition would then include virtually everything except the design and fabrication of the explosive and the post-shot-effects program. For future commercial application, the post-shot-effects program will essentially disappear. This emplacement portion of a nuclear explosive project constitutes a large fraction of the total project cost, but it has largely been overshadowed by the explosive and explosive-effects portions. As we move into commercial applications. Emplacement Engineering must receive more attention from both industry and government. To place emplacement costs in their proper relationship with total projects costs, we have performed a study of commercial underground nuclear explosive applications such as gas stimulation. Although there are many intangibles in such a study, we have been able to at least obtain some feel for the relative fractional costs of the non-explosive costs compared with the explosive costs. This study involved estimating the cost elements for applications using a single explosive at 5,000 ft, 10,000 ft, and 15,000 ft. For each depth, the cost estimates were made for a range of emplacement hole and explosive diameters. Results of these estimates for explosive-related costs, hole-related costs, and total costs are shown for the three depths. Note that the explosive package outside diameter is assumed as 2 inches less than the hole (or casing) inside diameter for all cases. For the 5,000-ft application the explosive-related costs dominate, and of particular importance is the indicated diameter for minimum total cost which occurs at approximately a 17.5-in. hole (15.5-in. explosive). The hole-related costs are in 'the same range as the explosive-related costs for the 10,000-ft application. For this case, the minimum total cost occurs at approximately a 14-in. hole (12-in. explosive

  5. INNOVATION DIFFUSION THEORY MAIN DEVELOPMENT STAGES

    Directory of Open Access Journals (Sweden)

    S. V. Lisafiev

    2011-01-01

    Full Text Available Abstract: Main innovation diffusion development theory stages are: Rogers model of moving new products to the market including characteristics of its segments; mathematic substantiation of this model by Bass; Moor model taking into account gaps between adjacent market segments; Goldenberg model making it possible to predict sales drops at new product life cycle initial stages. It is reasonable to use this theory while moving innovative products to the market.

  6. The Main Properties of q-Functions

    OpenAIRE

    Nina O. Virchenko; Olena V. Ovcharenko

    2017-01-01

    Background.  The new generalization of the function of complex variable (q-function) is considered, its main properties are investigated. Such distributions have a special place among the special functions due to their widespread use in many areas of applied mathematics. Objective. The aim of the paper is to study the new generalization of the function of complex variable for application in applied sciences. Methods. To obtain scientific results the general methods of the mathematical a...

  7. Radiation shielding of the main injector

    International Nuclear Information System (INIS)

    Bhat, C.M.; Martin, P.S.

    1995-05-01

    The radiation shielding in the Fermilab Main Injector (FMI) complex has been carried out by adopting a number of prescribed stringent guidelines established by a previous safety analysis. Determination of the required amount of radiation shielding at various locations of the FMI has been done using Monte Carlo computations. A three dimensional ray tracing code as well as a code based upon empirical observations have been employed in certain cases

  8. Post-main-sequence planetary system evolution

    Science.gov (United States)

    Veras, Dimitri

    2016-01-01

    The fates of planetary systems provide unassailable insights into their formation and represent rich cross-disciplinary dynamical laboratories. Mounting observations of post-main-sequence planetary systems necessitate a complementary level of theoretical scrutiny. Here, I review the diverse dynamical processes which affect planets, asteroids, comets and pebbles as their parent stars evolve into giant branch, white dwarf and neutron stars. This reference provides a foundation for the interpretation and modelling of currently known systems and upcoming discoveries. PMID:26998326

  9. The BTeV main spectrometer

    International Nuclear Information System (INIS)

    Sheldon, P.D.

    2001-01-01

    BTeV is a second generation B-factory experiment that will use a double-arm, forward spectrometer in the C0 experimental hall at the Fermilab Tevatron. I will describe the motivation and design of the 'main spectrometer', consisting of a ring-imaging Cherenkov system for charged particle identification, an electromagnetic calorimeter of lead-tungstate crystals, a proportional tube muon system with magnetized filtering steel, and a straw-tube and silicon strip charged particle tracking system

  10. Engineers and Bildung

    DEFF Research Database (Denmark)

    Henriksen, Lars Bo

    2006-01-01

    and Bildung. In this chapter, this relation in investigated. In the first part, I present three engineers and their careers. In the second part, the concept of Bildung is analyzed, and in the third part, it is the conceptual relation between Bildung, engineers, and engineering work that is of concern.......What is an engineer? Or maybe better: how are engineers, and how are they “gebilded” in order to be able to be called engineers? In order to shed some light on this question we could ask: How is the relation between engineering and the making of an engineer, or the relation between engineering...

  11. Analysis of Engine Propeller Matching of DC Motor as a Main Propulsion

    Directory of Open Access Journals (Sweden)

    Eddy Setyo Koenhardono

    2017-12-01

    Full Text Available The development of ship always searches through the most benefits system for reducing costs of propulsion system without increase pollution. Diesel propulsion system or also known as conventional propulsion system is efficient but requires high operating costs and increase high level of marine pollution. Electrical propulsion system is using electric motors as the prime mover of the propeller. There are 2 types of electric motors that will be used for research of electric propulsion system, there are; DC motors and three-phases induction motor. As the use of DC motor as a prime mover for this electrical propulsion system, this study determines the characteristic between voltage terminal with torque and also field current with torque. It results that torque produced by the DC motor is in the same magnitude with the speed (RPM. The higher the speed have shaped the value of the torque. The input and terminal voltages adjusts all variables and results. In this study, different field voltage creates different pattern of motor envelope. Its manner to propeller curve occurs total different results. With field voltage of 50 V, the ranges of motor envelope immoveable in the point of 150% of present speed and 160%. While field voltage of 60 V serves larger ranges of motor envelope which possible to reach further than 50 V curve.

  12. Effects of Alternate Leading Edge Cutback on the Space Shuttle Main Engine Low Pressure Fuel Pump

    Science.gov (United States)

    Mulder, Andrew; Skelley, Stephen

    2016-01-01

    A higher order cavitation oscillation observed in the SSME low pressure fuel pump has been eliminated in water flow testing of a modified subscale replica of the inducer. The low pressure pump was modified by removing the outboard sections of two opposing blades of the four-bladed inducer, blending the "cutback" regions into the blades at the leading edge and tip, and removing material on the suction sides to decrease the exposed leading edge thickness. The leading edge tips of the cutback blades were moved approximately 25 degrees from their previous locations, thereby increasing one blade to blade spacing, decreasing the second, while simultaneously moving the cutback tips downstream. The test was conducted in MSFC's inducer test loop at scaled operating conditions in degassed and filtered water. In addition to eliminating HOC across the entire scaled operating regime, rotating cavitation was suppressed while the range of both alternate blade and asymmetric cavitation were increased. These latter phenomena, and more significantly, the shifts between these cavitation modes also resulted in significant changes to the head coefficient at low cavitation numbers. Reverse flow was detected at a slightly larger flow coefficient with the cutback inducer and suction capability was reduced by approximately 1 velocity head at and above approximately 90% of the reference flow coefficient. These performance changes along with more intense reverse flow are consistent with poor flow area management and increased incidence in the cutback region. Although the test demonstrated that the inducer modification was successful at eliminating the higher order cavitation across the entire scaled operating regime, different, previously unobserved, cavitation oscillations were introduced and significant performance penalties were imposed.

  13. Observation of the exhaust plume from the space shuttle main engines using the microwave limb sounder

    Directory of Open Access Journals (Sweden)

    H. C. Pumphrey

    2011-01-01

    Full Text Available A space shuttle launch deposits 700 tonnes of water in the atmosphere. Some of this water is released into the upper mesosphere and lower thermosphere where it may be directly detected by a limb sounding satellite instrument. We report measurements of water vapour plumes from shuttle launches made by the Microwave Limb Sounder (MLS on the Aura satellite. Approximately 50%–65% of shuttle launches are detected by MLS. The signal appears at a similar level across the upper 10 km of the MLS limb scan, suggesting that the bulk of the observed water is above the top of the scan. Only a small fraction at best of smaller launches (Ariane 5, Proton are detected. We conclude that the sensitivity of MLS is only just great enough to detect a shuttle sized launch, but that a suitably designed instrument of the same general type could detect the exhausts from a large proportion of heavy-lift launches.

  14. Engineering method of calculation and choice of main parameters of the linear induction accelerator inductors

    Directory of Open Access Journals (Sweden)

    В.Т. Чемерис

    2006-04-01

    Full Text Available  There is a method of simplified calculation and design parameters choice elaborated in this article with corresponding basing for the induction system of electron-beam sterilizer on the base of linear induction accelerator taking into account the parameters of magnetic material for production of cores and parameters of pulsed voltage.

