The effects of nitrogen deficiencies on the lipid and protein contents ...

African Journals Online (AJOL)

Nitrogen deficiencies were studied in Spirulina platensis (Cyanophyceae) with the aim of determining the effects of the 50 and 100% deficient nitrogen on the lipid and protein contents of the cell under laboratory conditions. S. platensis cultures were grown in Spirulina medium and kept at the constant room temperature of ...

Utilization of alimentary protein and amino acids in satisfying the nitrogen requirements of monogastric mammals

International Nuclear Information System (INIS)

Pion, R.; Arnal, M.

1976-01-01

The nitrogenous matter in the food of monogastric animals consists mainly of proteins, which are rapidly hydrolized in the intestinal tract when they have left the gastric reservoir. The digestive tube has several roles: it provides for hydrolysis of the food proteins and for a supply of endogenous nitrogen; it enables a certain digestive function to be performed by the intestinal flora and permits the transport of amino acids into the blood, selecting those which are needed for protein synthesis. The digestion products appear mainly in the form of free amino acids in the portal blood. A large proportion of these amino acids is taken up by the liver, so that intense protein synthesis takes place in the latter, coupled with a decrease in catabolism leading to a rhythmic increase in the liver content of proteins and RNA. The labile proteins retained are mainly enzymes, which catabolize the amino acids, and the liver is the site of the catabolism of most of the excess amino acids except those with chain branching. Alimentary deficiencies do not markedly reduce protein synthesis in this organ, since the rate of re-utilization of the amino acids is increased and the liver thus plays a regulatory role. The utilization of amino acids in muscle also follows a certain rhythm, partly connected with feeding, and under hormonal control. The muscle is the seat of catabolism of a large part of the branched chain amino acids, and like the liver it contributes to the energy utilization of amino acids. The rate of utilization of certain essential amino acids can be measured by metabolic criteria, including determination of blood and muscle concentrations and excretion of 14 CO 2 labels in the exhaled air or of 35 S labels in urine. (author)

Nitrogen excretion in rats on a protein-free diet and during starvation

DEFF Research Database (Denmark)

Chwalibog, André; Sawosz, Ewa; Niemiec, Tomasz

2008-01-01

Nitrogen balances (six days) were determined in male Wistar rats during feeding a diet with sufficient protein or a nearly protein-free diet (n = 2 x 24), and then during three days of starvation (n = 2 x 12). The objective was to evaluate the effect of protein withdrawal on minimum nitrogen...... excretion in urine (UN), corresponding to endogenous UN, during feeding and subsequent starvation periods. The rats fed the protein free-diet had almost the same excretion of urinary N during feeding and starvation (165 and 157 mg/kg W(0.75)), while it was 444 mg/kg W(0.75) in rats previously fed...... with protein, demonstrating a major influence of protein content in a diet on N excretion during starvation. Consequently, the impact of former protein supply on N losses during starvation ought to be considered when evaluating minimum N requirement necessary to sustain life....

Nitrogen-to-Protein Conversion Factors for Three Edible Insects: Tenebrio molitor, Alphitobius diaperinus, and Hermetia illucens.

Science.gov (United States)

Janssen, Renske H; Vincken, Jean-Paul; van den Broek, Lambertus A M; Fogliano, Vincenzo; Lakemond, Catriona M M

2017-03-22

Insects are considered a nutritionally valuable source of alternative proteins, and their efficient protein extraction is a prerequisite for large-scale use. The protein content is usually calculated from total nitrogen using the nitrogen-to-protein conversion factor (Kp) of 6.25. This factor overestimates the protein content, due to the presence of nonprotein nitrogen in insects. In this paper, a specific Kp of 4.76 ± 0.09 was calculated for larvae from Tenebrio molitor, Alphitobius diaperinus, and Hermetia illucens, using amino acid analysis. After protein extraction and purification, a Kp factor of 5.60 ± 0.39 was found for the larvae of three insect species studied. We propose to adopt these Kp values for determining protein content of insects to avoid overestimation of the protein content.

Comparative analysis of vitamin C, crude protein, elemental nitrogen ...

African Journals Online (AJOL)

Yomi

2011-12-21

Dec 21, 2011 ... greens (Brassica napus L.) and kale (Brassica oleracea var. acephala) ... Nitrogen is essential for protein production, for proper growth of ... Brassica crops. ..... the effect of trace element-amended fertilizers on their Co, Se, and.

Effects of water deficit and nitrogen levels on grain yield and oil and protein contents of maize

Directory of Open Access Journals (Sweden)

Kazem Ghassemi-Golezani

2015-02-01

Full Text Available This research was conducted in 2014, to evaluate the effects of water deficit and nitrogen fertilizer on grain yield, oil and protein contents of maize (cv. double Cross 303. The experiment was arranged as split-plot based on Randomized Complete Block design (RCB with three replications. Irrigation treatments (irrigation after 60, 90, 120 and 150 mm evaporation and nitrogen levels (0, 46 and 92 kg N/ha were located in the main and sub plots, respectively. Mean grain yield per unit area decreased with decreasing water availability, but it was improved with increasing nitrogen fertilizer. Grain oil percentage significantly decreased, but protein percentage slightly increased as a result of water deficit. In general, oil and protein yields significantly decreased under moderate and severe water stress, mainly because of decreasing grain yield under these conditions. Nitrogen application decreased oil percentage, but increased protein percentage significantly. Nevertheless, nitrogen fertilizer enhanced oil and protein yields per unit area, with no significant difference between nitrogen rates. These results were positively related with grain yield per unit area in maize.

Effect of nitrogen and Nitragin application on soybean yield and protein content

Directory of Open Access Journals (Sweden)

Đukić Vojin

2010-01-01

Full Text Available A three-year experiment was conducted to study the effect of different doses of nitrogen fertilizer applied under previous crop and seed inoculation with a microbial preparation NS Nitragin on soybean yield and protein content in grain. The experiment was set up in four replications at Rimski Šančevi experiment field of Institute of Field and Vegetable Crops, Novi Sad. Presowing seed inoculation contributed to a statistically significant increase in yield and protein content in all three research years, while the highest nitrogen dose had a positive impact on soybean yield only in 2007 and on protein content in 2006 and 2007. .

Nitrogen-to-Protein Conversion Factors for Crop Residues and Animal Manure Common in China.

Science.gov (United States)

Chen, Xueli; Zhao, Guanglu; Zhang, Yang; Han, Lujia; Xiao, Weihua

2017-10-25

Accurately determining protein content is essential in exploiting biomass as feed and fuel. A survey of biomass samples in China indicated protein contents from 2.65 to 3.98% for crop residues and from 6.07 to 10.24% for animal manure of dry basis. Conversion factors based on amino acid nitrogen (k A ) ranged from 5.42 to 6.00 for the former and from 4.78 to 5.36 for the latter, indicating that the traditional factor of 6.25 is not suitable for biomass samples. On the other hand, conversion factors from Kjeldahl nitrogen (k P ) ranged from 3.97 to 4.57 and from 2.76 to 4.31 for crop residues and animal manure, respectively. Of note, conversion factors were strongly affected by amino acid composition and levels of nonprotein nitrogen. Thus, k P values of 4.23 for crop residues, 4.11 for livestock manure, and 3.11 for poultry manure are recommended to better estimate protein content from total nitrogen.

Urinary Excretion of Sodium, Nitrogen, and Sugar Amounts Are Valid Biomarkers of Dietary Sodium, Protein, and High Sugar Intake in Nonobese Adolescents.

Science.gov (United States)

Moore, Lori B; Liu, Sarah V; Halliday, Tanya M; Neilson, Andrew P; Hedrick, Valisa E; Davy, Brenda M

2017-12-01

Background: Objective indicators of dietary intake (e.g., biomarkers) are needed to overcome the limitations of self-reported dietary intake assessment methods in adolescents. To our knowledge, no controlled feeding studies to date have evaluated the validity of urinary sodium, nitrogen, or sugar excretion as dietary biomarkers in adolescents. Objective: This investigation aimed to evaluate the validity of urinary sodium, nitrogen, and total sugars (TS) excretion as biomarkers for sodium, protein, and added sugars (AS) intake in nonobese adolescents. Methods: In a crossover controlled feeding study design, 33 adolescents [12-18 y of age, 47 ± 25th percentile (mean ± SD) of body mass index (BMI; in kg/m 2 ) for age] consumed 5% AS [low added sugars (LAS)] and 25% AS [high added sugars (HAS)] isocaloric, macronutrient-matched (55% carbohydrate, 30% fat, and 15% protein) diets for 7 d each, in a randomly assigned order, with a 4-wk washout period between diets. On the final 2 d of each diet period, 24-h urine samples were collected. Thirty-two adolescents completed all measurements (97% retention). Results: Urinary sodium was not different from the expected 90% recovery (mean ± SD: 88% ± 18%, P = 0.50). Urinary nitrogen was correlated with protein intake ( r = 0.69, P sodium appears to be a valid biomarker for sodium intake in nonobese adolescents. Urinary nitrogen is associated with protein intake, but nitrogen excretion rates were less than previously reported for adults, possibly owing to adolescent growth rates. TS excretion reflects AS at 25% AS intake and was responsive to the change in AS intake. Thus, urinary biomarkers are promising objective indicators of dietary intake in adolescents, although larger-scale feeding trials are needed to confirm these findings. This trial was registered at clinicaltrials.gov as NCT02455388. © 2017 American Society for Nutrition.

Comparison of Nitrogen Bioaccessibility from Salmon and Whey Protein Hydrolysates using a Human Gastrointestinal Model (TIM-1

Directory of Open Access Journals (Sweden)

Bomi Framroze

2014-05-01

Full Text Available Background: The TIM-1 system is a computer-controlled multi-compartmental dynamic model that closely simulates in vivo gastrointestinal tract digestion in humans. During digestion, the compounds released from meal matrix by gastric and intestinal secretions (enzymes are progressively absorbed through semipermeable membranes depending on their molecular weight. These absorbed (dialysed compounds are considered as bioaccessible, which means that they can be theoretically absorbed by the small intestine in the body. Methods: Salmon protein hydrolysate (SPH, whey protein hydrolysates extensively (WPHHigh or weakly (WPH-Low hydrolysed, non-hydrolysed whey protein isolate (WPI and mixtures of WPI:SPH (90:10, 80:20 were digested in TIM-1 using the conditions for a fast gastrointestinal transit that simulate the digestion of a liquid meal in human adults. During digestion (2 hours, samples were collected in intestinal compartments (duodenum, jejunum, and ileum and in both jejunal and ileal dialysates to determine their nitrogen content. All the products were compared in terms of kinetics of nitrogen absorption through the semipermeable membranes (bioaccessible nitrogen and nitrogen distribution throughout the intestinal compartments at the end of the 2 hour digestion. Results: After a 2 h-digestion in TIM-1, SPH was the protein substrate from which the highest amount of nitrogen (67.0% becomes available for the small intestine absorption. WPH-High had the second highest amount (56.0% of bioaccessible nitrogen while this amount decreased to 38.5–42.2% for the other protein substrates. The high nitrogen bioaccessibility of SPH is consistent with its richness in low molecular weight peptides (50% < 1000 Da. Conclusions: The results of this study indicate that SPH provides a higher proportion of bioaccessible nitrogen to a healthy adult compared to all forms of whey proteins, including extensively hydrolysed whey protein hydrolysate. The substitution of

Nitrogen 15 abundance in protein fractions of beans fertilized with (15NH4)2SO4

International Nuclear Information System (INIS)

Chaud, Saula Goulart; Oliveira, Admar Costa de; Trivelin, Paulo Cesar Ocheuze

2002-01-01

Studies evaluating the protein nutritive value of beans labelled with 15 N, using nitrogen balance and the quantitation of faecal and urinary endogenous nitrogen, determined by isotopic dilution, have been extensively used. The objective of this research was to verify if the isotopic labelling of raw, freeze dried beans (Phaseolus vulgaris L., cultivar Pirata 1) with 1.394 atoms % 15 N, resulted in the same abundance of the whole flour and of the protein fractions extracted from the beans with 0.5 mol L -1 NaCl. The isotopic abundance found in the whole bean flour, in the protein extract, in the globulin and albumin fractions were respectively: 1.394 +- 0.011; 1.403 +- 0.012; 1.399 +- 0.007 and 1.399 +- 0.028 atoms % of 15 N, presenting no difference (P > 0.05). However, a difference was found (P < 0.05) between the above mentioned abundances and the isotopic abundance found in the nitrogen of the proteins in the extraction residue, which was 0.969 +- 0.084. Since the abundances did not differ, the protein nutritive indexes, such as digestibility and biological value, determined from the nitrogen balance and corrected for isotopic dilution, would not be affected by extracting the proteins from the beans with 0.5 mol L 1 NaCl. If working with the nitrogen balance of the residual proteins after extraction and even with the whole flours, these indexes could present incorrect values, since the isotopic labelling of the residual proteins was less than that of the protein fractions. (author)

Molecular aspects of the nitrogen fixing system in pea root nodules

International Nuclear Information System (INIS)

Bisseling, T.

1980-01-01

The author considers symbiotic nitrogen fixation of Pisum sativum and Rhizobium leguminosarum. Some general aspects of nodule formation and the regulation of the proteins nitrogenase and leghemoglobin (Lb) have been studied. Synthesis of these proteins was studied by 35 SO 4 labelling of intact pea plants. The sequence of appearance of the proteins was determined with specific radioimmunoassays for each protein. (Auth.)

Effect of dietary protein to energy ratio on growth and nitrogenous ...

African Journals Online (AJOL)

The effect of dietary protein to energy ratio (P:E) on the growth of dusky kob Argyrosomus japonicus was investigated as a first step towards formulating a practical diet for this potential mariculture species in South Africa. The effects of dietary protein and lipid on growth, feed conversion ratio (FCR) and nitrogenous waste ...

Comparative changes in monthly blood urea nitrogen, total protein ...

African Journals Online (AJOL)

The objective of this study was to determine the comparative changes in the monthly blood urea nitrogen (BUN) concentration, total protein (TP) concentration in blood serum and the body condition score of Nguni cows and heifers raised on sweetveld. Twenty-four clinically healthy animals in different parities, namely Parity ...

EFFECTS OF PROTEIN-XANTHOPHYLL (PX CONCENTRATE OF ALFALFA ADDITIVE TO CRUDE PROTEIN-REDUCED DIETS ON NITROGEN EXCRETION, GROWTH PERFORMANCE AND MEAT QUALITY OF PIGS

Directory of Open Access Journals (Sweden)

Eugeniusz GRELA

2009-06-01

Full Text Available The infl uence of protein-xanthophyll (PX concentrate of alfalfa supplement to crude protein-reduced diets was examined in relation to nitrogen excretion, performance parameters and pig meat quality. The investigations included 60 growers (PL x PLW x Duroc crossbreeds assigned to 3 groups. The conclusion is that there is a large potential to decrease nitrogen emission to the environment by 10% lowering of dietary crude protein intake along with reduced animal growth rate and elevated mixture utilization. Inclusion of a protein-xanthophyll concentrate (PX of alfalfa to the diet is likely to diminish disadvantageous productive parameters arising from limiting of total crude protein level in relation to the requirements of pigs feeding norms [1993]. At the same time, it improves feed nitrogen utilization and reduces noxious odour emissions from a piggery. The components of a protein-xanthophyll concentrate (PX contribute to increased liver and kidney weight.

Role of PII proteins in nitrogen fixation control of Herbaspirillum seropedicae strain SmR1.

Science.gov (United States)

Noindorf, Lilian; Bonatto, Ana C; Monteiro, Rose A; Souza, Emanuel M; Rigo, Liu U; Pedrosa, Fabio O; Steffens, Maria B R; Chubatsu, Leda S

2011-01-11

The PII protein family comprises homotrimeric proteins which act as transducers of the cellular nitrogen and carbon status in prokaryotes and plants. In Herbaspirillum seropedicae, two PII-like proteins (GlnB and GlnK), encoded by the genes glnB and glnK, were identified. The glnB gene is monocistronic and its expression is constitutive, while glnK is located in the nlmAglnKamtB operon and is expressed under nitrogen-limiting conditions. In order to determine the involvement of the H. seropedicae glnB and glnK gene products in nitrogen fixation, a series of mutant strains were constructed and characterized. The glnK- mutants were deficient in nitrogen fixation and they were complemented by plasmids expressing the GlnK protein or an N-truncated form of NifA. The nitrogenase post-translational control by ammonium was studied and the results showed that the glnK mutant is partially defective in nitrogenase inactivation upon addition of ammonium while the glnB mutant has a wild-type phenotype. Our results indicate that GlnK is mainly responsible for NifA activity regulation and ammonium-dependent post-translational regulation of nitrogenase in H. seropedicae.

Seed protein and nitrogen fixation in chickpea mutant variety Hyprosola

Energy Technology Data Exchange (ETDEWEB)

Schroeder, H E; Gibson, A H; Oram, R N [CSIRO, Division of Plant Industry, Canberra ACT (Australia); Shaikh, M A.Q. [Bangladesh Institute of Nuclear Agriculture, Mymensingh (Bangladesh)

1989-01-01

Full text: 'Hyprosola' is a high yielding, high protein mutant cultivar obtained after gamma irradiation from the variety 'Faridpur-1'. The mutant yields 45 % more protein per unit area. The essential amino acid index is unchanged. It is likely that the high nutritional value in 'Hyprosola' seed protein arises from an increase in the albumin:globulin ratio. Nitrogen fixation rates of the mutant during the first 7 weeks of growth were found to be similar to 'Faridpur-1'. Under field conditions, the mutant may be able to nodulate more rapidly and more extensively than the parent variety. (author)

A nitrogen response pathway regulates virulence functions in Fusarium oxysporum via the protein kinase TOR and the bZIP protein MeaB.

Science.gov (United States)

López-Berges, Manuel S; Rispail, Nicolas; Prados-Rosales, Rafael C; Di Pietro, Antonio

2010-07-01

During infection, fungal pathogens activate virulence mechanisms, such as host adhesion, penetration and invasive growth. In the vascular wilt fungus Fusarium oxysporum, the mitogen-activated protein kinase Fmk1 is required for plant infection and controls processes such as cellophane penetration, vegetative hyphal fusion, or root adhesion. Here, we show that these virulence-related functions are repressed by the preferred nitrogen source ammonium and restored by treatment with l-methionine sulfoximine or rapamycin, two specific inhibitors of Gln synthetase and the protein kinase TOR, respectively. Deletion of the bZIP protein MeaB also resulted in nitrogen source-independent activation of virulence mechanisms. Activation of these functions did not require the global nitrogen regulator AreA, suggesting that MeaB-mediated repression of virulence functions does not act through inhibition of AreA. Tomato plants (Solanum lycopersicum) supplied with ammonium rather than nitrate showed a significant reduction in vascular wilt symptoms when infected with the wild type but not with the DeltameaB strain. Nitrogen source also affected invasive growth in the rice blast fungus Magnaporthe oryzae and the wheat head blight pathogen Fusarium graminearum. We propose that a conserved nitrogen-responsive pathway might operate via TOR and MeaB to control virulence in plant pathogenic fungi.

Role of PII proteins in nitrogen fixation control of Herbaspirillum seropedicae strain SmR1

Directory of Open Access Journals (Sweden)

Steffens Maria BR

2011-01-01

Full Text Available Abstract Background The PII protein family comprises homotrimeric proteins which act as transducers of the cellular nitrogen and carbon status in prokaryotes and plants. In Herbaspirillum seropedicae, two PII-like proteins (GlnB and GlnK, encoded by the genes glnB and glnK, were identified. The glnB gene is monocistronic and its expression is constitutive, while glnK is located in the nlmAglnKamtB operon and is expressed under nitrogen-limiting conditions. Results In order to determine the involvement of the H. seropedicae glnB and glnK gene products in nitrogen fixation, a series of mutant strains were constructed and characterized. The glnK- mutants were deficient in nitrogen fixation and they were complemented by plasmids expressing the GlnK protein or an N-truncated form of NifA. The nitrogenase post-translational control by ammonium was studied and the results showed that the glnK mutant is partially defective in nitrogenase inactivation upon addition of ammonium while the glnB mutant has a wild-type phenotype. Conclusions Our results indicate that GlnK is mainly responsible for NifA activity regulation and ammonium-dependent post-translational regulation of nitrogenase in H. seropedicae.

Purine nitrogen index, potentially a new parameter for rapid feed evaluation in ruminants

International Nuclear Information System (INIS)

Chen, X.B.; Oerskov, E.R.; Subba, D.B.; Jayasuriya, M.C.N.

1999-01-01

The concept of a new parameter 'Purine Nitrogen Index (PNI)' for feed evaluation in ruminants is discussed. PNI refers to the ratio of purine derivative (PD) nitrogen to total nitrogen in urine. It is suggested that PNI can potentially be used as an indicator of the efficiency with which degradable dietary nitrogen is converted to microbial protein in the rumen. The excretion of PD in the urine provides an estimation of the intestinal flow of microbial protein, and therefore, PNI effectively corresponds to the amount of microbial protein produced in the rumen relative to the nitrogen loss in the urine. If a diet or a dietary regime has a high conversion efficiency, proportionally more rumen degradable nitrogen is converted to microbial protein and less nitrogen is excreted in the urine, resulting in a high PNI. Conversely, if a diet has a poor conversion efficiency, proportionally less dietary nitrogen is converted to microbial protein and more is excreted in the urine, resulting in a low PNI. Preliminary data from six experiments involving 34 sheep confirmed a positive correlation between PNI and the nitrogen conversion efficiency, and suggested that a dietary regime with a PNI lower than 0.08 for sheep appeared to be a less efficient in the production of microbial protein and have a greater loss of nitrogen in the urine. PNI can theoretically be determined in spot urine samples, and has the potential to serve as a 'dipstick' method for the rapid evaluation of ruminant feeds. However, more research with a mathematical modelling approach is required to evaluate and develop the concept further. (author)

Purine nitrogen index, potentially a new parameter for rapid feed evaluation in ruminants

Energy Technology Data Exchange (ETDEWEB)

Chen, X B; Oerskov, E R [Rowett Research Institute, Bucksburn, Aberdeen (United Kingdom); Subba, D B [Pakhribas Agricultural Centre, Dhankuta, Kathmandu (Nepal); Jayasuriya, M C.N. [International Atomic Energy Agency, Animal Production and Health Section, Vienna (Austria)

1999-06-01

The concept of a new parameter `Purine Nitrogen Index (PNI)` for feed evaluation in ruminants is discussed. PNI refers to the ratio of purine derivative (PD) nitrogen to total nitrogen in urine. It is suggested that PNI can potentially be used as an indicator of the efficiency with which degradable dietary nitrogen is converted to microbial protein in the rumen. The excretion of PD in the urine provides an estimation of the intestinal flow of microbial protein, and therefore, PNI effectively corresponds to the amount of microbial protein produced in the rumen relative to the nitrogen loss in the urine. If a diet or a dietary regime has a high conversion efficiency, proportionally more rumen degradable nitrogen is converted to microbial protein and less nitrogen is excreted in the urine, resulting in a high PNI. Conversely, if a diet has a poor conversion efficiency, proportionally less dietary nitrogen is converted to microbial protein and more is excreted in the urine, resulting in a low PNI. Preliminary data from six experiments involving 34 sheep confirmed a positive correlation between PNI and the nitrogen conversion efficiency, and suggested that a dietary regime with a PNI lower than 0.08 for sheep appeared to be a less efficient in the production of microbial protein and have a greater loss of nitrogen in the urine. PNI can theoretically be determined in spot urine samples, and has the potential to serve as a `dipstick` method for the rapid evaluation of ruminant feeds. However, more research with a mathematical modelling approach is required to evaluate and develop the concept further. (author) 15 refs, 5 figs, 4 tabs

Nitrogen balance, microbial protein synthesis and blood metabolites in fattening of male Bali cattle fed ration with different protein levels in smallholder farms

Directory of Open Access Journals (Sweden)

P. K. Tahuk

2018-03-01

Full Text Available Research was aimed to determine nitrogen balance, microbial protein synthesis, and blood metabolites of male Bali cattle fattening fed ration with different protein level in smallholder farms North Central Timor, Province of East Timor Tenggara, Indonesia. The cattle used were 18 heads aged 2 to 2.5 years with initial body weight of 229.86±12.46 kg. The cattle were randomly divided into three treatment groups. The T0 group was given feed the same as traditional fattening cattle practices by farmers,T1 group fed ration containing 12% crude protein (CP and 72% total digestible nutrients (TDN, andT2 group fedration containing 15% CP and 72%TDN. Cattle were fed individually for 90 days and drinkingwater ad libitum. The data were analyzedby analysis of variance.Results of research indicated the nitrogen balance, and blood urea nitrogen between T1 and T2 were relatively similar, but those were higher (P<0.05 than T0 . In contrast, microbial proteins synthesis, and blood glucose at 0, 4, and 6 hours before and after feeding were relatively similar between the groups. Blood glucose of T2 at 2 hours after intake were higher (P <0.05 than T0, but was not different with T1 . It can be concluded, that the fattening maleBali cattle fed ration containing 12% CP and 72% TDNimprovedthe nitrogen balance and blood metabolites, butit was no positive effect on the microbial proteins and N synthesis.

A Nitrogen Response Pathway Regulates Virulence Functions in Fusarium oxysporum via the Protein Kinase TOR and the bZIP Protein MeaB[C][W

Science.gov (United States)

López-Berges, Manuel S.; Rispail, Nicolas; Prados-Rosales, Rafael C.; Di Pietro, Antonio

2010-01-01

During infection, fungal pathogens activate virulence mechanisms, such as host adhesion, penetration and invasive growth. In the vascular wilt fungus Fusarium oxysporum, the mitogen-activated protein kinase Fmk1 is required for plant infection and controls processes such as cellophane penetration, vegetative hyphal fusion, or root adhesion. Here, we show that these virulence-related functions are repressed by the preferred nitrogen source ammonium and restored by treatment with l-methionine sulfoximine or rapamycin, two specific inhibitors of Gln synthetase and the protein kinase TOR, respectively. Deletion of the bZIP protein MeaB also resulted in nitrogen source–independent activation of virulence mechanisms. Activation of these functions did not require the global nitrogen regulator AreA, suggesting that MeaB-mediated repression of virulence functions does not act through inhibition of AreA. Tomato plants (Solanum lycopersicum) supplied with ammonium rather than nitrate showed a significant reduction in vascular wilt symptoms when infected with the wild type but not with the ΔmeaB strain. Nitrogen source also affected invasive growth in the rice blast fungus Magnaporthe oryzae and the wheat head blight pathogen Fusarium graminearum. We propose that a conserved nitrogen-responsive pathway might operate via TOR and MeaB to control virulence in plant pathogenic fungi. PMID:20639450

Ultilization of nitrogen from feed protein and NPN for milk protein synthesis in the ewe

International Nuclear Information System (INIS)

Ulbrich, M.; Boldt, E.; Geissler, C.

1989-01-01

Two lactating Merino ewes with a rumen fistula were housed in metabolic boxes for N balance studies and fed a diet composed of oats, sugar beet pulp and hay. After adaptation on dietary ammonium sulfate suplementation the ewes received 21 g 15 N-ammonium sulfate daily lasting for 10 days. Uptake and utilization of nitrogen especially for protein syntheses were determined. (author)

The Effect of Percentage of Nitrogen in Plasma Gas on Nitrogen ...

African Journals Online (AJOL)

Increase in nitrogen percent in the plasma gas results in increased content of dissociated nitrogen and molecular nitrogen possessing excess vibrational energy and therefore the increased solution of nitrogen in the liquid iron. It would appear that above 35% nitrogen in the plasma gas, frequency of collisions of species in ...

Nitrogen 15 abundance in protein fractions of beans fertilized with ({sup 15}NH{sub 4}){sub 2}SO{sub 4}

Energy Technology Data Exchange (ETDEWEB)

Chaud, Saula Goulart; Oliveira, Admar Costa de [Universidade Estadual de Campinas, SP (Brazil). Faculdade de Estudos Agricolas. Dept. de Planejamento Alimentar e Nutricao; Trivelin, Paulo Cesar Ocheuze [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil). Lab. de Isotopos Estaveis]. E-mail: admarco@fea.unicamp.br

2002-12-01

Studies evaluating the protein nutritive value of beans labelled with 15 N, using nitrogen balance and the quantitation of faecal and urinary endogenous nitrogen, determined by isotopic dilution, have been extensively used. The objective of this research was to verify if the isotopic labelling of raw, freeze dried beans (Phaseolus vulgaris L., cultivar Pirata 1) with 1.394 atoms % 15 N, resulted in the same abundance of the whole flour and of the protein fractions extracted from the beans with 0.5 mol L{sup -1} NaCl. The isotopic abundance found in the whole bean flour, in the protein extract, in the globulin and albumin fractions were respectively: 1.394 +- 0.011; 1.403 +- 0.012; 1.399 +- 0.007 and 1.399 +- 0.028 atoms % of 15 N, presenting no difference (P > 0.05). However, a difference was found (P < 0.05) between the above mentioned abundances and the isotopic abundance found in the nitrogen of the proteins in the extraction residue, which was 0.969 +- 0.084. Since the abundances did not differ, the protein nutritive indexes, such as digestibility and biological value, determined from the nitrogen balance and corrected for isotopic dilution, would not be affected by extracting the proteins from the beans with 0.5 mol L 1 NaCl. If working with the nitrogen balance of the residual proteins after extraction and even with the whole flours, these indexes could present incorrect values, since the isotopic labelling of the residual proteins was less than that of the protein fractions. (author)

Pengaruh Nisbah Energi-Protein, Nitrogen-Sulfur dan Kalsium-Fosfor Terhadap Produk Metabolisme Rumen dan Kecernaan Substrat

Directory of Open Access Journals (Sweden)

S.N.O. Suwandyastuti

2013-10-01

Full Text Available Influence of the ratio of energy-protein, nitrogen-sulphur, and calsium-phosphor upon rumen metabolism product and digestibility of substrat ABSTRACT. The Rumen microbes are capable to digest the glucosa polymer of plant waste for energy source and can used the Non Protein Nitrogen (NPN for body protein synthesis, if the other precussor (Sulphur, Phospor and Branch Chain of Carbon are available.  To know the effectivity of the utilization of plant waste for energy, an experiment have been conducted by in vitro method, used the Randomized Black Design, four replication, factorial 33.  The factors tested are : (1 three levels of energy : protein (E/P ratio : 4, 5 and 6; (2 three levels of Nitrogen : Sulphur (N/Sratio: 7.5, 10 and 12.5; (3 three levels of Calsium : Phospor (Ca/P ratio : 0.5, 1 and 2. The variables measured are : synthesis of protein microbes (SPM ; production of Volatile Fatty Acid (VFA and Nitrogen Ammonia (N-NH3; the digestibility of substrat. Based on the all variable measured, the experiment can be concluded : (1 the effectivity of the utilization of rice straw will be increased if it used is fortified with 50 percent TDN as energy source (E/P=4, 0.20 percent dry matter of sulphur (N/S=10 and 0.0625 - 0.125 percent dry matter (DM of phospor (Ca/P=1.0 – 2.0; (2 To stimulate the activity of cellulolytic microbes, its need the fortification of sulphur until reach the optimum level (must be investigated.

Analisis Kadar Protein Total Dan Non Protein Nitrogen Pada Air Dan Daging Buah Kelapa (Cocos Nucifera L.) Dengan Metode Kjeldahl

OpenAIRE

Margata, Linda

2015-01-01

In Indonesia, coconut palm is one of the big contributors for the economy of the people and nation. As food, coconut water and coconut meat contain some nutrients such as carbohydrates, fats, and also proteins. During maturation, changes in protein content of coconut water and coconut meat may happen. The purpose of this study was to determine the concentration of total protein and non protein nitrogen (NPN) in coconut water and coconut meat, and their changes in young and mature coconuts....

Nitrogen balance and milk composition of dairy cows fed urea and soybean meal and two protein levels using sugar cane based diets

Directory of Open Access Journals (Sweden)

Luís Henrique Andreucci Conti

2014-12-01

Full Text Available The aim of the study was to evaluate the effect of feeding two levels of crude protein (CP (low: 142 g CP/kg DM; and high: 156 g CP/kg DM and two nitrogen sources (soybean meal and urea to dairy cows using sugar cane as forage on microbial protein synthesis, the composition of the milk nitrogen fraction, nitrogen (N balance and blood parameters. Twelve Holstein cows with an average milk yield of 22.0 ± 2.3 kg/day, and with 235 ± 40 days in milk were included in this study. The animals were grouped into three balanced and contemporary 4x4 Latin squares for an experimental period of 21 days. On the 15th day of each period, milk and urine samples were collected for microbial protein synthesis determination. Total excretion of urine (L/day, milk urea nitrogen (MUN and blood urea were higher for the diets with high CP, regardless of the nitrogen source. Nitrogen efficiency was higher for cows fed diets with low CP. Cows in the final third of lactation can be fed diets with reduced CP levels, regardless of the nitrogen source, soybean meal or urea, without influencing the synthesis of microbial protein or the composition of the nitrogen fraction of milk.

Project in determination of crystal structure of nitrogen fixation proteins from azospirilum brasiliense and herbaspirilum seropedicae by synchrotron x-ray diffraction

International Nuclear Information System (INIS)

Barbosa, Valma M.; Leggs, Luciana A.; Delboni, Luis F.; Chubatsu, LedaS.; Souza, Emanuel M.; Machado, Hidevaldo B.; Yates, Geoffrey M.; Pedrosa, Fabio O.

1996-01-01

Full text. Biological nitrogen fixation is essential for maintaining the nitrogen cycle on earth and of high importance for Brazilian agriculture. The nitrogenase enzyme system, which provides the biochemical machinery for nitrogen fixation, consists of two component metalloproteins, the molybdenumiron (Mo Fe) protein and the iron (Fe) protein. Nitrogen fixation is a very energy-intensive process, requiring around 16 moles of ATP for each mol of N 2 fixed (reduced). As a consequence, synthesis and activity of nitrogenase is tighty regulated at two levels: general and specific. The general level regulation is mediated by the ntr (nitrogen regulation) system. Two gene products are involved: the ntrB gene product (NtrB) is responsible for the activation of the ntrC gene product (NtrC) by phosphorylating a conserved Asp54, which activates the expression of the nifA gene. The nif specific control system is mediated by the NifA protein, which binds to a DNA specific sequence (UAS, Upstream Activator Sequence) and activates nif promoter transcriptions by RNA polymerase- α54 , following ATP hydrolysis. The aim of this project is to solve the crystal structure of dinitrogenase reductase (iron protein) and dinitrogenase (molybdenum-iron protein) from Azospirilim brasiliense and the regulatory proteins NifA from Herbaspirillum seropedicae and NtrC Azospirillum brasiliense. The three dimensional structure of the proteins involved in this project will allow a better understanding of the mechanism of biological nitrogen fixation. To this end, the data collection will probably be done at the LNLS facilities which will be available in the near future. (author)

Project in determination of crystal structure of nitrogen fixation proteins from azospirilum brasiliense and herbaspirilum seropedicae by synchrotron x-ray diffraction

Energy Technology Data Exchange (ETDEWEB)

Barbosa, Valma M.; Leggs, Luciana A.; Delboni, Luis F.; Chubatsu, LedaS.; Souza, Emanuel M.; Machado, Hidevaldo B.; Yates, Geoffrey M.; Pedrosa, Fabio O. [Parana Univ., Curitiba, PR (Brazil). Dept. de Bioquimica

1996-12-31

Full text. Biological nitrogen fixation is essential for maintaining the nitrogen cycle on earth and of high importance for Brazilian agriculture. The nitrogenase enzyme system, which provides the biochemical machinery for nitrogen fixation, consists of two component metalloproteins, the molybdenumiron (Mo Fe) protein and the iron (Fe) protein. Nitrogen fixation is a very energy-intensive process, requiring around 16 moles of ATP for each mol of N{sub 2} fixed (reduced). As a consequence, synthesis and activity of nitrogenase is tighty regulated at two levels: general and specific. The general level regulation is mediated by the ntr (nitrogen regulation) system. Two gene products are involved: the ntrB gene product (NtrB) is responsible for the activation of the ntrC gene product (NtrC) by phosphorylating a conserved Asp54, which activates the expression of the nifA gene. The nif specific control system is mediated by the NifA protein, which binds to a DNA specific sequence (UAS, Upstream Activator Sequence) and activates nif promoter transcriptions by RNA polymerase-{sup {alpha}54}, following ATP hydrolysis. The aim of this project is to solve the crystal structure of dinitrogenase reductase (iron protein) and dinitrogenase (molybdenum-iron protein) from Azospirilim brasiliense and the regulatory proteins NifA from Herbaspirillum seropedicae and NtrC Azospirillum brasiliense. The three dimensional structure of the proteins involved in this project will allow a better understanding of the mechanism of biological nitrogen fixation. To this end, the data collection will probably be done at the LNLS facilities which will be available in the near future. (author)

Proximate composition of marine invertebrates from tropical coastal waters, with emphasis on the relationship between nitrogen and protein contents

Directory of Open Access Journals (Sweden)

Graciela S Diniz

2014-05-01

Full Text Available The chemical profiles of Desmapsamma anchorata, Hymeniacidon heliophila (Porifera, Bunodosoma caissarum, Renilla muelleri (Cnidaria, Aplysia brasiliana, Eledone massyae, Isognomon bicolor (Mollusca, Echinaster brasiliensis, Echinometra lucunter, Holothuria grisea, Lytechinus variegatus (Echinodermata, and Phallusia nigra (Chordata were determined. Hydrosoluble protein was the most abundant class of substances for all species, except for the ascidian Phallusia nigra, in which the carbohydrate content was higher. The percentages of hydrosoluble protein (dry weight, dw varied widely among the invertebrates, ranging from 5.88% (R. muelleri to 47.6% (Eledone massyae of the dw .The carbohydrate content fluctuated from 1.3% (R. muelleri to 18.4% (Aplysia brasiliana of the dw. For most of the species, lipid was the second most abundant class of substances, varying from 2.8% (R. muelleri to 25.3% (Echinaster brasiliensis of the dw. Wide variations were also found for the invertebrates nitrogen content, with the lowest value recorded in the cnidarian R. muelleri (2.02% of the dw and the highest in the molluscan E. massyae (12.7% of the dw. The phosphorus content of the dw varyed from 0.24% (R. muelleri to 1.16% (E. massyae. The amino acid composition varied largely among the species, but for most of the species glycine, arginine, glutamic acid, and aspartic acid were the most abundant amino acids, with histidine and tyrosine among the less abundant amino acids. The actual content of total protein in the samples was calculated by the sum of amino acid residues, establishing dw values that fluctuated from 11.1% (R. muelleri to 66.7% (E. massyae. The proteinaceous nitrogen content was high in all species, with an average value of 97.3% of the total nitrogen. From data of total amino acid residues and total nitrogen, specific nitrogen-to-protein conversion factors were calculated for each species. The nitrogen-to-protein conversion factors ranged from 5.10 to

Correlation Between Protein Intake and Nitrogen Balance of Surgical Patients in Anesthesiology and Intensive Care Installation, Sanglah General Hospital, Denpasar, Bali, Indonesia

Directory of Open Access Journals (Sweden)

Made Wiryana

2016-06-01

Full Text Available Background: A cell injury from surgical stress in a trauma or a non-trauma case will induce a hyper metabolic response in which the protein degradation increases, the somatic protein synthesis decreases and the amino acid catabolism increases. Thus, the pyper metabolic response contributes to nitrogen loss in urine. This response, without an adequate nutrition, will lead an iatrogenic malnutrition and deterioration. A balance nitrogen formula through urinary urea nitrogen is one of many nutrition evaluation methods. This method aids in evaluating the daily nutrition status and it can be the baseline data for daily intake. Objective: To find a correlation between the protein intake and the nitrogen balance of the surgical patients in anesthesiology and intensive care installation, Sanglah General Hospital, Denpasar, Bali. Methods: Fifty-one surgical patients with trauma and non-trauma cases were observed for their protein intake for 2-3 days continuously. Moreover, they were evaluated for their nitrogen balance based on the urinary urea nitrogen per 24 hours for 2-3 days. For statistical analysis, we utilized Shapiro-Francia, Shapiro-Wilk, Spearman Frank correlation, two-sample t test, and multivariate regression analysis in Strata SE 12.1. Results: The correlation between the protein intake and the nitrogen balance on the first day was ra=0.50 (p<0.05, on the second day ra=0.70 (p<0,05, and on the third day ra=0.740 (p<0,05. Conclusions: There is a correlation between the protein intake and the nitrogen balance of surgical patients in Anesthesiology and Intensive Care Installation Sanglah General Hospital Denpasar. 