  15. Progress of the Civil Engineering Work in the Main Amphithéâtre.

    CERN Multimedia

    Maximilien Brice

    2011-01-01

    Picture 1 and 2 : 31 Janvier 2011. - PanoA1 & PanoA2 : 09 March 2011. #mypanoviewer { height:480px; width: 800px; margin:auto} var viewer=new PTGuiViewer(); viewer.setSwfUrl("/record/1334834/files/PTGuiViewer.swf"); viewer.preferFlashViewer(); viewer.setVars({ pano: "/record/1334834/files/PanoA1_", format: "14faces", pan: 0, minpan: -180, maxpan: 180, tilt:0, mintilt: -75.60468140442133, maxtilt: 75.60468140442133, fov: 90, minfov: 10, maxfov: 120, autorotatespeed: 5, autorotatedelay: 10, maxiosdimension: 396 }); viewer.embed("mypanoviewer"); #mypanoviewer2 { height:480px; width: 800px; margin:auto} var viewer2=new PTGuiViewer(); viewer2.setSwfUrl("/record/1334834/files/PTGuiViewer.swf"); viewer2.preferFlashViewer(); viewer2.setVars({ pano: "/record/1334834/files/PanoA2_", format: "14faces", pan: 0, minpan: -180, maxpan: 180, tilt:0, mintilt: -75.60468140442133, maxtilt: 75.604681404...

  16. Main-sequence photometry in NGC 2808

    International Nuclear Information System (INIS)

    Buonanno, R.; Corsi, C.E.; Fusi Pecci, F.; Harris, W.E.

    1984-01-01

    We have obtained a color-magnitude diagram for the southern globular cluster NGC 2808, to V/sub lim/approx. =21 (about 2 mag below the main-sequence turnoff). The internal photographic errors are sigma/sub V/approx. =0.02, sigma/sub B/-Vapprox. =0.03, small enough to permit a precise definition of the turnoff region and an estimate of the ''cosmic scatter'' along the main sequence. Fitting of the CMD to VandenBerg's [Astrophys. J. Suppl. 51, 29 (1983)] isochrones shows that an excellent match to the observations is achieved for model parameters of Yapprox. =0.2, Zapprox. =0.003 ([Fe/H]approx. =-0.8), and an age of (16 +- 2) billion years. All these characteristics are within the expected range from other observational constraints; no new clues from the main-sequence data alone have arisen to help explain the presence of the anomalous blue horizontal-branch stars

  17. Isolated systems with wind power. Main report

    Energy Technology Data Exchange (ETDEWEB)

    Lundsager, P.; Bindner, H.; Clausen, N.E.; Frandsen, S.; Hansen, L.H.; Hansen, J.C.

    2001-06-01

    The overall objective of this research project is to study the development of methods and guidelines rather than 'universal solutions' for the use of wind energy in isolated communities. The main specific objective of the project is to develop and present a more unified and generally applicable approach for assessing the technical and economical feasibility of isolated power supply systems with wind energy. As a part of the project the following tasks were carried out: Review of literature, field measurements in Egypt, development of an inventory of small isolated systems, overview of end-user demands, analysis of findings and development of proposed guidelines. The project is reported in one main report and four topical reports, all of them issued as Risoe reports. This is the Main Report Risoe-R-1256, summing up the activities and findings of the project and outlining an Implementation Strategy for Isolated Systems with Wind Power, applicable for international organisations such as donor agencies and development banks. (au)

  18. Committee on Women in Science, Engineering, and Medicine (CWSEM)

    Science.gov (United States)

    harassment on women and their careers in science, engineering, and medicine. In addition to evidence-based Skip to Main Content Contact Us | Search: Search The National Academies of Sciences, Engineering and Medicine Committee on Women in Science, Engineering, and Medicine Committee on Women in Science

  19. An Exploratory Survey of Student Perspectives Regarding Search Engines

    Science.gov (United States)

    Alshare, Khaled; Miller, Don; Wenger, James

    2005-01-01

    This study explored college students' perceptions regarding their use of search engines. The main objective was to determine how frequently students used various search engines, whether advanced search features were used, and how many search engines were used. Various factors that might influence student responses were examined. Results showed…

  20. Sequence of decommissioning of the main equipment in a central type VVER 440 V-230

    International Nuclear Information System (INIS)

    Andres, E.; Garcia Ruiz, R.

    2014-01-01

    IBERDROLA Ingenieria y Construccion S.A.U., leader of consortium with Empresarios Agrupados and INDRA, has developed the Basic Engineering for the decommissioning of contaminated systems and building of a VVER 440 V-230 Nuclear Power Plant, establishing the sequence and methodology for the main equipment fragmentation. For that, it has been designed dry and wet cutting zones to be set up in the area where steam generators, main cooling pumps and pressurizer are located; these components will be dismantled previously. (Author)

  1. Industrial Education. "Small Engines".

    Science.gov (United States)

    Parma City School District, OH.

    Part of a series of curriculum guides dealing with industrial education in junior high schools, this guide provides the student with information and manipulative experiences on small gasoline engines. Included are sections on shop adjustment, safety, small engines, internal combustion, engine construction, four stroke engines, two stroke engines,…

  2. Biosystems Engineering in Portugal

    OpenAIRE

    Marques da Silva, José Rafael; Silva, Luis Leopoldo; Cruz, Vasco Fitas

    2008-01-01

    The paper gives the definition of Biosystems Engineering in Portugal; Possible revisions of the core curriculum presented in the FEANI report; the current situation of Biosystems Engineering in Portugal; The impacts of the transition to Biosystems Engineering; The need for a transition to Biosystems Engineering;Opportunities to the Biosystems Engineer in the labour market.

  3. Metabolic Engineering X Conference

    Energy Technology Data Exchange (ETDEWEB)

    Flach, Evan [American Institute of Chemical Engineers

    2015-05-07

    The International Metabolic Engineering Society (IMES) and the Society for Biological Engineering (SBE), both technological communities of the American Institute of Chemical Engineers (AIChE), hosted the Metabolic Engineering X Conference (ME-X) on June 15-19, 2014 at the Westin Bayshore in Vancouver, British Columbia. It attracted 395 metabolic engineers from academia, industry and government from around the globe.

  4. Single-piston alternative to Stirling engines

    International Nuclear Information System (INIS)

    Glushenkov, Maxim; Sprenkeler, Martin; Kronberg, Alexander; Kirillov, Valeriy

    2012-01-01

    Highlights: ► Thermodynamic analysis of an unconventional heat engine. ► The engine has a number of advantages compared to state-of-the-art Stirling engines. ► The engine can to be fuelled with “difficult” fuels and used for micro-CHP systems. ► The energy conversion efficiency can be as high as 40–50%. ► A prototype of the engine was demonstrated. -- Abstract: Thermodynamic analysis of an unconventional heat engine was performed. The engine studied has a number of advantages compared to state-of-the-art Stirling engines. The main advantage of the engine proposed is its simplicity. A power piston is integral with a displacer and a heat regenerator. It allows solving the problem of the high-temperature sealing of the piston and the displacer typical of all types of Stirling engines. In addition the design proposed provides ideal use of the displacer volume eliminating heat losses from outside gas circuit. Both strokes of the piston are working ones in contrary to any other types of piston engines. The engine can be considered as maintenance-free as it has no piston rings or any other rubbing components requiring lubrication. The only seal is contactless and wear free. It is located in the cold part of the cylinder. As a result the leakage rate in operation can be one-two orders of magnitude as small as that in Stirling engines. Balancing of the engine is much easy compared to Stirling engines with two reciprocating masses because of the only moving part inside the engine cylinder. The engine suits ideally to be fuelled with “difficult” fuels such as bio oil and can be used as a prime mover for micro-CHP systems. The thermodynamic model developed incorporates non-ideal features of the cycle, such as specific regenerator efficiency, dead volumes and other geometrical parameters of the engine. The model shows that the energy efficiency is highly sensitive to regenerator performance. For realistic geometric and operating parameters and the

  5. Engineering allostery.

    Science.gov (United States)

    Raman, Srivatsan; Taylor, Noah; Genuth, Naomi; Fields, Stanley; Church, George M

    2014-12-01

    Allosteric proteins have great potential in synthetic biology, but our limited understanding of the molecular underpinnings of allostery has hindered the development of designer molecules, including transcription factors with new DNA-binding or ligand-binding specificities that respond appropriately to inducers. Such allosteric proteins could function as novel switches in complex circuits, metabolite sensors, or as orthogonal regulators for independent, inducible control of multiple genes. Advances in DNA synthesis and next-generation sequencing technologies have enabled the assessment of millions of mutants in a single experiment, providing new opportunities to study allostery. Using the classic LacI protein as an example, we describe a genetic selection system using a bidirectional reporter to capture mutants in both allosteric states, allowing the positions most crucial for allostery to be identified. This approach is not limited to bacterial transcription factors, and could reveal new mechanistic insights and facilitate engineering of other major classes of allosteric proteins such as nuclear receptors, two-component systems, G protein-coupled receptors, and protein kinases. Copyright © 2014 Elsevier Ltd. All rights reserved.

  6. EDF source term reduction project main outcomes and further developments

    International Nuclear Information System (INIS)

    Ranchoux, Gilles; Bonnefon, Julien; Benfarah, Moez; Wintergerst Matthieu; Gressier, Frederic; Leclercq, Stephanie

    2012-09-01

    The dose reduction is a strategic purpose for EDF in link with the stakes of, nuclear acceptability, respect of regulation and productivity gains. This consists not only in improving the reactor shutdown organization (time spent in control area, biological shielding,...) but also in improving the radiological state of the unit and the efficiency of the source term reduction operations. Since 2003, EDF has been running an innovative project called 'Source Term Reduction' federating the different EDF research and engineering centers in order to: - participate to the long term view about Radiological Protection issues (international feedback analyses), - develop contamination prediction tools (OSCAR software) suitable for the industrial needs (operating units and EPR design), - develop scientific models useful for the understanding of contamination mechanisms to support the strategic decision processes, - carry on with updating and analyzing of contamination measurements feedback in corrosion products (EMECC and CZT campaigns), - carry on with the operational support at short or middle term by optimizing startup and shutdown processes, pre-oxidation or and by improving purification efficiency or material characteristics. This paper will show in a first part the main 2011 results in occupational exposure (collective and individual dose, RCS index...). In a second part, an overview of the main EDF outcomes of the last 3 years in the field of source term reduction will be presented. Future developments extended to contamination issues in EDF NPPs will be also pointed out in this paper. (authors)

  7. When the engineering has to stop

    International Nuclear Information System (INIS)

    Baker, J.W.

    1985-01-01

    The paper proposes that, in the UK, there needs to be a fundamental change in the attitudes of engineers. Engineering alone is not enough for engineers. They need to see themselves in the broader context of society as a whole. At present there is a general distrust by the general public of science and engineering, mainly because engineers have kept quiet for too long, and have been letting facts speak for themselves when they should have been explaining them. Now it is up to the engineering profession to educate the general public in terms that they can understand, in an attempt to win back wider public support. The paper includes a discussion of some aspects of the UK nuclear power programme: the choice of reactor types; reprocessing and waste disposal; Sizewell-B enquiry; public opinion on civil nuclear power; CEGB public relations. (author)

  8. Search Engines: Gateway to a New ``Panopticon''?

    Science.gov (United States)

    Kosta, Eleni; Kalloniatis, Christos; Mitrou, Lilian; Kavakli, Evangelia

    Nowadays, Internet users are depending on various search engines in order to be able to find requested information on the Web. Although most users feel that they are and remain anonymous when they place their search queries, reality proves otherwise. The increasing importance of search engines for the location of the desired information on the Internet usually leads to considerable inroads into the privacy of users. The scope of this paper is to study the main privacy issues with regard to search engines, such as the anonymisation of search logs and their retention period, and to examine the applicability of the European data protection legislation to non-EU search engine providers. Ixquick, a privacy-friendly meta search engine will be presented as an alternative to privacy intrusive existing practices of search engines.

  9. Mixer Assembly for a Gas Turbine Engine

    Science.gov (United States)

    Dai, Zhongtao (Inventor); Cohen, Jeffrey M. (Inventor); Fotache, Catalin G. (Inventor); Smith, Lance L. (Inventor); Hautman, Donald J. (Inventor)

    2018-01-01

    A mixer assembly for a gas turbine engine is provided, including a main mixer with fuel injection holes located between at least one radial swirler and at least one axial swirler, wherein the fuel injected into the main mixer is atomized and dispersed by the air flowing through the radial swirler and the axial swirler.

  10. Engineering Education and Students' Challenges: Strategies toward Enhancing the Educational Environment in Engineering Colleges

    Science.gov (United States)

    Alkandari, Nabila Y.

    2014-01-01

    The main goal of this research is to gain an understanding of the challenges which have to be confronted by the engineering students at the College of Engineering and Petroleum at Kuwait University. The college has a large number of students, of which three hundred and eighty five were selected on a random basis for study purposes. The results…

  11. Rates of the main thermonuclear reactions

    International Nuclear Information System (INIS)

    Abramovich, S.N.; Guzhovskii, B.Ya.; Dunaeva, S.A.; Fomushkin, E.F.

    1992-01-01

    The data on the cross sections of main thermonuclear reactions have been estimated with an account of the latest experimental results in a form of S-factor spline presentation. Based on this estimation, the reates of these reactions in 0.0001-1 MeV temperature range in the supposition of Maxwell distribution of relative velocities have been computed. The Maxwell-Boltzmann averaged -factors were calculated according to the table values of the reaction rates. Then the -factors were approximated with the 3 order spline-function. The necessity of the account of electron shielding and intramolecular movement at low temperatures is discussed (orig.)

  12. Musculoskeletal disorders in main battle tank personnel

    DEFF Research Database (Denmark)

    Nissen, Lars Ravnborg; Guldager, Bernadette; Gyntelberg, Finn

    2009-01-01

    PURPOSE: To compare the prevalence of musculoskeletal disorders of personnel in the main battle tank (MBT) units in the Danish army with those of personnel in other types of army units, and to investigate associations between job function in the tank, military rank, and musculoskeletal problems......, and ankle. RESULTS AND CONCLUSIONS: There were only 4 women in the MBT group; as a consequence, female personnel were excluded from the study. The participation rate was 58.0% (n = 184) in the MBT group and 56.3% (n = 333) in the reference group. The pattern of musculoskeletal disorders among personnel...

  13. Main problems of modern radiation hygiene

    International Nuclear Information System (INIS)

    Il'in, L.A.; Buldakov, L.A.; Knizhnikov, V.A.

    1982-01-01

    The results of investigations carried out in 1980-81 in the field of radiation hygiene as well as plans for 1981-85 are considered. Three main groups of problems which the radiation hygiene is facing at the present time are discussed. The determination of levels and study of regularities of ionizing radiation dose formation in the population and personnel working with ionizing radiation sources in one of the promissing directions of the investigations. Delayed irradiation aftereffects andcontaminant action ofirradiation and chemical substances are no less important. The third important problem lies in the development of protective measures and arrangements on improving state sanitary inspection in the field of radiation hygiene

  14. Some peat deposits in Penobscot County, Maine

    Science.gov (United States)

    Cameron, Cornelia Clermont; Anderson, Walter A.

    1979-01-01

    Twenty of the peat deposits in Penobscot County, Maine contain an estimated 29,282,000 short tons air-dried peat. The peat is chiefly sphagnum moss and reed-sedge of high quality according to ASTM standards for agricultural and horticultural use. Analyses show that this same volume has high fuel value, low sulfur and high hydrogen contents compared with lignite and sub-bituminous coal, which may indicate that it also has potential for fuel use. On the basis of the metallic trace element content, one area within the region containing the 20 deposits has been delineated for further bedrock studies.

  15. Main-chain supramolecular block copolymers.

    Science.gov (United States)

    Yang, Si Kyung; Ambade, Ashootosh V; Weck, Marcus

    2011-01-01

    Block copolymers are key building blocks for a variety of applications ranging from electronic devices to drug delivery. The material properties of block copolymers can be tuned and potentially improved by introducing noncovalent interactions in place of covalent linkages between polymeric blocks resulting in the formation of supramolecular block copolymers. Such materials combine the microphase separation behavior inherent to block copolymers with the responsiveness of supramolecular materials thereby affording dynamic and reversible materials. This tutorial review covers recent advances in main-chain supramolecular block copolymers and describes the design principles, synthetic approaches, advantages, and potential applications.

  16. Main challenges in demulsifier research and application

    Science.gov (United States)

    Zhang, Fusheng; Liu, Guoliang; Ma, Junhan; Ouyang, Jian; Yi, Xiaoling; Su, Huimin

    2017-01-01

    Main challenges in demulsifier research, such as demulsification of ASP flooding produced liquid, demulsification of heavy oil produced liquid, low temperature demulsification and fast demulsification, are summarized. Some importance technology routes to solve the challenges are proposed according to demulsification mechanisms and emulsion characteristics. The proposed routes include increasing aromaticity, molecular weight and branch degree of demulsifiers, and introducing double-function groups to demulsifiers for W/O and O/W emulsions, or groups with alkyl matching with alkyl carbon number of the crude oil into demulsifier molecule. The demulsification mechanisms of the above-mentioned research routes are described in detail.

  17. Isolated systems with wind power. Main report

    DEFF Research Database (Denmark)

    Lundsager, P.; Bindner, Henrik W.; Clausen, Niels-Erik

    2001-01-01

    The overall objective of this research project is to study the development of methods and guidelines rather than "universal solutions" for the use of wind energy in isolated communities. The main specific objective of the project is to develop and present amore unified and generally applicable...... approach for assessing the technical and economical feasibility of isolated power supply systems with wind energy. As a part of the project the following tasks were carried out: Review of literature, fieldmeasurements in Egypt, development of an inventory of small isolated systems, overview of end...... for Isolated Systems with Wind Power, applicable for international organisations such as donoragencies and development banks....