Ammonia Nitrogen Added to Diets Deficient in Dispensable Amino Acid Nitrogen Is Poorly Utilized for Urea Production in Growing Pigs.

Science.gov (United States)

Mansilla, Wilfredo D; Silva, Kayla E; Zhu, Cuilan L; Nyachoti, Charles M; Htoo, John K; Cant, John P; de Lange, Cornelis Fm

2017-12-01

Background: Including ammonia in low-crude protein (CP) diets deficient in dispensable amino acid (DAAs) increases nitrogen retention in growing pigs. Objective: We investigated the absorption and metabolism of dietary ammonia nitrogen in the portal-drained viscera (PDV) and liver of pigs fed a diet deficient in DAA nitrogen. Methods: Eight pigs with an initial mean ± SD body weight (BW) of 26.5 ± 1.4 kg were surgically fitted with 4 catheters each (portal, hepatic and mesenteric veins, and carotid artery). The pigs were fed (2.8 × 191 kcal/kg BW 0.60 ), for 7 d and every 8 h, a diet deficient in DAA nitrogen supplemented with increasing amounts of ammonia nitrogen (CP: 7.76%, 9.27%, and 10.77%; indispensable amino acid nitrogen:total nitrogen ratio: 0.71, 0.59, and 0.50 for control and low- and high-ammonia diets, respectively). The treatment sequence was based on a Latin square design with 3 consecutive periods. On the last day of each period, blood flows in the portal and hepatic veins were determined with a continuous infusion of ρ-amino hippuric acid into the mesenteric vein. Serial blood samples were taken to determine ammonia and urea nitrogen concentration. Net balances of ammonia and urea nitrogen were calculated for the PDV and liver. Results: Cumulative (8 h) ammonia nitrogen appearance in the portal vein increased ( P ≤ 0.05) with ammonia intake (433, 958, and 1629 ± 60 mg ammonia nitrogen/meal for control and low- and high-ammonia diets, respectively). The cumulative hepatic uptake of ammonia nitrogen increased ( P ≤ 0.05) with ammonia nitrogen supply. The cumulative urea nitrogen appearance in the hepatic vein tended to increase ( P ≤ 0.10) only in high-ammonia treatment (-92.5, -59.4, and 209.7 ± 92 mg urea nitrogen/meal for control and low- and high-ammonia diets, respectively) and, relative to the control diet, represented -6.0% and 11% of ammonia nitrogen intake. Conclusion: Dietary ammonia nitrogen is poorly utilized for urea

Full protein alimentation and nitrogen equilibrium in a renal failure patient treated with continuous hemodiafiltration: a case report of 67 days of continuous hemodiafiltration.

Science.gov (United States)

Reynolds, H N; Borg, U; Frankenfield, D

1992-01-01

Standard care for patients with renal failure while in an intensive care unit involves traditional hemodialysis or peritoneal dialysis and protein restriction. We present a case of a patient with renal failure supported with continuous arteriovenous hemofiltration with dialysis (CAVH-D) who was given full protein alimentation. Total daily urea clearance was measured from the CAVH-D output. Protein load was 196 +/- 34 g/day while receiving total parenteral nutrition and 164 +/- 30 g/day while receiving enteral alimentation. Serum blood urea nitrogen was controlled between 40 and 75 mg/dL, except during septic episodes. Nitrogen balance was estimated based upon known alimentation protein load and measurable and estimated nitrogenous losses. The patient was potentially in nitrogen equilibrium during most of the dialysis period. The cumulative nitrogen balance was positive by 5.2 g after 67 days of dialysis. Volume of alimentation was 3.49 +/- 0.7 liters/day. With CAVH-D, the renal failure patient can receive full alimentation without volume or protein load limitations. Furthermore, nitrogen balances can be estimated easily while the patient is on CAVH-D.

Yellow berry, protein and agronomic characteristics in bread wheat under different conditions of nitrogen and irrigation in northwest mexico

International Nuclear Information System (INIS)

Felix, F.R.; Wong, B.R.; Chavez, P.I.T.; Alviles, A.; Salazar, S.M.; Martinez, M.E.R

2014-01-01

The aim of this research was to determine the effect of the amount of nitrogen fertilizer and number of irrigations on the YB disorder of wheat cultivar Tarachi, as well as its relationship with protein content, and the agronomic characteristics. The experiment was conducted in northwestern Mexico, during the fall-winter season, 2009-2010. Three levels of nitrogen (75, 150 or 250 kg ha-1) and three levels of irrigation (3, 4 or 5 irrigations) were studied. Increasing the nitrogen rate decreased the YB content, the thousand kernel weight and hectoliter weight; and increased the protein content and the number of grains per spike. The number of irrigations did not affect the number of grains per spike. However, increasing the number of irrigations increased the YB content, the thousand kernel weight and hectoliter weight; on the other hand, the protein content decreased. A negative correlation between protein content and percentage of YB was presented. It was concluded that the presence of the disorder YB in bread wheat, Tarachi, is due to a low nitrogen rate in the soil and an increase in number of irrigations. (author)

Determination of nitrogen absorption and endogenous nitrogen secretion in the digestive tract of pigs fed with nitrogen-15-labelled dried whey

International Nuclear Information System (INIS)

Gebhardt, G.; Souffrant, W.; Koehler, R.; Zebrowska, T.

1977-01-01

Two fistulated pigs weighing between 15kg and 54kg were given experimental diets containing 15 N-labelled dried whey. The labelled experimental diets were given once only. Samples of the digesta were taken from the duodenum and terminal ileum at various intervals of time up to 48h after feeding the labelled protein feed. The digesta were separated into the four following fractions: Residue on centrifugation, proteins, peptides and free amino acids. The secretion of endogenous nitrogen in the duodenum was 12.5g/24h in pigs having a live weight of 50kg. The endogenous nitrogen was found to be relatively uniformly distributed among the four fractions. The rate of secretion of endogenous nitrogen showed a continuous decrease during 24h. The secretion of endogenous nitrogen in the terminal ileum was 54 to 60mg of nitrogen per kilogram live weight. After passage through the small intestine the greater part of the free amino acids in digesta was of exogenous origin. In the protein fraction most came from endogenous proteins. A true absorption of 17% of nitrogen was determined in the duodenum. The amount of nitrogen absorbed in the terminal part of the small intestine was, on average, 90% relative to the nitrogen intake. The true digestibility calculated with the amount of 15 N in food and faeces was 98%. (author)

Urea recycling contributes to nitrogen retention in calves fed milk replacer and low-protein solid feed.

Science.gov (United States)

Berends, Harma; van den Borne, Joost J G C; Røjen, Betina A; van Baal, Jürgen; Gerrits, Walter J J

2014-07-01

Urea recycling, with urea originating from catabolism of amino acids and hepatic detoxification of ammonia, is particularly relevant for ruminant animals, in which microbial protein contributes substantially to the metabolizable protein supply. However, the quantitative contribution of urea recycling to protein anabolism in calves during the transition from preruminants (milk-fed calves) to ruminants [solid feed (SF)-fed calves] is unknown. The aim of this study was to quantify urea recycling in milk-fed calves when provided with low-protein SF. Forty-eight calves [164 ± 1.6 kg body weight (BW)] were assigned to 1 of 4 SF levels [0, 9, 18, and 27 g of dry matter (DM) SF · kg BW(-0.75) · d⁻¹] provided in addition to an identical amount of milk replacer. Urea recycling was quantified after a 24-h intravenous infusion of [¹⁵N₂]urea by analyzing urea isotopomers in 68-h fecal and urinary collections. Real-time qPCR was used to measure gene expression levels of bovine urea transporter B (bUTB) and aquaglyceroporin-3 and aquaglyceroporin-7 in rumen wall tissues. For every incremental gram of DM SF intake (g DM · kg(0.75)), nitrogen intake increased by 0.70 g, and nitrogen retention increased by 0.55 g (P intake, but aquaglyceroporin-7 expression did not. We conclude that in addition to the increase in digested nitrogen, urea recycling contributes to the observed increase in nitrogen retention with increasing SF intake in milk-fed calves. Furthermore, ruminal bUTB and aquaglyceroporin-3 expression are upregulated with SF intake, which might be associated with urea recycling. © 2014 American Society for Nutrition.

Effect of nitrogen supply on leaf appearance, leaf growth, leaf nitrogen economy and photosynthetic capacity in maize (Zea mays L.)

NARCIS (Netherlands)

Vos, J.; Putten, van der P.E.L.; Birch, C.J.

2005-01-01

Leaf area growth and nitrogen concentration per unit leaf area, Na (g m-2 N) are two options plants can use to adapt to nitrogen limitation. Previous work indicated that potato (Solanum tuberosum L.) adapts the size of leaves to maintain Na and photosynthetic capacity per unit leaf area. This paper

Plasma urea nitrogen and progesterone concentrations and follicular dynamics in ewes fed proteins of different degradability

Directory of Open Access Journals (Sweden)

Gustavo Bianchi Lazarin

2012-07-01

Full Text Available The effects of overfeeding with protein of different degradability on body condition, plasma urea nitrogen and progesterone concentrations, ovulation number and follicular dynamics were assessed in Santa Ines ewes. Twelve ewes were assigned to a randomized block design according to body weight and received overfeeding with soybean meal or with corn gluten meal or maintenance diet for 28 days before ovulation and during the next estrous cycle. Blood samples were taken on days 7, 14, 21, and 28 after the beginning of treatments for analysis of plasma urea nitrogen and on days 3, 6, 9, 12, and 15 into the estrous cycle for analysis of plasma urea nitrogen and progesterone. Follicular dynamics was monitored daily by ultrasound during one estrous cycle. Dry matter and crude protein intake, weight gain, plasma urea nitrogen concentration before ovulation, number of ovulations, diameter of the largest follicle of the 1st and of the 2nd waves and the growth rate of the largest follicle of the 1st wave were higher in the ewes that received overfeeding. The growth rate of the largest follicle of the 3rd wave was higher in the ewes fed maintenance diet. The back fat thickness, plasma urea nitrogen before ovulation and progesterone concentrations, diameter of the largest follicle of the 2nd wave and growth rate of the largest follicle of the 3rd wave were higher in ewes that received overfeeding with soybean meal. The growth rate of the largest follicle of the 1st wave was higher in ewes that received overfeeding with corn gluten meal. Overfeeding with protein-rich feeds may increase the ovulation number and with soybean meal, it may be effective in increasing plasma progesterone concentration in ewes.

Physiological Mechanisms in Herbivores for Retention and Utilization of Nitrogenous Compounds

Energy Technology Data Exchange (ETDEWEB)

Sperber, I. [Department of Animal Physiology, Agricultural College of Sweden, Uppsala 7 (Sweden)

1968-07-01

A short review is given of some aspects of nitrogen metabolism in herbivorous mammals. In the rumen the passage of urea into the rumen and of ammonia out of the rumen are of considerable importance. As yet no facts have been disclosed which definitely prove the existence of special mechanisms influencing these processes in a way favouring the use of endogenous urea in the rumen. The excretion of urea by the kidneys on the other hand is regulated in a manner which appears to be adapted for improved utilization of nitrogen when the nitrogen supply is low. It is further pointed out that efficient retention of microbial protein produced in the caecum must be of considerable importance to herbivores with a large caecum. Some preliminary results are given concerning the physiology of the colon in rabbits and the anatomy and physiology of the colon in lemmings. In the rabbit it appears probable that the passage of fluid and fine particles through the colon is considerably delayed compared with the passage of larger particles. In the lemming an anatomically complicated proximal part of the colon effects a very efficient separation of the microorganisms from the indigestible food residues when caecal contents pass through the colon. The microorganisms appear to be returned to the most proximal part of the colon or into the caecum. Mechanisms of this type seem to be of considerable value to herbivores, enabling them to utilize food with a low digestibility and a low protein content. (author)

Effect of gamma irradiation on the total nitrogen and protein content in body during different stages of silkworm development

International Nuclear Information System (INIS)

Petkov, N.; Malinova, K.; Binkh, N.T.

1996-01-01

The aim was to determine the effect of gamma irradiation of eggs of silk moth in B 2 stage in doses of 1.00, 2.00 and 3.00 Gy on the changes of total nitrogen and protein content during different stages of Bombyx mori L. development. Highest levels of total nitrogen and protein were found in silk gland 14.032-14.355 mg%, followed by pupae - 7.448-8.092 and 46.550-48.906 mg%, moths after egg laying - 6.650-7.825 and 41.563-48.906 mg% and silkworm hemolymph - 6.920-6.980 and 43.250-43.625 mg%, respectively. The irradiation of eggs with 2.00 and 3,00 Gy gamma rays stimulated the increase of total nitrogen and protein content in silk gland by 6.66-7.3% compared to non-irradiated eggs of the same breed. 14 refs., 3 tabs. (author)

Seasonal changes in amino acids, protein and total nitrogen in needles of fertilized Scots pine trees.

Science.gov (United States)

Näsholm, T; Ericsson, A

1990-09-01

Seasonal changes in amino acids, protein and total nitrogen in needles of 30-year-old, fertilized Scots pine (Pinus sylvestris L.) trees growing in Northern Sweden were investigated over two years in field experiments. The studied plots had been fertilized annually for 17 years with (i) a high level of N, (ii) a medium level of N, or (iii) a medium level of N, P and K. Trees growing on unfertilized plots served as controls. In control trees, glutamine, glutamic acid, gamma-aminobutyric acid, aspartic acid and proline represented 50-70% of the total free amino acids determined. Arginine was present only in low concentrations in control trees throughout the year, but it was usually the most abundant amino acid in fertilized trees. Glutamine concentrations were high during the spring and summer in both years of study, whereas proline concentrations were high in the spring but otherwise low throughout the year. In the first year of study, glutamic acid concentrations were high during the spring and summer, whereas gamma-aminobutyric acid was present in high concentrations during the winter months. This pattern was less pronounced in the second year of investigation. The concentrations of most amino acids, except glutamic acid, increased in response to fertilization. Nitrogen fertilization increased the foliar concentration of arginine from trees to a maximum of 110 micromol g(dw) (-1). Trees fertilized with nitrogen, phosphorus and potassium had significantly lower arginine concentrations than trees fertilized with the same amount of nitrogen only. Protein concentrations were similar in all fertilized trees but higher than those in control trees. For all treatments, protein concentrations were high in winter and at a minimum in early spring. In summer, the protein concentration remained almost constant except for a temporary decrease which coincided with the expansion of new shoots. Apart from arginine, the amino acid composition of proteins was similar in all

Dietary protein and urinary nitrogen in relation to 6-year changes in fat mass and fat-free mass

DEFF Research Database (Denmark)

Ankarfeldt, Mikkel Zøllner; Gottliebsen, K; Ängquist, L

2015-01-01

Background:In contrast to the physiological expectation, observational studies show that greater protein intake is associated with subsequent body weight (BW) gain. An increase in fat-free mass (FFM) due to anabolic effects of protein could explain this.Objective:To examine associations between...... protein intake and subsequent changes in fat mass (FM) and FFM in longitudinal, observational data.Design:A health examination, including measures of FM and FFM by bioelectrical impedance at baseline and follow-up six years later, was conducted. Diet history interviews (DHI) were performed, and 24-hour...... nitrogen. Estimated from DHI, FM increased 46 gram/year with every 1 E% protein substituted for fat (95%CI: 13, 79; P=0.006) and FFM increased 15 gram/year (1, 30; P=0.046). Results were similar in other substitution models. Estimated from urinary nitrogen, FM increased 53 gram/year with 1 E% protein...

Appearance of infused 15N-ammonia in urinary nitrogenous compounds in chickens fed low and high protein diets

International Nuclear Information System (INIS)

Karasawa, Yutaka

1984-01-01

The chickens fed a high protein diet responded to the intraportal administration of ammonia with a remarkable increase in urinary uric acid as well as an appreciable increase in urinary ammonia, while in those fed a low protein diet, the increase was appreciable in tissue glutamine and in urinary ammonia, but a little amount in urinary uric acid in response to the ammonia load. It was demonstrated by the present study that the increases in urinary ammonia and uric acid excretion in response to intraportal ammonia load were the adaptive response to remove the exogenous ammonia from the body. The mode of disposal of the intraportally loaded ammonia was changeable depending on protein intake. (Mori, K.)

Kinetics of Nif gene expression in a nitrogen-fixing bacterium.

Science.gov (United States)

Poza-Carrión, César; Jiménez-Vicente, Emilio; Navarro-Rodríguez, Mónica; Echavarri-Erasun, Carlos; Rubio, Luis M

2014-02-01

Nitrogen fixation is a tightly regulated trait. Switching from N2 fixation-repressing conditions to the N2-fixing state is carefully controlled in diazotrophic bacteria mainly because of the high energy demand that it imposes. By using quantitative real-time PCR and quantitative immunoblotting, we show here how nitrogen fixation (nif) gene expression develops in Azotobacter vinelandii upon derepression. Transient expression of the transcriptional activator-encoding gene, nifA, was followed by subsequent, longer-duration waves of expression of the nitrogenase biosynthetic and structural genes. Importantly, expression timing, expression levels, and NifA dependence varied greatly among the nif operons. Moreover, the exact concentrations of Nif proteins and their changes over time were determined for the first time. Nif protein concentrations were exquisitely balanced, with FeMo cofactor biosynthetic proteins accumulating at levels 50- to 100-fold lower than those of the structural proteins. Mutants lacking nitrogenase structural genes or impaired in FeMo cofactor biosynthesis showed overenhanced responses to derepression that were proportional to the degree of nitrogenase activity impairment, consistent with the existence of at least two negative-feedback regulatory mechanisms. The first such mechanism responded to the levels of fixed nitrogen, whereas the second mechanism appeared to respond to the levels of the mature NifDK component. Altogether, these findings provide a framework to engineer N2 fixation in nondiazotrophs.

Production and characterization of cowpea protein hydrolysate with optimum nitrogen solubility by enzymatic hydrolysis using pepsin.

Science.gov (United States)

Mune Mune, Martin Alain; Minka, Samuel René

2017-06-01

Cowpea is a source of low-cost and good nutritional quality protein for utilization in food formulations in replacement of animal proteins. Therefore it is necessary that cowpea protein exhibits good functionality, particularly protein solubility which affects the other functional properties. The objective of this study was to produce cowpea protein hydrolysate exhibiting optimum solubility by the adequate combination of hydrolysis parameters, namely time, solid/liquid ratio (SLR) and enzyme/substrate ratio (ESR), and to determine its functional properties and molecular characteristics. A Box-Behnken experimental design was used for the experiments, and a second-order polynomial to model the effects of hydrolysis time, SLR and ESR on the degree of hydrolysis and nitrogen solubility index. The optimum hydrolysis conditions of time 208.61 min, SLR 1/15 (w/w) and ESR 2.25% (w/w) yielded a nitrogen solubility of 75.71%. Protein breakdown and the peptide profile following enzymatic hydrolysis were evaluated by sodium dodecyl sulfate polyacrylamide gel electrophoresis and size exclusion chromatography. Cowpea protein hydrolysate showed higher oil absorption capacity, emulsifying activity and foaming ability compared with the concentrate. The solubility of cowpea protein hydrolysate was adequately optimized by response surface methodology, and the hydrolysate showed adequate functionality for use in food. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

PLASMA PROTEIN AND HEMOGLOBIN PRODUCTION : DELETION OF INDIVIDUAL AMINO ACIDS FROM GROWTH MIXTURE OF TEN ESSENTIAL AMINO ACIDS. SIGNIFICANT CHANGES IN URINARY NITROGEN.

Science.gov (United States)

Robscheit-Robbins, F S; Miller, L L; Whipple, G H

1947-02-28

Given healthy dogs fed abundant iron and protein-free or low protein diets with sustained anemia and hypoproteinemia, we can study the capacity of these animals to produce simultaneously new hemoglobin and plasma protein. Reserve stores of blood protein-building materials are measurably depleted and levels of 6 to 8 gm. per cent for hemoglobin and 4 to 5 gm. per cent for plasma protein can be maintained for weeks or months depending upon the intake of food proteins or amino acid mixtures. These dogs are very susceptible to infection and various poisons. Dogs tire of these diets and loss of appetite terminates many experiments. Under these conditions (double depletion) standard growth mixtures of essential amino acids are tested to show the response in blood protein output and urinary nitrogen balance. As a part of each tabulated experiment one of the essential amino acids is deleted from the complete growth mixture to compare such response with that of the whole mixture. Methionine, threonine, phenylalanine, and tryptophane when singly eliminated from the complete amino acid mixture do effect a sharp rise in urinary nitrogen. This loss of urinary nitrogen is corrected when the individual amino acid is replaced in the mixture. Histidine, lysine, and valine have a moderate influence upon urinary nitrogen balance toward nitrogen conservation. Leucine, isoleucine, and arginine have minimal or no effect upon urinary nitrogen balance when these individual amino acids are deleted from the complete growth mixture of amino acids during 3 to 4 week periods. Tryptophane and to a less extent phenylalanine and threonine when returned to the amino acid mixture are associated with a conspicuous preponderance of plasma protein output over the hemoglobin output (Table 4). Arginine, lysine, and histidine when returned to the amino acid mixture are associated with a large preponderance of hemoglobin output. Various amino acid mixtures under these conditions may give a positive

Improved Eco-Friendly Recombinant Anabaena sp. Strain PCC7120 with Enhanced Nitrogen Biofertilizer Potential▿

Science.gov (United States)

Chaurasia, Akhilesh Kumar; Apte, Shree Kumar

2011-01-01

Photosynthetic, nitrogen-fixing Anabaena strains are native to tropical paddy fields and contribute to the carbon and nitrogen economy of such soils. Genetic engineering was employed to improve the nitrogen biofertilizer potential of Anabaena sp. strain PCC7120. Constitutive enhanced expression of an additional integrated copy of the hetR gene from a light-inducible promoter elevated HetR protein expression and enhanced functional heterocyst frequency in the recombinant strain. The recombinant strain displayed consistently higher nitrogenase activity than the wild-type strain and appeared to be in homeostasis with compatible modulation of photosynthesis and respiration. The enhanced combined nitrogen availability from the recombinant strain positively catered to the nitrogen demand of rice seedlings in short-term hydroponic experiments and supported better growth. The engineered strain is stable, eco-friendly, and useful for environmental application as nitrogen biofertilizer in paddy fields. PMID:21057013

Improved eco-friendly recombinant Anabaena sp. strain PCC7120 with enhanced nitrogen biofertilizer potential.

Science.gov (United States)

Chaurasia, Akhilesh Kumar; Apte, Shree Kumar

2011-01-01

Photosynthetic, nitrogen-fixing Anabaena strains are native to tropical paddy fields and contribute to the carbon and nitrogen economy of such soils. Genetic engineering was employed to improve the nitrogen biofertilizer potential of Anabaena sp. strain PCC7120. Constitutive enhanced expression of an additional integrated copy of the hetR gene from a light-inducible promoter elevated HetR protein expression and enhanced functional heterocyst frequency in the recombinant strain. The recombinant strain displayed consistently higher nitrogenase activity than the wild-type strain and appeared to be in homeostasis with compatible modulation of photosynthesis and respiration. The enhanced combined nitrogen availability from the recombinant strain positively catered to the nitrogen demand of rice seedlings in short-term hydroponic experiments and supported better growth. The engineered strain is stable, eco-friendly, and useful for environmental application as nitrogen biofertilizer in paddy fields.

Nitrogen supply of crops by biological nitrogen fixation. 2

International Nuclear Information System (INIS)

Jensen, E.S.; Andersen, A.J.; Soerensen, H.; Thomsen, J.D.

1985-02-01

In the present work the contributions from combined N-sources and symbiotic nitrogen fixation to the nitrogen supply of field-grown peas and field beans were evaluated by means of 15 N fertilizer dilution. The effect of N-fertilizer, supplied at sowing and at different stages of plant development, on nitrogen fixation, yield and protein production in peas, was studied in pot experiments. (author)

Appearance and partial purification of a high molecular weight protein in crabs exposed to saxitoxin.

Science.gov (United States)

Barber, K G; Kitts, D D; Townsley, P M; Smith, D S

1988-01-01

This paper provides evidence for a protein component which appears to be involved in the seasonal resistance of small shore crabs, Hemigrapsus oregonesis and Hemigrapsus nudus to saxitoxin, a principle neurotoxin involved in paralytic shellfish poisoning (PSP). This unique protein complex was isolated and partially purified by ion exchange chromatography using DEAE-cellulose from visceral tissue extracts of resistant crabs. The complex was absent in control crabs that were sensitive to saxitoxin. In addition, the protein complex was induced in the crab after acute administration of low doses of saxitoxin. Results indicate that the protein complex is acidic in nature and has an apparent mol. wt of 145,000.

Dietary protein affects nitrogen excretion and ammonia emission from slurry of growing-finishing pigs.

NARCIS (Netherlands)

Canh, T.T.; Aarnink, A.J.A.; Schutte, J.B.; Sutton, A.L.; Langhout, D.J.; Verstegen, M.W.A.

1998-01-01

The effects of dietary protein on nitrogen excretion and ammonia emission from slurry of growing–finishing pigs were studied both in vitro and in a pig house. The three diets had similar contents of NE, minerals, vitamins and ileal digestible lysine, methionine cystine, threonine and tryptophan, but

Dietary protein affects nitrogen excretion and ammonia emission from slurry of growing-finishing pigs

NARCIS (Netherlands)

Canh, T.T.; Aarnink, A.J.A.; Schutte, J.B.; Sutton, A.; Langhout, D.J.; Verstegen, M.W.A.

1998-01-01

The effects of dietary protein on nitrogen excretion and ammonia emission from slurry of growing-finishing pigs were studied both in vitro and in a pig house. The three diets had similar contents of NE, minerals, vitamins and ileal digestible lysine, methionine + cystine, threonine and tryptophan,

Digestibility and nitrogen balance of diets containing non conventional vegetable proteins fed to pigs of genetic strains suitable for outdoor systems

Directory of Open Access Journals (Sweden)

L. Sardi

2010-04-01

Full Text Available The study was carried out to evaluate on growing pigs kept in metabolism crates, either belonging to a “traditional” cross-breed (Duroc x Large White – DLW or a local breed (Cinta Senese – CS, the digestibility and the nitrogen balance of non-conventional vegetable protein sources (field beans, pea and sunflower cake when compared to soybean meal. The four diets were formulated so as to supply the same crude protein amount. CS pigs showed lower apparent digestibility coefficients (ADCs for crude protein (81,38% vs 82,65% and crude fibre (35,97% vs 40,65%. Nitrogen balance was more favourable in DLW pigs (32,12% vs 19,67% which showed a higher nitrogen retention (+69%.With respect to the protein source, no differences were observed for nitrogen balance. Sunflower diet showed the higher ADC for ether extract (+20% compared with soybean diet. Crude fibre digestibility was lowered in sunflower (-33% and field beans (-13% diets. Sunflower and field beans diets showed the lowest gross energy digestibility coefficients. Field pea diet had the highest ADC for crude fibre (+ 12% leading to ADCs for organic matter and gross energy comparable to those of soybean meal. It is concluded that field bean, sunflower cake and field pea could be considered as valuable non-conventional protein sources in swine nutrition.

Microbial protein synthesis and nitrogen metabolism in cows bred on tropical pasture and fed on cassava root and corn

Directory of Open Access Journals (Sweden)

Ádler Carvalho da Silva

2014-05-01

Full Text Available Current experiment evaluated the effect of replacement of full corn meal by dehydrated ground cassava roots at levels 0%, 25%, 50%, 75% and 100% in experimental supplements for lactating cows grazing on irrigated and fertilized tropical pastures. Ten Holstein cows were divided into two 5 x 5 Latin squares, with average initial 150 days of lactation, milk production 22±3.30 kg day-1 at the beginning of experiment and initial body weight of 603±65 kg. Cows were maintained on pasture consisting of elephant grass (Pennisetum purpureum, Schum cultivar Pioneiro, intercropped with Tifton 85 (Cynodon nlemfuensis, fertilized with 600 kg nitrogen per hectare year-1. There was no significant difference (p > 0.05 between the substitution levels of corn meal by ground and dehydrated cassava root in the concentrate on the synthesis of microbial protein with an estimated average of 1,288.49 g day-1 and efficiency in the synthesis of microbial protein per kilogram of TDN with estimated average of 91.30 g kg-1 TDN. Nitrogen equilibrium showed an estimated average of 218.79 g day-1 of retained nitrogen. The microbial protein synthesis and nitrogen balance were not affected by treatments.

Effect of Borax and cysteamine compound on finishing sheep growth performance, nitrogen retention, serum biochemical indices and body protein motabolism

International Nuclear Information System (INIS)

Chang Xinyao' Xie Hongbing; Wei Gangcai; Wang Hong

2009-01-01

Experiment was conducted to investigate the effects of borax, cysteamine and the mixture of two compounds on growth performance, serum biochemical indices, protein turn-over and nitrogen aggradation of sheep by using isotope ( 15 N-Gly) technique, nitrogen balance trial and serum testing. The results showed that both borax and cysteamine could increase the growth performance of sheep, especially the cysteamine and its mixture with borax, which increased average daily feed intake (P 3 ) and levothyroxine (T 4 ) of mixture were higher than that of control group (P<0.05), and the concentrations of growth hormone (GH) and insulin-like growth factors (IGF-1) were also significantly higher than those of control group (P<0.01). There was no significant difference of insulin (INS) between experiment groups and control group (P<0.05). Both mixture and borax contributed to increasing nitrogen retention, net nitrogen utilization, digestibility and biological value. Both borax and cysteamine accelerated protein degradation rate, apparent amino acid utilization rate and net amino acid utilization rate as well as biological value, body protein and oxidation rate, but the former was greater than the later. (authors)

Potassium Bicarbonate Attenuates the Urinary Nitrogen Excretion That Accompanies an Increase in Dietary Protein and May Promote Calcium Absorption

Science.gov (United States)

Ceglia, Lisa; Harris, Susan S.; Abrams, Steven A.; Rasmussen, Helen M.; Dallal, Gerard E.; Dawson-Hughes, Bess

2009-01-01

Context: Protein is an essential component of muscle and bone. However, the acidic byproducts of protein metabolism may have a negative impact on the musculoskeletal system, particularly in older individuals with declining renal function. Objective: We sought to determine whether adding an alkaline salt, potassium bicarbonate (KHCO3), allows protein to have a more favorable net impact on intermediary indices of muscle and bone conservation than it does in the usual acidic environment. Design: We conducted a 41-d randomized, placebo-controlled, double-blind study of KHCO3 or placebo with a 16-d phase-in and two successive 10-d metabolic diets containing low (0.5 g/kg) or high (1.5 g/kg) protein in random order with a 5-d washout between diets. Setting: The study was conducted in a metabolic research unit. Participants: Nineteen healthy subjects ages 54–82 yr participated. Intervention: KHCO3 (up to 90 mmol/d) or placebo was administered for 41 d. Main Outcome Measures: We measured 24-h urinary nitrogen excretion, IGF-I, 24-h urinary calcium excretion, and fractional calcium absorption. Results: KHCO3 reduced the rise in urinary nitrogen excretion that accompanied an increase in protein intake (P = 0.015) and was associated with higher IGF-I levels on the low-protein diet (P = 0.027) with a similar trend on the high-protein diet (P = 0.050). KHCO3 was also associated with higher fractional calcium absorption on the low-protein diet (P = 0.041) with a similar trend on the high-protein diet (P = 0.064). Conclusions: In older adults, KHCO3 attenuates the protein-induced rise in urinary nitrogen excretion, and this may be mediated by IGF-I. KHCO3 may also promote calcium absorption independent of the dietary protein content. PMID:19050051

Identification and characterization of finger millet OPAQUE2 transcription factor gene under different nitrogen inputs for understanding their role during accumulation of prolamin seed storage protein.

Science.gov (United States)

Gaur, Vikram Singh; Kumar, Lallan; Gupta, Supriya; Jaiswal, J P; Pandey, Dinesh; Kumar, Anil

2018-03-01

In this study, we report the isolation and characterization of the mRNA encoding OPAQUE2 (O2) like TF of finger millet (FM) ( Eleusine coracana) ( EcO2 ). Full-length EcO2 mRNA was isolated using conserved primers designed by aligning O2 mRNAs of different cereals followed by 3' and 5' RACE (Rapid Amplification of cDNA Ends). The assembled full-length EcO2 mRNA was found to contain an ORF of 1248-nt coding the 416 amino acids O2 protein. Domain analysis revealed the presence of the BLZ and bZIP-C domains which is a characteristic feature of O2 proteins. Phylogenetic analysis of EcO2 protein with other bZIP proteins identified using finger millet transcriptome data and O2 proteins of other cereals showed that EcO2 shared high sequence similarity with barley BLZ1 protein. Transcripts of EcO2 were detected in root, stem, leaves, and seed development stages. Furthermore, to investigate nitrogen responsiveness and the role of EcO2 in regulating seed storage protein gene expression, the expression profiles of EcO2 along with an α-prolamin gene were studied during the seed development stages of two FM genotypes (GE-3885 and GE-1437) differing in grain protein content (13.8 and 6.2%, respectively) grown under increasing nitrogen inputs. Compared to GE-1437, the EcO2 was relatively highly expressed during the S2 stage of seed development which further increased as nitrogen input was increased. The Ecα - prolamin gene was strongly induced in the high protein genotype (GE-3885) at all nitrogen inputs. These results indicate the presence of nitrogen responsiveness regulatory elements which might play an important role in accumulating protein in FM genotypes through modulating EcO2 expression by sensing plant nitrogen status.

New concepts of microbial treatment processes for the nitrogen removal: effect of protein and amino acids degradation.

Science.gov (United States)

González-Martínez, Alejandro; Calderón, Kadiya; González-López, Jesús

2016-05-01

High concentrations of proteins and amino acids can be found in wastewater and wastewater stream produced in anaerobic digesters, having shown that amino acids could persist over different managements for nitrogen removal affecting the nitrogen removal processes. Nitrogen removal is completely necessary because of their implications and the significant adverse environmental impact of ammonium such as eutrophication and toxicity to aquatic life on the receiving bodies. In the last decade, the treatment of effluents with high ammonium concentration through anammox-based bioprocesses has been enhanced because these biotechnologies are cheaper and more environmentally friendly than conventional technologies. However, it has been shown that the presence of important amounts of proteins and amino acids in the effluents seriously affects the microbial autotrophic consortia leading to important losses in terms of ammonium oxidation efficiency. Particularly the presence of sulfur amino acids such as methionine and cysteine has been reported to drastically decrease the autotrophic denitrification processes as well as affect the microbial community structure promoting the decline of ammonium oxidizing bacteria in favor of other phylotypes. In this context we discuss that new biotechnological processes that improve the degradation of protein and amino acids must be considered as a priority to increase the performance of the autotrophic denitrification biotechnologies.

Studies on nitrogen metabolism of soybean plants, (4)

International Nuclear Information System (INIS)

Kato, Yasumasa; Kitada, Subaru

1979-01-01

Nitrogen that came from cotyledons and nitrogen ( 15 N) pulse-fed at 5 different times during the growth of young soybean plants were studied for 33-days after germination. Cotyledons furnished nitrogen to primary leaves, stems, and roots for the first 8 days, but thereafter principally to 1 st and 2 nd trifoliate leaves. Redistribution of the cotyledon-derived nitrogen from primary leaves commenced from the 14 th day after germination when their total nitrogen was still increasing. At the end of the experiment, the cotyledon-derived nitrogen was distributed approximately uniformly among 6 expanded leaves, and very small amount was found in 3 immature leaves. It was shown that soybean leaves took up 15 N (via roots) throughout the entire period of their life, and from their near-mature stage onwards, uptake and redistribution of nitrogen were observed simultaneously. Thus, the nitrogen in mature leaves was partially being renewed constantly. Considering this fact, the nitrogen supplying capacity of soybean leaves was estimated to be about two times as large as that estimated conventionally from the net loss of nitrogen during their senescence. The turnover of leaf nitrogen was closely related to the turnover of leaf protein. Influx of nitrogen was invariably accompanied by the simultaneous synthesis of leaf protein, and conversely, efflux by the simultaneous breakdown of leaf protein. Sink removal (topping treatment) prevented the breakdown of leaf protein (as measured from the rate of release of label after the pulse feeding) as well as the export of nitrogen from the leaves. The nitrogen supplying function of soybean leaves was discussed in relation to the nitrogen and protein turnover of leaves. (Kaihara, S.)

Metabolizable energy, nitrogen balance, and ileal digestibility of amino acids in quality protein maize for pigs

Science.gov (United States)

2014-01-01

Background To compare the nutritional value and digestibility of five quality protein maize (QPM) hybrids to that of white and yellow maize, two experiments were carried out in growing pigs. In experiment 1, the energy metabolizability and the nitrogen balance of growing pigs fed one of five QPM hybrid diets were compared against those of pigs fed white or yellow maize. In experiment 2, the apparent and standardized ileal digestibility (AID and SID, respectively) of proteins and amino acids from the five QPM hybrids were compared against those obtained from pigs fed white and yellow maize. In both experiments, the comparisons were conducted using contrasts. Results The dry matter and nitrogen intakes were higher in the pigs fed the QPM hybrids (P digestibility (P digestible lysine than normal maize. PMID:25045520

Nitrogen balance and milk composition of dairy cows fed urea and soybean meal and two protein levels using sugar cane based diets

OpenAIRE

Luís Henrique Andreucci Conti; Elmeson Ferreira de Jesus; Angélica Simone Cravo Pereira; Marcos André Arcari; Kleber da Cunha Peixoto Junior; Francisco Palma Rennó; Marcos Veiga dos Santos

2014-01-01

The aim of the study was to evaluate the effect of feeding two levels of crude protein (CP) (low: 142 g CP/kg DM; and high: 156 g CP/kg DM) and two nitrogen sources (soybean meal and urea) to dairy cows using sugar cane as forage on microbial protein synthesis, the composition of the milk nitrogen fraction, nitrogen (N) balance and blood parameters. Twelve Holstein cows with an average milk yield of 22.0 ± 2.3 kg/day, and with 235 ± 40 days in milk were included in this study. The animals wer...