  18. Meta Search Engines.

    Science.gov (United States)

    Garman, Nancy

    1999-01-01

    Describes common options and features to consider in evaluating which meta search engine will best meet a searcher's needs. Discusses number and names of engines searched; other sources and specialty engines; search queries; other search options; and results options. (AEF)

  19. NDE in biomedical engineering

    International Nuclear Information System (INIS)

    Bhagwat, Aditya; Kumar, Pradeep

    2015-01-01

    Biomedical Engineering (BME) is an interdisciplinary field, marking the conjunction of Medical and Engineering disciplines. It combines the design and problem solving skills of engineering with medical and biological sciences to advance health care treatment, including diagnosis, monitoring, and therapy

  20. Standing detonation wave engine

    KAUST Repository

    Kasimov, Aslan

    2015-01-01

    A detonation engine can detonate a mixture of fuel and oxidizer within a cylindrical detonation region to produce work. The detonation engine can have a first and a second inlet having ends fluidly connected from tanks to the detonation engine

  1. Assessment of total efficiency in adiabatic engines

    Science.gov (United States)

    Mitianiec, W.

    2016-09-01

    The paper presents influence of ceramic coating in all surfaces of the combustion chamber of SI four-stroke engine on working parameters mainly on heat balance and total efficiency. Three cases of engine were considered: standard without ceramic coating, fully adiabatic combustion chamber and engine with different thickness of ceramic coating. Consideration of adiabatic or semi-adiabatic engine was connected with mathematical modelling of heat transfer from the cylinder gas to the cooling medium. This model takes into account changeable convection coefficient based on the experimental formulas of Woschni, heat conductivity of multi-layer walls and also small effect of radiation in SI engines. The simulation model was elaborated with full heat transfer to the cooling medium and unsteady gas flow in the engine intake and exhaust systems. The computer program taking into account 0D model of engine processes in the cylinder and 1D model of gas flow was elaborated for determination of many basic engine thermodynamic parameters for Suzuki DR-Z400S 400 cc SI engine. The paper presents calculation results of influence of the ceramic coating thickness on indicated pressure, specific fuel consumption, cooling and exhaust heat losses. Next it were presented comparisons of effective power, heat losses in the cooling and exhaust systems, total efficiency in function of engine rotational speed and also comparison of temperature inside the cylinder for standard, semi-adiabatic and full adiabatic engine. On the basis of the achieved results it was found higher total efficiency of adiabatic engines at 2500 rpm from 27% for standard engine to 37% for full adiabatic engine.

  2. Ionic liquids in chemical engineering.

    Science.gov (United States)

    Werner, Sebastian; Haumann, Marco; Wasserscheid, Peter

    2010-01-01

    The development of engineering applications with ionic liquids stretches back to the mid-1990s when the first examples of continuous catalytic processes using ionic liquids and the first studies of ionic liquid-based extractions were published. Ever since, the use of ionic liquids has seen tremendous progress in many fields of chemistry and engineering, and the first commercial applications have been reported. The main driver for ionic liquid engineering applications is to make practical use of their unique property profiles, which are the result of a complex interplay of coulombic, hydrogen bonding and van der Waals interactions. Remarkably, many ionic liquid properties can be tuned in a wide range by structural modifications at their cation and anion. This review highlights specific examples of ionic liquid applications in catalysis and in separation technologies. Additionally, the application of ionic liquids as working fluids in process machines is introduced.

  3. Solid-state laser engineering

    CERN Document Server

    Koechner, Walter

    1992-01-01

    This book is written from an industrial perspective and provides a detailed discussion of solid-state lasers, their characteristics, design and construction. Emphasis is placed on engineering and practical considerations. The book is aimed mainly at the practicing scientist or engineer who is interested in the design or use of solid-state lasers, but the comprehensive treatment of the subject will make the work useful also to students of laser physics who seek to supplement their theoretical knowledge with engineering information. In order to present the subject as clearly as possible, phenomenological descriptions using models have been used rather than abstract mathematical descriptions. This results in a simplified presentation. The descriptions are enhanced by the inclusion of numerical and technical data, tables and graphs. This new edition has been updated and revised to take account of important new developments, concepts, and technologies that have emerged since the publication of the first and second...

  4. Engineering Encounters: Blasting off with Engineering

    Science.gov (United States)

    Dare, Emily A.; Childs, Gregory T.; Cannaday, E. Ashley; Roehrig, Gillian H

    2014-01-01

    What better way to engage young students in physical science concepts than to have them engineer flying toy rockets? The integration of engineering into science classrooms is advocated by the "Next Generation Science Standards" (NGSS) and researchers alike (Brophy et al. 2008), as engineering provides: (1) A "real-world…

  5. Environmental Engineering in Mining Engineering Education

    Science.gov (United States)

    Mahamud-Lopez, Manuel Maria; Menendez-Aguado, Juan Maria

    2005-01-01

    In this paper, the current profile of the environmental engineer and the programming of the subject "Environmental Engineering and Technology" corresponding to the studies of Mining Engineering at the University of Oviedo in Spain, is discussed. Professional profile, student knowledge prior to and following instruction as well as…

  6. Modular Engineering Concept at Novo Nordisk Engineering

    DEFF Research Database (Denmark)

    Moelgaard, Gert; Miller, Thomas Dedenroth

    1997-01-01

    This report describes the concept of a new engineering method at Novo Nordisk Engineering: Modular Engineering (ME). Three tools are designed to support project phases with different levels of detailing and abstraction. ME supports a standard, cross-functional breakdown of projects that facilitates...

  7. Magical Engineering Plastic

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Gwang Ung

    1988-01-15

    This book introduces engineering plastic about advantage of engineering plastic, plastic material from processing method, plastic shock, plastic until now, background of making of engineering plastic, wonderful engineering plastic science such as a high molecule and molecule, classification of high molecule, difference between metal and high molecule, heat and high molecule materials, and property of surface, engineering plastic of dream like from linseed oil to aramid, small dictionary of engineering plastic.

  8. Magical Engineering Plastic

    International Nuclear Information System (INIS)

    Kim, Gwang Ung

    1988-01-01

    This book introduces engineering plastic about advantage of engineering plastic, plastic material from processing method, plastic shock, plastic until now, background of making of engineering plastic, wonderful engineering plastic science such as a high molecule and molecule, classification of high molecule, difference between metal and high molecule, heat and high molecule materials, and property of surface, engineering plastic of dream like from linseed oil to aramid, small dictionary of engineering plastic.

  9. Forensic entomology and main challenges in Brazil.

    Science.gov (United States)

    Gomes, Leonardo; Von Zuben, Cláudio J

    2006-01-01

    Apart from an early case report from China (13th century), the first observations on insects and other arthropods as forensic indicators were documented in Germany and France during mass exhumations in the 1880s by Reinhard, who is considered a co-founder of the discipline. After the French publication of Mégnin's popular book on the applied aspects of forensic entomology, the concept quickly spread to Canada and United States. At that time, researchers recognized that the lack of systematic observations of insects of forensic importance jeopardized their use as indicators of postmortem interval. General advances in insect taxonomy and ecology helped to fill this gap over the following decades. After World Wars, few forensic entomology cases were reported in the scientific literature. From 1960s to the 1980s, Leclercq and Nuorteva were primarily responsible for maintaining the method in Central Europe, reporting isolated cases. Since then, basic research in the USA, Russia and Canada opened the way to the routine use of Entomology in forensic investigations. Identifications of insects associated with human cadavers are relatively few in the literature of the Neotropical region and have received little attention in Brazil. This article brings an overview of historic developments in this field, the recent studies and the main problems and challenges in South America and mainly in Brazil.

  10. Main Issues in Big Data Security

    Directory of Open Access Journals (Sweden)

    Julio Moreno

    2016-09-01

    Full Text Available Data is currently one of the most important assets for companies in every field. The continuous growth in the importance and volume of data has created a new problem: it cannot be handled by traditional analysis techniques. This problem was, therefore, solved through the creation of a new paradigm: Big Data. However, Big Data originated new issues related not only to the volume or the variety of the data, but also to data security and privacy. In order to obtain a full perspective of the problem, we decided to carry out an investigation with the objective of highlighting the main issues regarding Big Data security, and also the solutions proposed by the scientific community to solve them. In this paper, we explain the results obtained after applying a systematic mapping study to security in the Big Data ecosystem. It is almost impossible to carry out detailed research into the entire topic of security, and the outcome of this research is, therefore, a big picture of the main problems related to security in a Big Data system, along with the principal solutions to them proposed by the research community.

  11. Engine Test Facility (ETF)

    Data.gov (United States)

    Federal Laboratory Consortium — The Air Force Arnold Engineering Development Center's Engine Test Facility (ETF) test cells are used for development and evaluation testing of propulsion systems for...

  12. Contemporary engineering economics

    CERN Document Server

    Park, Chan S

    2011-01-01

    Contemporary Engineering Economics, 5/e, is intended for undergraduate engineering students taking introductory engineering economics while appealing to the full range of engineering disciplines for which this course is often required: industrial, civil, mechanical, electrical, computer, aerospace, chemical, and manufacturing engineering, as well as engineering technology. This edition has been thoroughly revised and updated while continuing to adopt a contemporary approach to the subject, and teaching, of engineering economics. This text aims not only to build a sound and comprehensive coverage of engineering economics, but also to address key educational challenges, such as student difficulty in developing the analytical skills required to make informed financial decisions.

  13. Solar engine system

    International Nuclear Information System (INIS)

    Tan, K.K.; Bahrom Sanugi; Chen, L.C.; Chong, K.K.; Jasmy Yunus; Kannan, K.S.; Lim, B.H.; Noriah Bidin; Omar Aliman; Sahar Salehan; Sheikh Ab Rezan Sheikh A H; Tam, C.M.; Chen, Y.T.

    2001-01-01

    This paper reports the revolutionary solar engine system in Universiti Teknologi Malaysia (UTM). The solar engine is a single cylinder stirling engine driven by solar thermal energy. A first prototype solar engine has been built and demonstrated. A new-concept non-imaging focusing heliostat and a recently invented optical receiver are used in the demonstration. Second generation of prototype solar engine is described briefly. In this paper, the solar engine system development is reported. Measurement for the first prototype engine speed, temperature and specifications are presented. The benefits and potential applications for the future solar engine system, especially for the electricity generating aspect are discussed. (Author)

  14. Sound engineering for diesel engines; Sound Engineering an Dieselmotoren

    Energy Technology Data Exchange (ETDEWEB)

    Enderich, A.; Fischer, R. [MAHLE Filtersysteme GmbH, Stuttgart (Germany)

    2006-07-01

    The strong acceptance for vehicles powered by turbo-charged diesel engines encourages several manufacturers to think about sportive diesel concepts. The approach of suppressing unpleasant noise by the application of distinctive insulation steps is not adequate to satisfy sportive needs. The acoustics cannot follow the engine's performance. This report documents, that it is possible to give diesel-powered vehicles a sportive sound characteristic by using an advanced MAHLE motor-sound-system with a pressure-resistant membrane and an integrated load controlled flap. With this the specific acoustic disadvantages of the diesel engine, like the ''diesel knock'' or a rough engine running can be masked. However, by the application of a motor-sound-system you must not negate the original character of the diesel engine concept, but accentuate its strong torque characteristic in the middle engine speed range. (orig.)

  15. Synthetic biology meets tissue engineering.

    Science.gov (United States)

    Davies, Jamie A; Cachat, Elise

    2016-06-15

    Classical tissue engineering is aimed mainly at producing anatomically and physiologically realistic replacements for normal human tissues. It is done either by encouraging cellular colonization of manufactured matrices or cellular recolonization of decellularized natural extracellular matrices from donor organs, or by allowing cells to self-organize into organs as they do during fetal life. For repair of normal bodies, this will be adequate but there are reasons for making unusual, non-evolved tissues (repair of unusual bodies, interface to electromechanical prostheses, incorporating living cells into life-support machines). Synthetic biology is aimed mainly at engineering cells so that they can perform custom functions: applying synthetic biological approaches to tissue engineering may be one way of engineering custom structures. In this article, we outline the 'embryological cycle' of patterning, differentiation and morphogenesis and review progress that has been made in constructing synthetic biological systems to reproduce these processes in new ways. The state-of-the-art remains a long way from making truly synthetic tissues, but there are now at least foundations for future work. © 2016 Authors; published by Portland Press Limited.

  16. Introduction to nuclear engineering

    International Nuclear Information System (INIS)

    Bouchard, J.; Deffain, J.P.; Gouchet, A.

    2007-01-01

    This book is an introductory course to the technology of nuclear reactors, it is based on lectures given to students engaged in nuclear engineering curricula. A brief historical account of nuclear power is given in which Three Miles Island and Chernobyl accidents appear to be the main milestones because of their big impacts on the way to apprehend the safety in the design of a reactor for the first and on the public controversy of nuclear energy for the second. All the concepts and knowledge required to understand the design of a reactor and how it operates, are described: radioactivity, nuclear safety, irradiation effects on materials, uranium enrichment, reactor kinetics, fission products poisoning,... This book is made up of 4 parts: 1) nuclear power, 2) types of power nuclear reactors (PWR, BWR and fast reactors), 3) the fuel cycle, and 4) neutronics basics. (A.C.)

  17. Stirling Engine Configuration Selection

    Directory of Open Access Journals (Sweden)

    Jose Egas

    2018-03-01

    Full Text Available Unlike internal combustion engines, Stirling engines can be designed to work with many drive mechanisms based on the three primary configurations, alpha, beta and gamma. Hundreds of different combinations of configuration and mechanical drives have been proposed. Few succeed beyond prototypes. A reason for poor success is the use of inappropriate configuration and drive mechanisms, which leads to low power to weight ratio and reduced economic viability. The large number of options, the lack of an objective comparison method, and the absence of a selection criteria force designers to make random choices. In this article, the pressure—volume diagrams and compression ratios of machines of equal dimensions, using the main (alpha, beta and gamma crank based configurations as well as rhombic drive and Ross yoke mechanisms, are obtained. The existence of a direct relation between the optimum compression ratio and the temperature ratio is derived from the ideal Stirling cycle, and the usability of an empirical low temperature difference compression ratio equation for high temperature difference applications is tested using experimental data. It is shown that each machine has a different compression ratio, making it more or less suitable for a specific application, depending on the temperature difference reachable.

  18. A random walk down Main Street

    Directory of Open Access Journals (Sweden)

    David Matthew Levinson

    2016-08-01

    Full Text Available US suburbs have often been characterized by their relatively low walk accessibility compared to more urban environments, and US urban environments have been char- acterized by low walk accessibility compared to cities in other countries. Lower overall density in the suburbs implies that activities, if spread out, would have a greater distance between them. But why should activities be spread out instead of developed contiguously? This brief research note builds a positive model for the emergence of contiguous development along “Main Street” to illustrate the trade-offs that result in the built environment we observe. It then suggests some policy interventions to place a “thumb on the scale” to choose which parcels will develop in which sequence to achieve socially preferred outcomes.

  19. Mortise terrorism on the main pipelines

    Science.gov (United States)

    Komarov, V. A.; Nigrey, N. N.; Bronnikov, D. A.; Nigrey, A. A.

    2018-01-01

    The research aim of the work is to analyze the effectiveness of the methods of physical protection of main pipelines proposed in the article from the "mortise terrorism" A mathematical model has been developed that made it possible to predict the dynamics of "mortise terrorism" in the short term. An analysis of the effectiveness of physical protection methods proposed in the article to prevent unauthorized impacts on the objects under investigation is given. A variant of a video analytics system has been developed that allows detecting violators with recognition of the types of work they perform at a distance of 150 meters in conditions of complex natural backgrounds and precipitation. Probability of detection is 0.959.

  20. Siberian snakes for the Fermilab Main Injector

    International Nuclear Information System (INIS)

    Anferov, V.A.; Baiod, R.; Courant, E.D.

    1993-01-01

    Appropriate Siberian snakes were designed to maintain the proton beam polarization during acceleration in the Fermilab Main Injector from 8 to 150 GeV. Various snake designs were investigated to find one fitting into the 14 m straight section spaces with the required spin rotation axis and the minimum orbit excursion. The authors studied both cold and warm discrete magnet snakes as well as warm snakes with helical magnets. For the warm discrete magnet snake, obtaining small orbit excursions required a nearly longitudinal snake axis, while axes near ±45 degrees are needed when using two snakes in a ring. The authors found acceptable snakes either by using superconducting magnets or by using warm magnets with a helical dipole field

  1. CBA main magnet power supply ripple reduction

    International Nuclear Information System (INIS)

    Bagley, G.; Edwards, R.J.

    1983-01-01

    The preliminary results of a development program to minimize beam perturbation resulting from ripple current generated by the CBA Main Magnet Power Supply are presented. The assessment of the magnitude and causes of the ripple generated led to a modification of the SCR Gate Driver and the addition of a bandpass amplifier correction loop which gave significant improvement. A description of the changes made and the results obtained are included. A second design approach was developed in which the timing of the SCR gate pulses is directly determined by a VCO. The results reported with this VCO Loop indicate superior performance particularly at frequencies below 60 Hz. A shunt transistor regulator design is proposed to minimize higher SCR switching frequency harmonics

  2. BANKING ETHICS: MAIN CONCEPTIONS AND PROBLEMS

    Directory of Open Access Journals (Sweden)

    VALENTINA FETINIUC

    2014-10-01

    Full Text Available Banking ethics is a specialized set of ethical standards and rules that should be followed in the activities of financial institutions and employees of the banking sector. But despite the simplicity of the definition, in the modern world, this concept becomes complex and ambiguous. The importance of studying this subject is defined by the fact that the ethical behavior of the bank and bank employees promotes banking. At present there are several conceptions of banking ethics: general ethics, regulated ethics and ethical bank. The most common practice is to regulate internal and external relations of banks and bank workers with ethical codes. At the same time, studies show the existence of problems in the banking standards of ethics, which negatively affects the financial institution. This article is intended to reflect main tendencies and problems of banking ethics at international level and experience of Republic of Moldova in this field.