Endogenous Losses of Nitrogen and Protein Requirement for ...

African Journals Online (AJOL)

Four fistulated and four intact West African dwarf wether sheep, maintained on hay and concentrate supplements were used for a study of metabolic faecal nitrogen (MEN) and endogenous urinary nitrogen (EUN). The composition of the faecal losses was examined. The values obtained enabled calculation of nitrogen ...

Host-derived viral transporter protein for nitrogen uptake in infected marine phytoplankton

Science.gov (United States)

Chambouvet, Aurélie; Milner, David S.; Attah, Victoria; Terrado, Ramón; Lovejoy, Connie; Moreau, Hervé; Derelle, Évelyne; Richards, Thomas A.

2017-01-01

Phytoplankton community structure is shaped by both bottom–up factors, such as nutrient availability, and top–down processes, such as predation. Here we show that marine viruses can blur these distinctions, being able to amend how host cells acquire nutrients from their environment while also predating and lysing their algal hosts. Viral genomes often encode genes derived from their host. These genes may allow the virus to manipulate host metabolism to improve viral fitness. We identify in the genome of a phytoplankton virus, which infects the small green alga Ostreococcus tauri, a host-derived ammonium transporter. This gene is transcribed during infection and when expressed in yeast mutants the viral protein is located to the plasma membrane and rescues growth when cultured with ammonium as the sole nitrogen source. We also show that viral infection alters the nature of nitrogen compound uptake of host cells, by both increasing substrate affinity and allowing the host to access diverse nitrogen sources. This is important because the availability of nitrogen often limits phytoplankton growth. Collectively, these data show that a virus can acquire genes encoding nutrient transporters from a host genome and that expression of the viral gene can alter the nutrient uptake behavior of host cells. These results have implications for understanding how viruses manipulate the physiology and ecology of phytoplankton, influence marine nutrient cycles, and act as vectors for horizontal gene transfer. PMID:28827361

Impact of feeding reduced crude protein diets to lactating sows on nitrogen utilizatilon

DEFF Research Database (Denmark)

Huber, L; de Lange, C F M; Larsen, Uffe Krogh

2015-01-01

-fed; analyzed contents; HCP); 2) 15.7% CP (MHCP); 3) 14.3% CP (MLCP); 4) 13.2% CP (LCP); diet HCP was formulated using soybean meal and corn as the only Lys sources. The reduced CP diets contained CAA to meet requirements of the limiting AA. Sow and piglet BW were measured on d 1, 3, 7, 14, 18, and 21...... of lactation. Nitrogen retention was measured on sows between d 3 and 7 (early) and d 14 and 18 (peak) of lactation. Milk true protein output was calculated from estimated milk yield and analyzed true protein concentration. Sow BW change (overall mean: -4.2 ± 3.37 kg over the 21-d lactation period) and average...... daily DM intake (overall mean: 4.05 ± 0.18 and 6.12 ± 0.20 kg/d, early and peak lactation, respectively) did not differ between diets. Nitrogen intake decreased as dietary CP concentration decreased (114.3, 106.0, 107.4, and 99.0 ± 5.29 g/d and 169.5, 168.3, 161.2, and 145.1 ± 5.29 g/d for HCP, MHCP...

PipY, a Member of the Conserved COG0325 Family of PLP-Binding Proteins, Expands the Cyanobacterial Nitrogen Regulatory Network

Directory of Open Access Journals (Sweden)

José I. Labella

2017-07-01

Full Text Available Synechococcus elongatus PCC 7942 is a paradigmatic model organism for nitrogen regulation in cyanobacteria. Expression of genes involved in nitrogen assimilation is positively regulated by the 2-oxoglutarate receptor and global transcriptional regulator NtcA. Maximal activation requires the subsequent binding of the co-activator PipX. PII, a protein found in all three domains of life as an integrator of signals of the nitrogen and carbon balance, binds to PipX to counteract NtcA activity at low 2-oxoglutarate levels. PII-PipX complexes can also bind to the transcriptional regulator PlmA, whose regulon remains unknown. Here we expand the nitrogen regulatory network to PipY, encoded by the bicistronic operon pipXY in S. elongatus. Work with PipY, the cyanobacterial member of the widespread family of COG0325 proteins, confirms the conserved roles in vitamin B6 and amino/keto acid homeostasis and reveals new PLP-related phenotypes, including sensitivity to antibiotics targeting essential PLP-holoenzymes or synthetic lethality with cysK. In addition, the related phenotypes of pipY and pipX mutants are consistent with genetic interactions in the contexts of survival to PLP-targeting antibiotics and transcriptional regulation. We also showed that PipY overexpression increased the length of S. elongatus cells. Taken together, our results support a universal regulatory role for COG0325 proteins, paving the way to a better understanding of these proteins and of their connections with other biological processes.

Protein intake, nitrogen balance and nutritional status in patients with Parkinson's disease; time for a change?

Science.gov (United States)

Zilli Canedo Silva, Maryanne; Carol Fritzen, Natali; de Oliveira, Marlon; Paes da Silva, Michel; Rasmussen Petterle, Ricardo; Teive, Hélio Afonso; de Mesquita Barros Almeida Leite, Christiane; Rabito, Estela Iraci; Madalozzo Schieferdecker, Maria Eliana; Carvalho, Mauricio

2015-06-01

To evaluate protein intake, nitrogen balance and nutritional status of clinically stable patients with Parkinson's disease (PD). A cross-sectional study of PD patients Hoehn-Yahr scale stage 1-3 and subjects with no neurologic disease (controls) matched for age and gender. All participants underwent a diet history interview, anthropometric measurements, bioelectrical impedance and food record over three non-consecutive days, including a weekend. A 24-hour urine collection and fasting venous blood sampling were collected from the participants for evaluation of creatinine clearance, creatinine height index and the nitrogen balance. The mean age of PD patients was 58.9 ± 12.8 year compared to 54.7 ± 12.6 year of the controls, P = 0.34. One third of PD group had symptoms of dysphagia and ingested less water and fibers when compared to controls. Calf circumference was small in PD group (35.5 ± 2.8 vs. 38.4 ± 3.5 cm, P = 0.012). Intake of nitrogen was significantly lower and nitrogen balance was negative in PD patients (-1.8 ± 3.9 vs. 1.1 ± 4.2 controls, P = 0.06). The antioxidants folate and vitamin E were consumed in small amounts in both groups, although significantly less in PD patients (P = 0.04 and 0.03, respectively). Daily intakes of protein of approximately 1.1 g/kg by clinically stable PD patients may not be enough to ensure a neutral calorie-nitrogen balance and muscle tissue conservation. Larger studies are necessary to provide a more comprehensive picture of PD patients' metabolic status. Copyright AULA MEDICA EDICIONES 2014. Published by AULA MEDICA. All rights reserved.

Effect of Nitrogen, Phosphorus and Potassium on the Dynamics of Synthesis of Nucleic Acids and Proteins in the Different Phases of Wheat Development

Energy Technology Data Exchange (ETDEWEB)

Martinovic, B.; Grujic-Injac, B.; Jelenic, Dj. [Institute for the Application of Nuclear Energy in Agriculture, Veterinary Medicine and Forestry, Belgrade (Yugoslavia)

1968-07-01

The influence of different nitrogen, phosphorus and potassium levels on the dynamics of RNA synthesis and raw proteins, as well as the uptake of phosphorus in the different phases of wheat development, were studied by applying radioactive phosphorus {sup 32}P . The rate of the uptake of phosphorus is proportional to its concentration in the nutrient supply in all phases of wheat development, in spite of the fact that the uptake of phosphorus during vegetation decreases with the plant's maturity. The influence of nitrogen on the uptake of phosphorus is inversely proportional to the concentration of nitrogen in the nutrient, while the influence of potassium depends on the relation of the amounts of nitrogen and phosphorus. The increased levels of nitrogen and phosphorus are directly proportional to the increase of RNA synthesis, and conversely the decrease of these levels decreases the RNA synthesis. The RNA synthesis decreases with the wheat's maturity during vegetation and is considerably greater in the first phase than in the later phases of the plant's development. Nitrogen and phosphorus have the greatest influence on protein synthesis; potassium has far less influence. These investigations show that the synthesis of nucleic acids and the building up of phosphorus in the RNA-fraction is directly proportional to the concentration of nitrogen in the nutrient supply, even though the uptake of phosphorus by wheat is not proportional to the increased nitrogen levels. Investigations now being carried out provide further explanations concerning the mutual relationship of some forms of RNA of the cells and the amino acids in the synthesis of certain protein fractions of wheat under the influence of different levels of nitrogen, phosphorus and potassium. (author)

Microbial Protein Production and Nitrogen Balance of Local Steer Fed Ammoniated Rice Straws Added

Directory of Open Access Journals (Sweden)

H Hindratiningrum

2009-05-01

Full Text Available The objective of the experiment was to investigate the kind of energy source feedstuffs on nutrient balance and microbial protein synthesis in local male beef cattle fed with ammoniated rice straws Twenty steers Peranakan Ongole (PO with average age 1-2 years old were used. They were divided 5 groups based on initial body weight as block. Therefore, Completely Randomised Block Design (CBRD was used for this experiment. Data were analysed by analysis variance and continued honestly significant different (HSD to test the differences between means. The result showed that the range MCP and eficiency MCP were 154,61 g/d until 226,54 g/d and 54,08 gMCP/kg DOMR until 62,64 gMCP/kg DOMR. The range of nitrogen balance were 72,28 gram until 111,67 gram. MCP and efficiency MCP were not affected (P>0,05 by the treatments but balance of nitrogen was affected (P<0,05. Diet containing fresh cassava waste as energy source (R2 was lower (P<0,05 than R1 and R4 while between R1,R3 and R4 was similar. This results indicate that feed source of energy (rice brand, wet cassava waste, dry cassava waste and corn can be used in steers with rice straw ensilage as forage. (Animal Production 11(2: 116-121 (2009 Key Words : Microbial protein production, nitrogen balance, rice straw, ensilage

Effect of prolonged intravenous glucose and essential amino acid infusion on nitrogen balance, muscle protein degradation and ubiquitin-conjugating enzyme gene expression in calves

Directory of Open Access Journals (Sweden)

Scaife Jes R

2008-02-01

Full Text Available Abstract Background Intravenous infusions of glucose and amino acids increase both nitrogen balance and muscle accretion. We hypothesised that co-infusion of glucose (to stimulate insulin and essential amino acids (EAA would act additively to improve nitrogen balance by decreasing muscle protein degradation in association with alterations in muscle expression of components of the ubiquitin-proteasome proteolytic pathway. Methods We examined the effect of a 5 day intravenous infusions of saline, glucose, EAA and glucose + EAA, on urinary nitrogen excretion and muscle protein degradation. We carried out the study in 6 restrained calves since ruminants offer the advantage that muscle protein degradation can be assessed by excretion of 3 methyl-histidine and multiple muscle biopsies can be taken from the same animal. On the final day of infusion blood samples were taken for hormone and metabolite measurement and muscle biopsies for expression of ubiquitin, the 14-kDa E2 ubiquitin conjugating enzyme, and proteasome sub-units C2 and C8. Results On day 5 of glucose infusion, plasma glucose, insulin and IGF-1 concentrations were increased while urea nitrogen excretion and myofibrillar protein degradation was decreased. Co-infusion of glucose + EAA prevented the loss of urinary nitrogen observed with EAA infusions alone and enhanced the increase in plasma IGF-1 concentration but there was no synergistic effect of glucose + EAA on the decrease in myofibrillar protein degradation. Muscle mRNA expression of the ubiquitin conjugating enzyme, 14-kDa E2 and proteasome sub-unit C2 were significantly decreased, after glucose but not amino acid infusions, and there was no further response to the combined infusions of glucose + EAA. Conclusion Prolonged glucose infusion decreases myofibrillar protein degradation, prevents the excretion of infused EAA, and acts additively with EAA to increase plasma IGF-1 and improve net nitrogen balance. There was no evidence of

The Crc protein inhibits the production of polyhydroxyalkanoates in Pseudomonas putida under balanced carbon/nitrogen growth conditions.

Science.gov (United States)

La Rosa, Ruggero; de la Peña, Fernando; Prieto, María Axiliadora; Rojo, Fernando

2014-01-01

Pseudomonas putida synthesizes polyhydroxyalkanoates (PHAs) as storage compounds. PHA synthesis is more active when the carbon source is in excess and the nitrogen source is limiting, but can also occur at a lower rate under balanced carbon/nitrogen ratios. This work shows that PHA synthesis is controlled by the Crc global regulator, a protein that optimizes carbon metabolism by inhibiting the expression of genes involved in the use of non-preferred carbon sources. Crc acts post-transcriptionally. The mRNAs of target genes contain characteristic catabolite activity (CA) motifs near the ribosome binding site. Sequences resembling CA motifs can be predicted for the phaC1 gene, which codes for a PHA polymerase, and for phaI and phaF, which encode proteins associated to PHA granules. Our results show that Crc inhibits the translation of phaC1 mRNA, but not that of phaI or phaF, reducing the amount of PHA accumulated in the cell. Crc inhibited PHA synthesis during exponential growth in media containing a balanced carbon/nitrogen ratio. No inhibition was seen when the carbon/nitrogen ratio was imbalanced. This extends the role of Crc beyond that of controlling the hierarchical utilization of carbon sources and provides a link between PHA synthesis and the global regulatory networks controlling carbon flow. © 2013 Society for Applied Microbiology and John Wiley & Sons Ltd.

Effect of irradiation and soaking in BHT and sodium pyrophosphate on meat proteins and lipids during cold storage

International Nuclear Information System (INIS)

Hassan, I.M.; Emam, O.A.

1988-01-01

The effect of irradiation treatments up to 10 KGy, soaking in a solution containing 0.5% Na-pyrophosphate and 250 ppm butylated hydroxy toluene (BHT) and a combination of both treatments on the nitrogen content and solubility, protein fractions and lipids stability in beef steaks during cold storage at 4 ± 1°C was followed until the samples were rejected by sensory evaluation. The least effective radiation doses for soluble protein nitrogen (SPN), total soluble nitrogen (TSN) and total nitrogen (TN) were 2, 5 and 10 KGy, respectively. Such effects were proportionally related to the applied dose. The loss in nitrogen compounds and/or their solubility which occurred upon irradiation appeared to be retarded by soaking treatment. Irradiation treatments induced additional protein fraction which seems to be originated from the sarcoplasmic proteins. After the resolution of rigor mortis, the incremental rate of nitrogen extractability was inversely related to the irradiation dose. Another protein fraction was detected only in the 10 KGy irradiated samples after 14 days of cold storage which might be originating from fibrillar proteins as a result of its interaction with some lipid oxidation products. However, soaking treatment itself caused extensive changes in protein fractions, in contrast, protection from radiation and radiation after-effects were observed

Integrated analysis of the effects of agricultural management on nitrogen fluxes at landscape scale

Energy Technology Data Exchange (ETDEWEB)

Kros, J., E-mail: hans.kros@wur.nl [Alterra, Wageningen University and Research Centre, P.O. Box 47, 6700 AA Wageningen (Netherlands); Frumau, K.F.A.; Hensen, A. [Energy Research Centre of The Netherlands, P.O. Box 1, 1755 ZG Petten (Netherlands); Vries, W. de [Alterra, Wageningen University and Research Centre, P.O. Box 47, 6700 AA Wageningen (Netherlands); Environmental Systems Analysis Group, Wageningen University, P.O. Box 47, 6700 AA Wageningen (Netherlands)

2011-11-15

The integrated modelling system INITIATOR was applied to a landscape in the northern part of the Netherlands to assess current nitrogen fluxes to air and water and the impact of various agricultural measures on these fluxes, using spatially explicit input data on animal numbers, land use, agricultural management, meteorology and soil. Average model results on NH{sub 3} deposition and N concentrations in surface water appear to be comparable to observations, but the deviation can be large at local scale, despite the use of high resolution data. Evaluated measures include: air scrubbers reducing NH{sub 3} emissions from poultry and pig housing systems, low protein feeding, reduced fertilizer amounts and low-emission stables for cattle. Low protein feeding and restrictive fertilizer application had the largest effect on both N inputs and N losses, resulting in N deposition reductions on Natura 2000 sites of 10% and 12%, respectively. - Highlights: > We model nitrogen fluxes and the impact of agricultural measures in a rural landscape. > Average model results appear to be comparable to observations. > The measures low protein feeding and restrictive fertilizer application had the largest effect. - Effects of agricultural management on N losses to air and water are evaluated at landscape scale combining a model assessment and measurements.

[Research advance in nitrogen metabolism of plant and its environmental regulation].

Science.gov (United States)

Xu, Zhenzhu; Zhou, Guangsheng

2004-03-01

Nitrogen metabolism is not only one of the basic processes of plant physiology, but also one of the important parts of global chemical cycle. Plant nitrogen assimilation directly takes part in the synthesis and conversion of amino acid through the reduction of nitrate. During this stage, some key enzymes, e.g., nitrate reductase (NR), glutamine synthetase (GS), glutamate dehydrogenase (GDH), glutamine synthase (GOGAT), aspargine synthetase (AS), and asparate aminotransferase (AspAT) participate these processes. The protein is assimilated in plant cell through amino acid, and becomes a part of plant organism through modifying, classifying, transporting and storing processes, etc. The nitrogen metabolism is associated with carbonic metabolism through key enzyme regulations and the conversion of products, which consists of basic life process. Among these amino acids in plant cell, glutamic acid (Glu), glutamine (Gln), aspartic acid (Asp) and asparagines (Asn), etc., play a key role, which regulates their conversion each other and their contents in the plant cell through regulating formation and activity of those key enzymes. Environmental factors also affect the conversion and recycle of the key amino acids through regulating gene expression of the key enzymes and their activities. Nitrate and light intensity positively regulate the gene transcription of NR, but ammonium ions and Glu, Gln do the negative way. Water deficit is a very serious constraint on N2 fixation rate and soybean (Glycine max Merr.) grain yield, in which, ureide accumulation and degradation under water deficit appear to be the key issues of feedback mechanism on nitrogen fixation. Water stress decreases NR activity, but increases proteinase activity, and thus, they regulate plant nitrogen metabolism, although there are some different effects among species and cultivars. Water stress also decreases plant tissue protein content, ratio of protein and amino acid, and reduces the absorption of amino

Relationship of Nitrogen Use Efficiency with the Activities of Enzymes Involved in Nitrogen Uptake and Assimilation of Finger Millet Genotypes Grown under Different Nitrogen Inputs

Directory of Open Access Journals (Sweden)

Nidhi Gupta

2012-01-01

Full Text Available Nitrogen responsiveness of three-finger millet genotypes (differing in their seed coat colour PRM-1 (brown, PRM-701 (golden, and PRM-801 (white grown under different nitrogen doses was determined by analyzing the growth, yield parameters and activities of nitrate reductase (NR, glutamine synthetase (GS, glutamate synthase; GOGAT, and glutamate dehydrogenase (GDH at different developmental stages. High nitrogen use efficiency and nitrogen utilization efficiency were observed in PRM-1 genotype, whereas high nitrogen uptake efficiency was observed in PRM-801 genotype. At grain filling nitrogen uptake efficiency in PRM-1 negatively correlated with NR, GS, GOGAT activities whereas it was positively correlated in PRM-701 and PRM-801, however, GDH showed a negative correlation. Growth and yield parameters indicated that PRM-1 responds well at high nitrogen conditions while PRM-701 and PRM-801 respond well at normal and low nitrogen conditions respectively. The study indicates that PRM-1 is high nitrogen responsive and has high nitrogen use efficiency, whereas golden PRM-701 and white PRM-801 are low nitrogen responsive genotypes and have low nitrogen use efficiency. However, the crude grain protein content was higher in PRM-801 genotype followed by PRM-701 and PRM-1, indicating negative correlation of nitrogen use efficiency with source to sink relationship in terms of seed protein content.

Measurements of protein turnover in man with nitrogen-15

International Nuclear Information System (INIS)

Garlick, P.J.; Waterlow, J.C.

1977-01-01

Past and present methods of measuring total body protein turnover with 15 N-labelled compounds are reviewed, and a short assessment made of results achieved. Protein turnover in man was first measured by Sprinson and Rittenberg (1949) using 15 N glycine as tracer. The rate of turnover was calculated from the fraction of the dose excreted in urine in the days following a single oral dose of the isotope. In the following years a number of similar methods were devised but interest waned, perhaps because consistent changes in turnover rate under different conditions were not detected. A revival of interest came with the measurement of changes in protein turnover in malnourished and recovering children by Picou and Taylor-Roberts (1969). Nitrogen-15-glycine was infused and measurements were made of the abundance of 15 N in urinary urea, which reached a plateau in about 24 hours. Turnover rates were calculated from the proportion of the infused dose excreted in urea after the plateau had been reached. This method has also been used successfully on adults when the isotope has been given as three-hourly oral doses. In adults, however, plateau labelling in urea is not usually reached for two days. In our laboratory the use of urinary ammonia, which reaches a plateau more quickly than urea, has been examined. In addition, comparisons have been made between constant infusion and single dose of isotope. Halliday and McKeran (1975) infused 15 N-lysine and measured the 15 N abundance in the free lysine of plasma, which reached a plateau in about 12 hours. Turnover in the whole body and turnover of muscle proteins and of plasma albumin were estimated separately. These methods of measuring protein turnover with 15 N are described and results reviewed of the effects of food intake, nutritional status and age. (author)

Distinct domains within the NITROGEN LIMITATION ADAPTATION protein mediate its subcellular localization and function in the nitrate-dependent phosphate homeostasis pathway

Science.gov (United States)

The NITROGEN LIMITATION ADAPTATION (NLA) protein is a RING-type E3 ubiquitin ligase that plays an essential role in the regulation of nitrogen and phosphate homeostasis. NLA is localized to two distinct subcellular sites, the plasma membrane and nucleus, and contains four distinct domains: i) a RING...

Photodamaging mechanisms of the eye structure: the aggregates appearance at UV-illumination of lens proteins

International Nuclear Information System (INIS)

El'chaninov, V.V.; Fedorovich, I.B.

1989-01-01

UV-light injury of individual crystallines (water soluble proteins of the cattle eye crystalline lens) were studied by SDS PSSG technique. Photodamage resulted in olygomer formation. The appearance of high molecular aggregates with the molecular mass as large as 10 5 D were seen in all fractions of the crystalline

Changes in the contents of nitrogen fractions with loosing vital capacity of the Siberian fir Abies sibirica Ledeb. seeds

Directory of Open Access Journals (Sweden)

S. G. Prokushkin

2017-02-01

Full Text Available Siberian fir seeds often lose their germinating capacity during storage. This results from, among other factors, changing contents of nitrogen compounds in the seeds, especially those of protein fractions. This paper focuses on analyzing changes of these compounds in nonviable seeds of the species depending on ecological and conditions and stand location, as well as on tree growth class (Kraft growth classes I and IV. The contents of the total and protein nitrogen in the nonviable seeds of the trees of growth classes I and IV appeared to vary widely and to depend on stand location and seed location in the tree crown. The maximum contents were in the seeds located in the upper part of the crown. The seeds from the middle and lower crown parts contained much less total and protein nitrogen. The hard-to-solve protein fraction dominated over other protein fraction in the seeds from the upper part of the crowns of the trees of growth classes I and IV. However, this fraction, like prolamines, changed uniformly throughout the crowns, whereas seed glutelin content varied insignificantly among the crown parts. Albumins and globulins showed a uniform crown top-to-bottom decrease. A comparison of viable seed with unviable seeds for contents of the nitrogen forms revealed a marked decrease in the total and protein nitrogen in the latter, especially for the trees of growth class IV. The seeds that lost their germinating capacity exhibited increasingly hard-to-solve protein fraction and drastically decreasing albumins and globulins wherever the seeds were in the crown. Their glutelin and prolamine contents changed inconsiderably.The changes of the quantitative ratio between the protein fractions found by the study cause, along with other physiological and biochemical factors, the loss of viability of Siberian fir seeds during storage.

A nitrogen response pathway regulates virulence in plant pathogenic fungi: role of TOR and the bZIP protein MeaB.

Science.gov (United States)

López-Berges, Manuel S; Rispail, Nicolas; Prados-Rosales, Rafael C; Di Pietro, Antonio

2010-12-01

Virulence in plant pathogenic fungi is controlled through a variety of cellular pathways in response to the host environment. Nitrogen limitation has been proposed to act as a key signal to trigger the in planta expression of virulence genes. Moreover, a conserved Pathogenicity mitogen activated protein kinase (MAPK) cascade is strictly required for plant infection in a wide range of pathogens. We investigated the relationship between nitrogen signaling and the Pathogenicity MAPK cascade in controlling infectious growth of the vascular wilt fungus Fusarium oxysporum. Several MAPK-activated virulence functions such as invasive growth, vegetative hyphal fusion and host adhesion were strongly repressed in the presence of the preferred nitrogen source ammonium. Repression of these functions by ammonium was abolished by L-Methionine sulfoximine (MSX) or rapamycin, two specific inhibitors of Gln synthetase and the protein kinase TOR (Target Of Rapamycin), respectively, and was dependent on the bZIP protein MeaB. Supplying tomato plants with ammonium rather than nitrate resulted in a significant delay of vascular wilt symptoms caused by the F. oxysporum wild type strain, but not by the ΔmeaB mutant. Ammonium also repressed invasive growth in two other pathogens, the rice blast fungus Magnaporthe oryzae and the wheat head blight pathogen Fusarium graminearum. Our results suggest the presence of a conserved nitrogen-responsive pathway that operates via TOR and MeaB to control infectious growth in plant pathogenic fungi.

Nitrogen in global animal production and management options for improving nitrogen use efficiency

NARCIS (Netherlands)

Oenema, O.; Tamminga, S.

2005-01-01

Animal production systems convert plant protein into animal protein. Depending on animal species, ration and management, between 5% and 45 % of the nitrogen (N) in plant protein is converted to and deposited in animal protein. The other 55%-95% is excreted via urine and feces, and can be used as

Hibernating black bears (Ursus americanus) experience skeletal muscle protein balance during winter anorexia.

Science.gov (United States)

Lohuis, T D; Harlow, H J; Beck, T D I

2007-05-01

Black bears spend four to seven months every winter confined to their den and anorexic. Despite potential for skeletal muscle atrophy and protein loss, bears appear to retain muscle integrity throughout winter dormancy. Other authors have suggested that bears are capable of net protein anabolism during this time. The present study was performed to test this hypothesis by directly measuring skeletal muscle protein metabolism during the summer, as well as early and late hibernation periods. Muscle biopsies were taken from the vastus lateralis of six free-ranging bears in the summer, and from six others early in hibernation and again in late winter. Protein synthesis and breakdown were measured on biopsies using (14)C-phenylalanine as a tracer. Muscle protein, nitrogen, and nucleic acid content, as well as nitrogen stable isotope enrichment, were also measured. Protein synthesis was greater than breakdown in summer bears, suggesting that they accumulate muscle protein during periods of seasonal food availability. Protein synthesis and breakdown were both lower in winter compared to summer but were equal during both early and late denning, indicating that bears are in protein balance during hibernation. Protein and nitrogen content, nucleic acid, and stable isotope enrichment measurements of the biopsies support this conclusion.

Human Decisions: Nitrogen Footprints and Environmental Effects

Science.gov (United States)

Leach, A. M.; Bleeker, A.; Galloway, J. N.; Erisman, J.

2012-12-01

Human consumption choices are responsible for growing losses of reactive nitrogen (Nr) to the environment. Once in the environment, Nr can cause a cascade of negative impacts such as smog, acid rain, coastal eutrophication, climate change, and biodiversity loss. Although all humans must consume nitrogen as protein, the food production process releases substantial Nr to the environment. This dilemma presents a challenge: how do we feed a growing population while reducing Nr? Although top-down strategies to reduce Nr losses (e.g., emissions controls) are necessary, the bottom-up strategies focusing on personal consumption patterns will be imperative to solve the nitrogen challenge. Understanding the effects of different personal choices on Nr losses and the environment is an important first step for this strategy. This paper will utilize information and results from the N-Calculator, a per capita nitrogen footprint model (www.N-Print.org), to analyze the impact of different food consumption patterns on a personal food nitrogen footprint and the environment. Scenarios will analyze the impact of the following dietary patterns on the average United States (28 kg Nr/cap/yr) food nitrogen footprint: 1) Consuming only the recommended protein as defined by the WHO and the USDA; 2) Reducing food waste by 50%; 3) Consuming a vegetarian diet; 4) Consuming a vegan diet; 5) Consuming a demitarian diet (replacing half of animal protein consumption with vegetable protein); 6) Substituting chicken (a more efficient animal protein) with beef (a less efficient animal protein); 7) Consuming sustainably-produced food; and 8) Using advanced wastewater treatment. Preliminary results suggest that widespread advanced wastewater treatment with nutrient removal technology and halving food waste would each reduce the US personal food nitrogen footprint by 13%. In addition, reducing protein consumption to the recommended levels would reduce the footprint by about 42%. Combining these measures

Transcriptome study of storage protein genes of field-grown barley in response to inorganic nitrogen fertilizers

DEFF Research Database (Denmark)

Hansen, Michael; Bowra, Steve; Lange, Mette

2010-01-01

The storage proteins of barley, in terms of both amino acid profile and quantity, are traits strongly influenced by the amount of nitrogen applied. Given this, we performed a developmental expression analysis of the genes from barley grains grown under field conditions to further our understanding...... profile under different N regimes. Reviewing the expression of the storage protein homologues within the families revealed markedly different temporal profiles; for example, some alleles were expressed very early in development. Furthermore, the differential temporal expression of the homologues suggested...

Identification of multiply charged proteins and amino acid clusters by liquid nitrogen assisted spray ionization mass spectrometry.

Science.gov (United States)

Kumar Kailasa, Suresh; Hasan, Nazim; Wu, Hui-Fen

2012-08-15

The development of liquid nitrogen assisted spray ionization mass spectrometry (LNASI MS) for the analysis of multiply charged proteins (insulin, ubiquitin, cytochrome c, α-lactalbumin, myoglobin and BSA), peptides (glutathione, HW6, angiotensin-II and valinomycin) and amino acid (arginine) clusters is described. The charged droplets are formed by liquid nitrogen assisted sample spray through a stainless steel nebulizer and transported into mass analyzer for the identification of multiply charged protein ions. The effects of acids and modifier volumes for the efficient ionization of the above analytes in LNASI MS were carefully investigated. Multiply charged proteins and amino acid clusters were effectively identified by LNASI MS. The present approach can effectively detect the multiply charged states of cytochrome c at 400 nM. A comparison between LNASI and ESI, CSI, SSI and V-EASI methods on instrumental conditions, applied temperature and observed charge states for the multiply charged proteins, shows that the LNASI method produces the good quality spectra of amino acid clusters at ambient conditions without applied any electric field and heat. To date, we believe that the LNASI method is the most simple, low cost and provided an alternative paradigm for production of multiply charged ions by LNASI MS, just as ESI-like ions yet no need for applying any electrical field and it could be operated at low temperature for generation of highly charged protein/peptide ions. Copyright © 2012 Elsevier B.V. All rights reserved.

Forest fuel reduces the nitrogen load - calculations of nitrogen flows

International Nuclear Information System (INIS)

Burstroem, F.; Johansson, Jan.

1995-12-01

Nitrogen deposition in Sweden has increased strongly during recent decades, particularly in southern Sweden. Nitrogen appears to be largely accumulated in biomass and in the soil. It is therefore desirable to check the accumulation of nitrogen in the forest. The most suitable way of doing this is to remove more nitrogen-rich biomass from the forest, i.e., increase the removal of felling residues from final fellings and cleanings. An ecological condition for intensive removal of fuel is that the ashes are returned. The critical load for nitrogen, CL(N), indicates the level of nitrogen deposition that the forest can withstand without leading to ecological changes. Today, nitrogen deposition is higher than the CL(N) in almost all of Sweden. CL(N) is calculated in such a manner that nitrogen deposition should largely be balanced by nitrogen losses through harvesting during a forest rotation. The value of CL(N) thus largely depends on how much nitrogen is removed with the harvested biomass. When both stems and felling residues are harvested, the CL(N) is about three times higher than in conventional forestry. The increase is directly related to the amount of nitrogen in the removed biofuel. Use of biofuel also causes a certain amount of nitrogen emissions. From the environmental viewpoint there is no difference between the sources of the nitrogen compounds. An analysis of the entire fuel chain shows that, compared with the amount of nitrogen removed from the forest with the fuel, about 5 % will be emitted as nitrogen oxides or ammonia during combustion, and a further ca 5 % during handling and transports. A net amount of about 90 % of biomass nitrogen is removed from the system and becomes inert nitrogen (N 2 ). 60 refs, 3 figs, 4 tabs, 11 appendices

Effects of the source of energy and minerals on microbial protein synthesis in rumen using 35S as indicator. Part of a coordinated programme on tracer techniques in studies on the use of non-protein nitrogen in ruminants

International Nuclear Information System (INIS)

Durant, M.

1976-05-01

Part I. The effect of the nature of carbohydrates and minerals on microbial growth in vitro was studied in vitro to intensify rumen microbial protein synthesis from non-protein nitrogen, using phosphorus incorporation (PR). The nature of starch greatly influences urea utilization. Among the tropical tubers studied, yam Cayenesis and canna Edulis give lower urea utilization than cassava and yam Dumetorum. However, this can be improved by processing. The effects are greatest when the proportion of urea to processed cereal is ca. 4-5%. S-addition as sulfate improves urea utilization with both natural and purified diets. Part II. Results from the Jouy and Ghent laboratories were analyzed statistically, to check the accuracy of the 32 P method for estimating microbial growth, using protein-free substrates. The linear relationship between PR and every other variable was studied. Two multivariate analyses, principal components and multiple regression, were applied. Net NH 3 utilization was predicted using the equations for substrates with proteins likely to be degraded. This method appears more accurate than using the N/P ratio in microflora. Equations should only be used under the specific experiments described

Nitrogen recycling through the gut and the nitrogen economy of ruminants: An asynchronous symbiosis

DEFF Research Database (Denmark)

Reynolds, C K; Kristensen, Niels Bastian

2007-01-01

The extensive development of the ruminant forestomach sets apart their nitrogen (N) economy from that of nonruminants in a number of respects. Extensive pre-gastric fermentation alters the profile of protein reaching the small intestine, largely through the transformation of nitrogenous compounds...

Key intermediates in nitrogen transformation during microwave pyrolysis of sewage sludge: a protein model compound study.

Science.gov (United States)

Zhang, Jun; Tian, Yu; Cui, Yanni; Zuo, Wei; Tan, Tao

2013-03-01

The nitrogen transformations with attention to NH3 and HCN were investigated at temperatures of 300-800°C during microwave pyrolysis of a protein model compound. The evolution of nitrogenated compounds in the char, tar and gas products were conducted. The amine-N, heterocyclic-N and nitrile-N compounds were identified as three important intermediates during the pyrolysis. NH3 and HCN were formed with comparable activation energies competed to consume the same reactive substances at temperatures of 300-800°C. The deamination and dehydrogenation of amine-N compounds from protein cracking contributed to the formation of NH3 (about 8.9% of Soy-N) and HCN (6.6%) from 300 to 500°C. The cracking of nitrile-N and heterocyclic-N compounds from the dehydrogenation and polymerization of amine-N generated HCN (13.4%) and NH3 (31.3%) between 500 and 800°C. It might be able to reduce the HCN and NH3 emissions through controlling the intermediates production at temperatures of 500-800°C. Copyright © 2013 Elsevier Ltd. All rights reserved.

Urea and Ammonia Metabolism and the Control of Renal Nitrogen Excretion

Science.gov (United States)

Mitch, William E.; Sands, Jeff M.

2015-01-01

Renal nitrogen metabolism primarily involves urea and ammonia metabolism, and is essential to normal health. Urea is the largest circulating pool of nitrogen, excluding nitrogen in circulating proteins, and its production changes in parallel to the degradation of dietary and endogenous proteins. In addition to serving as a way to excrete nitrogen, urea transport, mediated through specific urea transport proteins, mediates a central role in the urine concentrating mechanism. Renal ammonia excretion, although often considered only in the context of acid-base homeostasis, accounts for approximately 10% of total renal nitrogen excretion under basal conditions, but can increase substantially in a variety of clinical conditions. Because renal ammonia metabolism requires intrarenal ammoniagenesis from glutamine, changes in factors regulating renal ammonia metabolism can have important effects on glutamine in addition to nitrogen balance. This review covers aspects of protein metabolism and the control of the two major molecules involved in renal nitrogen excretion: urea and ammonia. Both urea and ammonia transport can be altered by glucocorticoids and hypokalemia, two conditions that also affect protein metabolism. Clinical conditions associated with altered urine concentrating ability or water homeostasis can result in changes in urea excretion and urea transporters. Clinical conditions associated with altered ammonia excretion can have important effects on nitrogen balance. PMID:25078422

A Nitrogen Response Pathway Regulates Virulence Functions in Fusarium oxysporum via the Protein Kinase TOR and the bZIP Protein MeaB

OpenAIRE

López-Berges, Manuel S.; Rispail, Nicolas; Prados-Rosales, Rafael C.; Pietro, Antonio D.

2010-01-01

During infection, fungal pathogens activate virulence mechanisms, such as host adhesion, penetration and invasive growth. In the vascular wilt fungus Fusarium oxysporum, the mitogen-activated protein kinase Fmk1 is required for plant infection and controls processes such as cellophane penetration, vegetative hyphal fusion, or root adhesion. Here, we show that these virulence-related functions are repressed by the preferred nitrogen source ammonium and restored by treatment with l-methionine s...

The influence of nitrogen supplementation on microbial protein synthesis on water-buffaloes

International Nuclear Information System (INIS)

Abidin, Zainal; Hendratno, C.; Suharjono; Rustam, B.

1982-01-01

This work was carried out to observe the effects of nitrogen supplementation from urea and soybean meal on microbial protein synthesis, and other parameters of rumen functions of the waterbuffalo. Four rations were given to four water-buffaloes assigned in 4x4 latin square design. Ration A consisted of local grass+0% urea, ration B local grass+0.7% urea, ration C local grass+1.4% urea and ration D local grass+8.5% soybean meal. The result indicated that microbial protein synthesis was significantly affected (P/0.05) by the supplementation of urea, and the utilization of N in ration B was more efficient compared to the other rations. The ammonia concentration in the rumen fluid also increased (P/0.05) as a result of urea supplementation. However, no changes were found in the total volatile fatty acids production and total protozoal counts. An increased (P/0.05) of pH in the rumen fluid was also observed in the rations B and C. (author)

Nitrogen retention and water balance in animals fed medium protein ...

African Journals Online (AJOL)

amount of nitrogen, in contrast to control animals that lost 2.4% nitrogen via the faeces. Inadequate drinking caused decreased excretion of urea. The improved nitrogen retention coupled with high rates of urea recycling enhances nutrients digestion and consequently the animals' absorptive capabilities. . (Afr. J. Biomed.