  3. Seismic risks at Elsie Lake Main Dam

    International Nuclear Information System (INIS)

    McCammon, N.R.; Momenzadeh, M.; Hawson, H.H.; Nielsen, N.M.

    1991-01-01

    The Elsie Lake dams are located on Vancouver Island in an area of high seismic risk. A safety review in 1986 indicated potential deficiencies in the earthfill main dam with respect to modern earthquake design standards. A detailed field investigation program comprising drilling and penetration tests was carried out and the results used in an assessment of seismic stability. A 0.8 m thick less dense layer in the granular shell of the dam, possibly caused by wet construction conditions, would likely liquefy in a major earthquake but sufficient residual strength would likely remain to prevent catastrophic failure. The dam shell might undergo some distortion, and an assessment was initiated to determine the requirements for reservoir drawdown following an extreme earthquake to ensure the timely lowering of the reservoir for inspection and repair. It was suggested that an adequate evacuation capability would be 25% and 50% drawdown in not more than 30 and 50 days, respectively. 9 refs., 11 figs., 1 tab

  4. Natural syntax : English interrogative main clauses

    Directory of Open Access Journals (Sweden)

    Janez Oresnik

    2007-12-01

    Full Text Available Natural Syntax is a developing deductive theory, a branch of Naturalness Theory. The naturalnessjudgements are couched in naturalness scales, whichfollow from the basic parameters (or «axioms» listed at the beginning of the paper. The predictions of the theory are calculated in deductions, whose chief components are apair of naturalness scales and the rules governing the alignment of corresponding naturalness values. Parallel and chiastic alignments are distinguished, in complementary distribution. Chiastic alignment is mandatory in deductions limited to unnatural environments. The paper deals with English interrogative main clauses. Within these, only the interrogatives containing wh-words exclusively insitu constitute an extremely unnatural environment and require chiastic alignment. Otherwiseparallel alignment is used. Earlier publications on Natural Syntax: Kavcic 2005a,b, Oresnik 1999, 2000a,b, 200la-f   2002, 2003a-c, 2002/03, 2004. This list cites only works written in English.

  5. PS main supply: motor-generator set.

    CERN Multimedia

    Maximilien Brice

    2002-01-01

    In picture 04 the motor is on the right in the background and the main view is of the generator. The peak power in each PS cycle drawn from the generator, up to 96 MW, is taken from the rotational kinetic energy of the rotor (a heavy-weight of 80 tons), which makes the rotational speed drop by only a few percent. The motor replenishes the average power of 2 to 4 MW. Photo 05: The motor-generator set is serviced every year and, in particular, bearings and slip-rings are carefully checked. To the left is the motor with its slip-rings visible. It has been detached from the axle and moved to the side, so that the rotor can be removed from the huge generator, looming at the right.

  6. VAT EVASION INLEBANON: CASES AND MAIN CAUSES

    Directory of Open Access Journals (Sweden)

    Rana Ismail

    2012-07-01

    Full Text Available The Value Added Tax (VAT is a very important source oftreasuryrevenuesinLebanon. It was initially introduced inLebanon in order to reduce the budgetdeficit and help contain the debt. However, VAT evasion growth inLebanon isleading to significant VAT revenue losses because of its size and frequency.In this paper, we will highlight the contribution of VAT to the treasury revenue. Inaddition, our research has led to figure out the most significant VAT evasion casesand the way tax payers evade paying their required VAT or try to have an illegalrefund. From these tax evasion cases, we will pinpoint the main causes of suchevasions and propose solutions to limit as much as possible VAT evasion inLebanon.

  7. Main clinical epidemiological features of lung cancer

    International Nuclear Information System (INIS)

    Costa Montane, Daniel Marino; Prado Lage, Yulien; Lozano Salazar; Jorge Luis

    2011-01-01

    A descriptive and cross-sectional study of 95 patients with lung cancer, discharged from Neumology Service at 'Dr Juan Bruno Zayas Alfonso' General Hospital in Santiago de Cuba, was carried out from January, 2008 to December, 2008 in order to identify the main clinical epidemiological features of the aforementioned disease. A malignancy predominance among men aged between 56 and 65 years old, belonging to urban areas and being heavy smoker (out of 30 cigarettes per day over 30 years ), was found. Those affected without a confirmed histological type and IV clinical stage epidermoid carcinoma were predominant. Most of them had the opportunity to be treated. Increasing and intensifying health promotion and disease prevention campaigns were recommended so as to achieve the population to avoid or quit the smoking habit. (author)

  8. Main heat transfer components for SNR-300

    International Nuclear Information System (INIS)

    De Haas Van Dorsser, A.H.

    1976-01-01

    Early in the joint German-Belgium-Dutch fast breeder programme it was decided that all main components should be tested, if possible at full scale, before fabrication of the actual SNR-300 components. Descriptions are given of the results of testing, and subsequent modifications, of the pumps, intermediate heat exchangers, and steam generators. A full scale model of the primary pump, free surface vertical shaft centrifugal type, was constructed and tested in the 5000 cubic metres per hour pump test facility erected at Bensberg. A 70 MW model of an intermediate heat exchanger, straight tube type with floating head, was tested in the 50 MW steam generator test station at Hengelo. Also tested in the Hengelo facility was an almost full scale straight tube 50 MW steam generator and subsequently a 50 MW helical tube evaporator. The latter tests were of more than 3000 h operation and resulted in minor changes in design and manufacturing operation. (U.K.)

  9. Malware analysis and reverse engineering

    OpenAIRE

    Šváb, Martin

    2014-01-01

    Focus of this thesis is reverse engineering in information technology closely linked with the malware analysis. It explains fundamentals of IA-32 processors architecture and basics of operating system Microsoft Windows. Main part of this thesis is dedicated to the malware analysis, including description of creating a tool for simplification of static part of the analysis. In Conclusion various approaches to the malware analysis, which were described in previous part of the thesis, are practic...

  10. Civil Engineering & Design Standards Manual

    OpenAIRE

    Vänttinen, Eetu

    2014-01-01

    Civil Discipline Engineering department in Foster Wheeler Energia Oy takes care of the construction of foundation, steel frame, platforms, cladding/roofing, HVAC, elevator, hoist and central vacuum system of the boiler building. The goal of the thesis was to compile a design manual for the department to ease up the startup of the design of a new project and standardize the design. Main objective was to gather together all the existing guidelines, standards and directives regarding the des...

  11. Naturally Engineered Maturation of Cardiomyocytes

    Directory of Open Access Journals (Sweden)

    Gaetano J. Scuderi

    2017-05-01

    Full Text Available Ischemic heart disease remains one of the most prominent causes of mortalities worldwide with heart transplantation being the gold-standard treatment option. However, due to the major limitations associated with heart transplants, such as an inadequate supply and heart rejection, there remains a significant clinical need for a viable cardiac regenerative therapy to restore native myocardial function. Over the course of the previous several decades, researchers have made prominent advances in the field of cardiac regeneration with the creation of in vitro human pluripotent stem cell-derived cardiomyocyte tissue engineered constructs. However, these engineered constructs exhibit a functionally immature, disorganized, fetal-like phenotype that is not equivalent physiologically to native adult cardiac tissue. Due to this major limitation, many recent studies have investigated approaches to improve pluripotent stem cell-derived cardiomyocyte maturation to close this large functionality gap between engineered and native cardiac tissue. This review integrates the natural developmental mechanisms of cardiomyocyte structural and functional maturation. The variety of ways researchers have attempted to improve cardiomyocyte maturation in vitro by mimicking natural development, known as natural engineering, is readily discussed. The main focus of this review involves the synergistic role of electrical and mechanical stimulation, extracellular matrix interactions, and non-cardiomyocyte interactions in facilitating cardiomyocyte maturation. Overall, even with these current natural engineering approaches, pluripotent stem cell-derived cardiomyocytes within three-dimensional engineered heart tissue still remain mostly within the early to late fetal stages of cardiomyocyte maturity. Therefore, although the end goal is to achieve adult phenotypic maturity, more emphasis must be placed on elucidating how the in vivo fetal microenvironment drives cardiomyocyte

  12. Research on a Scania 11 liter ethanol fueled bus engine

    Energy Technology Data Exchange (ETDEWEB)

    Egebaeck, K E; Pettersson, E

    1996-05-01

    This report presents research carried out on an alcohol fueled bus engine. The engine used was a six cylinder 11 liter compression ignition turbo-charged engine with an inter cooler. The research program included studies of the impact on the emissions when changing different engine components and different settings of the engine. A study of the impact on the engine performance and emissions when using different fuel compositions was also carried out. During the course of the work, the engine was equipped with oxidation catalysts of two different types, one of which was more efficient than the other concerning the oxidation of unburnt fuel related components. One of the main purposes of the research was to improve the emission characteristics of the engine by an optimization of the engine and its setting. The exhaust emissions were thoroughly characterized with respect to both regulated and unregulated emissions. 13 refs, figs, tabs

  13. Main Findings: Lessons to be Learnt

    International Nuclear Information System (INIS)

    2010-01-01

    This section summarizes the main lessons to be learnt from the workshop: 1 - Workshop Methodology: This method of work has proven to be successful. Participants appreciated the high level of interaction with the other colleagues, especially in view of the variety of expertise that was represented at the workshop. The method also affords the participants the opportunity to learn about the status of waste management in the host country, and to come into contact with the main actors. Conversely, the method also affords the host country programme added visibility at the international level. 2 - National Regulations and International Guidance and Bases for Criteria and Regulatory Judgement: There is reasonable consensus amongst national regulations on fundamental regulatory objectives, but much less agreement on the most appropriate criteria. Consensus is nationally and internationally hampered by the lack of common definition of concepts and terms. International guidance is interpreted in different ways in each country. International guidance is rather difficult to interpret, understand and apply. It is important that stakeholders understand the bases for regulatory judgements. 3 - Optimisation: The fundamental goals of optimisation need to be clarified. Optimisation of long-term vs. short-term safety remains problematic. The process of performing optimisation is more important than the numerical or scientific result. A transparent, stepwise and iterative process of decision making is essential for optimisation. The basic, broad rules for decision making and involvement of stakeholders need to be defined in advance. 4 - Technical Indicators for Safe Performance: The relative importance of different safety indicators varies with timescale. There is still much to be done before reaching consensus on the relative importance of different time frames. More discussion is needed on time cut-offs for regulatory compliance. More discussion on the meaning and applicability of

  14. Maine Environmental Vulnerability Index (EVI) Atlas, Maine - 2007, maps in portable document format (NODC Accession 0036827)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This four volume set of Environmental Vulnerability Index Maps depicts environmental resources along the coast of Maine most at risk from oil spilled into the marine...

  15. Laser welding engineering

    International Nuclear Information System (INIS)

    Bhieh, N. M.; El Eesawi, M. E.; Hashkel, A. E.

    2007-01-01

    Laser welding was in its early life used mainly for unusual applications where no other welding process would be suitable that was twenty five years ago. Today, laser welding is a fully developed part of the metal working industry, routinely producing welds for common items such as cigarette lighters, which springs, motor/transformer lamination, hermetic seals, battery and pacemaker cans and hybrid circuit packages. Yet very few manufacturing engineering have seriously considers employing lasers in their own operations. Why? There are many reasons, but a main one must be not acquainted with the operation and capabilities of a laser system. Other reasons, such as a relatively high initial cost and a concern about using lasers in the manufacturing environment, also are frequently cited, and the complexity of the component and flexibility of the light delivery system. Laser welding could be used in place of many different standard processes, such as resistance (spot or seam), submerged arc, RF induction, high-frequency resistance, ultrasonic and electronic and electron-beam. while each of these techniques has established an independent function in the manufacturing world, the flexible laser welding approach will operate efficiently and economically in many different applications. Its flexibility will even permit the welding system to be used for other machining function, such as drilling, scribing, sealing and serializing. In this article, we will look at how laser welding works and what benefits it can offer to manufacturing engineers. Some industry observers state that there are already 2,000 laser machine tools being used for cutting, welding and drilling and that the number could reach 30,000 over the next 15 years as manufacturing engineers become more aware of the capabilities of lasers [1). While most laser applications are dedicated to one product or process that involves high-volume, long-run manufacturing, the flexibility of a laser to supply energy to hard

  16. 2016 Milwaukee Engineering Research Conference | College of Engineering &

    Science.gov (United States)

    Biomedical Engineering Concentration on Ergonomics M.S. Program in Computer Science Interdisciplinary Concentration on Energy Doctoral Programs in Engineering Non-Degree Candidate Departments Biomedical Engineering Biomedical Engineering Industry Advisory Council Civil & Environmental Engineering Civil &

  17. Main attributes influencing spent nuclear fuel management

    International Nuclear Information System (INIS)

    Andreescu, N.; Ohai, D.

    1997-01-01

    All activities regarding nuclear fuel, following its discharge from the NPP, constitute the spent fuel management and are grouped in two possible back end variants, namely reprocessing (including HLW vitrification and geological disposal) and direct disposal of spent fuel. In order to select the appropriate variant it is necessary to analyse the aggregate fulfillment of the imposed requirements, particularly of the derived attributes, defined as distinguishing characteristics of the factors used in the decision making process. The main identified attributes are the following: - environmental impact, - availability of suitable sites, - non-proliferation degree, -strategy of energy, - technological complexity and technical maturity, -possible further technical improvements, - size of nuclear programme, - total costs, - public acceptance, - peculiarity of CANDU fuel. The significance of the attributes in the Romanian case, taking into consideration the present situation, as a low scenario and a high scenario corresponding to an important development of the nuclear power, after the year 2010, is presented. According to their importance the ranking of attributes is proposed . Subsequently, the ranking could be used for adequate weighing of attributes in order to realize a multi-criteria analysis and a relevant comparison of back end variants. (authors)

  18. EPR compared to international requirements (Mainly EUR)

    International Nuclear Information System (INIS)

    Broecker, B.

    1996-01-01

    A number of European Utilities have entered an agreement to write common requirements dedicated to future light water nuclear power plants to be built in Europe. The activities are known under the sign EUR (European Utilities Requirements). EPR, the future European Pressurized water Reactor, is the first installation of this type which will be operational from the year 2000 onwards, must fulfill the European requirements. EPR will serve as a test whether these requirements are realistic and well balanced. At the basic design stage of EPR, this paper concentrates on four main topics: the requirements which are new compared with existing reactors and which put a major challenge to the designer; the requirements today still open and the way they can be met by the EPR or not; the points for which already today the EPR special requirements exceed the EUR; the examples where the design of the EPR has given feedback which has led to a change of the EUR. EPR and EUR are different approaches to the reactor of the future. EUR is a set of requirements which leaves a flexibility to the designer while EPR is a real project which defines the technical solutions. EPR will fulfill the EUR and will at the same time serve as a test whether these requirements are realistic. EPR will also fulfill international requirements with minor changes. (J.S.). 7 figs

  19. CVD - main concepts, applications and restrictions

    International Nuclear Information System (INIS)

    Bliznakovska, B.; Milosevski, M.; Krawczynski, S.; Meixner, C.; Koetter, H.R.

    1993-01-01

    Despite of the fact that the existing literature covering the last two decades is plentiful with data related to CVD, this document is an attempt to provide to a reader a concise information about the nature of CVD technique at production of technologically important materials as well as to point at special references. The text is devided into three separate sections. The first section, The Main Features of CVD, is intended to give a complete comprehensive picture of the CVD technique through process description and characterization. The basic principles of thermodynamics, CVD chemical reactions classification, CVD chemical kinetics aspects and physics of CVD (with particular attention on the gas-flow phenomena) are included. As an additional aspect, in CVD unavoidable aspect however, the role of the coating/substrate compatibility on the overall process was outlined. The second section, CVD Equipment, concerns on the pecularities of the complete CVD unit pointing out the individual significances of the separate parts, i.e. pumping system, reactor chamber, control system. The aim of this section is to create to a reader a basic understanding of the arising problems but connected to be actual CVD performance. As a final goal of this review the reader's attention is turned upon the CVD applications for production of an up-to-date important class of coatings such as multilayer coatings. (orig.)

  20. Proposed Fermilab upgrade main injector project

    International Nuclear Information System (INIS)

    1992-04-01

    The US Department of Energy (DOE) proposes to construct and operate a ''Fermilab Main Injector'' (FMI), a 150 GeV proton injector accelerator, at the Fermi National Accelerator Laboratory (Fermilab) in Batavia, Illinois. The purpose and need for this action are given of this Environmental Assessment (EA). A description of the proposed FMI and construction activities are also given. The proposed FMI would be housed in an underground tunnel with a circumference of approximately 2.1 miles (3.4 kilometers), and the construction would affect approximately 135 acres of the 6,800 acre Fermilab site. The purpose of the proposed FMI is to construct and bring into operation a new 150 GeV proton injector accelerator. This addition to Fermilab's Tevatron would enable scientists to penetrate ever more deeply into the subatomic world through the detection of the super massive particles that can be created when a proton and antiproton collide head-on. The conversion of energy into matter in these collisions makes it possible to create particles that existed only an instant after the beginning of time. The proposed FMI would significantly extend the scientific reach of the Tevatron, the world's first superconducting accelerator and highest energy proton-antiproton collider

  1. Main prospects of EDF's nuclear program

    International Nuclear Information System (INIS)

    Pierre Bacher, M.; Jean Pierrard, M.