Investigation on the Assimilation of Nitrogen by Maize Roots and the Transport of Some Major Nitrogen Compounds by Xylem Sap. III

DEFF Research Database (Denmark)

Ivanko, S.; Ingversen, J.

1971-01-01

Xylem sap was collected from nitrogen-starved maize plants and investigations were made on the nitrogen transported. It appears from the results that several pools for different amino acids exist, which have different relations to the transport of nitrogen taken up. While in maize roots Glu, Glu...

Balance sheet method assessment for nitrogen fertilization in bread wheat: I. yield and quality

Directory of Open Access Journals (Sweden)

Maria Corbellini

2006-09-01

Full Text Available In the European Union the production of high quality wheat is mainly located in the Mediterranean regions where the climatic conditions positively affect protein concentration in the grain. High quality wheat calls for proper management of nitrogen fertilization, thus there is a need to verify whether the limitations imposed by local governments on maximum rate of nitrogen fertilization admitted may affect bread making quality. Trials were conducted in fourteen environments (E to study the effects of different nitrogen fertilizations on eight cultivars (C, belonging to four quality grades (Q. Nitrogen (N was applied to crops according to three rates/modalities: N1 corresponding to the maximum rate admitted calculated according to a balance sheet method and distributed at the stage of spike initiation; N2 with 50 kg ha-1 of nitrogen more than N1, also distributed at the stage of spike initiation; N3 with 50 kg ha-1 of nitrogen more than N1 but distributed at the stage of flag leaf appearance. The effects of environment, nitrogen and cultivar were significant for grain yield, test weight, 1000 kernel weight, heading time, plant height and for quality traits (protein content and alveograph indices. The existence of variability among cultivars and quality grades in the response to rate and timing of nitrogen fertilization was demonstrated by the significance of NxC and NxQ interactions. Dry matter and nitrogen contents of plant at anthesis and at harvest were significantly affected by the main sources of variation. High quality cultivars yielded more grain of better quality with higher N rates (N2 and N3 as compared to the maximum rate of nitrogen admitted by the local government (N1. These results demonstrated that the adopted balance sheet method for the calculation of N requirements of wheat crop adversely affects the full potential expression of the cultivars belonging to superior bread making quality grades.

Balance sheet method assessment for nitrogen fertilization in bread wheat: I. yield and quality

Directory of Open Access Journals (Sweden)

Mario Monotti

2011-02-01

Full Text Available In the European Union the production of high quality wheat is mainly located in the Mediterranean regions where the climatic conditions positively affect protein concentration in the grain. High quality wheat calls for proper management of nitrogen fertilization, thus there is a need to verify whether the limitations imposed by local governments on maximum rate of nitrogen fertilization admitted may affect bread making quality. Trials were conducted in fourteen environments (E to study the effects of different nitrogen fertilizations on eight cultivars (C, belonging to four quality grades (Q. Nitrogen (N was applied to crops according to three rates/modalities: N1 corresponding to the maximum rate admitted calculated according to a balance sheet method and distributed at the stage of spike initiation; N2 with 50 kg ha-1 of nitrogen more than N1, also distributed at the stage of spike initiation; N3 with 50 kg ha-1 of nitrogen more than N1 but distributed at the stage of flag leaf appearance. The effects of environment, nitrogen and cultivar were significant for grain yield, test weight, 1000 kernel weight, heading time, plant height and for quality traits (protein content and alveograph indices. The existence of variability among cultivars and quality grades in the response to rate and timing of nitrogen fertilization was demonstrated by the significance of NxC and NxQ interactions. Dry matter and nitrogen contents of plant at anthesis and at harvest were significantly affected by the main sources of variation. High quality cultivars yielded more grain of better quality with higher N rates (N2 and N3 as compared to the maximum rate of nitrogen admitted by the local government (N1. These results demonstrated that the adopted balance sheet method for the calculation of N requirements of wheat crop adversely affects the full potential expression of the cultivars belonging to superior bread making quality grades.

Water and temperature stresses impact canola (Brassica napus L.) fatty acid, protein and yield over nitrogen and sulfur

Science.gov (United States)

Interactive effects of weather and soil nutrient status often control crop productivity. An experiment was conducted to determine effects of N and S fertilizer rate, soil water, and atmospheric temperature on canola fatty acid (FA), total oil, protein and grain yield. Nitrogen and S were assessed in...

Anaerobic Nitrogen Fixers on Mars

Science.gov (United States)

Lewis, B. G.

2000-07-01

The conversion of atmospheric nitrogen gas to the protein of living systems is an amazing process of nature. The first step in the process is biological nitrogen fixation, the transformation of N2 to NH3. The phenomenon is crucial for feeding the billions of our species on Earth. On Mars, the same process may allow us to discover how life can adapt to a hostile environment, and render it habitable. Hostile environments also exist on Earth. For example, nothing grows in coal refuse piles due to the oxidation of pyrite and marcasite to sulfuric acid. Yet, when the acidity is neutralized, alfalfa and soybean plants develop root nodules typical of symbiotic nitrogen fixation with Rhizobium species possibly living in the pyritic material. When split open, these nodules exhibited the pinkish color of leghemoglobin, a protein in the nodule protecting the active nitrogen-fixing enzyme nitrogenase against the toxic effects of oxygen. Although we have not yet obtained direct evidence of nitrogenase activity in these nodules (reduction of acetylene to ethylene, for example), these findings suggested the possibility that nitrogen fixation was taking place in this hostile, non-soil material. This immediately raises the possibility that freeliving anaerobic bacteria which fix atmospheric nitrogen on Earth, could do the same on Mars.

Effect of non-protein nitrogen and fodder legumes on the intake, digestibility and growth parameters of buffaloes

International Nuclear Information System (INIS)

Premaratne, S.

1990-01-01

Two in vivo digestibility studies and three nylon bag studies were conducted using four rumen fistulated male buffaloes to investigate the role of supplements of tree legumes and non-protein nitrogen on the feed intake, rumen function and growth of buffaloes given a basal diet of rice straw. Straw dry matter (DM) intake and digestibility were increased by urea treatment compared with urea supplementation. Inclusion of legume tree leaves in the diet increased the in vivo DM digestibility of both untreated and treated straw, but the increment was much higher for untreated straw. A supplementation of legumes also increased the in vivo nitrogen (N) digestibility of the diet of buffaloes. A trend towards an increase in straw intake with legume supplementation was also observed. Of the tree fodder legumes tested, Erythrina lithosperma had the highest potential for providing protein. Inclusion of legumes in the diet increased the DM and N degradation rates of feedstuff. In a growth trial of grazing female buffalo calves, the inclusion of fodder legumes increased the weight gain when compared with grazing alone. (author). 6 refs, 5 tabs

Investigation on the Assimilation of Nitrogen by Maize Roots and the Transport of Some Major Nitrogen Compounds by Xylem Sap. II

DEFF Research Database (Denmark)

Ingversen, J.; Ivanko, S.

1971-01-01

The amino acid and protein metabolism of roots of maize has been studied. The important role of the free amino acids and proteins of the roots as active agents in nitrogen assimilation is pointed out. Nitrogen supplied as nitrate is preferably incorporated into α-ketoglutaric acid, and then by tr...

Herbicides effect on the nitrogen fertilizer assimilation by sensitive plants

International Nuclear Information System (INIS)

Ladonin, V.F.; Samojlov, L.N.

1976-01-01

It has been established in studying the effect of herbicides on pea plants that the penetration of the preparations into the tissues of leaves and stems results in a slight increase of the rate of formation of dry substance in the leaves of the treated plants within 24 hours after treatment as compared with control, whereas in the last period of the analysis the herbicides strongly inhibit the formation of dry substance in leaves. The applied herbicide doses have resulted in drastic changes of the distribution of the plant-assimilated nitrogen between the protein and non-protein fractions in the leaves and stems of pea. When affected by the studied herbicides, the fertilizer nitrogen supply to the pea plants changes and the rate of the fertilizer nitrogen assimilation by the plants varies noticeably. The regularities of the fertilizer nitrogen inclusion in the protein and non-protein nitrogen compounds of the above-ground pea organs have been studied

Simultaneous effect of nitrate (NO3- concentration, carbon dioxide (CO2 supply and nitrogen limitation on biomass, lipids, carbohydrates and proteins accumulation in Nannochloropsis oculata

Directory of Open Access Journals (Sweden)

Aarón Millán-Oropeza

2015-03-01

Full Text Available Biodiesel from microalgae is a promising technology. Nutrient limitation and the addition of CO2 are two strategies to increase lipid content in microalgae. There are two different types of nitrogen limitation, progressive and abrupt limitation. In this work, the simultaneous effect of initial nitrate concentration, addition of CO2, and nitrogen limitation on biomass, lipid, protein and carbohydrates accumulation were analyzed. An experimental design was established in which initial nitrogen concentration, culture time and CO2 aeration as independent numerical variables with three levels were considered. Nitrogen limitation was taken into account as a categorical independent variable. For the experimental design, all the experiments were performed with progressive nitrogen limitation. The dependent response variables were biomass, lipid production, carbohydrates and proteins. Subsequently, comparison of both types of limitation i.e. progressive and abrupt limitation, was performed. Nitrogen limitation in a progressive mode exerted a greater effect on lipid accumulation. Culture time, nitrogen limitation and the interaction of initial nitrate concentration with nitrogen limitation had higher influences on lipids and biomass production. The highest lipid production and productivity were at 582 mgL-1 (49.7 % lipid, dry weight basis and 41.5 mgL-1d-1, respectively; under the following conditions: 250 mgL-1 of initial nitrate concentration, CO2 supply of 4% (v/v, 12 d of culturing and 2 d in state of nitrogen starvation induced by progressive limitation. This work presents a novel way to perform simultaneous analysis of the effect of the initial concentration of nitrate, nitrogen limitation, and CO2 supply on growth and lipid production of Nannochloropsis oculata, with the aim to produce potential biofuels feedstock.

The distribution and utilization of nitrogen in developing zea mays L. seedlings

International Nuclear Information System (INIS)

Watt, M.P.M. de O.C.

1987-01-01

During the first five days of germination, in the presence of NO - 3 - 15 N and N-SERVE, the nitrogen reserves of Zea mays L. caryopses accounted for 75% of the total nitrogen content of the seedlings. By day 7, exogenous nitrate contributed to all the inorganic nitrogen measured in the plant. Although NO - 3 - 15 N (94,2 atom % 15 N) was supplied throughout the germination process, and increasing pool of unlabelled nitrate was detected in both the grain and the seedling during this period. It appears that during germination in maize there is an oxidative pathway from reduced nitrogen in the reserve proteins to nitrate-nitrogen which is then supplied to the developing embryo. The levels of nitrate in the leaf increased towards the sheath, whereas other forms of nitrogen, nitrate reductase activity and capacity for nitrate accumulation increased in the opposite direction. Studies with mesophyll and bundle sheath protoplasts showed that the mesophyll tissue contributes over 80% of the total leaf content of inorganic nitrogen. Leaf tissue of Zea mays was found to have the capacity to assimilate nitrate in the dark, but at a lower rate than in the light. Oxygen did not restrict the initial rate of nitrate reduction in the dark. The rate of the in vivo nitrate reduction declined during the second hour of dark anaerobiosis, and was only restored upon supply of oxygen. Under dark anaerobic conditions nitrite accumulated and, on transfer to oxygen, the accumulate nitrite was reduced

PROTEOSE INTOXICATIONS AND INJURY OF BODY PROTEIN

Science.gov (United States)

Cooke, J. V.; Whipple, G. H.

1918-01-01

Sterile abscess formation in the dog is accompanied by a large increase in output of urinary nitrogen and also by a small but definite increase in the blood non-protein nitrogen. All this nitrogenous material of course is derived from body protein injury and autolysis. Septic inflammation in the dog (pleurisy, pneumonia, peritonitis, etc.) likewise shows a distinct rise in the blood non-protein nitrogen. This rise is not often so great as that frequently observed in the intoxication of intestinal obstruction. Many acute infections in man (septicemia, peritonitis, pneumonia, etc.) show a definite rise in the non-protein nitrogen and urea nitrogen of the blood; some cases show a very great rise above normal (over 100 mg. of non-protein nitrogen per 100 cc. of blood). There may be no anatomical change in the kidney beyond the familiar picture of cloudy swelling. This does not exclude the possibility of some transient functional derangement of the kidney epithelium. Certain obscure intoxications in man may show a considerable rise in the non-protein nitrogen of the blood, indicating a large amount of protein disintegration. These findings must be taken into account in any clinical analysis and interpretation of high non-protein nitrogen of the blood in pathological conditions. PMID:19868253

Optimization of Protein Extraction from Spirulina platensis to Generate a Potential Co-Product and a Biofuel Feedstock with Reduced Nitrogen Content

Energy Technology Data Exchange (ETDEWEB)

Parimi, Naga Sirisha; Singh, Manjinder; Kastner, James R.; Das, Keshav C., E-mail: kdas@engr.uga.edu [College of Engineering, The University of Georgia, Athens, GA (United States); Forsberg, Lennart S.; Azadi, Parastoo [Complex Carbohydrate Research Center, The University of Georgia, Athens, GA (United States)

2015-06-23

The current work reports protein extraction from Spirulina platensis cyanobacterial biomass in order to simultaneously generate a potential co-product and a biofuel feedstock with reduced nitrogen content. S. platensis cells were subjected to cell disruption by high-pressure homogenization and subsequent protein isolation by solubilization at alkaline pH followed by precipitation at acidic pH. Response surface methodology was used to optimize the process parameters – pH, extraction (solubilization/precipitation) time and biomass concentration for obtaining maximum protein yield. The optimized process conditions were found to be pH 11.38, solubilization time of 35 min and biomass concentration of 3.6% (w/w) solids for the solubilization step, and pH 4.01 and precipitation time of 60 min for the precipitation step. At the optimized conditions, a high protein yield of 60.7% (w/w) was obtained. The protein isolate (co-product) had a higher protein content [80.6% (w/w)], lower ash [1.9% (w/w)] and mineral content and was enriched in essential amino acids, the nutritious γ-linolenic acid and other high-value unsaturated fatty acids compared to the original biomass. The residual biomass obtained after protein extraction had lower nitrogen content and higher total non-protein content than the original biomass. The loss of about 50% of the total lipids from this fraction did not impact its composition significantly owing to the low lipid content of S. platensis (8.03%).

Optimization of Protein Extraction from Spirulina platensis to Generate a Potential Co-Product and a Biofuel Feedstock with Reduced Nitrogen Content

International Nuclear Information System (INIS)

Parimi, Naga Sirisha; Singh, Manjinder; Kastner, James R.; Das, Keshav C.; Forsberg, Lennart S.; Azadi, Parastoo

2015-01-01

The current work reports protein extraction from Spirulina platensis cyanobacterial biomass in order to simultaneously generate a potential co-product and a biofuel feedstock with reduced nitrogen content. S. platensis cells were subjected to cell disruption by high-pressure homogenization and subsequent protein isolation by solubilization at alkaline pH followed by precipitation at acidic pH. Response surface methodology was used to optimize the process parameters – pH, extraction (solubilization/precipitation) time and biomass concentration for obtaining maximum protein yield. The optimized process conditions were found to be pH 11.38, solubilization time of 35 min and biomass concentration of 3.6% (w/w) solids for the solubilization step, and pH 4.01 and precipitation time of 60 min for the precipitation step. At the optimized conditions, a high protein yield of 60.7% (w/w) was obtained. The protein isolate (co-product) had a higher protein content [80.6% (w/w)], lower ash [1.9% (w/w)] and mineral content and was enriched in essential amino acids, the nutritious γ-linolenic acid and other high-value unsaturated fatty acids compared to the original biomass. The residual biomass obtained after protein extraction had lower nitrogen content and higher total non-protein content than the original biomass. The loss of about 50% of the total lipids from this fraction did not impact its composition significantly owing to the low lipid content of S. platensis (8.03%).

Utilization of urea-nitrogen-15 in ruminants

International Nuclear Information System (INIS)

Boda, K.; Varady, J.; Havassy, I.

1976-01-01

In Merino sheep a series of experiments were carried out investigating exogenous and endogenous urea utilization. On the experimental sheep with isolated jejunum, rumen and intestine fistula, re-entral intestine cannulae, and after intra-ruminal or intra-intestinal 15 N-urea administration it was found that urea- 15 N takes part in the nitrogen recycling, and is utilized in the nitrogen pool. In experiments with synthetic protein-free diet, low protein diet and high nitrogen diet, after the intravenous administration of 15 N-urea the following findings were made: The results of experiments with synthetic diet, where the only nitrogen source was perorally (for 3-6 months) and then intravenously (for 3 months) administered urea, indicated the ability of ruminants to replace fully the nitrogen in the feed under certain conditions by increased endogenous urea recirculation. The results of the experiments with various nitrogen intakes showed that considerable amounts of urea- 15 N (44-96% from the given dose) were retained. Nitrogen compounds synthetized from blood urea- 15 N were recycled through the alimentary tract. Its secretion predominated in the forestomachs, abomasum and duodenum, and its reabsorption took place in the intestinal tract. From the 15 N incorporated into the nitrogenous substances which passed through the duodenum, 73-84% was reabsorbed. The retained 15 N was incorporated into the microbial and plasma proteins and its amide-N. On the basis of these results it is concluded that in addition to the rumeno-hepatal circulation, the entero-hepatal circulation of nitrogenous substances, including endogenous nitrogen, also plays an important role quantitatively and perhaps qualitatively in the process of re-utilizing the blood urea N for proteosynthesis and synthesis of other N-metabolites in ruminants. The hydrolysis of endogenous urea in the gastro-intestinal tract of ruminants and its utilization is a natural process indispensable for the maintenance of

Assimilation of 15N-labelled urea nitrogen and ammonium nitrate nitrogen by plants in case of root and non-root fertilization

International Nuclear Information System (INIS)

Muravin, Eh.A.; Kozhemyachko, V.A.; Vernichenko, I.V.

1974-01-01

Assimilation of 15 N labeled urea and ammonium nitrate in root and foliar application by spring wheat and barley has been studied during 1970-1973 period in a series of vegetative experiments at the Department of Agrochemistry, Timiryazev Agricultural Academy, and at D.N. Pryanishnikov Experimental Agrochemical Station. Additional fertilizer nitrogen applied at later ontogenesis stages (flowering and milky ripeness) is utilized mostly for protein synthesis in developing grains, thus leading to a significant increase in the relative grain protein content. A transfer of a part of nitrogen from the main ortion of fertilizer at later stages of nitrition results, at the same time, in a lower yield. Nitrogen utilization degree of urea and ammonium nitrate, when introduced before sowing or at the flowering stage is similar but in the latter case, however, additional assimilation of soil nitrogen is lower. The assimilation rate of nitrogen in root application is the lower the later the fertilizer is applied. When ammonium nitrate is additionally applied as nutrition to barley at the milky ripeness stage, ammonia and nitrate nitrogen are assimilated at the same rate and to the same extent but ammonia nitrogen is more rapidly used for protein synthesis and the rate of its transfer to the developing grains is higher. The rate of nitrogen assimilation at plant is much higher in foliar than in root application. Wheat utilizes more urea nitrogen at the flowering stage when root application is used but at the milky ripeness stage foliar application is more effective

Effect of T- and C-loop mutations on the Herbaspirillum seropedicae GlnB protein in nitrogen signalling.

Science.gov (United States)

Bonatto, Ana C; Souza, Emanuel M; Pedrosa, Fábio O; Yates, M Geoffrey; Benelli, Elaine M

2005-01-01

Proteins of the PII family are found in species of all kingdoms. Although these proteins usually share high identity, their functions are specific to the different organisms. Comparison of structural data from Escherichia coli GlnB and GlnK and Herbaspirillum seropedicae GlnB showed that the T-loop and C-terminus were variable regions. To evaluate the role of these regions in signal transduction by the H. seropedicae GlnB protein, four mutants were constructed: Y51F, G108A/P109a, G108W and Q3R/T5A. The activities of the native and mutated proteins were assayed in an E. coli background constitutively expressing the Klebsiella pneumoniae nifLA operon. The results suggested that the T-loop and C-terminus regions of H. seropedicae GlnB are involved in nitrogen signal transduction.

[Effects of the nitrogen nutrition conditions on the growth and protein synthesis of carboxydobacteria].

Science.gov (United States)

Volova-Kesler, T G; Barashkov, V A; Trubachev, I N; Stasishina, G N

1979-01-01

The rate of growth of bacterial strains oxidizing carbon monoxide (Pseudomonas gazotropha Z-1156, Comamonas compransoris Z-1155, and Seliberia carboxydohydrogena Z--1062) was studied as a function of the concentration of NH4Cl in the medium. The bacteria could grow on media containing various nitrogen sources (NH4Cl, KNO3, CO(NH2)2). Changes in the amino acid content and biochemical composition of the biomass were studied during growth of the bacteria on these media. The biological value of proteins of the bacteria was estimated.

Nitrogen utilization efficiency and nitrogen nutrition of rice crops at MADA using the microplot nitrogen balance method

International Nuclear Information System (INIS)

Ahmad Nazrul Abd Wahid; Abdul Razak Ruslan; Latiffah Norddin; Hazlina Abdullah; Khairuddin Abdul Rahim

2004-01-01

Nitrogen (N) is a very important nutrient for rice crops and is a main component of protein. Nitrogen is essential in the production of plant chlorophyll and involves in vegetative and fruit growth and development processes. Nitrogen is a critical input and exert high cost in rice crop production. Nitrogen fertilizer is not fully utilised by the rice crop; some is lost due the processes of vaporization, hydrolysis, erosion, leaching and used by other plants and microorganisms. Several agronomic practices have been studied and adopted in this country with the purpose of increasing the efficiency nitrogen fertilizer utilization and thus, reducing the output cost for rice crops. The microplot nitrogen balance method is one of the methods used to determine uptake efficiency of nitrogen fertilizers by rice crops. In this research, the microplot of 1 m x 1 m squares in paddy plot were used, to ensure that sequential sampling was done at predetermined areas. Scheduled monthly sampling of soil and rice crops was conducted until the mature stage, harvest and post-harvest period. This MINT-MADA cooperative project contains the elements of information sharing on fertilizer efficiency measurement methods by using the N-15 isotopic tracer technique and the N-balance technique in soil, besides the cooperation on use of infrastructure and facilities, expertise and labour. (Author)

Is nitrogen the next carbon?

Science.gov (United States)

Battye, William; Aneja, Viney P.; Schlesinger, William H.

2017-09-01

Just as carbon fueled the Industrial Revolution, nitrogen has fueled an Agricultural Revolution. The use of synthetic nitrogen fertilizers and the cultivation of nitrogen-fixing crops both expanded exponentially during the last century, with most of the increase occurring after 1960. As a result, the current flux of reactive, or fixed, nitrogen compounds to the biosphere due to human activities is roughly equivalent to the total flux of fixed nitrogen from all natural sources, both on land masses and in the world's oceans. Natural fluxes of fixed nitrogen are subject to very large uncertainties, but anthropogenic production of reactive nitrogen has increased almost fivefold in the last 60 years, and this rapid increase in anthropogenic fixed nitrogen has removed any uncertainty on the relative importance of anthropogenic fluxes to the natural budget. The increased use of nitrogen has been critical for increased crop yields and protein production needed to keep pace with the growing world population. However, similar to carbon, the release of fixed nitrogen into the natural environment is linked to adverse consequences at local, regional, and global scales. Anthropogenic contributions of fixed nitrogen continue to grow relative to the natural budget, with uncertain consequences.

Effects of split nitrogen fertilization on post-anthesis photoassimilates, nitrogen use efficiency and grain yield in malting barley

DEFF Research Database (Denmark)

Cai, Jian; Jiang, Dong; Liu, Fulai

2011-01-01

photosynthesis after anthesis, dry matter accumulation and assimilates remobilization, nitrogen use efficiency and grain yield to fraction of topdressed nitrogen treatments were investigated in malting barley. Net photosynthetic rate of the penultimate leaf, leaf area index and light extinction coefficient...... assimilation rate and nitrogen use efficiency resulting in higher grain yields and proper grain protein content in malting barley.......Split nitrogen applications are widely adopted to improve grain yield and enhance nitrogen use effective in crops. In a twoyear field experiment at two eco-sites, five fractions of topdressed nitrogen of 0%, 20%, 30%, 40% and 50% were implemented. Responses of radiation interception and leaf...

Terrestrial nitrogen cycles: Some unanswered questions

Science.gov (United States)

Vitousek, P.

1984-01-01

Nitrogen is generally considered to be the element which most often limits the growth of plants in both natural and agricultural ecosystems. It regulates plant growth because photosynthetic rates are strongly dependent on the concentration of nitrogen in leaves, and because relatively large mounts of protein are required for cell division and growth. Yet nitrogen is abundant in the biosphere - the well-mixed pool in the atmosphere is considered inexhaustible compared to biotic demand, and the amount of already fixed organic nitrogen in soils far exceeds annual plant uptake in terrestrial ecosystems. In regions where natural vegetation is not nitrogen limited, continuous cultivation induces nitrogen deficiency. Nitrogen loss from cultivated lands is more rapid than that of other elements, and nitrogen fertilization is generally required to maintain crop yield under any continuous system. The pervasiveness of nitrogen deficiency in many natural and most managed sites is discussed.

Crystalline amino acids and nitrogen emission

NARCIS (Netherlands)

Verstegen, M.W.A.; Jongbloed, A.W.

2003-01-01

Reductions in dietary protein level and supplementation with certain crystalline amino acids is a well-established method of formulating diets to achieve a more ideal amino acid pattern and to reduce nitrogen excretion. Up to 35% reduction in nitrogen excretion may be achieved by supplementing pig

Evolution of nitrogen species in landfill leachates under various stabilization states.

Science.gov (United States)

Zhao, Renzun; Gupta, Abhinav; Novak, John T; Goldsmith, C Douglas

2017-11-01

In this study, nitrogen species in landfill leachates under various stabilization states were investigated with emphasis on organic nitrogen. Ammonium nitrogen was found to be approximately 1300mg/L in leachates from younger landfill units (less than 10years old), and approximately 500mg/L in leachates from older landfill units (up to 30years old). The concentration and aerobic biodegradability of organic nitrogen decreased with landfill age. A size distribution study showed that most organic nitrogen in landfill leachates is nitrogen (TON, mg/L-N, R 2 =0.88 and 0.98 for untreated and treated samples, respectively). The slopes of the regression curves of untreated (protein=0.45TON) and treated (protein=0.31TON) leachates indicated that the protein is more biodegradable than the other organic nitrogen species in landfill leachates. XAD-8 resin was employed to isolate the hydrophilic fraction of leachate samples, and it was found that the hydrophilic fraction proportion in terms of organic nitrogen decreased with landfill age. Solid-state 15 N nuclear magnetic resonance (NMR) was utilized to identify the nitrogen species. Proteinaceous materials were found to be readily biodegradable, while heterocyclic nitrogen species were found to be resistant to biodegradation. Copyright © 2017 Elsevier Ltd. All rights reserved.

Nitrate and ammonium lead to distinct global dynamic phosphorylation patterns when resupplied to nitrogen-starved Arabidopsis seedlings.

Science.gov (United States)

Engelsberger, Wolfgang R; Schulze, Waltraud X

2012-03-01

Nitrogen is an essential macronutrient for plant growth and development. Inorganic nitrogen and its assimilation products control various metabolic, physiological and developmental processes. Although the transcriptional responses induced by nitrogen have been extensively studied in the past, our work here focused on the discovery of candidate proteins for regulatory events that are complementary to transcriptional changes. Most signaling pathways involve modulation of protein abundance and/or activity by protein phosphorylation. Therefore, we analyzed the dynamic changes in protein phosphorylation in membrane and soluble proteins from plants exposed to rapid changes in nutrient availability over a time course of 30 min. Plants were starved of nitrogen and subsequently resupplied with nitrogen in the form of nitrate or ammonium. Proteins with maximum change in their phosphorylation level at up to 5 min after nitrogen resupply (fast responses) included GPI-anchored proteins, receptor kinases and transcription factors, while proteins with maximum change in their phosphorylation level after 10 min of nitrogen resupply (late responses) included proteins involved in protein synthesis and degradation, as well as proteins with functions in central metabolism and hormone metabolism. Resupply of nitrogen in the form of nitrate or ammonium resulted in distinct phosphorylation patterns, mainly of proteins with signaling functions, transcription factors and transporters. © 2011 The Authors. The Plant Journal © 2011 Blackwell Publishing Ltd.

Assimilation of /sup 15/N-labelled urea nitrogen and ammonium nitrate nitrogen by plants in case of root and non-root fertilization

Energy Technology Data Exchange (ETDEWEB)

Muravin, E A; Kozhemyachko, V A; Vernichenko, I V

1974-01-01

Assimilation of /sup 15/N labeled urea and ammonium nitrate in root and foliar application by spring wheat and barley has been studied during 1970-1973 period in a series of vegetative experiments at the Department of Agrochemistry, Timiryazev Agricultural Academy, and at D.N. Pryanishnikov Experimental Agrochemical Station. Additional fertilizer nitrogen applied at later ontogenesis stages (flowering and milky ripeness) is utilized mostly for protein synthesis in developing grains, thus leading to a significant increase in the relative grain protein content. A transfer of a part of nitrogen from the main portion of fertilizer at later stages of nitrition results, at the same time, in a lower yield. Nitrogen utilization degree of urea and ammonium nitrate, when introduced before sowing or at the flowering stage is similar but in the latter case, however, additional assimilation of soil nitrogen is lower. The assimilation rate of nitrogen in root application is the lower the later the fertilizer is applied. When ammonium nitrate is additionally applied as nutrition to barley at the milky ripeness stage, ammonia and nitrate nitrogen are assimilated at the same rate and to the same extent but ammonia nitrogen is more rapidly used for protein synthesis and the rate of its transfer to the developing grains is higher. The rate of nitrogen assimilation at plant is much higher in foliar than in root application. Wheat utilizes more urea nitrogen at the flowering stage when root application is used but at the milky ripeness stage foliar application is more effective.

Evaluation of the protein quality of cereal mutants

International Nuclear Information System (INIS)

Eggum, B.O.

1984-01-01

Protein content, true protein digestibility, biological value, net protein utilization, and utilizable protein in several varieties of barley, wheat and rice were determined in nitrogen-balance trials with rats. It appeared that protein quality varied significantly between these three cereal grains, with the lowest values for wheat. However, the protein content was markedly higher in wheat; consequently, utilizable protein was highest in this cereal grain. The different varieties within barley, wheat and rice varied considerably in protein quality. This demonstrates a large variation in the potential for protein synthesis. The main problem with rice and barley is the low protein concentration, whereas with wheat the biggest problem seems to be the quality of the protein. As the lysine level in all cereal grains, expressed in percentage of the protein, cannot meet the requirements for either man or domestic animals efforts should be made to increase the lysine concentration in these food sources. (author)

Effect of feeding aflatoxin on nitrogen kinetics in crossbred and buffalo calves fed different levels of protein

International Nuclear Information System (INIS)

Dass, R.S.; Arora, S.P.

1989-01-01

The studies were conducted to elucidate the effect of feeding aflatoxin on nitrogen kinetics in rumen fistulated calves. One calf each in groups 1, 2, 5 and 6 and one bufffalo calf each, in groups 3, 4, 7 and 8 were alloted. Calves of groups 5 to 8 were provided optimum protein (OP) while those in groups 1 to 4 were given 42.5 per cent more protein (HP) in their diets. In addition, animals in groups 2, 4, 6 and 8 were given an oral dose of aflatoxin at the rate of 1.0 ppm of drymatter intake. Subsequent to digestibility trial, 2 hourly feeding was practised for 10 days, after which 15 N-ammonium sulphate and 51 Cr-EDTA were infused intra-ruminally. Results indicated that there was no effect of feeding aflatoxin on the digestibility of nutrients except crude protein. Nitrogen balances were better with groups fed OP diets as compared to HP diets, more in crossbreds than the buffalo. The estimated rumen volume ranged from 37.70 to 56.00 litres and rumen fluid outflow rates varied from 87.34 to 123.70 litres per day. Ruminal ammonia pool size, ruminal ammonia entry rates and irreversible loss rates were higher in HP fed groups without showing any effect of afflatoxins. Ruminal ammonia-N was better utilized for incorporation into bacterial protein and for transfer to plasma urea-N with OP fed groups, again without showing aflatoxin toxicity effect. Ruminal ammonia-N excretion pattern through urine was greater as a result of aflatoxin toxicity, more in crossbreds as compared to buffalo. (author). 19 refs. 5 tabs

Nitrogen Assimilation in Escherichia coli: Putting Molecular Data into a Systems Perspective

Science.gov (United States)

van Heeswijk, Wally C.; Westerhoff, Hans V.

2013-01-01

SUMMARY We present a comprehensive overview of the hierarchical network of intracellular processes revolving around central nitrogen metabolism in Escherichia coli. The hierarchy intertwines transport, metabolism, signaling leading to posttranslational modification, and transcription. The protein components of the network include an ammonium transporter (AmtB), a glutamine transporter (GlnHPQ), two ammonium assimilation pathways (glutamine synthetase [GS]-glutamate synthase [glutamine 2-oxoglutarate amidotransferase {GOGAT}] and glutamate dehydrogenase [GDH]), the two bifunctional enzymes adenylyl transferase/adenylyl-removing enzyme (ATase) and uridylyl transferase/uridylyl-removing enzyme (UTase), the two trimeric signal transduction proteins (GlnB and GlnK), the two-component regulatory system composed of the histidine protein kinase nitrogen regulator II (NRII) and the response nitrogen regulator I (NRI), three global transcriptional regulators called nitrogen assimilation control (Nac) protein, leucine-responsive regulatory protein (Lrp), and cyclic AMP (cAMP) receptor protein (Crp), the glutaminases, and the nitrogen-phosphotransferase system. First, the structural and molecular knowledge on these proteins is reviewed. Thereafter, the activities of the components as they engage together in transport, metabolism, signal transduction, and transcription and their regulation are discussed. Next, old and new molecular data and physiological data are put into a common perspective on integral cellular functioning, especially with the aim of resolving counterintuitive or paradoxical processes featured in nitrogen assimilation. Finally, we articulate what still remains to be discovered and what general lessons can be learned from the vast amounts of data that are available now. PMID:24296575

Economics of low nitrogen feeding strategies

NARCIS (Netherlands)

Vuuren, van A.M.; Pineiro, C.; Hoek, Van der K.W.; Oenema, O.

2015-01-01

Livestock retains typically between 10 and 40 % of the protein-nitrogen in the animal feed in milk, egg and/or meat, depending also on animal productivity and management. The remaining 60–90 % of the nitrogen (N) is excreted in urine and faeces, and contributes to the emissions of ammonia (NH3) and

Nitrogen balance study in young Nigerian adult males using four levels of protein intake.

Science.gov (United States)

Atinmo, T; Mbofung, C M; Egun, G; Osotimehin, B

1988-11-01

1. The present study was carried out to estimate precisely, via the nitrogen balance technique, the protein requirement of Nigerians (earlier estimated via the obligatory N method) using graded levels of protein intake. 2. Fifteen medical students of the University of Ibadan who volunteered to participate in the study were given graded levels of protein (0.3, 0.45, 0.6 and 0.75 g/kg body-weight per d) derived from foods similar to those usually consumed by the subjects. 3. Each subject was given each of the dietary protein levels for a period of 10 d. Subjects were divided into two groups and the feeding pattern followed a criss-cross design with one group starting with the highest level of protein intake (0.3 g). Mean energy intake during each of the eleven experimental periods was maintained at 0.2 MJ/kg per d. After an initial 5 d adaptation period in each experimental period, 24 h urine and faecal samples were collected in marked containers for five consecutive days for N determination. 4. Mean N balance during consumption of the four protein levels (0.30, 0.45, 0.6 and 0.75 g/kg) were -11.02 (SD 8.07), -9.90 (SD 6.64), +9.70 (SD 4.15) and +5.13 (SD 4.62) respectively. Using regression analysis, the mean daily N requirement was estimated at 110.25 mg N/kg body-weight (0.69 g protein/kg body-weight). Estimates of allowances for individual variations to cover 97.5% of the population adjusted this value to 0.75 g protein/kg body-weight. Net protein utilization for the diet at maintenance level was estimated at 57.5.

Dryland Winter Wheat Yield, Grain Protein, and Soil Nitrogen Responses to Fertilizer and Biosolids Applications

Directory of Open Access Journals (Sweden)

Richard T. Koenig

2011-01-01

Full Text Available Applications of biosolids were compared to inorganic nitrogen (N fertilizer for two years at three locations in eastern Washington State, USA, with diverse rainfall and soft white, hard red, and hard white winter wheat (Triticum aestivum L. cultivars. High rates of inorganic N tended to reduce yields, while grain protein responses to N rate were positive and linear for all wheat market classes. Biosolids produced 0 to 1400 kg ha−1 (0 to 47% higher grain yields than inorganic N. Wheat may have responded positively to nutrients other than N in the biosolids or to a metered N supply that limited vegetative growth and the potential for moisture stress-induced reductions in grain yield in these dryland production systems. Grain protein content with biosolids was either equal to or below grain protein with inorganic N, likely due to dilution of grain N from the higher yields achieved with biosolids. Results indicate the potential to improve dryland winter wheat yields with biosolids compared to inorganic N alone, but perhaps not to increase grain protein concentration of hard wheat when biosolids are applied immediately before planting.

Nitrogen balance of healthy Dutch women before and during pregnancy

NARCIS (Netherlands)

Mojtahedi, M.; Groot, de C.P.G.M.; Boekholt, H.A.; Raaij, van J.M.A.

2002-01-01

Background: Experimental studies including longitudinal nitrogen balance studies could provide insight into protein metabolism in pregnancy. Objective: Our aim was to determine the development of nitrogen balance during pregnancy compared with nitrogen balance before pregnancy in women consuming

Nitrogen uptake kinetics of freshly isolated zooxanthellae

Digital Repository Service at National Institute of Oceanography (India)

Wafar, M.V.M.; Wafar, S.; Rajkumar, R.

that for nitrate [2.8 nmol. ( mu chl-a)./1h/1] and urea [0.37 nmol. ( mu chl-a)./1h/1]. Half-saturation constants for uptake of the three nitrogen compounds were in the range of 10-15 mu mol.l/1. Generally, uptake of any one nitrogen substrate appears to be inhibit...

Effect of Nitrogen Fertilizer on Variations in Composition in Protein and Non-Protein Compounds in the Aerial Parts of Dactylis Glomerata L; Influence de la Fertilisation Azotee sur les Variations de la Composition en Composes Proteiques et Non Proteiques des Parties Aeriennes de Dactylis Glomerata L.

Energy Technology Data Exchange (ETDEWEB)

Lefebvre, J. M. [Institut National de la Recherche Agronomique, Station d' Agronomie, Dijon (France)

1968-07-01

A knowledge of the effects of nitrogen fertilizer on plant quality would appear to be of prime importance in the study of plant-animal relations. Th e author examined, at a test facility in the east-central part of France, variations in the composition of the aerial parts of ''Floreal'' cocksfoot treated with nitrogen fertilizer at different supply rates. Enrichment in soluble organic nitrogen, amino acids, amides, simple peptides and protein compounds is fairly proportional to the nitrogen dose supplied at different vegetative cycles. Free mineral nitrogen, consisting almost exclusively of nitrates, shows elevated values, particularly during the first vegetative cycles which take place at a time when low temperatures are not favourable to a rapid reduction. The values found increase with the amounts of nitrogen supplied to the plants. If the fertilizer is applied to the grass 15 days after ablation of the aerial parts and not immediately, as in common farming practice, a complete modification of the various phenomena accompanying protein synthesis will be noted. In this case nitrate production is very swift and metabolization into soluble organic compounds and condensates is extensive. As a result, temporarily large accumulations of nitrates are not observed in the summer and autumn vegetative cycles. In addition, and of great importance for the nutritional quality of the harvested produce, the gross protein contents are much higher (around 50%) at the end of the cycle for an equal quantity of nitrogen supplied during fertilization. Soluble organic nitrogen compounds, amino acids and amides, are also found in greater quantities. (author) [French] La connaissance des repercussions de la fertilisation azotee sur la qualite vegetale semble primordiale dans l'etude des liaisons plante-animal. L'auteur a examine sur un dispositif experimental situe dans le Centre-Est de la France les variations de la composition des parties aeriennes d'un Dactyle Floreal soumis a des

The effect of high pressure on nitrogen compounds of milk

International Nuclear Information System (INIS)

Kielczewska, Katarzyna; Czerniewicz, Maria; Michalak, Joanna; Brandt, Waldemar

2004-01-01

The effect of pressurization at different pressures (from 200 to 1000 MPa, at 200 MPa intervals, t const. = 15 min) and periods of time (from 15 to 35 min, at 10 min intervals, p const. = 800 MPa) on the changes of proteins and nitrogen compounds of skimmed milk was studied. The pressurization caused an increase in the amount of soluble casein and denaturation of whey proteins. The level of nonprotein nitrogen compounds and proteoso-peptone nitrogen compounds increased as a result of the high-pressure treatment. These changes increased with an increase in pressure and exposure time. High-pressure treatment considerably affected the changes in the conformation of milk proteins, which was reflected in the changes in the content of proteins sedimenting and an increase in their degree of hydration

Split Nitrogen Application Improves Wheat Baking Quality by Influencing Protein Composition Rather Than Concentration.

Science.gov (United States)

Xue, Cheng; Auf'm Erley, Gunda Schulte; Rossmann, Anne; Schuster, Ramona; Koehler, Peter; Mühling, Karl-Hermann

2016-01-01

The use of late nitrogen (N) fertilization (N application at late growth stages of wheat, e.g., booting, heading or anthesis) to improve baking quality of wheat has been questioned. Although it increases protein concentration, the beneficial effect on baking quality (bread loaf volume) needs to be clearly understood. Two pot experiments were conducted aiming to evaluate whether late N is effective under controlled conditions and if these effects result from increased N rate or N splitting. Late N fertilizers were applied either as additional N or split from the basal N at late boot stage or heading in the form of nitrate-N or urea. Results showed that late N fertilization improved loaf volume of wheat flour by increasing grain protein concentration and altering its composition. Increasing N rate mainly enhanced grain protein quantitatively. However, N splitting changed grain protein composition by enhancing the percentages of gliadins and glutenins as well as certain high molecular weight glutenin subunits (HMW-GS), which led to an improved baking quality of wheat flour. The late N effects were greater when applied as nitrate-N than urea. The proportions of glutenin and x-type HMW-GS were more important than the overall protein concentration in determining baking quality. N splitting is more effective in improving wheat quality than the increase in the N rate by late N, which offers the potential to cut down N fertilization rates in wheat production systems.

Split nitrogen application improves wheat baking quality by influencing protein composition rather than concentration

Directory of Open Access Journals (Sweden)

Cheng eXue

2016-06-01

Full Text Available The use of late nitrogen (N fertilization (N application at late growth stages of wheat, e.g. booting, heading or anthesis to improve baking quality of wheat has been questioned. Although it increases protein concentration, the beneficial effect on baking quality (bread loaf volume needs to be clearly understood. Two pot experiments were conducted aiming to evaluate whether late N is effective under controlled conditions and if these effects result from increased N rate or N splitting. Late N fertilizers were applied either as additional N or split from the basal N at late boot stage or heading in the form of nitrate-N or urea. Results showed that late N fertilization improved loaf volume of wheat flour by increasing grain protein concentration and altering its composition. Increasing N rate mainly enhanced grain protein quantitatively. However, N splitting changed grain protein composition by enhancing the percentages of gliadins and glutenins as well as certain high molecular weight glutenin subunits (HMW-GS, which led to an improved baking quality of wheat flour. The late N effects were greater when applied as nitrate-N than urea. The proportions of glutenin and x-type HMW-GS were more important than the overall protein concentration in determining baking quality. N splitting is more effective in improving wheat quality than the increase in the N rate by late N, which offers the potential to cut down N fertilization rates in wheat production systems.

Properties and regulation of biosynthesis of cottonseed storage proteins. Comprehensive progress report, December 1, 1976 to September 1, 1979

Energy Technology Data Exchange (ETDEWEB)

Dure, III, L S

1979-01-01

The regulation of gene expression in cotton seed embryogenesis was studied by attempting to define what gene products are likely to be highly regulated during this developmental progression. The flow of nitrogen into the free amino acids pools of the developing cotyledons, and into the principal nitrogen nutritional reserve of the seed, the storage proteins was measured. This was continued by following the flow of nitrogen from the storage proteins to the principal exported amino acid asparagine that occurs during the first several days of germination. In this fashion the rise and fall of certain enzymes of amino acid intermediary metabolism could be postulated, and in some cases, verified. The subsets of abundant mRNAs whose appearance and disappearance coincided with developmental events in cotyledon embryogenesis/germination with the short range goal of identifying proteins/enzyme activities were delineated as well as their mRNAs that represent specific developmental stages and the long range goal of using these representatives as probes for studying the mechanisms controlling the rise and fall of these mRNAs and their protein products.

Nitrogen control of chloroplast development: Progress report

International Nuclear Information System (INIS)

Schmidt, G.W.

1987-11-01

A manifestation of nitrogen deficiency in vascular plants and algae is chlorosis, indicating that chloroplast biogenesis can be strongly restricted by direct or indirect effects of nitrogen assimilation products. To define the molecular basis of nitrogen responses we are using Chlamydomonas reinhardtii. Depending on the levels of ammonium, steady-state deficiency conditions are established such that the cellular levels of chlorophylls and xanthophylls are depressed. Chloroplasts in nitrogen-deficient cells contain appreciable levels of carbon assimilation enzyme and thylakoids with high electron transport activities. However, the light harvesting complexes are nearly absent and Photosystem I exhibits unusual characteristics. Studies of rates of protein synthesis by in vivo pulse-chase labeling and levels of RNAs encoded by the chloroplast and nuclear genomes have been initiated: the accumulation of transcripts for the nuclear light-harvesting apoproteins is dramatically altered qualitatively and quantitatively; there is no major effect on chloroplast RNAs but, in general, these are inefficiently utilized for protein synthesis until nitrogen is provided to the cultures. Supplying nitrogen results in an almost immediate release of chloroplast mRNAs from a translational arrest but the stimulation of the accumulation of nuclear transcripts for light-harvesting apoproteins does not occur until after a 1-2 hour lag

Nitrogen control of chloroplast development: Progress report

Energy Technology Data Exchange (ETDEWEB)

Schmidt, G.W.

1987-11-01

A manifestation of nitrogen deficiency in vascular plants and algae is chlorosis, indicating that chloroplast biogenesis can be strongly restricted by direct or indirect effects of nitrogen assimilation products. To define the molecular basis of nitrogen responses we are using Chlamydomonas reinhardtii. Depending on the levels of ammonium, steady-state deficiency conditions are established such that the cellular levels of chlorophylls and xanthophylls are depressed. Chloroplasts in nitrogen-deficient cells contain appreciable levels of carbon assimilation enzyme and thylakoids with high electron transport activities. However, the light harvesting complexes are nearly absent and Photosystem I exhibits unusual characteristics. Studies of rates of protein synthesis by in vivo pulse-chase labeling and levels of RNAs encoded by the chloroplast and nuclear genomes have been initiated: the accumulation of transcripts for the nuclear light-harvesting apoproteins is dramatically altered qualitatively and quantitatively; there is no major effect on chloroplast RNAs but, in general, these are inefficiently utilized for protein synthesis until nitrogen is provided to the cultures. Supplying nitrogen results in an almost immediate release of chloroplast mRNAs from a translational arrest but the stimulation of the accumulation of nuclear transcripts for light-harvesting apoproteins does not occur until after a 1-2 hour lag.

Dual purpose wheat production with different levels of nitrogen topdressing

Directory of Open Access Journals (Sweden)

Éderson Luis Henz

2016-04-01

Full Text Available Currently, the practice of Crop-Livestock Integration is stimulated as a way of increasing the generation of foreign exchange for Brazil. Integrated systems improve land use efficiency as well as preserve, recover and increment or soil fertility. The aim of this research was to evaluate how different doses of nitrogen fertilization can affect production and quality of dual purpose wheat submitted to grazing. The experimental designed was randomized block with five treatments (0, 75, 150, 225 and 300 Kg N ha-1, like ammonium nitrate and four repetitions. The forage yield, the percentage crude protein (P=.0001 and acid detergent insoluble protein (P=.0054 had a linear increased because of the nitrogen addition doses. The crude protein percentage changed the estimate of all soluble carbohydrates (P=.0001 and non-fibrous carbohydrates (P=.0186, but did not influence the, nitrogen detergent fiber corrected with ash and proteins percentage contributing for content cell. The crops production (P=.0001 and the number of kernels per ear (P=.0001 showed significantly difference because of the nitrogen additions dose, increasing the number of fertile flowers. The nitrogen topdressing alters forage production, the chemical composition and the production of dual purpose wheat grains subjected to grazing.

Digestibility and nitrogen balance of diets containing non conventional vegetable proteins fed to pigs of genetic strains suitable for outdoor systems

OpenAIRE

L. Sardi; M. Simioli; R. Paganelli; G. Martelli; L. Rizzi

2010-01-01

The study was carried out to evaluate on growing pigs kept in metabolism crates, either belonging to a “traditional” cross-breed (Duroc x Large White – DLW) or a local breed (Cinta Senese – CS), the digestibility and the nitrogen balance of non-conventional vegetable protein sources (field beans, pea and sunflower cake) when compared to soybean meal. The four diets were formulated so as to supply the same crude protein amount. CS pigs showed lower apparent digestibilit...

Purification and binding analysis of the nitrogen fixation regulatory NifA protein from Azospirillum brasilense

Directory of Open Access Journals (Sweden)

L.M.P. Passaglia

1998-11-01

Full Text Available NifA protein activates transcription of nitrogen fixation operons by the alternative sigma54 holoenzyme form of RNA polymerase. This protein binds to a well-defined upstream activator sequence (UAS located at the -200/-100 position of nif promoters with the consensus motif TGT-N10-ACA. NifA of Azospirillum brasilense was purified in the form of a glutathione-S-transferase (GST-NifA fusion protein and proteolytic release of GST yielded inactive and partially soluble NifA. However, the purified NifA was able to induce the production of specific anti-A. brasilense NifA-antiserum that recognized NifA from A. brasilense but not from K. pneumoniae. Both GST-NifA and NifA expressed from the E. coli tac promoter are able to activate transcription from the nifHDK promoter but only in an A. brasilense background. In order to investigate the mechanism that regulates NifA binding capacity we have used E. coli total protein extracts expressing A. brasilense nifA in mobility shift assays. DNA fragments carrying the two overlapping, wild-type or mutated UAS motifs present in the nifH promoter region revealed a retarded band of related size. These data show that the binding activity present in the C-terminal domain of A. brasilense NifA protein is still functional even in the presence of oxygen.

Elevated CO2 plus chronic warming reduce nitrogen uptake and levels or activities of nitrogen-uptake and -assimilatory proteins in tomato roots.

Science.gov (United States)

Jayawardena, Dileepa M; Heckathorn, Scott A; Bista, Deepesh R; Mishra, Sasmita; Boldt, Jennifer K; Krause, Charles R

2017-03-01

Atmospheric CO 2 enrichment is expected to often benefit plant growth, despite causing global warming and nitrogen (N) dilution in plants. Most plants primarily procure N as inorganic nitrate (NO 3 - ) or ammonium (NH 4 + ), using membrane-localized transport proteins in roots, which are key targets for improving N use. Although interactive effects of elevated CO 2 , chronic warming and N form on N relations are expected, these have not been studied. In this study, tomato (Solanum lycopersicum) plants were grown at two levels of CO 2 (400 or 700 ppm) and two temperature regimes (30 or 37°C), with NO 3 - or NH 4 + as the N source. Elevated CO 2 plus chronic warming severely inhibited plant growth, regardless of N form, while individually they had smaller effects on growth. Although %N in roots was similar among all treatments, elevated CO 2 plus warming decreased (1) N-uptake rate by roots, (2) total protein concentration in roots, indicating an inhibition of N assimilation and (3) shoot %N, indicating a potential inhibition of N translocation from roots to shoots. Under elevated CO 2 plus warming, reduced NO 3 - -uptake rate per g root was correlated with a decrease in the concentration of NO 3 - -uptake proteins per g root, reduced NH 4 + uptake was correlated with decreased activity of NH 4 + -uptake proteins and reduced N assimilation was correlated with decreased concentration of N-assimilatory proteins. These results indicate that elevated CO 2 and chronic warming can act synergistically to decrease plant N uptake and assimilation; hence, future global warming may decrease both plant growth and food quality (%N). © 2016 Scandinavian Plant Physiology Society.

Isotopic patterns in caps and stipes in sporocarps reveal patterns of organic nitrogen use by ectomycorrhizal fungi

Science.gov (United States)

Hobbie, Erik; Ouimette, Andrew; Chen, Janet

2016-04-01

%), the interaction of exploration type and %Ncap/stipe (22%), %Ccap-stipe (8%), and %Ncap-stipe (5%). δ15N differences between caps and stipes in a multiple regression model had an adjusted r2 of 0.486 (p Ncap-stipe (26%), the interaction of exploration type and %Ncap/stipe (14%), %Ncap/stipe (11%),and %Ccap-stipe (2%). We argue that these differences in the 13C and 15N enrichment of caps relative to stipes reflect not only shifts in the proportions of protein and carbohydrates, but also differences in the extent of fluxes and the δ13C and δ15N signatures of soil- and litter-derived organic nitrogen taken up by these fungi. We also propose equations to quantify this uptake. Organic nitrogen from litter (lower δ13C and δ15N) may be incorporated by medium-distance mat, short-distance, and contact exploration types of ectomycorrhizal fungi, whereas long-distance and medium-distance fringe exploration types appeared to incorporate deeper soil organic nitrogen.

[Characteristics of dry matter production and nitrogen accumulation in barley genotypes with high nitrogen utilization efficiency].

Science.gov (United States)

Huang, Yi; Li, Ting-Xuan; Zhang, Xi-Zhou; Ji, Lin

2014-07-01

A pot experiment was conducted under low (125 mg x kg-1) and normal (250 mg x kg(-1)) nitrogen treatments. The nitrogen uptake and utilization efficiency of 22 barley cultivars were investigated, and the characteristics of dry matter production and nitrogen accumulation in barley were analyzed. The results showed that nitrogen uptake and utilization efficiency were different for barley under two nitrogen levels. The maximal values of grain yield, nitrogen utilization efficiency for grain and nitrogen harvest index were 2.87, 2.91 and 2.47 times as those of the lowest under the low nitrogen treatment. Grain yield and nitrogen utilization efficiency for grain and nitrogen harvest index of barley genotype with high nitrogen utilization efficiency were significantly greater than low nitrogen utilization efficiency, and the parameters of high nitrogen utilization efficiency genotype were 82.1%, 61.5% and 50.5% higher than low nitrogen utilization efficiency genotype under the low nitrogen treatment. Dry matter mass and nitrogen utilization of high nitrogen utilization efficiency was significantly higher than those of low nitrogen utilization efficiency. A peak of dry matter mass of high nitrogen utilization efficiency occurred during jointing to heading stage, while that of nitrogen accumulation appeared before jointing. Under the low nitrogen treatment, dry matter mass of DH61 and DH121+ was 34.4% and 38.3%, and nitrogen accumulation was 54. 8% and 58.0% higher than DH80, respectively. Dry matter mass and nitrogen accumulation seriously affected yield before jointing stage, and the contribution rates were 47.9% and 54.7% respectively under the low nitrogen treatment. The effect of dry matter and nitrogen accumulation on nitrogen utilization efficiency for grain was the largest during heading to mature stages, followed by sowing to jointing stages, with the contribution rate being 29.5% and 48.7%, 29.0% and 15.8%, respectively. In conclusion, barley genotype with high

Food nitrogen footprint reductions related to a balanced Japanese diet.

Science.gov (United States)

Oita, Azusa; Nagano, Ichiro; Matsuda, Hiroyuki

2018-04-01

Dietary choices largely affect human-induced reactive nitrogen accumulation in the environment and resultant environmental problems. A nitrogen footprint (NF) is an indicator of how an individual's consumption patterns impact nitrogen pollution. Here, we examined the impact of changes in the Japanese diet from 1961 to 2011 and the effect of alternative diets (the recommended protein diet, a pescetarian diet, a low-NF food diet, and a balanced Japanese diet) on the food NF. The annual per capita Japanese food NF has increased by 55% as a result of dietary changes since 1961. The 1975 Japanese diet, a balanced omnivorous diet that reportedly delays senescence, with a protein content similar to the current level, reduced the current food NF (15.2 kg N) to 12.6 kg N, which is comparable to the level in the recommended protein diet (12.3 kg N). These findings will help consumers make dietary choices to reduce their impacts on nitrogen pollution.

Accumulation of dry matter and nitrogen in the developing seeds of high protein mutant lines of Triticum Aestivum (L.) produced by the IAEA

International Nuclear Information System (INIS)

Mir Ali, N.; Nabulsi, I.

1993-03-01

Accumulation patterns of dry matter and nitrogen in the developing seeds of nine mutant lines produced by the IAEA and their mother Triticum Aestivum (L.) line were studied. The experiments lasted 2 years under rain fed conditions. Significant differences were found among the lines in dry matter and nitrogen rates, and periods of accumulation, whereas no significant differences were found in the final seed weight of the lines. The highest rates of accumulation for dry matter and nitrogen were accompanied with the shortest period of accumulation in two late flowering mutant lines. However, these two lines were the lowest in their yield per plot. The other mutant lines achieved the high nitrogen percentage in their seeds through the relative reduction in dry matter accumulation rate compared to their mother line rather than through higher rate of nitrogen accumulation. This study revealed some of the potential reasons behind the higher percentage of protein in the seeds of the mutant lines under investigation. (author). 17 refs., 3 figs., 2 tabs

Nitrogen fixation in the tissues of ruminant

International Nuclear Information System (INIS)

Buttery, P.J.

1990-01-01

Protein metabolism in animals is in a constant state of flux, the processes of protein synthesis and protein breakdown acting against each other, and the balance between the two processes causing changes in the mass of protein in a tissue. Reduction in the diet reduces both protein synthesis and protein degradation unless the dietary depletion is severe and prolonged, when there is a marked increase in protein catabolism. The synthesis and degradation of protein can be manipulated by anabolic agents, thus increasing the efficiency of animals. While the use of these agents has met with success in many countries, it remains to be seen whether they will be useful in harsh environments. Lactation and pregnancy put an extra demand on the nitrogen economy of animals. Evidence indicates that the extra amino acids needed for milk production do not come from muscle protein breakdown. Many animals in harsh environments are infected with parasites; intestinal parasites reduce food intake and cause blood loss into the intestines. Associated with this is a general disruption of protein metabolism. In all these studies, isotopic techniques have played a vital role. Few studies have been conducted on nitrogen metabolism in the tissue of ruminants exposed to harsh environments (with one notable exception: rumen function studies, some of which are described elsewhere in the Proceedings of this Seminar). This lack of work on nitrogen metabolism of animals from the harsher environments has often made it necessary to extrapolate data obtained from animals found and maintained in the temperate zones to quite different environments and to animals maintained on quite different dietary regimens. Several examples of the use of isotopes in metabolic studies with animals to yield information of direct or potential relevance to the harsh environments are presented. (author). 23 refs. 1 fig. 6 tabs

Energy transfer in Anabaena variabilis filaments adapted to nitrogen-depleted and nitrogen-enriched conditions studied by time-resolved fluorescence.

Science.gov (United States)

Onishi, Aya; Aikawa, Shimpei; Kondo, Akihiko; Akimoto, Seiji

2017-09-01

Nitrogen is among the most important nutritious elements for photosynthetic organisms such as plants, algae, and cyanobacteria. Therefore, nitrogen depletion severely compromises the growth, development, and photosynthesis of these organisms. To preserve their integrity under nitrogen-depleted conditions, filamentous nitrogen-fixing cyanobacteria reduce atmospheric nitrogen to ammonia, and self-adapt by regulating their light-harvesting and excitation energy-transfer processes. To investigate the changes in the primary processes of photosynthesis, we measured the steady-state absorption and fluorescence spectra and time-resolved fluorescence spectra (TRFS) of whole filaments of the nitrogen-fixing cyanobacterium Anabaena variabilis at 77 K. The filaments were grown in standard and nitrogen-free media for 6 months. The TRFS were measured with a picosecond time-correlated single photon counting system. Despite the phycobilisome degradation, the energy-transfer paths within phycobilisome and from phycobilisome to both photosystems were maintained. However, the energy transfer from photosystem II to photosystem I was suppressed and a specific red chlorophyll band appeared under the nitrogen-depleted condition.

[Nitrogen balance assessment in burn patients].

Science.gov (United States)

Beça, Andreia; Egipto, Paula; Carvalho, Davide; Correia, Flora; Oliveira, Bruno; Rodrigues, Acácio; Amarante, José; Medina, J Luís

2010-01-01

The burn injury probably represents the largest stimulus for muscle protein catabolism. This state is characterized by an accelerated catabolism of the lean or skeletal mass that results in a clinical negative balance of nitrogen and muscle wasting. The determination of an appropriate value for protein intake is essential, since it is positively related to the nitrogen balance (NB) and accordingly several authors argue that a positive NB is the key parameter associated with nutritional improvement of a burn patient. Evaluation of the degree of protein catabolism by assessment of the Nitrogen Balance; Defining of nutritional support (protein needs) to implement in patients with burned surface area (BSA) = 10%. We prospectively evaluated the clinical files and scrutinized the clinical variables of interest. The NB was estimated according to three formulae. Each gram of nitrogen calculated by the NB was then converted into grams of protein, subtracted or added to protein intake (or administered enteric or parenterically) and divided by kg of reference Weight (kg Rweight), in an attempt to estimate the daily protein needs. The cohort consisted of 10 patients, 6 females, with average age of 58(23) years old, a mean of BSA of 21.4(8.4)%, ranging from a minimum of 10.0% and máximum of 35.0%. On average, patients were 58 (23) years old. The average number of days of hospitalization in the burn unit was 64.8(36.5) days. We observed significant differences between the 3 methods used for calculating the NB (p = 0.004), on average the NB was positive. When the formula A was used the average value of NB was higher. Regarding the attempt to estimate the needs of g prot/kg Rweight/day most of the values did not exceed, on average, 2.6 g Prot/kg Rweight/day and no significant differences between patients with a BSA% of 10-20% and with BSA% > 20% were found. Despite being able to estimate the protein catabolism through these formulas and verifying that most values were above zero

Recent developments in the structural organization and regulation of nitrogen fixation genes in Herbaspirillum seropedicae.

Science.gov (United States)

Pedrosa, F O; Benelli, E M; Yates, M G; Wassem, R; Monteiro, R A; Klassen, G; Steffens, M B; Souza, E M; Chubatsu, L S; Rigo, L U

2001-10-04

Herbaspirillum seropedicae is a nitrogen-fixing bacterium found in association with economically important gramineae. Regulation of nitrogen fixation involves the transcriptional activator NifA protein. The regulation of NifA protein and its truncated mutant proteins is described and compared with that of other nitrogen fixation bacteria. Nitrogen fixation control in H. seropedicae, of the beta-subgroup of Proteobacteria, has regulatory features in common with Klebsiella pneumoniae, of the gamma-subgroup, at the level of nifA expression and with rhizobia and Azospirillum brasilense, of the alpha-subgroup, at the level of control of NifA by oxygen.

Nitrogen recycling from fuel-extracted algal biomass: residuals as the sole nitrogen source for culturing Scenedesmus acutus.

Science.gov (United States)

Gu, Huiya; Nagle, Nick; Pienkos, Philip T; Posewitz, Matthew C

2015-05-01

In this study, the reuse of nitrogen from fuel-extracted algal residues was investigated. The alga Scenedesmus acutus was found to be able to assimilate nitrogen contained in amino acids, yeast extracts, and proteinaceous alga residuals. Moreover, these alternative nitrogen resources could replace nitrate in culturing media. The ability of S. acutus to utilize the nitrogen remaining in processed algal biomass was unique among the promising biofuel strains tested. This alga was leveraged in a recycling approach where nitrogen is recovered from algal biomass residuals that remain after lipids are extracted and carbohydrates are fermented to ethanol. The protein-rich residuals not only provided an effective nitrogen resource, but also contributed to a carbon "heterotrophic boost" in subsequent culturing, improving overall biomass and lipid yields relative to the control medium with only nitrate. Prior treatment of the algal residues with Diaion HP20 resin was required to remove compounds inhibitory to algal growth. Copyright © 2014 Elsevier Ltd. All rights reserved.

Nutritional geometry: gorillas prioritize non-protein energy while consuming surplus protein.

Science.gov (United States)

Rothman, Jessica M; Raubenheimer, David; Chapman, Colin A

2011-12-23

It is widely assumed that terrestrial food webs are built on a nitrogen-limited base and consequently herbivores must compensate through selection of high-protein foods and efficient nitrogen retention. Like many folivorous primates, gorillas' diet selection supports this assumption, as they apparently prefer protein-rich foods. Our study of mountain gorillas (Gorilla beringei) in Uganda revealed that, in some periods, carbohydrate-rich fruits displace a large portion of protein-rich leaves in their diet. We show that non-protein energy (NPE) intake was invariant throughout the year, whereas protein intake was substantially higher when leaves were the major portion of the diet. This pattern of macronutrient intake suggests that gorillas prioritize NPE and, to achieve this when leaves are the major dietary item, they over-eat protein. The concentrations of protein consumed in relation to energy when leaves were the major portion of the diet were close to the maximum recommended for humans and similar to high-protein human weight-loss diets. By contrast, the concentrations of protein in relation to energy when gorillas ate fruit-dominated diets were similar to those recommended for humans. Our results question the generality of nitrogen limitation in terrestrial herbivores and provide a fascinating contrast with human macronutrient intake.

Nutritional geometry: gorillas prioritize non-protein energy while consuming surplus protein

Science.gov (United States)

Rothman, Jessica M.; Raubenheimer, David; Chapman, Colin A.

2011-01-01

It is widely assumed that terrestrial food webs are built on a nitrogen-limited base and consequently herbivores must compensate through selection of high-protein foods and efficient nitrogen retention. Like many folivorous primates, gorillas' diet selection supports this assumption, as they apparently prefer protein-rich foods. Our study of mountain gorillas (Gorilla beringei) in Uganda revealed that, in some periods, carbohydrate-rich fruits displace a large portion of protein-rich leaves in their diet. We show that non-protein energy (NPE) intake was invariant throughout the year, whereas protein intake was substantially higher when leaves were the major portion of the diet. This pattern of macronutrient intake suggests that gorillas prioritize NPE and, to achieve this when leaves are the major dietary item, they over-eat protein. The concentrations of protein consumed in relation to energy when leaves were the major portion of the diet were close to the maximum recommended for humans and similar to high-protein human weight-loss diets. By contrast, the concentrations of protein in relation to energy when gorillas ate fruit-dominated diets were similar to those recommended for humans. Our results question the generality of nitrogen limitation in terrestrial herbivores and provide a fascinating contrast with human macronutrient intake. PMID:21632622

Cyanobacteria in CELSS: Growth strategies for nutritional variation and nitrogen cycling

Science.gov (United States)

Fry, I. V.; Packer, L.

1990-01-01

Cyanobacteria (blue-green algae) are versatile organisms which are capable of adjusting their cellular levels of carbohydrate, protein, and lipid in response to changes in the environment. Under stress conditions there is an imbalance between nitrogen metabolism and carbohydrate/lipid synthesis. The lesion in nitrogen assimilation is at the level of transport: the stress condition diverts energy from the active accumulation of nitrate to the extrusion of salt, and probably inhibits a cold-labile ATP'ace in the case of cold shock. Both situations affect the bioenergetic status of the cell such that the nitrogenous precursors for protein synthesis are depleted. Dispite the inhibition of protein synthesis and growth, photosynthetic reductant generation is relatively unaffected. The high O2 reductant would normally lead to photo-oxidative damage of cellular components; however, the organism copes by channeling the 'excess' reductant into carbon storage products. The increase in glycogen (28 to 35 percent dry weight increase) and the elongation of lipid fatty acid side chains (2 to 5 percent dry weight increase) at the expense of protein synthesis (25 to 34 percent dry weight decrease) results in carbohydrate, lipid and protein ratios that are closer to those required in the human diet. In addition, the selection of nitrogen fixing mutants which excrete ammonium ions present an opportunity to tailor these micro-organisms to meet the specific need for a sub-system to reverse potential loss of fixed nitrogen material.

Evaluation of the Impact of Alveolar Nitrogen Excretion on Indices Derived from Multiple Breath Nitrogen Washout

Science.gov (United States)

Nielsen, Niklas; Nielsen, Jorgen G.; Horsley, Alex R.

2013-01-01

Background A large body of evidence has now accumulated describing the advantages of multiple breath washout tests over conventional spirometry in cystic fibrosis (CF). Although the majority of studies have used exogenous sulphur hexafluoride (SF6) as the tracer gas this has also led to an increased interest in nitrogen washout tests, despite the differences between these methods. The impact of body nitrogen excreted across the alveoli has previously been ignored. Methods A two-compartment lung model was developed that included ventilation heterogeneity and dead space (DS) effects, but also incorporated experimental data on nitrogen excretion. The model was used to assess the impact of nitrogen excretion on washout progress and accuracy of functional residual capacity (FRC) and lung clearance index (LCI) measurements. Results Excreted nitrogen had a small effect on accuracy of FRC (1.8%) in the healthy adult model. The error in LCI calculated with true FRC was greater (6.3%), and excreted nitrogen contributed 21% of the total nitrogen concentration at the end of the washout. Increasing DS and ventilation heterogeneity both caused further increase in measurement error. LCI was increased by 6–13% in a CF child model, and excreted nitrogen increased the end of washout nitrogen concentration by 24–49%. Conclusions Excreted nitrogen appears to have complex but clinically significant effects on washout progress, particularly in the presence of abnormal gas mixing. This may explain much of the previously described differences in washout outcomes between SF6 and nitrogen. PMID:24039916

Autophagy supports biomass production and nitrogen use efficiency at the vegetative stage in rice.

Science.gov (United States)

Wada, Shinya; Hayashida, Yasukzu; Izumi, Masanori; Kurusu, Takamitsu; Hanamata, Shigeru; Kanno, Keiichi; Kojima, Soichi; Yamaya, Tomoyuki; Kuchitsu, Kazuyuki; Makino, Amane; Ishida, Hiroyuki

2015-05-01

Much of the nitrogen in leaves is distributed to chloroplasts, mainly in photosynthetic proteins. During leaf senescence, chloroplastic proteins, including Rubisco, are rapidly degraded, and the released nitrogen is remobilized and reused in newly developing tissues. Autophagy facilitates the degradation of intracellular components for nutrient recycling in all eukaryotes, and recent studies have revealed critical roles for autophagy in Rubisco degradation and nitrogen remobilization into seeds in Arabidopsis (Arabidopsis thaliana). Here, we examined the function of autophagy in vegetative growth and nitrogen usage in a cereal plant, rice (Oryza sativa). An autophagy-disrupted rice mutant, Osatg7-1, showed reduced biomass production and nitrogen use efficiency compared with the wild type. While Osatg7-1 showed early visible leaf senescence, the nitrogen concentration remained high in the senescent leaves. (15)N pulse chase analysis revealed suppression of nitrogen remobilization during leaf senescence in Osatg7-1. Accordingly, the reduction of nitrogen available for newly developing tissues in Osatg7-1 likely led its reduced leaf area and tillers. The limited leaf growth in Osatg7-1 decreased the photosynthetic capacity of the plant. Much of the nitrogen remaining in senescent leaves of Osatg7-1 was in soluble proteins, and the Rubisco concentration in senescing leaves of Osatg7-1 was about 2.5 times higher than in the wild type. Transmission electron micrographs showed a cytosolic fraction rich with organelles in senescent leaves of Osatg7-1. Our results suggest that autophagy contributes to efficient nitrogen remobilization at the whole-plant level by facilitating protein degradation for nitrogen recycling in senescent leaves. © 2015 American Society of Plant Biologists. All Rights Reserved.

Effects of Mg on C and N Metabolism of Soybean at Different Nitrogen Supplying Levels

Institute of Scientific and Technical Information of China (English)

LANG Man; LIU Yuanying; PENG Xianlong; ZHANG Wenzhao

2006-01-01

A pot experiment was conducted to study the effects of magnesium on carbon and nitrogen metabolism of soybean at different nitrogen supplying levels. The results showed that the effects of magnesium at low nitrogen rate on N content, soluble protein, soluble sugar contents were not alike at different growth stage, although nodule dry weights raised, the yield and protein content of seeds decreased, however, the oil content was improved.The application of magnesium at medium and high nitrogen supplying levels promoted the uptake of N effectively,increased the soluble protein and soluble sugar contents, but the nodule dry weights of application magnesium at medium nitrogen supplying level decreased and the yield increased only a little despite the improved quality.Application of magnesium at high nitrogen supplying level raised nodule dry weights and soybean yield significantly, the quality of seeds was also improved.

Tissue protein metabolism in parasitized animals

International Nuclear Information System (INIS)

Symons, L.E.A.; Steel, J.W.; Jones, W.O.

1981-01-01

The effects of gastrointestinal nematode infection of mammals, particularly of the small intestine of the sheep, on protein metabolism of skeletal muscle, liver, the gastrointestinal tract and wool are described. These changes have been integrated to explain poor growth and production in the sheep heavily infected with Trichostrongylus colubriformis. The rates of both synthesis and catabolism of muscle protein are depressed, but nitrogen is lost from this tissue because the depression of synthesis exceeds that of catabolism. Anorexia is the major cause of these changes. Although the effect on liver protein synthesis is unclear, it is probable that the leakage of plasma proteins into the gastrointestinal tract stimulates an early increase in the rate of synthesis of these proteins, but this eventually declines and is insufficient to correct developing hypoalbuminaemia. Changes in the intestinal tract are complex. Exogenous nitrogen is reduced by anorexia, but the flow of nitrogen through the tract from abomasum to faeces is above normal because of the increase of endogenous protein from leakage of plasma protein and, presumably, from exfoliated epithelial cells. There is evidence that protein metabolism of intestinal tissue, particularly in the uninfected distal two-thirds, is increased. Synthesis of wool protein is decreased. As the result of anorexia, intestinal loss of endogenous protein and an increased rate of intestinal protein metabolism there is a net movement of amino nitrogen from muscle, liver and possibly skin to the intestine of the heavily infected sheep. Thus, the availability of amino nitrogen for growth and wool production is reduced. (author)

Whole-body nitrogen and tyrosine metabolism in surgical patients receiving branched-chain amino acid solutions

International Nuclear Information System (INIS)

Desai, S.P.; Bistrian, B.R.; Moldawer, L.L.; Blackburn, G.L.

1985-01-01

Fifteen patients undergoing gastric bypass surgery for morbid obesity received preoperatively a standard crystalline amino acid solution containing 15.6% branched-chain amino acids. During the first five postoperative days, the patients were randomized to receive one of three amino acid solutions of different branched-chain amino acid content. Whole-body amino acid appearance and oxidation were estimated using a continuous intravenous infusion of L-(U- 14 C)-tyrosine preoperatively and on the third postoperative day. This study suggests that an adequate nitrogen intake of a balanced amino acid mixture, as well as a solution enriched with branched-chain amino acids, maintains protein homeostasis and supports protein synthesis similarly in well-nourished patients following major abdominal surgery. A diet containing only branched-chain amino acids in isomolar ratios was as effective at maintaining protein retention and whole-body protein synthesis and albumin renewal postoperatively when compared with a standard amino acid formula

Protein leverage effects of beef protein on energy intake in humans.

Science.gov (United States)

Martens, Eveline A; Tan, Sze-Yen; Dunlop, Mandy V; Mattes, Richard D; Westerterp-Plantenga, Margriet S

2014-06-01

The protein leverage hypothesis requires specific evidence that protein intake is regulated more strongly than energy intake. The objective was to determine ad libitum energy intake, body weight changes, appetite profile, and nitrogen balance in response to 3 diets with different protein-to-carbohydrate + fat ratios over 12 consecutive days, with beef as a source of protein. A 3-arm, 12-d randomized crossover study was performed in 30 men and 28 women [mean ± SD age: 33 ± 16 y; body mass index (in kg/m²): 24.4 ± 4.0] with the use of diets containing 5%, 15%, and 30% of energy (En%) from protein, predominantly from beef. Energy intake was significantly lower in the 30En%-protein condition (8.73 ± 1.93 MJ/d) than in the 5En%-protein (9.48 ± 1.67 MJ/d) and 15En%-protein (9.30 ± 1.62 MJ/d) conditions (P = 0.001), stemming largely from lower energy intake during meals (P = 0.001). Hunger (P = 0.001) and desire to eat (P = 0.001) ratings were higher and fullness ratings were lower (P = 0.001) in the 5En%-protein condition than in the 15En%-protein and 30En%-protein conditions. Nitrogen excretion was lower in the 5En%-protein condition (4.7 ± 1.5 g/24 h; P = 0.001) and was higher in the 30En%-protein condition (15.3 ± 8.7 g/24 h; P = 0.001) compared with the 15En%-protein condition (10.0 ± 5.2 g/24 h). Nitrogen balance was maintained in the 5En%-protein condition and was positive in the 15En%- and 30En%-protein conditions (P = 0.001). Complete protein leverage did not occur because subjects did not consume to a common protein amount at the expense of energy balance. Individuals did underconsume relative to energy requirements from high-protein diets. The lack of support for protein leverage effects on a low-protein diet may stem from the fact that protein intake was sufficient to maintain nitrogen balance over the 12-d trial. © 2014 American Society for Nutrition.

Phenylbutyrate improves nitrogen disposal via alternative pathway without eliciting an increase in protein breakdown and catabolism in control and ornithine transcarbamylace-deficient patients

Science.gov (United States)

Phenylbutyrate (PB) is a drug used in urea cycle disorder patients to elicit alternative pathways for nitrogen disposal. However, PB decreases plasma branched chain amino acid (BCAA) concentrations and prior research suggests that PB may increase leucine oxidation, indicating increased protein degra...

Over-expression of a tobacco nitrate reductase gene in wheat (Triticum aestivum L.) increases seed protein content and weight without augmenting nitrogen supplying.