    1994-01-01

    Today, EDF is at a half way point in its third major standardized series, the N4 1400 MW series. The main objective agreed upon for this N4 series, was to improve the insertion of man in the control loop. After the TMI accident in 1979, selective improvements had already been introduced in the 900 series ; the 1300 series, which was the underway, was also the object of more significant improvements (for instance a digital control system) ; but it still seemed desirable that all the lessons to be learned from the accident be reflected in the third series : the fully computerized instrumentation and control system developed for the N4 series ?comparable to the one developed for Airbus ?is today the first of its kind in the world. The demand increase for electric energy dramatically stopped in 1993. However, the prospect for the coming years is more optimistic. Electricity consumption is expected to increase slowly by an average 2% per year. In this context, EDF is preparing its energy program for the nest century and takes into account that hydraulic generation capacity will remain stable and that the French thermal units fueled with coal are rather old and will have to be replaced.

  2. The two main theories on dental bruxism.

    Science.gov (United States)

    Behr, Michael; Hahnel, Sebastian; Faltermeier, Andreas; Bürgers, Ralf; Kolbeck, Carola; Handel, Gerhard; Proff, Peter

    2012-03-20

    Bruxism is characterized by non-functional contact of mandibular and maxillary teeth resulting in clenching or grating of teeth. Theories on factors causing bruxism are a matter of controversy in current literature. The dental profession has predominantly viewed peripheral local morphological disorders, such as malocclusion, as the cause of clenching and gnashing. This etiological model is based on the theory that occlusal maladjustment results in reduced masticatory muscle tone. In the absence of occlusal equilibration, motor neuron activity of masticatory muscles is triggered by periodontal receptors. The second theory assumes that central disturbances in the area of the basal ganglia are the main cause of bruxism. An imbalance in the circuit processing of the basal ganglia is supposed to be responsible for muscle hyperactivity during nocturnal dyskinesia such as bruxism. Some authors assume that bruxism constitutes sleep-related parafunctional activity (parasomnia). A recent model, which may explain the potential imbalance of the basal ganglia, is neuroplasticity. Neural plasticity is based on the ability of synapses to change the way they work. Activation of neural plasticity can change the relationship between inhibitory and excitatory neurons. It seems obvious that bruxism is not a symptom specific to just one disease. Many forms (and causes) of bruxism may exist simultaneously, as, for example, peripheral or central forms. Copyright © 2011 Elsevier GmbH. All rights reserved.

  3. Prototype fast breeder reactor main options

    International Nuclear Information System (INIS)

    Bhoje, S.B.; Chellapandi, P.

    1996-01-01

    Fast reactor programme gets importance in the Indian energy market because of continuous growing demand of electricity and resources limited to only coal and FBR. India started its fast reactor programme with the construction of 40 MWt Fast Breeder Test Reactor (FBTR). The reactor attained its first criticality in October 1985. The reactor power will be raised to 40 MWt in near future. As a logical follow-up of FBTR, it was decided to build a prototype fast breeder reactor, PFBR. Considering significant effects of capital cost and construction period on economy, systematic efforts are made to reduce the same. The number of primary and secondary sodium loops and components have been reduced. Sodium coolant, pool type concept, oxide fuel, 20% CW D9, SS 316 LN and modified 9Cr-1Mo steel (T91) materials have been selected for PFBR. Based on the operating experience, the integrity of the high temperature components including fuel and cost optimization aspects, the plant temperatures are recommended. Steam temperature of 763 K at 16.6 MPa and a single TG of 500 MWe gross output have been decided. PFBR will be located at Kalpakkam site on the coast of Bay of Bengal. The plant life is designed for 30 y and 75% load factor. In this paper the justifications for the main options chosen are given in brief. (author). 2 figs, 2 tabs

  4. Brand new hall in the main building

    CERN Multimedia

    Corinne Pralavorio

    2014-01-01

    The renovation of the UNIQA and post office premises is getting under way, with their reopening scheduled for the spring.   The renovation of the large hall in the main building (Building 500) has finally reached the home straight. As of this week, building contractors will get to work on the last part – the offices of UNIQA and La Poste. In the last week of November, the two concessions moved their offices across Route Scherrer to the same part of Building 510 where UBS was temporarily housed during the bank’s refurbishment. Their services were therefore unavailable for one day. The renovation work will last until the spring, with the new offices expected to open in May 2015. Between now and then, the windows and insulation will be completely refitted, with a view to reducing heat loss considerably, and, above all, the premises will be modernised to improve customer reception and service. For example, UNIQA’s new premises will feature a confidential area, guarantee...

  5. Fusion reactor blanket-main design aspects

    International Nuclear Information System (INIS)

    Strebkov, Yu.; Sidorov, A.; Danilov, I.

    1994-01-01

    The main function of the fusion reactor blanket is ensuring tritium breeding and radiation shield. The blanket version depends on the reactor type (experimental, DEMO, commercial) and its parameters. Blanket operation conditions are defined with the heat flux, neutron load/fluence, cyclic operation, dynamic heating/force loading, MHD effects etc. DEMO/commercial blanket design is distinguished e.g. by rather high heat load and neutron fluence - up to 100 W/cm 2 and 7 MWa/m 2 accordingly. This conditions impose specific requirements for the materials, structure, maintenance of the blanket and its most loaded components - FW and limiter. The liquid Li-Pb eutectic is one of the possible breeder for different kinds of blanket in view of its advantages one of which is the blanket convertibility that allow to have shielding blanket (borated water) or breeding one (Li-Pb eutectic). Using Li-Pb eutectic for both ITER and DEMO blankets have been considered. In the conceptual ITER design the solid eutectic blanket was carried out. The liquid eutectic breeder/coolant is suggested also for the advanced (high parameter) blanket

  6. Fundamental of biomedical engineering

    CERN Document Server

    Sawhney, GS

    2007-01-01

    About the Book: A well set out textbook explains the fundamentals of biomedical engineering in the areas of biomechanics, biofluid flow, biomaterials, bioinstrumentation and use of computing in biomedical engineering. All these subjects form a basic part of an engineer''s education. The text is admirably suited to meet the needs of the students of mechanical engineering, opting for the elective of Biomedical Engineering. Coverage of bioinstrumentation, biomaterials and computing for biomedical engineers can meet the needs of the students of Electronic & Communication, Electronic & Instrumenta

  7. Studying Engineering Practice

    DEFF Research Database (Denmark)

    Buch, Anders

    2015-01-01

    The study of engineering practices has been the focus of Engineering Studies over the last three decades. Theses studies have used ethnographic and grounded methods in order to investigate engineering practices as they unfold in natural settings - in workplaces and engineering education. However......, engineering studies have not given much attention to conceptually clarifying what should be understood by 'engineering practices' and more precisely account for the composition and organization of the entities and phenomena that make up the practices. This chapter investigates and discusses how a 'practice...... will draw out some methodological consequences and discuss the ramifications of a practice theoretical approach for Engineering Studies....

  8. An Analysis of the Acquisition Process for Simplified Acquisition of Base Engineering Requirements (SABER) Contracts and Its Potential Impact on Contractor Performance

    National Research Council Canada - National Science Library

    Heaps, Brian

    2001-01-01

    The Simplified Acquisition of Base Engineering Requirements (SABER) contract's main purpose is to expedite contract award of civil engineer requirements through the issuance of individual delivery orders...

  9. Engineering Education and the Identities of Engineers in Colombia, 1887–1972

    DEFF Research Database (Denmark)

    Pineda, Andres Felipe Valderrama

    2009-01-01

    of codes of meaning. The authors pay especial attention to the role of foreign models of educating engineers and the regional tensions that emerge between competing schools in the country. These two tensions are related to the different ideals or metrics of progress advocated by government officials......In this article the authors analyze the history of engineering education in Colombia from 1887 to 1972. The main theme of the analysis is how engineering educators actively contribute to the shaping of the identity of their profession in response to different societal influences in the forms......, politicians, industrialists, and engineering educators themselves in various cities of the country. As the twentieth century passes its midpoint the code of meaning of the discourse on development becomes the main influence shaping the identities of engineers in Colombia....

  10. Strategic Plan | College of Engineering & Applied Science

    Science.gov (United States)

    Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

  11. News | College of Engineering & Applied Science

    Science.gov (United States)

    Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

  12. Structures Laboratory | College of Engineering & Applied Science

    Science.gov (United States)

    Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

  13. Contact | College of Engineering & Applied Science

    Science.gov (United States)

    Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

  14. Johnson Controls | College of Engineering & Applied Science

    Science.gov (United States)

    Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

  15. FAQ's | College of Engineering & Applied Science

    Science.gov (United States)

    Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

  16. Current Students | College of Engineering & Applied Science

    Science.gov (United States)

    Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

  17. Admissions - Undergraduate Students | College of Engineering & Applied

    Science.gov (United States)

    Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

  18. Student Organizations | College of Engineering & Applied Science

    Science.gov (United States)

    Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

  19. Community | College of Engineering & Applied Science

    Science.gov (United States)

    Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering

  20. Corporate Partners | College of Engineering & Applied Science

    Science.gov (United States)

    Electrical Engineering Instructional Laboratories Student Resources Industrial & Manufacturing Engineering Industrial & Manufacturing Engineering Academic Programs Industrial & Manufacturing Engineering Major Industrial & Manufacturing Engineering Minor Industrial & Manufacturing Engineering