Science.gov (United States)

Zhao, Xiao-Qiang; Nie, Xuan-Li; Xiao, Xing-Guo

2013-01-01

Heavy nitrogen (N) application to gain higher yield of wheat (Triticum aestivum L.) resulted in increased production cost and environment pollution. How to diminish the N supply without losing yield and/or quality remains a challenge. To meet the challenge, we integrated and expressed a tobacco nitrate reductase gene (NR) in transgenic wheat. The 35S-NR gene was transferred into two winter cultivars, "Nongda146" and "Jimai6358", by Agrobacterium-mediation. Over-expression of the transgene remarkably enhanced T1 foliar NR activity and significantly augmented T2 seed protein content and 1000-grain weight in 63.8% and 68.1% of T1 offspring (total 67 individuals analyzed), respectively. Our results suggest that constitutive expression of foreign nitrate reductase gene(s) in wheat might improve nitrogen use efficiency and thus make it possible to increase seed protein content and weight without augmenting N supplying.

Over-expression of a tobacco nitrate reductase gene in wheat (Triticum aestivum L. increases seed protein content and weight without augmenting nitrogen supplying.

Directory of Open Access Journals (Sweden)

Xiao-Qiang Zhao

Full Text Available Heavy nitrogen (N application to gain higher yield of wheat (Triticum aestivum L. resulted in increased production cost and environment pollution. How to diminish the N supply without losing yield and/or quality remains a challenge. To meet the challenge, we integrated and expressed a tobacco nitrate reductase gene (NR in transgenic wheat. The 35S-NR gene was transferred into two winter cultivars, "Nongda146" and "Jimai6358", by Agrobacterium-mediation. Over-expression of the transgene remarkably enhanced T1 foliar NR activity and significantly augmented T2 seed protein content and 1000-grain weight in 63.8% and 68.1% of T1 offspring (total 67 individuals analyzed, respectively. Our results suggest that constitutive expression of foreign nitrate reductase gene(s in wheat might improve nitrogen use efficiency and thus make it possible to increase seed protein content and weight without augmenting N supplying.

PLASMA PROTEIN AND HEMOGLOBIN PRODUCTION

Science.gov (United States)

Robscheit-Robbins, F. S.; Miller, L. L.; Whipple, G. H.

1947-01-01

Given healthy dogs fed abundant iron and protein-free or low protein diets with sustained anemia and hypoproteinemia, we can study the capacity of these animals to produce simultaneously new hemoglobin and plasma protein. Reserve stores of blood protein-building materials are measurably depleted and levels of 6 to 8 gm. per cent for hemoglobin and 4 to 5 gm. per cent for plasma protein can be maintained for weeks or months depending upon the intake of food proteins or amino acid mixtures. These dogs are very susceptible to infection and various poisons. Dogs tire of these diets and loss of appetite terminates many experiments. Under these conditions (double depletion) standard growth mixtures of essential amino acids are tested to show the response in blood protein output and urinary nitrogen balance. As a part of each tabulated experiment one of the essential amino acids is deleted from the complete growth mixture to compare such response with that of the whole mixture. Methionine, threonine, phenylalanine, and tryptophane when singly eliminated from the complete amino acid mixture do effect a sharp rise in urinary nitrogen. This loss of urinary nitrogen is corrected when the individual amino acid is replaced in the mixture. Histidine, lysine, and valine have a moderate influence upon urinary nitrogen balance toward nitrogen conservation. Leucine, isoleucine, and arginine have minimal or no effect upon urinary nitrogen balance when these individual amino acids are deleted from the complete growth mixture of amino acids during 3 to 4 week periods. Tryptophane and to a less extent phenylalanine and threonine when returned to the amino acid mixture are associated with a conspicuous preponderance of plasma protein output over the hemoglobin output (Table 4). Arginine, lysine, and histidine when returned to the amino acid mixture are associated with a large preponderance of hemoglobin output. Various amino acid mixtures under these conditions may give a positive

Nitrogen metabolism in the tissues of the ruminant

International Nuclear Information System (INIS)

Buttery, P.J.

1986-01-01

Protein metabolism in animals is in a constant state of flux, the processes of protein synthesis and protein breakdown acting against each other, and the balance between the two processes causing changes in the mass of protein in a tissue. Reduction in the diet reduces both protein synthesis and protein degradation unless the dietary depletion is severe and prolonged, when there is a marked increase in protein catabolism. The synthesis and degradation of protein can be manipulated by anabolic agents, thus increasing the efficiency of animals. While the use of these agents has met with success in many countries, it remains to be seen whether they will be useful in harsh environments. Lactation and pregnancy put an extra demand on the nitrogen economy of animals. Evidence indicates that the extra amino acids needed for milk production do not come from muscle protein breakdown. Many animals in harsh environments are infected with parasites; intestinal parasites reduce food intake and cause blood loss into the intestines. Associated with this is a general disruption of protein metabolism. In all these studies, isotopic techniques have played a vital role. Few studies have been conducted on nitrogen metabolism in the tissue of ruminants exposed to harsh environments (with one notable exception: rumen function studies, some of which are described elsewhere in the Proceedings of this Seminar). This lack of work on nitrogen metabolism of animals from the harsher environments has often made it necessary to extrapolate data obtained from animals found and maintained in the temperate zones to quite different environments and to animals maintained on quite different dietary regimens. Several examples of the use of isotopes in metabolic studies with animals to yield information of direct or potential relevance to the harsh environments are presented. (author)

Dry land Winter Wheat Yield, Grain Protein, and Soil Nitrogen Responses to Fertilizer and Bio solids Applications

International Nuclear Information System (INIS)

Koenig, R.T.; Cogger, C.G.; Bary, A.I.

2011-01-01

Applications of bio solids were compared to inorganic nitrogen (N) fertilizer for two years at three locations in eastern Washington State, USA, with diverse rainfall and soft white, hard red, and hard white winter wheat (Triticum aestivum L.) cultivars. High rates of inorganic N tended to reduce yields, while grain protein responses to N rate were positive and linear for all wheat market classes. Bio solids produced 0 to 1400 kg ha -1 (0 to 47%) higher grain yields than inorganic N. Wheat may have responded positively to nutrients other than N in the bio solids or to a metered N supply that limited vegetative growth and the potential for moisture stress-induced reductions in grain yield in these dry land production systems. Grain protein content with bio solids was either equal to or below grain protein with inorganic N, likely due to dilution of grain N from the higher yields achieved with bio solids. Results indicate the potential to improve dry land winter wheat yields with bio solids compared to inorganic N alone, but perhaps not to increase grain protein concentration of hard wheat when bio solids are applied immediately before planting.

Estimation of daily protein intake based on spot urine urea nitrogen concentration in chronic kidney disease patients.

Science.gov (United States)

Kanno, Hiroko; Kanda, Eiichiro; Sato, Asako; Sakamoto, Kaori; Kanno, Yoshihiko

2016-04-01

Determination of daily protein intake in the management of chronic kidney disease (CKD) requires precision. Inaccuracies in recording dietary intake occur, and estimation from total urea excretion presents hurdles owing to the difficulty of collecting whole urine for 24 h. Spot urine has been used for measuring daily sodium intake and urinary protein excretion. In this cross-sectional study, we investigated whether urea nitrogen (UN) concentration in spot urine can be used to predict daily protein intake instead of the 24-h urine collection in 193 Japanese CKD patients (Stages G1-G5). After patient randomization into 2 datasets for the development and validation of models, bootstrapping was used to develop protein intake estimation models. The parameters for the candidate multivariate regression models were male gender, age, body mass index (BMI), diabetes mellitus, dyslipidemia, proteinuria, estimated glomerular filtration rate, serum albumin level, spot urinary UN and creatinine level, and spot urinary UN/creatinine levels. The final model contained BMI and spot urinary UN level. The final model was selected because of the higher correlation between the predicted and measured protein intakes r = 0.558 (95 % confidence interval 0.400, 0.683), and the smaller distribution of the difference between the measured and predicted protein intakes than those of the other models. The results suggest that UN concentration in spot urine may be used to estimate daily protein intake and that a prediction formula would be useful for nutritional control in CKD patients.

Effect of gamma radiation on the nitrogen metabolism of Paecilomyces Violacea

International Nuclear Information System (INIS)

Salama, A.H.; Nadia, M.; Elzawahry, Y.A.; Abo Elkhair, I.A.

1989-01-01

Quantitative variabilities could be noticed in the nitrogen utilization and mycelial content of mats arising from gamma irradiated and non-irradiated Inocula of P.Violacea. The two lowest doses, 0.1 and 0.25 KGy, showed an increase in nitrate uptake and nitrogen utilization more than control by 7.43 and 15.61% for nitrate uptake and 8.33 and 14.89 for nitrogen utilization respectively, while the higher doses (0.5 up to 3.0 KGy) were inhibitory to the above parameters and also to protein synthesis. The chemical changes in the composition of fungal mats reveal that the peptide-N was the highest in amount as compared with the other nitrogen fractions. The protein-N was second in rank of quantity followed by the amino-N, while the nitrate-N was the least in amount compared to other nitrogen fractions at all radiation treatments

Phosphoproteome of the cyanobacterium Synechocystis sp. PCC 6803 and its dynamics during nitrogen starvation.

Directory of Open Access Journals (Sweden)

Philipp eSpät

2015-03-01

Full Text Available Cyanobacteria have shaped the earth’s biosphere as the first oxygenic photoautotrophs and still play an important role in many ecosystems. The ability to adapt to changing environmental conditions is an essential characteristic in order to ensure survival. To this end, numerous studies have shown that bacteria use protein post-translational modifications such as Ser/Thr/Tyr phosphorylation in cell signalling, adaptation and regulation. Nevertheless, our knowledge of cyanobacterial phosphoproteomes and their dynamic response to environmental stimuli is relatively limited. In this study, we applied gel-free methods and high accuracy mass spectrometry towards the unbiased detection of Ser/Thr/Tyr phosphorylation events in the model cyanobacterium Synechocystis sp. PCC 6803. We could identify over 300 phosphorylation events in cultures grown on nitrate as exclusive nitrogen source. Chemical dimethylation labelling was applied to investigate proteome and phosphoproteome dynamics during nitrogen starvation. Our dataset describes the most comprehensive (phosphoproteome of Synechocystis to date, identifying 2,382 proteins and 183 phosphorylation events and quantifying 2,111 proteins and 148 phosphorylation events during nitrogen starvation. Global protein phosphorylation levels were increased in response to nitrogen depletion after 24 hours. Among the proteins with increased phosphorylation, the PII signalling protein showed the highest fold-change, serving as positive control. Other proteins with increased phosphorylation levels comprised functions in photosynthesis and in carbon and nitrogen metabolism. This study reveals dynamics of Synechocystis phosphoproteome in response to environmental stimuli and suggests an important role of protein Ser/Thr/Tyr phosphorylation in fundamental mechanisms of homeostatic control in cyanobacteria.

Distribution of nitrogen fixation and nitrogenase-like sequences amongst microbial genomes

Science.gov (United States)

2012-01-01

Background The metabolic capacity for nitrogen fixation is known to be present in several prokaryotic species scattered across taxonomic groups. Experimental detection of nitrogen fixation in microbes requires species-specific conditions, making it difficult to obtain a comprehensive census of this trait. The recent and rapid increase in the availability of microbial genome sequences affords novel opportunities to re-examine the occurrence and distribution of nitrogen fixation genes. The current practice for computational prediction of nitrogen fixation is to use the presence of the nifH and/or nifD genes. Results Based on a careful comparison of the repertoire of nitrogen fixation genes in known diazotroph species we propose a new criterion for computational prediction of nitrogen fixation: the presence of a minimum set of six genes coding for structural and biosynthetic components, namely NifHDK and NifENB. Using this criterion, we conducted a comprehensive search in fully sequenced genomes and identified 149 diazotrophic species, including 82 known diazotrophs and 67 species not known to fix nitrogen. The taxonomic distribution of nitrogen fixation in Archaea was limited to the Euryarchaeota phylum; within the Bacteria domain we predict that nitrogen fixation occurs in 13 different phyla. Of these, seven phyla had not hitherto been known to contain species capable of nitrogen fixation. Our analyses also identified protein sequences that are similar to nitrogenase in organisms that do not meet the minimum-gene-set criteria. The existence of nitrogenase-like proteins lacking conserved co-factor ligands in both diazotrophs and non-diazotrophs suggests their potential for performing other, as yet unidentified, metabolic functions. Conclusions Our predictions expand the known phylogenetic diversity of nitrogen fixation, and suggest that this trait may be much more common in nature than it is currently thought. The diverse phylogenetic distribution of nitrogenase

Distribution of nitrogen fixation and nitrogenase-like sequences amongst microbial genomes

Directory of Open Access Journals (Sweden)

Dos Santos Patricia C

2012-05-01

Full Text Available Abstract Background The metabolic capacity for nitrogen fixation is known to be present in several prokaryotic species scattered across taxonomic groups. Experimental detection of nitrogen fixation in microbes requires species-specific conditions, making it difficult to obtain a comprehensive census of this trait. The recent and rapid increase in the availability of microbial genome sequences affords novel opportunities to re-examine the occurrence and distribution of nitrogen fixation genes. The current practice for computational prediction of nitrogen fixation is to use the presence of the nifH and/or nifD genes. Results Based on a careful comparison of the repertoire of nitrogen fixation genes in known diazotroph species we propose a new criterion for computational prediction of nitrogen fixation: the presence of a minimum set of six genes coding for structural and biosynthetic components, namely NifHDK and NifENB. Using this criterion, we conducted a comprehensive search in fully sequenced genomes and identified 149 diazotrophic species, including 82 known diazotrophs and 67 species not known to fix nitrogen. The taxonomic distribution of nitrogen fixation in Archaea was limited to the Euryarchaeota phylum; within the Bacteria domain we predict that nitrogen fixation occurs in 13 different phyla. Of these, seven phyla had not hitherto been known to contain species capable of nitrogen fixation. Our analyses also identified protein sequences that are similar to nitrogenase in organisms that do not meet the minimum-gene-set criteria. The existence of nitrogenase-like proteins lacking conserved co-factor ligands in both diazotrophs and non-diazotrophs suggests their potential for performing other, as yet unidentified, metabolic functions. Conclusions Our predictions expand the known phylogenetic diversity of nitrogen fixation, and suggest that this trait may be much more common in nature than it is currently thought. The diverse phylogenetic

Effect of Nitrogen and Phosphorus on Yield and Yield Components of Sesame (Sesamumindicum L.)

OpenAIRE

Muhammad Ibrahim; Manzoor Hussain; Ahmad Khan; Yousaf Jamal; Muhammad Ali; Muhammad Faisal Anwar Malik

2014-01-01

Nitrogen is a structural component of chlorophyll and protein therefore adequate supply of nitrogen is beneficial for both carbohydrates and protein metabolism as it promotes cell division and cell enlargement, resulting in more leaf area and thus ensuring good seed and dry matter yield. Theexperiment entitled effect of nitrogen and phosphorus on yield and yield components of sesame were conducted at New Developmental Farm of the University of Agriculture Peshawar during kharif 2013. Randomiz...

Respiration and nitrogen assimilation: targeting mitochondria-associated metabolism as a means to enhance nitrogen use efficiency.

Science.gov (United States)

Foyer, Christine H; Noctor, Graham; Hodges, Michael

2011-02-01

Considerable advances in our understanding of the control of mitochondrial metabolism and its interactions with nitrogen metabolism and associated carbon/nitrogen interactions have occurred in recent years, particularly highlighting important roles in cellular redox homeostasis. The tricarboxylic acid (TCA) cycle is a central metabolic hub for the interacting pathways of respiration, nitrogen assimilation, and photorespiration, with components that show considerable flexibility in relation to adaptations to the different functions of mitochondria in photosynthetic and non-photosynthetic cells. By comparison, the operation of the oxidative pentose phosphate pathway appears to represent a significant limitation to nitrogen assimilation in non-photosynthetic tissues. Valuable new insights have been gained concerning the roles of the different enzymes involved in the production of 2-oxoglutarate (2-OG) for ammonia assimilation, yielding an improved understanding of the crucial role of cellular energy balance as a broker of co-ordinate regulation. Taken together with new information on the mechanisms that co-ordinate the expression of genes involved in organellar functions, including energy metabolism, and the potential for exploiting the existing flexibility for NAD(P)H utilization in the respiratory electron transport chain to drive nitrogen assimilation, the evidence that mitochondrial metabolism and machinery are potential novel targets for the enhancement of nitrogen use efficiency (NUE) is explored.

Resistance training reduces whole-body protein turnover and improves net protein retention in untrained young males.

Science.gov (United States)

Hartman, Joseph W; Moore, Daniel R; Phillips, Stuart M

2006-10-01

It is thought that resistance exercise results in an increased need for dietary protein; however, data also exists to support the opposite conclusion. The purpose of this study was to determine the impact of resistance exercise training on protein metabolism in novices with the hypothesis that resistance training would reduce protein turnover and improve whole-body protein retention. Healthy males (n = 8, 22 +/- 1 y, BMI = 25.3 +/- 1.8 kg.m(-2)) participated in a progressive whole-body split routine resistance-training program 5d/week for 12 weeks. Before (PRE) and after (POST) the training, oral [15N]-glycine ingestion was used to assess nitrogen flux (Q), protein synthesis (PS), protein breakdown (PB), and net protein balance (NPB = PS-PB). Macronutrient intake was controlled over a 5d period PRE and POST, while estimates of protein turnover and urinary nitrogen balance (N(bal) = N(in) - urine N(out)) were conducted. Bench press and leg press increased 40% and 50%, respectively (p training-induced increases in both NPB (PRE = 0.22 +/- 0.13 g.kg(-1).d(-1); POST = 0.54 +/- 0.08 g.kg(-1).d(-1)) and urinary nitrogen balance (PRE = 2.8 +/- 1.7 g N.d(-1); POST = 6.5 +/- 0.9 g N.d(-1)) were observed. A program of resistance training that induced significant muscle hypertrophy resulted in reductions of both whole-body PS and PB, but an improved NPB, which favoured the accretion of skeletal muscle protein. Urinary nitrogen balance increased after training. The reduction in PS and PB and a higher NPB in combination with an increased nitrogen balance after training suggest that dietary requirements for protein in novice resistance-trained athletes are not higher, but lower, after resistance training.

Nitrogen metabolism and protozoa production rate in cattle fed on diet containing protected protein

International Nuclear Information System (INIS)

Singh, G.P.; Gupta, B.N.

1992-01-01

Nitrogen metabolism and protozoa production rate using 14 C-choline as marker were studied on 9 adult male crossbred (Tharparker x Brown Swiss) rumen fistulated animals divided into 3 groups (A, B and C). All the animals were fed concentrate mixture and wheatstraw. However, groundnut cake (GNC) in concentrate mixture was untreated in group A, 50 per cent formaldehyde treated in group B and 100 per cent formaldehyde treated in group C. Although, DM intake was similar in these groups but water intake was significantly (P<0.05) higher in control group. Total-N, ammonia-N and blood urea were significantly lower in group B and C as compared to group A. Apparent CP digestibility was not affected by addition of formaldehyde treated GNC at 50 and 100 per cent levels. However, N balances increased significantly (P<0.05) due to addition of protected protein in diet. Protozoal pool as well as production rate were significantly (P<0.01) decreased due to formaldehyde treatment of GNC protein. Thus addition of formaldehyde treated GNC in diets decreased ammonia and protozoa production but increased N retention in groups B and C. (author). 27 refs., 3 tabs., 2 figs

Production of fungal biomass protein using microfungi from winery wastewater treatment.

Science.gov (United States)

Zhang, Zhan Ying; Jin, Bo; Bai, Zhi Hui; Wang, Xiao Yi

2008-06-01

This study was carried out to investigate the production of fungal biomass protein (FBP) in treatment of winery wastewater using microfungi. Three fungal strains, Trichoderma viride WEBL0702, Aspergillus niger WEBL0901 and Aspergillus oryzae WEBL0401, were selected in terms of microbial capability for FBP production and COD reduction. T. viride appeared to be the best strain for FBP production due to high productivity and less nitrogen requirement. More than 5 g/L of fungal biomass was produced in shake fermentation using T. viride without nitrogen addition, and by A. oryzae and A. niger with addition of 0.5-1.0 g/L (NH4)2SO4. The FBP production process corresponded to 84-90% COD reduction of winery wastewater. Fungal biomass contained approximately 36% protein produced by two Aspergillus strains, while biomass produced by T. viride consisted of 19.8% protein. Kinetic study indicated that maximum fungal cell growth could be achieved in 24h for T. viride and 48 h for A. oryzae and A. niger. Current results indicated that it could be feasible to develop a biotechnological treatment process integrated with FBP production from the winery waste streams.

Investigation of the connection between the quality of protein, protein level and endogenous N excretion

International Nuclear Information System (INIS)

Koehler, R.; Gebhardt, G.

1979-01-01

The influence of various protein qualities as well as of different levels of protein on the amount of endogenous N excretion, metabolic fecal nitrogen (MFN) and endogenous urinary N (EUN) was determined in growing albino rats. The test rations were labelled with admixtures of 15 N-DL-methionine and 15 N-DL-lysine, respectively, or contained feed protein enriched with 15 N. EUN and MFN and their sum (the N maintenance requirement) showed the influence of the respective protein source and its dependence on the protein level. The endogenous N excretions showed an opposite tendency to the N balance; for high-quality protein feedstuffs with a high N balance (e.g. dried eggs) they are lower than for protein sources of inferior quality, with a low N-balance only (e.g. wheat gluten). Presumably this interaction of retention and maintenance is due to the complementary effect of exogenous and endogenous amino acids in the N and amino acid pool, respectively. Provided that the N dose and the live weight of the animals are comparable, the N balance appears to be more suitable as parameter for the description of the protein quality and the calculation of the protein utilisation than N retention, as the sum of N balance and the values of MFN and EUN (depending on the feedstuffs and the N level). (author)

Enhanced cytocompatibility of silver-containing biointerface by constructing nitrogen functionalities

Energy Technology Data Exchange (ETDEWEB)

Zhang, Wei, E-mail: weizhang@mail.ipc.ac.cn [Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Liu, Jun [Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Wang, Huaiyu [Department of Physics & Materials Science, City University of Hong Kong, Tat Chee Avenue, Kowloon, Hong Kong (China); Xu, Ying; Wang, Pingli [Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Ji, Junhui, E-mail: jhji@mail.ipc.ac.cn [Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Chu, Paul K. [Department of Physics & Materials Science, City University of Hong Kong, Tat Chee Avenue, Kowloon, Hong Kong (China)

2015-09-15

Graphical abstract: Constructing nitrogen functionalities is promising method to enhance cytocompatibility of the biointerface by simultaneous Ag and N{sub 2} plasma modification. - Highlights: • N{sub 2} plasma immersion ion implantation (PIII) treatment generates plenty of nitrogen functionalities on polymer substrate. • N{sub 2} PIII treatment increases surface roughness and hydrophilicity and improves its capability to adsorb protein. • Simultaneous Ag and N{sub 2} plasma modification constructs nitrogen functionalities to enhance cytocompatibility of the biointerface. - Abstract: Silver (Ag) has recently been introduced into polymeric biomedical implants by plasma immersion ion implantation (PIII) to enhance the antibacterial capability. However, Ag ions and nanoparticles can increase the cytotoxicity and inhibit cellular proliferation and the relationship is time- and dose-dependent. In this study, Ag and N{sub 2} PIII is conducted in concert to produce nitrogen functional groups as well as Ag-containing biointerface. In addition to the creation of nitrogen functionalities, the surface roughness and hydrophilicity are improved in favor of protein adsorption. Compared to the biointerface created by Ag PIII only, the nitrogen functionalities generated by N{sub 2} co-PIII do not affect DNA synthesis and the total protein level but evidently enhance cellular adhesion, viability, and proliferation at the biointerface. The modified surface is observed to upregulate the osteogenesis-related marker expression of bone cells in contact. Our findings suggest that dual Ag and N{sub 2} PIII is a desirable technique to enhance both the cytocompatibility and antibacterial capability of medical polymers.

Autophagy Supports Biomass Production and Nitrogen Use Efficiency at the Vegetative Stage in Rice1[OPEN

Science.gov (United States)

Hayashida, Yasukazu; Kurusu, Takamitsu; Kojima, Soichi; Makino, Amane

2015-01-01

Much of the nitrogen in leaves is distributed to chloroplasts, mainly in photosynthetic proteins. During leaf senescence, chloroplastic proteins, including Rubisco, are rapidly degraded, and the released nitrogen is remobilized and reused in newly developing tissues. Autophagy facilitates the degradation of intracellular components for nutrient recycling in all eukaryotes, and recent studies have revealed critical roles for autophagy in Rubisco degradation and nitrogen remobilization into seeds in Arabidopsis (Arabidopsis thaliana). Here, we examined the function of autophagy in vegetative growth and nitrogen usage in a cereal plant, rice (Oryza sativa). An autophagy-disrupted rice mutant, Osatg7-1, showed reduced biomass production and nitrogen use efficiency compared with the wild type. While Osatg7-1 showed early visible leaf senescence, the nitrogen concentration remained high in the senescent leaves. 15N pulse chase analysis revealed suppression of nitrogen remobilization during leaf senescence in Osatg7-1. Accordingly, the reduction of nitrogen available for newly developing tissues in Osatg7-1 likely led its reduced leaf area and tillers. The limited leaf growth in Osatg7-1 decreased the photosynthetic capacity of the plant. Much of the nitrogen remaining in senescent leaves of Osatg7-1 was in soluble proteins, and the Rubisco concentration in senescing leaves of Osatg7-1 was about 2.5 times higher than in the wild type. Transmission electron micrographs showed a cytosolic fraction rich with organelles in senescent leaves of Osatg7-1. Our results suggest that autophagy contributes to efficient nitrogen remobilization at the whole-plant level by facilitating protein degradation for nitrogen recycling in senescent leaves. PMID:25786829

The effects of calcium regulation of endosperm reserve protein ...

African Journals Online (AJOL)

The effects of steep liquor calcium ion on sorghum endosperm reserve protein mobilization were evaluated using two improved Nigeria sorghum cultivars (ICSV 400 and KSV 8). The key protein modification factors evaluated were free amino nitrogen (FAN), total non protein nitrogen (TNPN) and soluble protein of cold water ...

Effects of Synchronization of Carbohydrate and Protein Supply in Total Mixed Ration with Korean Rice Wine Residue on Ruminal Fermentation, Nitrogen Metabolism and Microbial Protein Synthesis in Holstein Steers

Directory of Open Access Journals (Sweden)

Min Yu Piao

2012-11-01

Full Text Available Three Holstein steers in the growing phase, each with a ruminal cannula, were used to test the hypothesis that the synchronization of the hourly rate of carbohydrate and nitrogen (N released in the rumen would increase the amount of retained nitrogen for growth and thus improve the efficiency of microbial protein synthesis (EMPS. In Experiment 1, in situ degradability coefficients of carbohydrate and N in feeds including Korean rice wine residue (RWR were determined. In Experiment 2, three total mixed ration (TMR diets having different rates of carbohydrate and N release in the rumen were formulated using the in situ degradability of the feeds. All diets were made to contain similar contents of crude protein (CP and neutral detergent fiber (NDF but varied in their hourly pattern of nutrient release. The synchrony index of the three TMRs was 0.51 (LS, 0.77 (MS and 0.95 (HS, respectively. The diets were fed at a restricted level (2% of the animal’s body weight in a 3×3 Latin-square design. Synchronizing the hourly supply of energy and N in the rumen did not significantly alter the digestibility of dry matter, organic matter, crude protein, NDF or acid detergent fiber (ADF (p>0.05. The ruminal NH3-N content of the LS group at three hours after feeding was significantly higher (p0.05. In addition, the purine derivative (PD excretion in urine and microbial-N production (MN among the three groups were not significantly different (p>0.05. In conclusion, synchronizing dietary energy and N supply to the rumen did not have a major effect on nutrient digestion or microbial protein synthesis (MPS in Holstein steers.

Technical note: Nitrogen isotopic fractionation can be used to predict nitrogen-use efficiency in dairy cows fed temperate pasture.

Science.gov (United States)

Cheng, L; Sheahan, A J; Gibbs, S J; Rius, A G; Kay, J K; Meier, S; Edwards, G R; Dewhurst, R J; Roche, J R

2013-12-01

The objective of this study was to investigate the relationship between nitrogen isotopic fractionation (δ(15)N) and nitrogen-use efficiency (milk nitrogen/nitrogen intake; NUE) in pasture-fed dairy cows supplemented with increasing levels of urea to mimic high rumen degradable protein pastures in spring. Fifteen cows were randomly assigned to freshly cut pasture and either supplemented with 0, 250, or 336 g urea/d. Feed, milk, and plasma were analyzed for δ(15)N, milk and plasma for urea nitrogen concentration, and plasma for ammonia concentration. Treatment effects were tested using ANOVA and relationships between variables were established by linear regression. Lower dry matter intake (P = 0.002) and milk yield (P = 0.002) occurred with the highest urea supplementation (336 g urea/d) compared with the other two treatments. There was a strong linear relationship between milk δ(15)N - feed δ(15)N and NUE: [NUE (%) = 58.9 - 10.17 × milk δ(15)N - feed δ(15)N (‰) (r(2) = 0.83, P < 0.001, SE = 1.67)] and between plasma δ(15)N - feed δ(15)N and NUE: [NUE (%) = 52.4 - 8.61 × plasma δ(15)N - feed δ(15)N (‰) (r(2) = 0.85, P < 0.001, SE = 1.56)] . This study confirmed the potential use of δ(15)N to predict NUE in cows consuming different levels of rumen degradable protein.

Nitrate signals determine the sensing of nitrogen through differential expression of genes involved in nitrogen uptake and assimilation in finger millet.

Science.gov (United States)

Gupta, Alok Kumar; Gaur, Vikram Singh; Gupta, Sanjay; Kumar, Anil

2013-06-01

In order to understand the molecular basis of high nitrogen use efficiency of finger millet, five genes (EcHNRT2, EcLNRT1, EcNADH-NR, EcGS, and EcFd-GOGAT) involved in nitrate uptake and assimilation were isolated using conserved primer approaches. Expression profiles of these five genes along with the previously isolated EcDof1 was studied under increased KNO3 concentrations (0.15 to 1,500 μM) for 2 h as well as at 1.5 μM for 24 h in the roots and shoots of 25 days old nitrogen deprived two contrasting finger millet genotypes (GE-3885 and GE-1437) differing in grain protein content (13.76 and 6.15 %, respectively). Time kinetics experiment revealed that, all the five genes except EcHNRT2 in the leaves of GE-3885 were induced within 30 min of nitrate exposure indicating that there might be a greater nitrogen deficit in leaves and therefore quick transportation of nitrate signals to the leaves. Exposing the plants to increasing nitrate concentrations for 2 h showed that in roots of GE-3885, NR was strongly induced while GS was repressed; however, the pattern was found to be reversed in leaves of GE-1437 indicating that in GE-3885, most of the nitrate might be reduced in the roots but assimilated in leaves and vice-versa. Furthermore, compared with the low-protein genotype, expression of HNRT2 was strongly induced in both roots and shoots of high-protein genotype at the least nitrate concentration supplied. This further indicates that GE-3885 is a quick sensor of nitrogen compared with the low-protein genotype. Furthermore, expression of EcDof1 was also found to overlap the expression of NR, GS, and GOGAT indicating that Dof1 probably regulates the expression of these genes under different conditions by sensing the nitrogen fluctuations around the root zone.

Effect of dietary protein sources of on blood or milk urea nitrogen of native cows

Energy Technology Data Exchange (ETDEWEB)

Sarker, N R; Huque, K S; Asaduzzaman, M. [Animal Production Research Division, Bangladesh Livestock Research Institute, Savar, Dhaka (Bangladesh)], E-mail: nathusarker@yahoo.com

2009-07-01

When feed protein metabolism in ruminants produces urea in the liver and recycles or blood urea (BUN) filters into milk urea nitrogen (MUN), an indicator of protein status in diets or feeding urea as one of the non-protein nitrogen sources for ruminants is scientifically acceptable throughout the world; a section of environmentalists, policy makers or even professionals often raise question of residual effects in milk and/or meat of fattening and/or dairy cattle fed with diets containing urea. Keeping their views in consideration, a feeding trial on 30 Pabna milking cows of 2 to 4 parities dividing equally into 5 groups was arranged to determine the effect of feeding of different sources of protein on BUN and MUN, and milk yield or protein content. To achieve the objectives, a group of cows was fed a diet of rice straw and concentrate as the control (T{sub 0}), two out of the rests was fed either with urea-molasses straw (UMS) (T{sub 1}) or Matikalai (Vigna mungo) hay ( T{sub 2}) as sources of basal roughage. The rest two groups of cows were fed the control diet replacing % of feed protein by the amount of urea and molasses fed to UMS group. The amount of urea and molasses was fed daily either in two meals (T{sub 3}) or fed to cows mixing with other concentrate feed (T{sub 4}). In addition, a concentrate mixture containing 45 % wheat bran, 24% Khesari bran, 12% Til oil cake, 12% soybean meal, 4% fishmeal, 2.0% oyster-shell, 0.5% DCP and 0.5% common salt, was supplied twice daily. Having adjusted the cows with the diets for 20 d, a 20 d feeding trial was conducted, when feed intake and samples of blood and milk were collected. Milk samples were collected from individual cow after feeding the experimental diets in the morning and evening milking. Samples were collected from milk bucket after complete milking and mixing thoroughly. Samples were analyzed for milk urea content (MUN) using a Colorimetric p-dimethylaminobenzaldehyde (DMAB) method as described by Bector et

Nitrogen uptake and assimilation by corn roots

International Nuclear Information System (INIS)

Yoneyama, Tadakatsu; Akiyama, Yoko; Kumazawa, Kikuo

1977-01-01

The site of nitrogen uptake in the apical root zone of corn was experimentally investigated. Two experiments were performed. The one is to see the assimilation of nitrate and ammonium and the effects of low temperature on it. The 4-day-old roots were treated with 15 N-labelled inorganic nitrogen of 20 ppm N in 5 x 10 -4 M CaSO 4 solution at 30 deg. C and 0 deg. C. The other is to see the nitrogen uptake at apical root zone and the utilization of newly absorbed nitrogen at the root top. The 4-day-old roots were transferred into 5 x 10 -4 M CaSO 4 solution containing 15 N-labelled ammonium nitrate of 40 ppm N. As a result, the effect of low temperature on the nitrogen uptake appeared to be more drastic in the case of nitrate than ammonium. The 15 N content of amino acids indicates that ammonium is assimilated into amino acids even at 0 deg. C, but nitrate is not. The ammonium nitrogen seemed to be absorbed at both cell dividing and elongating zones. On the other hand, nitrate nitrogen seemed to be strongly absorbed at cell elongating zone. The nitrogen in the apical part may be supplied not only by direct absorption but also by translocation from the basal part. The clear difference was found in the utilization of nitrate and ammonium nitrogen at the root top when the root was elongating. This may be due to the difference of assimilation products of inorganic nitrogen. Newly absorbed ammonium nitrogen is more utilizable for the growth of root top than nitrate nitrogen. (Iwakiri, K.)

Structure and thermodynamics of effector molecule binding to the nitrogen signal transduction PII protein GlnZ from Azospirillum brasilense.

Science.gov (United States)

Truan, Daphné; Bjelić, Saša; Li, Xiao-Dan; Winkler, Fritz K

2014-07-29

The trimeric PII signal transduction proteins regulate the function of a variety of target proteins predominantly involved in nitrogen metabolism. ATP, ADP and 2-oxoglutarate (2-OG) are key effector molecules influencing PII binding to targets. Studies of PII proteins have established that the 20-residue T-loop plays a central role in effector sensing and target binding. However, the specific effects of effector binding on T-loop conformation have remained poorly documented. We present eight crystal structures of the Azospirillum brasilense PII protein GlnZ, six of which are cocrystallized and liganded with ADP or ATP. We find that interaction with the diphosphate moiety of bound ADP constrains the N-terminal part of the T-loop in a characteristic way that is maintained in ADP-promoted complexes with target proteins. In contrast, the interactions with the triphosphate moiety in ATP complexes are much more variable and no single predominant interaction mode is apparent except for the ternary MgATP/2-OG complex. These conclusions can be extended to most investigated PII proteins of the GlnB/GlnK subfamily. Unlike reported for other PII proteins, microcalorimetry reveals no cooperativity between the three binding sites of GlnZ trimers for any of the three effectors under carefully controlled experimental conditions. Copyright © 2014 Elsevier Ltd. All rights reserved.

The discharge characteristics in nitrogen helicon plasma

Science.gov (United States)

Zhao, Gao; Wang, Huihui; Si, Xinlu; Ouyang, Jiting; Chen, Qiang; Tan, Chang

2017-12-01

Discharge characteristics of helicon plasma in nitrogen and argon-nitrogen mixtures were investigated experimentally by using a Langmuir probe, a B-dot probe, and an optical emission spectrum. Helicon wave discharge is confirmed by the changes of electron density and electromagnetic signal amplitude with the increasing RF power, which shows three discharge stages in nitrogen, corresponding to E-mode, H-mode, and W-mode discharges in helicon plasma, respectively. Discharge images in the radial cross section at different discharge modes through an intensified charge coupled device (ICCD) show a rapid increase in luminous intensity along with the RF power. When the nitrogen discharge is in the W-mode, the images show that the strongest luminance locates near the plasma boundary and no blue core appears in the axial center of tube, which is always observed in argon W-mode discharge. The "big blue" or blue core is a special character in helicon plasma, but it has not been observed in nitrogen helicon plasma. In nitrogen-argon mixtures, a weak blue core is observed in ICCD images since the nitrogen content is increased. The electric field turns to the periphery in the distribution of the radial field and the electron temperature decreases with the increasing nitrogen content, especially when the blue core disappears. The different behaviors of the electron impact and the energy consumption in nitrogen helicon plasma are suggested to be responsible for the decrease in electron energy and the change in the electric field distribution.

Liquid nitrogen cryotherapy of superior limbic keratoconjunctivitis.

Science.gov (United States)

Fraunfelder, Frederick W

2009-02-01

To evaluate the effects of liquid nitrogen cryotherapy on superior limbic keratoconjunctivitis (SLK). Interventional case series. In this clinical practice case series, the effects of liquid nitrogen cryotherapy on SLK were observed. Liquid nitrogen cryotherapy was performed using a Brymill E tip spray (0.013-inch aperture) with a double freeze-thaw technique. All subjects were outpatients who had local anesthesia with a single drop of topical proparacaine. The main outcome measure was the resolution of the disease process after treatment. Four female patients (average age, 64 +/- 13 years) and seven eyes with SLK were treated with liquid nitrogen cryotherapy. Resolution of signs and symptoms occurred within two weeks. Disease recurred in two patients and three of seven eyes, although repeat cryotherapy eradicated SLK in all cases. The repeat cryotherapy was performed at three months postoperatively. There were no adverse ocular events. Liquid nitrogen cryotherapy appears to be an effective alternative treatment for SLK as all subjects studied achieved long-term cures. Repeat cryotherapy may be necessary in some instances and may be performed three months after the first treatment.

Contribution of bacterial cell nitrogen to soil humic fractions

International Nuclear Information System (INIS)

Knowles, R.; Barro, L.

1981-01-01

Living cells of Serratia marcescens, uniformly labelled with 15 N, were added to samples of maple (Acer saccharum) and black spruce (Picea mariana) forest soils. After different periods of incubation from zero time to 100 days, the soils were subjected to alkali-acid and phenol extraction to provide humic acid, fulvic acid, humin and 'humoprotein' fractions. Significant amounts of the cell nitrogen were recovered in the humic and fulvic acids immediately after addition. After incubation, less cell nitrogen appeared in the humic acid and more in the fulvic acid. The amount of cell nitrogen recovered in the humin fraction increased with incubation. Roughly 5 to 10 per cent of the added cell nitrogen was found as amino acid nitrogen from humoprotein in a phenol extract of the humic acid. The data are consistent with the occurrence of co-precipitation of biologically labile biomass nitrogen compounds with humic polymers during the alkaline extraction procedure involved in the humic-fulvic fractionation. (orig.)

Genetic variability in uptake of nitrogen at various growth stages of barley and wheat under dryland conditions

International Nuclear Information System (INIS)

Della, A.; Hadjichristodoulou, A.

1976-01-01

Protein and dry matter in a number of high protein and commercial varieties of barley and wheat were tested at various growth stages and at two locations. Large genetic variability was found in uptake of nitrogen, which was taken up generally before heading. High protein yields were not associated with high protein content but with higher dry matter yields. Nitrogen fertilization increased protein content and protein yield at a low protein location only. It was concluded that it is possible to breed for both high grain and high straw protein varieties. (author)

Impact of Nitrogen, Phosphorus and Potassium on Brown Planthopper and Tolerance of Its Host Rice Plants

Directory of Open Access Journals (Sweden)

Md Mamunur Rashid

2016-05-01

Full Text Available The brown planthopper (BPH, Nilaparvata lugens (Stål, appeared as a devastating pest of rice in Asia. Experiments were conducted to study the effects of three nutrients, nitrogen (N, phosphorus (P and potassium (K, on BPH and its host rice plants. Biochemical constituents of BPH and rice plants with varying nutrient levels at different growth stages, and changes in relative water content (RWC of rice plants were determined in the laboratory. Feeding of BPH and the tolerance of rice plants to BPH with different nutrient levels were determined in the nethouse. Concentrations of N and P were found much higher in the BPH body than in its host rice plants, and this elemental mismatch is an inherent constraint on meeting nutritional requirements of BPH. Nitrogen was found as a more limiting element for BPH than other nutrients in rice plants. Application of N fertilizers to the rice plants increased the N concentrations both in rice plants and BPH while application of P and K fertilizers increased their concentrations in plant tissues only but not in BPH. Nitrogen application also increased the level of soluble proteins and decreased silicon content in rice plants, which resulted in increased feeding of BPH with sharp reduction of RWC in rice plants ultimately caused susceptible to the pest. P fertilization increased the concentration of P in rice plant tissues but not changed N, K, Si, free sugar and soluble protein contents, which indicated little importance of P to the feeding of BPH and tolerance of plant against BPH. K fertilization increased K content but reduced N, Si, free sugar and soluble protein contents in the plant tissues which resulted in the minimum reduction of RWC in rice plants after BPH feeding, thereby contributed to higher tolerance of rice plants to brown planthopper.

Can herbage nitrogen fractionation in Lolium perenne be improved by herbage management?

NARCIS (Netherlands)

Hoekstra, N.J.; Struik, P.C.; Lantinga, E.A.; Amburgh, van M.E.; Schulte, R.P.O.

2008-01-01

The high degradability of grass protein is an important factor in the low nitrogen (N) utilization of grazing bovines in intensive European grassland systems. We tested the hypothesis that protein degradability as measured by the Cornell Net Carbohydrate and Protein System (CNCPS) protein

Many Saccharomyces cerevisiae Cell Wall Protein Encoding Genes Are Coregulated by Mss11, but Cellular Adhesion Phenotypes Appear Only Flo Protein Dependent.

Science.gov (United States)

Bester, Michael C; Jacobson, Dan; Bauer, Florian F

2012-01-01

The outer cell wall of the yeast Saccharomyces cerevisiae serves as the interface with the surrounding environment and directly affects cell-cell and cell-surface interactions. Many of these interactions are facilitated by specific adhesins that belong to the Flo protein family. Flo mannoproteins have been implicated in phenotypes such as flocculation, substrate adhesion, biofilm formation, and pseudohyphal growth. Genetic data strongly suggest that individual Flo proteins are responsible for many specific cellular adhesion phenotypes. However, it remains unclear whether such phenotypes are determined solely by the nature of the expressed FLO genes or rather as the result of a combination of FLO gene expression and other cell wall properties and cell wall proteins. Mss11 has been shown to be a central element of FLO1 and FLO11 gene regulation and acts together with the cAMP-PKA-dependent transcription factor Flo8. Here we use genome-wide transcription analysis to identify genes that are directly or indirectly regulated by Mss11. Interestingly, many of these genes encode cell wall mannoproteins, in particular, members of the TIR and DAN families. To examine whether these genes play a role in the adhesion properties associated with Mss11 expression, we assessed deletion mutants of these genes in wild-type and flo11Δ genetic backgrounds. This analysis shows that only FLO genes, in particular FLO1/10/11, appear to significantly impact on such phenotypes. Thus adhesion-related phenotypes are primarily dependent on the balance of FLO gene expression.

Correlation between dietary nitrogen, level of plasma urea and urea excretion in urine of buffalo calves

International Nuclear Information System (INIS)

Verma, D.N.; Singh, U.B.

1978-01-01

Two experiments were conducted with 6 male buffalo calves of Murrah breed, aged 1.5 years, to determine whether blood urea nitrogen and urea excretion in urine were associated with protein intake. The animals were fed different amounts of crude protein in their diet. The levels of urea-N in the blood, excretion of 14 C from urea and urea-N in the urine were estimated. Close relationships were observed between nitrogen intake, blood urea nitrogen and urea excretion in the urine. The observations indicated that blood urea-N and urea excretion in urine could be quantitated with the protein intake. (author)

Nitrogen detected TROSY at high field yields high resolution and sensitivity for protein NMR

International Nuclear Information System (INIS)

Takeuchi, Koh; Arthanari, Haribabu; Shimada, Ichio; Wagner, Gerhard

2015-01-01

Detection of 15 N in multidimensional NMR experiments of proteins has sparsely been utilized because of the low gyromagnetic ratio (γ) of nitrogen and the presumed low sensitivity of such experiments. Here we show that selecting the TROSY components of proton-attached 15 N nuclei (TROSY 15 N H ) yields high quality spectra in high field magnets (>600 MHz) by taking advantage of the slow 15 N transverse relaxation and compensating for the inherently low 15 N sensitivity. The 15 N TROSY transverse relaxation rates increase modestly with molecular weight but the TROSY gain in peak heights depends strongly on the magnetic field strength. Theoretical simulations predict that the narrowest line width for the TROSY 15 N H component can be obtained at 900 MHz, but sensitivity reaches its maximum around 1.2 GHz. Based on these considerations, a 15 N-detected 2D 1 H– 15 N TROSY-HSQC ( 15 N-detected TROSY-HSQC) experiment was developed and high-quality 2D spectra were recorded at 800 MHz in 2 h for 1 mM maltose-binding protein at 278 K (τ c  ∼ 40 ns). Unlike for 1 H detected TROSY, deuteration is not mandatory to benefit 15 N detected TROSY due to reduced dipolar broadening, which facilitates studies of proteins that cannot be deuterated, especially in cases where production requires eukaryotic expression systems. The option of recording 15 N TROSY of proteins expressed in H 2 O media also alleviates the problem of incomplete amide proton back exchange, which often hampers the detection of amide groups in the core of large molecular weight proteins that are expressed in D 2 O culture media and cannot be refolded for amide back exchange. These results illustrate the potential of 15 N H -detected TROSY experiments as a means to exploit the high resolution offered by high field magnets near and above 1 GHz

Protein retention assessment of four levels of poultry by-product substitution of fishmeal in rainbow trout (Oncorhynchus mykiss) diets using stable isotopes of nitrogen (δ15N) as natural tracers.

Science.gov (United States)

Badillo, Daniel; Herzka, Sharon Z; Viana, Maria Teresa

2014-01-01

This is second part from an experiment where the nitrogen retention of poultry by-product meal (PBM) compared to fishmeal (FM) was evaluated using traditional indices. Here a quantitative method using stable isotope ratios of nitrogen (δ(15)N values) as natural tracers of nitrogen incorporation into fish biomass is assessed. Juvenile rainbow trout (Oncorhynchus mykiss) were fed for 80 days on isotopically distinct diets in which 0, 33, 66 and 100% of FM as main protein source was replaced by PBM. The diets were isonitrogenous, isolipidic and similar in gross energy content. Fish in all treatments reached isotopic equilibrium by the end of the experiment. Two-source isotope mixing models that incorporated the isotopic composition of FM and PBM as well as that of formulated feeds, empirically derived trophic discrimination factors and the isotopic composition of fish that had reached isotopic equilibrium to the diets were used to obtain a quantitative estimate of the retention of each source of nitrogen. Fish fed the diets with 33 and 66% replacement of FM by PBM retained poultry by-product meal roughly in proportion to its level of inclusion in the diets, whereas no differences were detected in the protein efficiency ratio. Coupled with the similar biomass gain of fishes fed the different diets, our results support the inclusion of PBM as replacement for fishmeal in aquaculture feeds. A re-feeding experiment in which all fish were fed a diet of 100% FM for 28 days indicated isotopic turnover occurred very fast, providing further support for the potential of isotopic ratios as tracers of the retention of specific protein sources into fish tissues. Stable isotope analysis is a useful tool for studies that seek to obtain quantitative estimates of the retention of different protein sources.

Large centric diatoms allocate more cellular nitrogen to photosynthesis to counter slower RUBISCO turnover rates

Directory of Open Access Journals (Sweden)

Yaping eWu

2014-12-01

Full Text Available Diatoms contribute ~40% of primary production in the modern ocean and encompass the largest cell size range of any phytoplankton group. Diatom cell size influences their nutrient uptake, photosynthetic light capture, carbon export efficiency, and growth responses to increasing pCO2. We therefore examined nitrogen resource allocations to the key protein complexes mediating photosynthesis across six marine centric diatoms, spanning 5 orders of magnitude in cell volume, under past, current and predicted future pCO2 levels, in balanced growth under nitrogen repletion. Membrane bound photosynthetic protein concentrations declined with cell volume in parallel with cellular concentrations of total protein, total nitrogen and chlorophyll. Larger diatom species, however, allocated a greater fraction (by 3.5 fold of their total cellular nitrogen to the soluble RUBISCO carbon fixation complex than did smaller species. Carbon assimilation per unit of RUBISCO large subunit (C RbcL-1 s-1 decreased with cell volume, from ~8 to ~2 C RbcL-1 s-1 from the smallest to the largest cells. Whilst a higher allocation of cellular nitrogen to RUBISCO in larger cells increases the burden upon their nitrogen metabolism, the higher RUBISCO allocation buffers their lower achieved RUBISCO turnover rate to enable larger diatoms to maintain carbon assimilation rates per total protein comparable to small diatoms. Individual species responded to increased pCO2, but cell size effects outweigh pCO2 responses across the diatom species size range examined. In large diatoms a higher nitrogen cost for RUBISCO exacerbates the higher nitrogen requirements associated with light absorption, so the metabolic cost to maintain photosynthesis is a cell size-dependent trait.

Nitrogen metabolism in the ruminant

International Nuclear Information System (INIS)

Buttery, P.J.; Lewis, D.

1976-01-01

Selected aspects of nitrogen metabolism in the ruminant are discussed. Particular attention is paid to the effect of rumen ammonia concentration on protein synthesis in the rumen. In order to judge the suitability of microbial protein as a source of protein for the ruminant, it is necessary to be able to assess the amino-acid requirements of the ruminant accurately. Several methods of doing this are discussed. Available data would indicate that under many conditions methionine is the first limiting amino acid. Possible ways of increasing the supply of methionine at the duodenum are discussed. When the amino-acid requirements are fully met, it is to be expected that protein synthesis in the tissues will proceed at its maximal rate. Ways of determining the extent of tissue protein synthesis in vivo are briefly discussed. (author)

Combined nitrogen limitation and cadmium stress stimulate total carbohydrates, lipids, protein and amino acid accumulation in Chlorella vulgaris (Trebouxiophyceae)

Energy Technology Data Exchange (ETDEWEB)

Chia, Mathias Ahii, E-mail: chia28us@yahoo.com [Department of Botany, Federal University of São Carlos, Rodovia Washington Luis km 235, São Carlos, SP Cep 13565905 (Brazil); Lombardi, Ana Teresa [Department of Botany, Federal University of São Carlos, Rodovia Washington Luis km 235, São Carlos, SP Cep 13565905 (Brazil); Graça Gama Melão, Maria da [Department of Hydrobiology, Federal University of São Carlos, Rodovia Washington Luis km 235, São Carlos, SP Cep 13565905 (Brazil); Parrish, Christopher C. [Department of Ocean Sciences, Memorial University of Newfoundland, St. John’s, Newfoundland A1C 5S7 (Canada)

2015-03-15

Highlights: • Chlorella vulgaris was exposed to Cd under varying N concentrations. • Growth rate and cell density decreased with increasing Cd stress and N limitation. • Dry weight, chlorophyll a, total lipid, carbohydrate and protein were accumulated. • Amino acids like proline and glutamine were accumulated under N and Cd stress. • Changes in amino acid composition are sensitive biomarkers for Cd and N stress. - Abstract: Metals have interactive effects on the uptake and metabolism of nutrients in microalgae. However, the effect of trace metal toxicity on amino acid composition of Chlorella vulgaris as a function of varying nitrogen concentrations is not known. In this research, C. vulgaris was used to investigate the influence of cadmium (10{sup −7} and 2.0 × 10{sup −8} mol L{sup −1} Cd) under varying nitrogen (2.9 × 10{sup −6}, 1.1 × 10{sup −5} and 1.1 × 10{sup −3} mol L{sup −1} N) concentrations on its growth rate, biomass and biochemical composition. Total carbohydrates, total proteins, total lipids, as well as individual amino acid proportions were determined. The combination of Cd stress and N limitation significantly inhibited growth rate and cell density of C. vulgaris. However, increasing N limitation and Cd stress stimulated higher dry weight and chlorophyll a production per cell. Furthermore, biomolecules like total proteins, carbohydrates and lipids increased with increasing N limitation and Cd stress. Ketogenic and glucogenic amino acids were accumulated under the stress conditions investigated in the present study. Amino acids involved in metal chelation like proline, histidine and glutamine were significantly increased after exposure to combined Cd stress and N limitation. We conclude that N limitation and Cd stress affects the physiology of C. vulgaris by not only decreasing its growth but also stimulating biomolecule production.

Nitrogen nutrition of the grape-vine (Vitis vinifera spp)

International Nuclear Information System (INIS)

Conradie, W.J.

1985-12-01

A thorough knowledge concerning the nitrogen relationship in the grape-vine is essential in order to appreciate how different patterns of uptake, assimilation, storage and utilisation of nitrogen might be advantageous in particular environmental situations. The 15 N-isotope technique has been used to determine the uptake and distribution of nitrogen absorbed during early spring, early summer and autumn. Apart from the total N fraction, protein N and soluble N were determined as well. The utilisation of labelled N applied in the field, was determined for vineyards on heavier and lighter soils

Ruminal Nitrogen Recycling and Nitrogen Efficiency in Lactating Dairy Cattle

OpenAIRE

Aguilar, Michelle

2012-01-01

Excess nitrogen (N) excretion from animal agriculture results in reduced air and water quality, and poses a risk to human health. Although the dairy industry utilizes milk urea N (MUN) to monitor protein feeding and N excretion, phenotypic diversity among cows may influence MUN and thus bias feed management. An initial study using data from 2 previously published research trials and a field trial, observed that cow had a significant effect on MUN variation. Regression models, utilized ...

Combined nitrogen limitation and cadmium stress stimulate total carbohydrates, lipids, protein and amino acid accumulation in Chlorella vulgaris (Trebouxiophyceae).

Science.gov (United States)

Chia, Mathias Ahii; Lombardi, Ana Teresa; da Graça Gama Melão, Maria; Parrish, Christopher C

2015-03-01

Metals have interactive effects on the uptake and metabolism of nutrients in microalgae. However, the effect of trace metal toxicity on amino acid composition of Chlorella vulgaris as a function of varying nitrogen concentrations is not known. In this research, C. vulgaris was used to investigate the influence of cadmium (10(-7) and 2.0×10(-8)molL(-1) Cd) under varying nitrogen (2.9×10(-6), 1.1×10(-5) and 1.1×10(-3)molL(-1)N) concentrations on its growth rate, biomass and biochemical composition. Total carbohydrates, total proteins, total lipids, as well as individual amino acid proportions were determined. The combination of Cd stress and N limitation significantly inhibited growth rate and cell density of C. vulgaris. However, increasing N limitation and Cd stress stimulated higher dry weight and chlorophyll a production per cell. Furthermore, biomolecules like total proteins, carbohydrates and lipids increased with increasing N limitation and Cd stress. Ketogenic and glucogenic amino acids were accumulated under the stress conditions investigated in the present study. Amino acids involved in metal chelation like proline, histidine and glutamine were significantly increased after exposure to combined Cd stress and N limitation. We conclude that N limitation and Cd stress affects the physiology of C. vulgaris by not only decreasing its growth but also stimulating biomolecule production. Copyright © 2015 Elsevier B.V. All rights reserved.

Functional analysis of TamA, a coactivator of nitrogen-regulated gene expression in Aspergillus nidulans.

Science.gov (United States)

Small, A J; Todd, R B; Zanker, M C; Delimitrou, S; Hynes, M J; Davis, M A

2001-06-01

The tam A gene of Aspergillus nidulans encodes a 739-amino acid protein with similarity to Uga35p/Dal81p/DurLp of Saccharomyces cerevisiae. It has been proposed that TamA functions as a co-activator of AreA, the major nitrogen regulatory protein in A. nidulans. Because AreA functions as a transcriptional activator under nitrogen-limiting conditions, we investigated whether TamA was also present in the nucleus. We found that a GFP-TamA fusion protein was predominantly localised to the nucleus in the presence and absence of ammonium, and that AreA was not required for this distribution. As the predicted DNA-binding domain of TamA is not essential for function, we have used a number of approaches to further define functionally important regions. We have cloned the tamA gene of A. oryzae and compared its functional and sequence characteristics with those of A. nidulans tamA and S. cerevisiae UGA35/DAL81/DURL. The Aspergillus homologues are highly conserved and functionally interchangeable, whereas the S. cerevisiae gene does not complement a tamA mutant when expressed in A. nidulans. Uga35p/Dal81p/DurLp was also found to be unable to recruit AreA. The sequence changes in a number of tamA mutant alleles were determined, and altered versions of TamA were tested for tamA complementation and interaction with AreA. Changes in most regions of TamA appeared to destroy its function, suggesting that the overall conformation of the protein may be critical for its activity.

Protein metabolism in obese patients during very low-calorie mixed diets containing different amounts of proteins and carbohydrates.

Science.gov (United States)

Pasquali, R; Casimirri, F; Melchionda, N

1987-12-01

To assess long-term nitrogen sparing capacity of very low-calorie mixed diets, we administered two isoenergetic (2092KJ) liquid formula regimens of different composition for 8 weeks to two matched groups of massively obese patients (group 1: proteins 60 g, carbohydrate 54 g; group 2: proteins 41 g, carbohydrates 81 g). Weight loss was similar in both groups. Daily nitrogen balance (g) during the second month resulted more a negative in group 2 with respect to group 1. However, within the groups individual nitrogen sparing capacity varied markedly; only a few in group 1 and one in group 2 were able to attain nitrogen equilibrium throughout the study. Daily urine excretion of 3-methylhistidine fell significantly in group 1 but did not change in group 2. Unlike total proteins, albumins, and transferrin, serum levels of retinol-binding protein, thyroxin-binding globulin, and complement-C3 fell significantly in both groups but per cent variations of complement-C3 were more pronounced in the first group. Prealbumin levels fell persistently in group 1 and transiently in group 2. The results indicate that even with this type of diet an adequate amount of dietary protein represents the most important factor in minimizing whole body protein catabolism during long-term semistarvation in massively obese patients. Moreover, they confirm the possible role of dietary carbohydrates in the regulation of some visceral protein metabolism.

Bread wheat varieties as influenced by different nitrogen levels.

Science.gov (United States)

Hussain, Iqtidar; Khan, Muhammad Ayyaz; Khan, Ejaz Ahmad

2006-01-01

Experiment was conducted to determine the effect of different nitrogen levels on four bread wheat varieties (Triticum aestivum L.) viz. Inqilab-91, Daman-98, Dera-98 and Punjab-96 at Gomal University, Dera Ismail Khan (NWFP), Pakistan during 2000 approximatey 2001. The experiment was laid out in split plot design having four replications using a net plot size of 2 m x 5 m. Nitrogen doses used were 0, 50, 100, 150 and 200 kg/ha. The results showed that different nitrogen levels had significant effects on plant height, total number of plants/m(2), number of grains/spike, number of spike/m(2), spike weight, biological yield, grain yield and grain protein content. Maximum plant height, total number of plants/m(2), number of spikes/m(2), spike weight, biological yield and grain protein content were observed at 200 kg N/ha. Among wheat varieties Daman-98 had maximum plant height, spike weight, grains/spike, 1000-grain weight, biological yield and grain yield. Inqilab-91 had heavier grains and the most grain protein content, while Dera-98 had the maximum plant population and spikes/m(2). Grain yield and biological yield were statistically similar at doses of 150 kg N/ha and 200 kg N/ha. However, dose of 200 kg N/ha, compared to dose of 150 Kg N/ha, significantly increased the protein content.

Protein characterization of Roditis Greek grape variety and Sauvignon blanc and changes in certain nitrogen compounds during alcoholic fermentation

Directory of Open Access Journals (Sweden)

Z. G. Nakopoulou

2006-09-01

Full Text Available Must and wine samples of the Greek grape variety Roditis and the French one Sauvignon blanc were analysed in order to obtain further knowledge of the protein profile of Roditis and to watch the evolution of grape proteins during the alcoholic fermentation of Roditis and Sauvignon blanc musts. For these purposes protein samples were isolated from must and wine samples by ammonium sulphate precipitation and subjected to sodium dodecyl sulphate polyacrylamide gel electrophoresis (SDS - PAGE. Eleven and nine bands with molecular weights between 11,1 and 64,4 kDa were detected on the electrophoregramms of Roditis and Sauvignon blanc must and wine samples respectively, using Coomassie Brillant Blue R-250 and silver staining methods. Two protein fractions of must and wine samples with molecular weights of 64,4 kDa and 34,4 kDa were identified as being glycoproteins in the profile of the Greek grape variety, according to the Periodic acid - silver staining, while only one must and wine fraction of 64,4 kDa had positively react with this stain, as far as it concerns Sauvignon blanc. None of the low molecular weight protein fractions found to be responsible for haze formation. A modified (Bradford dye - binding procedure was used for the determination of musts and wines soluble proteins. Free amino nitrogen and the contents of neutral and acidic polysaccharides in the protein fractions after chromatography on Sephadex G - 25, were also analyzed.

Transition Metal Ions Enable the Transition from Electrospun Prolamin Protein Fibers to Nitrogen-Doped Freestanding Carbon Films for Flexible Supercapacitors.

Science.gov (United States)

Wang, Yixiang; Yang, Jingqi; Du, Rongbing; Chen, Lingyun

2017-07-19

Flexible carbon ultrafine fibers are highly desirable in energy storage and conversion devices. Our previous finding showed that electrospun hordein/zein fibers stabilized by Ca 2+ were successfully transferred into nitrogen-doped carbon ultrafine fibers for supercapacitors. However, their relatively brittle nature needed to be improved. Inspired by this stabilizing effect of Ca 2+ , in this work, four transition metal divalent cations were used to assist the formation of flexible hordein/zein-derived carbon ultrafine fibers. Without alteration of the electrospinnability, adequate amounts of zinc acetate and cobalt acetate supported the fibrous structure during pyrolysis. This resulted in flexible freestanding carbon films consisting of well-defined fibers with nitrogen-doped graphitic layers and hierarchical pores. These carbon films were easily cut into small square pieces and directly applied as working electrode in the three-electrode testing system without the need for polymer binders or conducting agents. Notably, the hz-Zn0.3-p electrode, synthesized with 0.3 mol/L Zn 2+ and post-acid treatment, exhibited a specific capacitance of 393 F/g (at 1 A/g), a large rate capability (72.3% remained at 20 A/g), and a capacitance retention of ∼98% after 2000 charging-discharging cycles at 10 A/g. These superior electrochemical properties were attributed to the synergistic effects of the well-developed graphitic layers induced by Zn 2+ , the nitrogen-decorated carbon structure, and the interconnected channels generated by HCl treatment. This research advances potential applications for prolamin proteins as nitrogen-containing raw materials in developing carbon structures for high-performance supercapacitors.

Effects of Plant Density and Nitrogen Fertilizer on Quantity and Quality of Forage Corn in Daregaz Region (Iran

Directory of Open Access Journals (Sweden)

N. Saadatzadeh

2011-01-01

Full Text Available In order to evaluate the effects of plant density and nitrogen on quantity and quality of forage corn an experiment was conducted in Daregaz region in cropping season 2008 – 2009. The experimental design was a split – plot based on randomized complete block with three replications. The main plots were four levels of nitrogen (0 , 75, 150 and 225 kg/ha and sub plots were three levels of plant density (75000, 100000 and 125000 plant/ha. The results showed that increasing nitrogen levels and plant density, plant height, percentage crude protein and total protein production (ton/ha were increased. By increasing plant density, stem diameter, leaf and ear weight decreased while they increased with increased nitrogen levels. The highest forage yield obtained at nitrogen level 150 kg/ha (46 ton/ha and 100000 plant per hectare (40.27 ton/ha. The highest total protein production (7 ton/ha obtained at nitrogen level of 150 kg/ha and plant density of 125000 plant/ha.

Assessment of the usefulness of the PIGE method to determine nitrogen in human blood serum

International Nuclear Information System (INIS)

Kupila-Rantala, T.; Hyvoenen-Dabek, M.; Raiasanen, J.; Dabek, J.T.

1995-01-01

Proton-induced gamma-ray emission (PIGE) analysis has been applied to the determination of total nitrogen concentration of blood sera from hospital patients. Both the reaction 14 N(p,p'γ) 14 N, E γ =2313 keV, and the reaction 15 N(p,αγ) 12 C,E γ =4439keV, have been used. From 37 patients, the range of the nitrogen concentrations obtained was 9.54-16.3 g/l with a mean of 12.0 g/l. The corresponding total protein concentrations varied between 59 and 96 g/l, measured in a clinical laboratory auto analyser using the biuret method. The range of the albumin concentrations was 29-46 g/l. The nitrogen concentrations correlated well with the total protein concentrations (r=0.802). The multiple correlation of nitrogen versus (albumin+ (total protein- albumin)) gives a coefficient of 0.175 for albumin and 0.161 for total protein- albumin. The results agree with expectations and support the potential usefulness of the rapid PIGE method for medical studies. (author). 17 refs., 3 figs

Characterization of brazilian wheat cultivars in terms of nitrogen use efficiency

Directory of Open Access Journals (Sweden)

Cristiano Lemes da Silva

2014-06-01

Full Text Available Nitrogen (N management in wheat crop is one of the most studied agricultural practices in Brazil; however, there are few reports on its use efficiency. The objective of this study was to characterize 18 Brazilian wheat cultivars, which are representative and have been recently released to cultivation, for nitrogen use efficiency (NUE. The experiments were carried out in Pato Branco, Paraná, and Coxilha, Rio Grande do Sul, during the 2011 crop season. It was used a randomized block design with three replications, in factorial scheme (2 environments × 18 cultivars. Genetic variability was observed for nitrogen utilization efficiency by grains (NUtEg=47.6 to 81.1 kg kg-1 and nitrogen harvest index (NHI=71.3 to 84.6% with significant effects relating to the environment of cultivation and performance of these traits. The evaluation of the protein concentration of grain by near infrared spectrometry (GPC N produced equivalent results to the direct analytical method of Kjeldahl (GPC K, in Pato Branco (r=0.56 and Coxilha (RS (r=0.80. However the CPG N overestimated the protein values by 16.85%. The GPC and protein yield were positively correlated with NUtEg and NHI. The best performance for the traits associated with NUE was observed for the following cultivars: Mirante, Quartzo, Fundacep Cristalino, Fundacep Raízes and CD 150. This is the first report of differences between Brazilian wheat cultivars for nitrogen use efficiency.

Nitrogen metabolism in a grapevine in vitro system

Directory of Open Access Journals (Sweden)

Nuria Llorens

2002-09-01

Full Text Available Ammonium, nitrate, nitrite, protein and individual and total amino acid contents were determined in grapevine (cv Sauvignon cultured in vitro. The enzyme activities of nitrate and nitrite reductases, glutamine synthetase, glutamate synthetase and dehydrogenase were also determined. The nitrogen taken up by the plants was 70% of the total nitrogen in the medium after 75 days of in vitro culture. Most of the nitrogen taken up was recovered in the leaves, yet only ammonia and amino acid concentrations were significantly higher in leaves. In roots, glutamine was the most abundant amino acid. In leaves, the most abundant amino acids were aspartate, glutamate, glutamine, alanine, arginine and g-aminobutirate. All enzyme activities were higher in roots than in leaves. These results suggest that both roots and leaves incorporate inorganic nitrogen into organic forms.

Utilization of nitrogen fixing trees

Energy Technology Data Exchange (ETDEWEB)

Brewbaker, J.L.; Beldt, R. van den; MacDicken, K.; Budowski, G.; Kass, D.C.L.; Russo, R.O.; Escalante, G.; Herrera, R.; Aranguren, J.; Arkcoll, D.B.; Doebereinger, J. (cord.)

1983-01-01

Six papers from the symposium are noted. Brewbaker, J.L., Beldt, R. van den, MacDicken, K. Fuelwood uses and properties of nitrogen-fixing trees, pp 193-204, (Refs. 15). Includes a list of 35 nitrogen-fixing trees of high fuelwood value. Budowski, G.; Kass, D.C.L.; Russo, R.O. Leguminous trees for shade, pp 205-222, (Refs. 68). Escalante, G., Herrera, R., Aranguren, J.; Nitrogen fixation in shade trees (Erythrina poeppigiana) in cocoa plantations in northern Venezuela, pp 223-230, (Refs. 13). Arkcoll, D.B.; Some leguminous trees providing useful fruits in the North of Brazil, pp 235-239, (Refs. 13). This paper deals with Parkia platycephala, Pentaclethra macroloba, Swartzia sp., Cassia leiandra, Hymenaea courbaril, dipteryz odorata, Inga edulis, I. macrophylla, and I. cinnamonea. Baggio, A.J.; Possibilities of the use of Gliricidia sepium in agroforestry systems in Brazil, pp 241-243; (Refs. 15). Seiffert, N.F.; Biological nitrogen and protein production of Leucaena cultivars grown to supplement the nutrition of ruminants, pp 245-249, (Refs. 14). Leucaena leucocephala cv. Peru, L. campina grande (L. leucocephala), and L. cunningham (L. leucocephalae) were promising for use as browse by beef cattle in central Brazil.

Effects of nitrogen application rate on dry matter redistribution, grain yield, nitrogen use efficiency and photosynthesis in malting barley

DEFF Research Database (Denmark)

Cai, J; Jiang, D; Wollenweber, Bernd

2012-01-01

The harmonious combination of malting barley yield, quality and nitrogen (N) use-efficiency under nitrogen (N) rates applications was greatly conducive to production in China. The malting barley cultivar Supi 3 was planted during the growing seasons 2005 and 2006 at two contrasting sites in China....... Five nitrogen (N) application rates (0, 75, 150, 225 and 300 kg ha−1) were applied for research of effects of N rates application on grain yield, protein content and N use-efficiency. At both sites and in both years, grain yield increased with increasing N application rates up to 225 kg N ha−1...... with a quadrant model, the optimum N application rates for high grain yield with high nitrogen use-efficiency in malting barley could be indicated. So, the higher yields could be mainly ascribed to the higher accumulation of photoassimilates between anthesis and maturity. In order to achieve high grain yield...

Even low to medium nitrogen deposition impacts vegetation of dry, coastal dunes around the Baltic Sea

NARCIS (Netherlands)

Remke, E.; Brouwer, E.; Kooijman, A.; Blindow, I.; Esselink, H.; Roelofs, J.G.M.

2009-01-01

Coastal dunes around the Baltic Sea have received small amounts of atmospheric nitrogen and are rather pristine ecosystems in this respect. In 19 investigated dune sites the atmospheric wet nitrogen deposition is 3-8 kg N ha−1 yr−1. The nitrogen content of Cladonia portentosa appeared to be a

Effect of different rates of nitrogen fertilizer on durum wheat (Triticum ...

African Journals Online (AJOL)

Dr Asefa

2012-05-03

May 3, 2012 ... The result showed that nitrogen rates and cultivars had significant effect on yield, yield related traits, nitrogen uptake ... cooking quality [8]. Durum wheat grain protein functionality can be influenced by N fertilization, particularly in the varieties of relatively with less gluten strength [9]. Information on the quality ...

Protein as a sole source of nitrogen for in vitro grown tobacco plantlets

Czech Academy of Sciences Publication Activity Database

Synková, Helena; Hýsková, V.; Garčeková, K.; Křížová, S.; Ryšlavá, H.

2016-01-01

Roč. 60, č. 4 (2016), s. 635-644 ISSN 0006-3134 Institutional support: RVO:61389030 Keywords : glutamate-dehydrogenase * inorganic nitrogen * nitrate transport * organic nitrogen * amino-acids * metabolism * seedlings * leaves * roots * assimilation * ammonium * casein * chlorophyll fluorescence * nitrate * photosynthesis Subject RIV: EF - Botanics Impact factor: 1.551, year: 2016

High nitrogen availability reduces polyphenol content in Sphagnum peat.

Science.gov (United States)

Bragazza, Luca; Freeman, Chris

2007-05-15

Peat mosses of the genus Sphagnum constitute the bulk of living and dead biomass in bogs. These plants contain peculiar polyphenols which hamper litter peat decomposition through their inhibitory activity on microbial breakdown. In the light of the increasing availability of biologically active nitrogen in natural ecosystems, litter derived from Sphagnum mosses is an ideal substrate to test the potential effects of increased atmospheric nitrogen deposition on polyphenol content in litter peat. To this aim, we measured total nitrogen and soluble polyphenol concentration in Sphagnum litter peat collected in 11 European bogs under a chronic gradient of atmospheric nitrogen deposition. Our results demonstrate that increasing nitrogen concentration in Sphagnum litter, as a consequence of increased exogenous nitrogen availability, is accompanied by a decreasing concentration of polyphenols. This inverse relationship is consistent with reports that in Sphagnum mosses, polyphenol and protein biosynthesis compete for the same precursor. Our observation of modified Sphagnum litter chemistry under chronic nitrogen eutrophication has implications in the context of the global carbon balance, because a lower content of decay-inhibiting polyphenols would accelerate litter peat decomposition.

Robust biological nitrogen fixation in a model grass-bacterial association.

Science.gov (United States)

Pankievicz, Vânia C S; do Amaral, Fernanda P; Santos, Karina F D N; Agtuca, Beverly; Xu, Youwen; Schueller, Michael J; Arisi, Ana Carolina M; Steffens, Maria B R; de Souza, Emanuel M; Pedrosa, Fábio O; Stacey, Gary; Ferrieri, Richard A

2015-03-01

Nitrogen-fixing rhizobacteria can promote plant growth; however, it is controversial whether biological nitrogen fixation (BNF) from associative interaction contributes to growth promotion. The roots of Setaria viridis, a model C4 grass, were effectively colonized by bacterial inoculants resulting in a significant enhancement of growth. Nitrogen-13 tracer studies provided direct evidence for tracer uptake by the host plant and incorporation into protein. Indeed, plants showed robust growth under nitrogen-limiting conditions when inoculated with an ammonium-excreting strain of Azospirillum brasilense. (11)C-labeling experiments showed that patterns in central carbon metabolism and resource allocation exhibited by nitrogen-starved plants were largely reversed by bacterial inoculation, such that they resembled plants grown under nitrogen-sufficient conditions. Adoption of S. viridis as a model should promote research into the mechanisms of associative nitrogen fixation with the ultimate goal of greater adoption of BNF for sustainable crop production. © 2015 The Authors The Plant Journal © 2015 John Wiley & Sons Ltd.

Large fractions of CO2-fixing microorganisms in pristine limestone aquifers appear to be involved in the oxidation of reduced sulfur and nitrogen compounds

Science.gov (United States)

Herrmann, Martina; Rusznyák, Anna; Akob, Denise M.; Schulze, Isabel; Opitz, Sebastian; Totsche, Kai Uwe; Küsel, Kirsten

2015-01-01

The traditional view of the dependency of subsurface environments on surface-derived allochthonous carbon inputs is challenged by increasing evidence for the role of lithoautotrophy in aquifer carbon flow. We linked information on autotrophy (Calvin-Benson-Bassham cycle) with that from total microbial community analysis in groundwater at two superimposed—upper and lower—limestone groundwater reservoirs (aquifers). Quantitative PCR revealed that up to 17% of the microbial population had the genetic potential to fix CO2 via the Calvin cycle, with abundances of cbbM and cbbL genes, encoding RubisCO (ribulose-1,5-bisphosphate carboxylase/oxygenase) forms I and II, ranging from 1.14 × 103 to 6 × 106 genes liter−1 over a 2-year period. The structure of the active microbial communities based on 16S rRNA transcripts differed between the two aquifers, with a larger fraction of heterotrophic, facultative anaerobic, soil-related groups in the oxygen-deficient upper aquifer. Most identified CO2-assimilating phylogenetic groups appeared to be involved in the oxidation of sulfur or nitrogen compounds and harbored both RubisCO forms I and II, allowing efficient CO2 fixation in environments with strong oxygen and CO2 fluctuations. The genera Sulfuricellaand Nitrosomonas were represented by read fractions of up to 78 and 33%, respectively, within the cbbM and cbbL transcript pool and accounted for 5.6 and 3.8% of 16S rRNA sequence reads, respectively, in the lower aquifer. Our results indicate that a large fraction of bacteria in pristine limestone aquifers has the genetic potential for autotrophic CO2 fixation, with energy most likely provided by the oxidation of reduced sulfur and nitrogen compounds.

Nitrogen recycling through the gut and the nitrogen economy of ruminants: an asynchronous symbiosis.

Science.gov (United States)

Reynolds, C K; Kristensen, N B

2008-04-01

The extensive development of the ruminant forestomach sets apart their N economy from that of nonruminants in a number of respects. Extensive pregastric fermentation alters the profile of protein reaching the small intestine, largely through the transformation of nitrogenous compounds into microbial protein. This process is fueled primarily by carbohydrate fermentation and includes extensive recycling of N between the body and gut lumen pools. Nitrogen recycling occurs via blood and gut lumen exchanges of urea and NH(3), as well as endogenous gut and secretory N entry into the gut lumen, and the subsequent digestion and absorption of microbial and endogenous protein. Factors controlling urea transfer to the gut from blood, including the contributions of urea transporters, remain equivocal. Ammonia produced by microbial degradation of urea and dietary and endogenous AA is utilized by microbial fermentation or absorbed and primarily converted to urea. Therefore, microbial growth and carbohydrate fermentation affect the extent of NH(3) absorption and urea N recycling and excretion. The extensive recycling of N to the rumen represents an evolutionary advantage of the ruminant in terms of absorbable protein supply during periods of dietary protein deficiency, or asynchronous carbohydrate and protein supply, but incurs a cost of greater N intakes, especially in terms of excess N excretion. Efforts to improve the efficiency of N utilization in ruminants by synchronizing fermentable energy and N availability have generally met with limited success with regards to production responses. In contrast, imposing asynchrony through oscillating dietary protein concentration, or infrequent supplementation, surprisingly has not negatively affected production responses unless the frequency of supplementation is less than once every 3 d. In some cases, oscillation of dietary protein concentration has improved N retention compared with animals fed an equal amount of dietary protein on

Trifluoperazine inhibits acetaminophen-induced hepatotoxicity and hepatic reactive nitrogen formation in mice and in freshly isolated hepatocytes

Directory of Open Access Journals (Sweden)

Sudip Banerjee

Full Text Available The hepatotoxicity of acetaminophen (APAP occurs by initial metabolism to N-acetyl-p-benzoquinone imine which depletes GSH and forms APAP-protein adducts. Subsequently, the reactive nitrogen species peroxynitrite is formed from nitric oxide (NO and superoxide leading to 3-nitrotyrosine in proteins. Toxicity occurs with inhibited mitochondrial function. We previously reported that in hepatocytes the nNOS (NOS1 inhibitor NANT inhibited APAP toxicity, reactive nitrogen and oxygen species formation, and mitochondrial dysfunction. In this work we examined the effect of trifluoperazine (TFP, a calmodulin antagonist that inhibits calcium induced nNOS activation, on APAP hepatotoxicity and reactive nitrogen formation in murine hepatocytes and in vivo. In freshly isolated hepatocytes TFP inhibited APAP induced toxicity, reactive nitrogen formation (NO, GSNO, and 3-nitrotyrosine in protein, reactive oxygen formation (superoxide, loss of mitochondrial membrane potential, decreased ATP production, decreased oxygen consumption rate, and increased NADH accumulation. TFP did not alter APAP induced GSH depletion in the hepatocytes or the formation of APAP protein adducts which indicated that reactive metabolite formation was not inhibited. Since we previously reported that TFP inhibits the hepatotoxicity of APAP in mice without altering hepatic APAP-protein adduct formation, we examined the APAP treated mouse livers for evidence of reactive nitrogen formation. 3-Nitrotyrosine in hepatic proteins and GSNO were significantly increased in APAP treated mouse livers and decreased in the livers of mice treated with APAP plus TFP. These data are consistent with a hypothesis that APAP hepatotoxicity occurs with altered calcium metabolism, activation of nNOS leading to increased reactive nitrogen formation, and mitochondrial dysfunction. Keywords: Acetaminophen, Neuronal nitric oxide, Oxidative stress, Mitochondria

QQS orphan gene regulates carbon and nitrogen partitioning across species via NF-YC interactions.

Science.gov (United States)

Li, Ling; Zheng, Wenguang; Zhu, Yanbing; Ye, Huaxun; Tang, Buyun; Arendsee, Zebulun W; Jones, Dallas; Li, Ruoran; Ortiz, Diego; Zhao, Xuefeng; Du, Chuanlong; Nettleton, Dan; Scott, M Paul; Salas-Fernandez, Maria G; Yin, Yanhai; Wurtele, Eve Syrkin

2015-11-24

The allocation of carbon and nitrogen resources to the synthesis of plant proteins, carbohydrates, and lipids is complex and under the control of many genes; much remains to be understood about this process. QQS (Qua-Quine Starch; At3g30720), an orphan gene unique to Arabidopsis thaliana, regulates metabolic processes affecting carbon and nitrogen partitioning among proteins and carbohydrates, modulating leaf and seed composition in Arabidopsis and soybean. Here the universality of QQS function in modulating carbon and nitrogen allocation is exemplified by a series of transgenic experiments. We show that ectopic expression of QQS increases soybean protein independent of the genetic background and original protein content of the cultivar. Furthermore, transgenic QQS expression increases the protein content of maize, a C4 species (a species that uses 4-carbon photosynthesis), and rice, a protein-poor agronomic crop, both highly divergent from Arabidopsis. We determine that QQS protein binds to the transcriptional regulator AtNF-YC4 (Arabidopsis nuclear factor Y, subunit C4). Overexpression of AtNF-YC4 in Arabidopsis mimics the QQS-overexpression phenotype, increasing protein and decreasing starch levels. NF-YC, a component of the NF-Y complex, is conserved across eukaryotes. The NF-YC4 homologs of soybean, rice, and maize also bind to QQS, which provides an explanation of how QQS can act in species where it does not occur endogenously. These findings are, to our knowledge, the first insight into the mechanism of action of QQS in modulating carbon and nitrogen allocation across species. They have major implications for the emergence and function of orphan genes, and identify a nontransgenic strategy for modulating protein levels in crop species, a trait of great agronomic significance.

Storage and recycling utilization of leaf-nitrogen of jujube tree

International Nuclear Information System (INIS)

Zeng Xiang; Hao Zhongning

1991-01-01

16 N-urea was foliarly applied on bearing or young jujube tree in autumn of 1987. The effects of leaf-nitrogen retranslocation in the trees, positions of the N stored, forms of reserved N, and reutilization of storage N in the next year were studied. The results were as follows: 15 N returned and stored in all parts of the tree following foliar application of 15 N-urea. Root could use the nitrogen not only absorbed from soil but also transported from leaves. The above-ground organs and roots of jujube tree played the same important roles on nitrogen storage in winter. The main forms of storage nitrogen were protein-N, which was 2-3 fold more than non-protein-N. The storage nitrogen existed in above-ground parts was used first in early spring, and that returned from leaves last year could be prior used for the developments of leaves, branchlets and infloresences. The relative distribution of nitrogen in floresence was more in bearing tree than in young tree. In the next year, 15 N was redistributed in branchlets, leaves, flowers, young fruits and perennial spurs in autumn. The 15 N transported out of the treated spurs reappeared in next spring and further transported to neighboring spurs. The local storage N was prior used for growth. There was 21.49% of fertilizer-N stored in the young jujube trees when treated foliarly with urea in autumn of 1987. After one years's use, there was still 18.91% of fertilizer-N existed in the trees, which indicated a characteristic of circulatory utilization of nitrogen for a long period and the reutilized nitrogen was mainly from jujube leaves and deciduous branchlets

Dissolved nitrogen in drinking water resources of farming ...

African Journals Online (AJOL)

Dissolved nitrogen in drinking water resources of farming communities in Ghana. ... African Journal of Environmental Science and Technology ... Concentrations of these potentially toxic substances were below WHO acceptable limits for surface and groundwaters, indicating these water resources appear safe for drinking ...

Nitrogen detected TROSY at high field yields high resolution and sensitivity for protein NMR

Energy Technology Data Exchange (ETDEWEB)

Takeuchi, Koh [National Institute for Advanced Industrial Science and Technology, Molecular Profiling Research Center for Drug Discovery (Japan); Arthanari, Haribabu [Harvard Medical School, Department of Biochemistry and Molecular Pharmacology (United States); Shimada, Ichio, E-mail: shimada@iw-nmr.f.u-tokyo.ac.jp [National Institute for Advanced Industrial Science and Technology, Molecular Profiling Research Center for Drug Discovery (Japan); Wagner, Gerhard, E-mail: gerhard-wagner@hms.harvard.edu [Harvard Medical School, Department of Biochemistry and Molecular Pharmacology (United States)

2015-12-15

Detection of {sup 15}N in multidimensional NMR experiments of proteins has sparsely been utilized because of the low gyromagnetic ratio (γ) of nitrogen and the presumed low sensitivity of such experiments. Here we show that selecting the TROSY components of proton-attached {sup 15}N nuclei (TROSY {sup 15}N{sub H}) yields high quality spectra in high field magnets (>600 MHz) by taking advantage of the slow {sup 15}N transverse relaxation and compensating for the inherently low {sup 15}N sensitivity. The {sup 15}N TROSY transverse relaxation rates increase modestly with molecular weight but the TROSY gain in peak heights depends strongly on the magnetic field strength. Theoretical simulations predict that the narrowest line width for the TROSY {sup 15}N{sub H} component can be obtained at 900 MHz, but sensitivity reaches its maximum around 1.2 GHz. Based on these considerations, a {sup 15}N-detected 2D {sup 1}H–{sup 15}N TROSY-HSQC ({sup 15}N-detected TROSY-HSQC) experiment was developed and high-quality 2D spectra were recorded at 800 MHz in 2 h for 1 mM maltose-binding protein at 278 K (τ{sub c} ∼ 40 ns). Unlike for {sup 1}H detected TROSY, deuteration is not mandatory to benefit {sup 15}N detected TROSY due to reduced dipolar broadening, which facilitates studies of proteins that cannot be deuterated, especially in cases where production requires eukaryotic expression systems. The option of recording {sup 15}N TROSY of proteins expressed in H{sub 2}O media also alleviates the problem of incomplete amide proton back exchange, which often hampers the detection of amide groups in the core of large molecular weight proteins that are expressed in D{sub 2}O culture media and cannot be refolded for amide back exchange. These results illustrate the potential of {sup 15}N{sub H}-detected TROSY experiments as a means to exploit the high resolution offered by high field magnets near and above 1 GHz.

Towards understanding the nitrogen signal transduction for nif gene expression in Klebsiella pneumoniae.

Science.gov (United States)

Glöer, Jens; Thummer, Robert; Ullrich, Heike; Schmitz, Ruth A

2008-12-01

In the diazotroph Klebsiella pneumoniae, the nitrogen sensory protein GlnK mediates the cellular nitrogen status towards the NifL/NifA system that regulates transcription of the nitrogen fixation genes in response to ammonium and molecular oxygen. To identify amino acids of GlnK essential for this signal transduction by protein-protein interaction, we performed random point mutagenesis by PCR amplification under conditions of reduced Taq polymerase fidelity. Three thousand two hundred mutated glnK genes were screened to identify those that would no longer complement a K. pneumoniaeDeltaglnK strain for growth under nitrogen fixing conditions. Twenty-four candidates resulting in a Nif(-) phenotype were identified, carrying 1-11 amino acid changes in GlnK. Based on these findings, as well as structural data, several single mutations were introduced into glnK by site-directed mutagenesis, and the Nif phenotype and the respective effects on NifA-mediated nif gene induction was monitored in K. pneumoniae using a chromosomal nifK'-'lacZ fusion. Single amino acid changes resulting in significant nif gene inhibition under nitrogen limiting conditions were located within the highly conserved T-loop (A43G, A49T and N54D), the body of the protein (G87V and K79E) and in the C-terminal region (I100M, R103S, E106Q and D108G). Complex formation analyses between GlnK (wild-type or derivatives) and NifL or NifA in response to 2-oxoglutarate indicated that: (a) besides the T-loop, the C-terminal region of GlnK is essential for the interaction with NifL and NifA and (b) GlnK binds both proteins in the absence of 2-oxoglutarate, whereas, in the presence of 2-oxoglutarate, NifA is released but NifL remains bound to GlnK.

Properties of non-stoichiometric nitrogen doped LPCVD silicon thin films

Energy Technology Data Exchange (ETDEWEB)

Mansour, F.; Mahamdi, R. [Departement d' Electronique, Universite Mentouri, Constantine (Algeria); Beghoul, M.R. [Departement d' Electronique, Universite de Jijel (Algeria); Temple-Boyer, P. [CNRS, LAAS, Toulouse (France); Universite de Toulouse, UPS, INSA, INP, ISAE, LAAS, Toulouse (France); Bouridah, H.

2010-02-15

The influence of nitrogen on the internal structure and so on the electrical properties of silicon thin films obtained by low-pressure chemical vapor deposition (LPCVD) was studied using several investigation methods. We found by using Raman spectroscopy and SEM observations that a strong relationship exists between the structural order of the silicon matrix and the nitrogen ratio in film before and after thermal treatment. As a result of the high disorder caused by nitrogen on silicon network during the deposit phase of films, the crystallization phenomena in term of nucleation and crystalline growth were found to depend upon the nitrogen content. Resistivity measurements results show that electrical properties of NIDOS films depend significantly on structural properties. It was appeared that for high nitrogen content, the films tend to acquire an insulator behavior. (copyright 2010 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

(Methyl)ammonium Transport in the Nitrogen-Fixing Bacterium Azospirillum brasilense

Science.gov (United States)

Van Dommelen, Anne; Keijers, Veerle; Vanderleyden, Jos; de Zamaroczy, Miklos

1998-01-01

An ammonium transporter of Azospirillum brasilense was characterized. In contrast to most previously reported putative prokaryotic NH4+ transporter genes, A. brasilense amtB is not part of an operon with glnB or glnZ which, in A. brasilense, encode nitrogen regulatory proteins PII and PZ, respectively. Sequence analysis predicts the presence of 12 transmembrane domains in the deduced AmtB protein and classifies AmtB as an integral membrane protein. Nitrogen regulates the transcription of the amtB gene in A. brasilense by the Ntr system. amtB is the first gene identified in A. brasilense whose expression is regulated by NtrC. The observation that ammonium uptake is still possible in mutants lacking the AmtB protein suggests the presence of a second NH4+ transport mechanism. Growth of amtB mutants at low ammonium concentrations is reduced compared to that of the wild type. This suggests that AmtB has a role in scavenging ammonium at low concentrations. PMID:9573149

Behaviour and fate of animal waste nitrogen and soluble ions in the agricultural environment with particular reference to rice. Part of a coordinated programme on agricultural nitrogen residues with particular reference to their conservation as fertilizers and behaviour as potential pollutants

International Nuclear Information System (INIS)

Kobayashi, H.

1976-11-01

The fate of residual nitrogen and its fertilizer efficiency following application to rice plants in pots under controlled laboratory conditions have been studied. Nitrogen was applied as 15 N labelled fecal waste from goat and hog, and as chemical fertilizer (ammonium sulphate) respectively. Animal waste nitrogen was less effective than ammonium sulphate nitrogen in terms of rice yield. On the other hand residual nitrogen in the high soil layers was much higher for the organic nitrogen application and there appeared to be lower losses by volatilization (20-30% for animal waste N, 30-40% for ammonium sulphate nitrogen). Leaching losses were minimal and similar for both kinds of N-application (ca. 1%). Similar results were obtained under field conditions with alluvial, and ''sandy'' soils respectively. Plant recovery of N was greater from ammonium sulphate than from animal waste but overall losses in total balance studies appeared greater for N applied as ammonium sulphate under otherwise comparable conditions (30-40% of N applied as ammonium sulphate and 19-32% of N applied as fecal waste)

Commercial and home-made nitrogen modified titanias. A short reflection about the advantageous/disadvantageous properties of nitrogen doping in the frame of their applicability

Science.gov (United States)

Pap, Zs.; Mogyorósi, K.; Veréb, G.; Dombi, A.; Hernádi, K.; Danciu, V.; Baia, L.

2014-09-01

As visible light driven photocatalysis became more and more intensively studied, the first commercial products showed up on the market. Simultaneously controversial results appeared in the literature generating an intensive debate regarding the advantages and draw-backs of nitrogen doping of titania. Hence, the present work focuses on two commercially available and four sol-gel made nitrogen modified titania powders regarding their structure and activity. It is demonstrated that the interstitial nitrogen entities “leak out” from the catalysts if the material is irradiated with UV light, while substitutional nitrogen remains stable. However, the latter one was proven to be less important in the photocatalytic point of view. These observations were also valid in the case of sol-gel made nitrogen modified titanias. Furthermore, the results obtained after applying different spectroscopic methods (IR, XPS and DRS) shown that the yellow color of the titanias, does not necessary mean that a successful doping is achieved.

The value of symbiotic nitrogen fixation by grain legumes in comparison to the cost of nitrogen fertilizer used in developing countries

International Nuclear Information System (INIS)

Hardarson, G.; Bunning, S.; Montanez, A.; Roy, R.; MacMillan, A.

2001-01-01

A great challenge lies in devising more sustainable farming systems without compromising food production levels and food security. Obviously, increasing productivity is necessary to accommodate growth in the global population. World wide, the environmental factors that most severely restrict plant growth are the availability of water and nitrogen. The challenges in developing countries are to find ways of meeting this additional nitrogen demand without concomitant degrading natural productivity. Widespread adoption of biological nitrogen fixation (BNF) would contribute to this goal. BNF, together with adequate N management in the ecosystem, appears to be the most promising alternative to increasing the use of inorganic fertiliser nitrogen. BNF technologies represent economic, sustainable and environmentally friendly means of ensuring the nitrogen requirement of an agro-ecosystem. Here we investigate the value of BNF by grain legumes and compares it to the cost of nitrogen fertilizer used in developing countries. Our data show that major grain legumes fix approximately 11.1 million metric tons of nitrogen per annum in developing countries. If this N was supplied by inorganic fertiliser one would have to apply at least double that amount to achieve the same yields, and this would cost approximately 6.7 billion US dollars. As the eight major grain legumes grown in developing countries contribute 30 - 40% of the annual N requirement the contribution of BNF is of great economic and environmental importance. (author)

Impact of fermentation on nitrogenous compounds of cocoa beans (Theobroma cacao L.) from various origins.

Science.gov (United States)

Hue, C; Gunata, Z; Breysse, A; Davrieux, F; Boulanger, R; Sauvage, F X

2016-02-01

Tangential filtration technique was used to separate and quantify three different fractions of nitrogenous compounds depending on their molecular size, during cocoa fermentation. On every phenotype and origin analyzed, protein profile of non-fermented samples was similar. During fermentation course, proteins get degraded with a concomitant increase in amino acids content. Peptides between 3 and 10 kDa were observed at low levels. A strong correlation between amino acids and ammonia nitrogen, a fermentation marker was found. Attention was drawn on each fraction, and enabled to point out other phenomenon occurring during fermentation. The migration of some nitrogenous compounds towards the bean shell during fermentation was demonstrated. Acetone treatment of cocoa powder prior to SDS-PAGE led to losses of nitrogenous compounds. This result gives clues on the tanning phenomenon carried out by polyphenols on nitrogenous compounds, phenomenon which increases during fermentation. Copyright © 2015. Published by Elsevier Ltd.

Optimum dietary protein requirement in nondiabetic maintenance hemodialysis patients.

Science.gov (United States)

Ohkawa, Sakae; Kaizu, Yukiko; Odamaki, Mari; Ikegaya, Naoki; Hibi, Ikuo; Miyaji, Kunihiko; Kumagai, Hiromichi

2004-03-01

There is controversy about whether the dietary protein requirement of 1.2 g/kg/d for hemodialysis (HD) patients, in the nutritional guidelines recommended by the National Kidney Foundation-Kidney Disease Outcomes Quality Initiative (NKF-KDOQI), is reasonable. A cross-sectional study was conducted in 129 stable HD patients without diabetes (84 men, 45 women) to investigate the association between the protein equivalent of nitrogen appearance normalized by ideal body weight (nPNAibw), an index of protein intake, and skeletal muscle mass or other metabolic consequences. Patients were divided into 5 groups according to nPNAibw index. Midthigh muscle area (TMA), midthigh subcutaneous fat area (TSFA), abdominal muscle area (AMA), abdominal subcutaneous fat area (ASFA), and visceral fat area (AVFA) were measured using computed tomography, and various nutritional parameters were compared among these groups. TMA and AMA values increased with increasing dietary protein intake from less than 0.7 g/kg/d to 0.9-1.1 g/kg/d and showed a plateau at greater than 0.9 to 1.1 g/kg/d of dietary protein intake. Conversely, fat mass, including TSFA, ASFA, and AVFA, and serum potassium concentration increased with graded protein intake, and no plateau was formed. Patients with nPNAibw greater than 1.3 g/kg/d satisfied the criterion of visceral obesity. Although serum prealbumin levels showed a trend similar to that of muscle mass, there was no significant difference in serum albumin levels among the study groups. Optimal dietary protein requirement for patients undergoing maintenance HD in a stable condition appears to be less than the level recommended by the NKF-KDOQI nutritional guidelines.

Thermal activation of nitrogen acceptors in ZnO thin films grown by MOCVD

Energy Technology Data Exchange (ETDEWEB)

Dangbegnon, J.K.; Talla, K.; Botha, J.R. [Department of Physics, Nelson Mandela Metropolitan University, P.O. Box 77000, Port Elizabeth (South Africa)

2010-06-15

Nitrogen doping in ZnO is inhibited by spontaneous formation of compensating defects. Perfect control of the nitrogen doping concentration is required, since a high concentration of nitrogen could induce the formation of donor defects involving nitrogen. In this work, the effect of post-growth annealing in oxygen ambient on ZnO thin films grown by Metalorganic Chemical Vapor Deposition, using NO as both oxidant and nitrogen dopant, is studied. After annealing at 700 C and above, low-temperature photoluminescence shows the appearance of a transition at {proportional_to}3.23 eV which is interpreted as pair emission involving a nitrogen acceptor. A second transition at {proportional_to}3.15 eV is also discussed. This work suggests annealing as a potential means for p-type doping using nitrogen (copyright 2010 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

IMPROVING NITROGEN FERTILIZER ABSORPTION AND ITS EFFECT ON QUALITY AND SEED YIELD OF CORN (Zea mays

Directory of Open Access Journals (Sweden)

Kuswanto

2013-06-01

Full Text Available Improving nitrogen uptake by pyraclostrobin application in maize under green house and field conditions were investigated. There were three series experiments conducted in dry season, 2011 and 2012. The research conducted using nested design and three replications. Nested design applied to get information as careful as possible about the role of treatment, especially the main factor. The first and second experiments hold at field and green house and the third experiment hold at green house. They had two factors, pyraclostrobin application and nitrogen fertilizer. Vegetative growth, flowering and earing age, chlorophyll content, yield, amylose and protein content evaluated. Application of pyraclostrobin, significantly increase nitrogen fertilizer efficiency. Amylose content and fresh yield were different on nitrogen and pyraclostrobin application. Application of pyraclostrobin 400 ml/ha significantly increase amylose 10.85-18.5%. Both of amylose and protein content were increased by nitrogen fertilizer application. Vegetative growth and chlorophyll content were affected by nitrogen and pyraclostrobin.

Protein requirements of finishing paca (Cuniculus paca).

Science.gov (United States)

Nogueira-Filho, Sérgio Luiz Gama; Bastos, Ivanise da Hora; Mendes, Alcester; Nogueira, Selene Siqueira da Cunha

2016-06-01

We conducted a nitrogen balance digestion trial to determine the crude protein requirements of paca (Cuniculus paca) during the last growth phase. In a 4 × 4 Latin square design, four young captive male pacas, aged 5 months, were fed four isoenergetic diets containing four different levels of nitrogen (N) (11.3, 16.6, 21.4, and 26.6 g N/kg of dry matter). After 15 days of adaptation, we collected all feces and urine for five consecutive days. By regression analysis between N intake and N in feces and urine, the metabolic fecal nitrogen (MFN = 4.2 g/kg of dry matter intake) and daily endogenous urinary N (EUN = 91.6 mg/kg(0.75)) were determined. Likewise, by regression analyses between nitrogen intake and nitrogen retention [NR = N intake-(fecal N + urine N)], we estimated the daily requirement of 280.5 mg N/kg(0.75). Therefore, a minimum of 55 g crude protein per kilogram dry matter and 13 MJ/kg of digestible energy are required by finishing paca on unrestricted diets. Such values are similar to those of other wild frugivores and below those of growing rabbits. The data confirm that farmers overfeed protein, and similar growth can be more economically achieved on lower protein diets.

Studies with nitrogen-15-labelled amino acids for a quantitative description of nitrogen metabolism in man

International Nuclear Information System (INIS)

Hartig, W.; Faust, H.; Czarnetzki, H.D.; Winkler, E.; Akademie der Wissenschaften der DDR, Leipzig. Zentralinstitut fuer Isotopen- und Strahlenforschung)

1977-01-01

The utilization of glycine in healthy and stressed persons has been studied by continuous infusion or oral administration. The results of our studies show that (1) Breakdown of protein is increased in stress conditions; (2) Amino acids are also synthesized to protein in stress, the percentage of amino acids used for synthesis being smaller in stress conditions; (3) The urea synthesis during stress is increased and accelerated; (4) In the isotopic steady state 23% of the 15 N-glycine administered by infusion to healthy persons and 41% of the amount administered to patients after cholecystectomy is eliminated (urea 16%/26%; ammonia 4%/5%); using a single oral dose 24% is eliminated as total N after 24h (19% as 15 N-urea and 4% as 15 N-ammonia); (5) Depending on the method of gastric surgery the absorption and elimination rate of glycine-N varied; the more rapid intestinal absorption of glycine in comparison with healthy persons leads to a higher 15 N elimination via urine, and causes a disturbance of the nitrogen metabolism and nitrogen balance. (author)

Mineral commodity profiles: nitrogen

Science.gov (United States)

Kramer, Deborah A.

2004-01-01

Overview -- Nitrogen (N) is an essential element of life and a part of all animal and plant proteins. As a part of the DNA and RNA molecules, nitrogen is an essential constituent of each individual's genetic blueprint. As an essential element in the chlorophyll molecule, nitrogen is vital to a plant's ability to photosynthesize. Some crop plants, such as alfalfa, peas, peanuts, and soybeans, can convert atmospheric nitrogen into a usable form by a process referred to as 'fixation.' Most of the nitrogen that is available for crop production, however, comes from decomposing animal and plant waste or from commercially produced fertilizers. Commercial fertilizers contain nitrogen in the form of ammonium and/or nitrate or in a form that is quickly converted to the ammonium or nitrate form once the fertilizer is applied to the soil. Ammonia is generally the source of nitrogen in fertilizers. Anhydrous ammonia is commercially produced by reacting nitrogen with hydrogen under high temperatures and pressures. The source of nitrogen is the atmosphere, which is almost 80 percent nitrogen. Hydrogen is derived from a variety of raw materials, which include water, and crude oil, coal, and natural gas hydrocarbons. Nitrogen-based fertilizers are produced from ammonia feedstocks through a variety of chemical processes. Small quantities of nitrates are produced from mineral resources principally in Chile. In 2002, anhydrous ammonia and other nitrogen materials were produced in more than 70 countries. Global ammonia production was 108 million metric tons (Mt) of contained nitrogen. With 28 percent of this total, China was the largest producer of ammonia. Asia contributed 46 percent of total world ammonia production, and countries of the former U.S.S.R. represented 13 percent. North America also produced 13 percent of the total; Western Europe, 9 percent; the Middle East, 7 percent; Central America and South America, 5 percent; Eastern Europe, 3 percent; and Africa and Oceania

Effect of different nitrogen sources on growth, yield and quality of fodder maize (Zea mays L.

Directory of Open Access Journals (Sweden)

Mohamed El-Murtada Hassan Amin

2011-01-01

The present data revealed that, the crude protein and crude fiber were significantly affected by nitrogen sources in both seasons. The urea gave the lowest crude protein compared with the other nitrogen sources. On the other hand, the lowest crude fiber content was recorded when plant was treated with (ASN fertilizer, while the highest crude fiber content was recorded only under the control.

Efficiency of Different Nitrogen Forms in Buckwheat (Fagopyrum esculentum Moench

Directory of Open Access Journals (Sweden)

Burhan Kara

2016-06-01

Full Text Available The research was carried out with aim to determination the efficient of nitrogen forms (ammonium sulfate, ammonium nitrate and urea on nitrogen use efficient for buckwheat in Isparta during 2014 and 2015 years. All the examined characteristics were determined higher values in applied nitrogen forms according to non-nitrogen parcel. In compared to nitrogen forms, the highest grain yield (1456 and 1325 kg ha-1, biological yield (4873 and 4512 kg ha-1, 1000 grain weight (24.9 and 24.8 g, agronomic efficient (24.96% and 24.25%, recycling efficient (0.24% and 0.22% and utilization efficient (0.25% and 0.18% were obtained from ammonium sulfate, the highest protein content (11.37% and 12.44% and agro-physiological efficient (0.27% and 0.24% from ammonium nitrate in both years. Among the nitrogen forms weren’t significant differently in physiological efficient in both years, recycling and utilization efficient in the first year. The mineral nutrient content varied according to nitrogen forms. Generally, ammonium sulfate was positive effect to yield and some quality parameters.

Influence of irrigation and nitrogen fertilization on grain yield and some baking quality characteristics of spring wheat

Directory of Open Access Journals (Sweden)

Paavo Elonen

1975-05-01

Full Text Available In the years 1967—70 twelve irrigation experiments of spring wheat were carried out in southern Finland (60-62° N, 22-26° E. Sprinkler irrigation (2 X 30 mm increased the grain yields on an average by 1240±470kg/ha (from 2740 to 3980 kg or 45±17 %. The increases in yield were significant on clay soils (9 trials and loam (1 trial but insignificant on fines and (1 trial and mould (1 trial. Additional nitrogen fertilization (from 76 to 143kg/ha N increased the grain yields on an average by 350± 200 kg/ha or 11±6 %. The ripening of wheat was significantly promoted by irrigation in one year but slightly retarded in three years. Nitrogen fertilization slightly retarded ripening every year The falling number of grains tended to be slightly improved by irrigation (from 285 to 321, on an average, but in most trials irrigation and nitrogen fertilization had no significant influence on the falling number. Irrigation decreased the crude protein content of grains in all trials, on an average by 2.2 ± 0.7 %-units (from 16.3 to 14.1%. This unfavourable effect was, however, avoided with additional nitrogen which increased the protein content by 1.9±0.4%-units (from 14,3 to 16.2 %. The effects of irrigation and nitrogen fertilization on those characteristics of wheat that are correlated with protein, were similar to the effects on the protein content. Thus, irrigation decreased the zeleny value (from 64 to 53 ml, cold viscosity (from 214 to 114 seconds, water absorption (from 66.5 to 64.9 % and the valorimeter value (from 68 to 60, while these characteristics were improved by nitrogen fertilization. Irrigation did not decrease the Pelshenke value but increased significantly the ratio of the Pelshenke value/protein content (from 5,1 to 6.1. This indicates that the quality of protein was improved by irrigation, while the effect of nitrogen fertilization was the reverse. In fact, irrigation and additional nitrogen fertilization affected the quantity and

Assessment of safety and efficiency of nitrogen organic fertilizers from animal-based protein hydrolysates--a laboratory multidisciplinary approach.

Science.gov (United States)

Corte, Laura; Dell'abate, Maria Teresa; Magini, Alessandro; Migliore, Melania; Felici, Barbara; Roscini, Luca; Sardella, Roccaldo; Tancini, Brunella; Emiliani, Carla; Cardinali, Gianluigi; Benedetti, Anna

2014-01-30

Protein hydrolysates or hydrolysed proteins (HPs) are high-N organic fertilizers allowing the recovery of by-products (leather meal and fluid hydrolysed proteins) otherwise disposed of as polluting wastes, thus enhancing matter and energy conservation in agricultural systems while decreasing potential pollution. Chemical and biological characteristics of HPs of animal origin were analysed in this work to assess their safety, environmental sustainability and agricultural efficacy as fertilizers. Different HPs obtained by thermal, chemical and enzymatic hydrolytic processes were characterized by Fourier transform infrared spectroscopy and sodium dodecyl sulfate polyacrylamide gel electrophoresis, and their safety and efficacy were assessed through bioassays, ecotoxicological tests and soil biochemistry analyses. HPs can be discriminated according to their origin and hydrolysis system by proteomic and metabolomic methods. Three experimental systems, soil microbiota, yeast and plants, were employed to detect possible negative effects exerted by HPs. The results showed that these compounds do not significantly interfere with metabolomic activity or the reproductive system. The absence of toxic and genotoxic effects of the hydrolysates prepared by the three hydrolytic processes suggests that they do not negatively affect eukaryotic cells and soil ecosystems and that they can be used in conventional and organic farming as an important nitrogen source derived from otherwise highly polluting by-products. © 2013 Society of Chemical Industry.

Agronomic Factors Related to the Quality of Wheat for the Starch Industry : Part II, Nitrogen Fertilization and Overall Conclusions

NARCIS (Netherlands)

Kelfkens, M.; Hamer, R.J.

1991-01-01

In the N.W.-European wheat growing system high levels of nitrogen fertiliser are applied. Especially late nitrogen applications are thought to increase the amount of soluble proteins, leading to extra losses and wastage. On the other hand, protein content is the most important factor determining

Levels of multiple supplements or nitrogen salt for beef heifers in pasture during the dry season

Directory of Open Access Journals (Sweden)

Ériton Egidio Lisboa Valente

2011-09-01

Full Text Available The study assessed performance, microbial protein synthesis, intake and digestibility of nutrients by beef heifers receiving levels of multiple supplements or nitrogen salt, in a self-controlled intake, on pasture, during the dry season. Thirty-five beef heifers, from 6 to 9 months of age and average initial body weight of 203.4 + 4.5 kg, were used. Study factors were: control - mineral mixture; nitrogen salt - 50% of urea + mineral mixture, at proportion of 1:1, and 50% of corn (75% of crude protein; levels of multiple supplementation - multiple supplements with different percentages of intake controller mixture (urea + mineral mixture, at the proportion of 1:1, corn and soybean meal (45% of crude protein. Supplement consumptions observed were: 115, 173, 572 and 1214 g/animal/day for animals fed on nitrogen salt, low, medium and high levels of multiple supplement, respectively. Supplemented animals had greater average daily gain, evidencing the positive linear effect of the levels of multiple supplementation on average daily gain. Overall, there were no significant differences between average daily gain of animals fed on multiple supplements or nitrogen salt. Supplementation increased the intake and digestibility of nutrients, except for digestibility of neutral detergent fiber, although the intake of digested neutral detergent fiber increased. Supplementation increased the production of microbial nitrogen as well as nitrogen losses in urine, although the quantity of nitrogen assimilated by bacteria, proportionally to intake, was higher. Supplementation improves nutritional parameters and weight gain.

Isolate-specific conidiation in Trichoderma in response to different nitrogen sources.

Science.gov (United States)

Steyaert, Johanna M; Weld, Richard J; Stewart, Alison

2010-01-01

A characteristic feature of Trichoderma is the production of concentric rings of conidia in response to alternating light/dark conditions and a single ring of conidia in response to a single burst of light. In this study, conidiation was investigated in four biocontrol isolates (T. hamatum, T. atroviride, T. asperellum, T. virens) and one isolate from the mushroom pathogen species, T. pleuroticola. All five isolates produced concentric conidial rings under alternating light/dark conditions on potato-dextrose agar (PDA), however, in response to a 15min burst of blue light, only T. asperellum and T. virens produced a clearly defined conidial ring. Both T. pleuroticola and T. hamatum photoconidiated in a disk-like fashion and T. atroviride produced a broken ring with a partially filled in appearance. In the presence of primary nitrogen, T. asperellum and T. pleuroticola conidiated in a disk, whereas, when grown in the presence of secondary nitrogen, a ring of conidia was produced. Primary nitrogen promoted photoconidiation and competency to conidiate in response to light appeared dependent on the nitrogen catabolite repression state of the cell. Mycelial injury was also investigated in the same five isolates of Trichoderma on PDA and under different nitrogen statuses. For the first time, we report that conidiation in response to injury is differentially regulated in different isolates/species of Trichoderma. Copyright © 2009 The British Mycological Society. Published by Elsevier Ltd. All rights reserved.

Stable Isotope Identification of Nitrogen Sources for United ...

Science.gov (United States)

We used natural abundance stable isotope data to evaluate nitrogen sources to U.S. west coast estuaries. We collected δ15N of macroalgae data and supplemented this with available data from the literature for estuaries from Mexico to Alaska. Stable isotope ratios of green macroalgae were compared to δ15N of dissolved inorganic nitrogen of oceanic and watershed end members. There was a latitudinal gradient in δ15N of macroalgae with southern estuaries being 7 per mil heavier than northern estuaries. Gradients in isotope data were compared to nitrogen sources estimated by the USGS using the SPARROW model. In California estuaries, the elevation of isotope data appeared to be related to anthropogenic nitrogen sources. In Oregon systems, the nitrogen levels of streams flowing into the estuaries are related to forest cover, rather than to developed land classes. In addition, the δ15N of macroalgae suggested that the ocean and nitrogen-fixing trees in the watersheds were the dominant nitrogen sources. There was also a strong gradient in δ15N of macroalgae with heavier sites located near the estuary mouth. In some Oregon estuaries, there was an elevation an elevation of δ15N above marine end members in the vicinity of wastewater treatment facility discharge locations, suggesting isotopes may be useful for distinguishing inputs along an estuarine gradient. Nutrients are the leading cause of water quality impairments in the United States, and as a result too

Bacterial Degradation of Nitrogenous Energetic Compounds (NEC) in Coastal Waters and Sediments

Science.gov (United States)

2008-09-10

isotope values in the upper bay; C) DOC appears to be high in lignin concentration, especially in the Patuxent River. Figure 12. Bacterial...polycyclic aromatic hydrocarbons (PAHs, lignin ; Suen et al. 1996). We hypothesized that nitrogenous energetics will be transient in nitrogen-limited...water, TNT nitro groups can be reduced to amines (Barrows et al. 1996) affecting its reactivity (Achtnich et al. 2000). The presence of reduced

The importance of cytosolic glutamine synthetase in nitrogen assimilation and recycling

Energy Technology Data Exchange (ETDEWEB)

Bernard, S.M.; Habash, D.Z.

2009-07-02

Glutamine synthetase assimilates ammonium into amino acids, thus it is a key enzyme for nitrogen metabolism. The cytosolic isoenzymes of glutamine synthetase assimilate ammonium derived from primary nitrogen uptake and from various internal nitrogen recycling pathways. In this way, cytosolic glutamine synthetase is crucial for the remobilization of protein-derived nitrogen. Cytosolic glutamine synthetase is encoded by a small family of genes that are well conserved across plant species. Members of the cytosolic glutamine synthetase gene family are regulated in response to plant nitrogen status, as well as to environmental cues, such as nitrogen availability and biotic/abiotic stresses. The complex regulation of cytosolic glutamine synthetase at the transcriptional to post-translational levels is key to the establishment of a specific physiological role for each isoenzyme. The diverse physiological roles of cytosolic glutamine synthetase isoenzymes are important in relation to current agricultural and ecological issues.

Increased protein content of chickpea (Cicer arietinum L.) inoculated with arbuscular mycorrhizal fungi and nitrogen-fixing bacteria under water deficit conditions.

Science.gov (United States)

Oliveira, Rui S; Carvalho, Patrícia; Marques, Guilhermina; Ferreira, Luís; Nunes, Mafalda; Rocha, Inês; Ma, Ying; Carvalho, Maria F; Vosátka, Miroslav; Freitas, Helena

2017-10-01

Chickpea (Cicer arietinum L.) is a widely cropped pulse and an important source of proteins for humans. In Mediterranean regions it is predicted that drought will reduce soil moisture and become a major issue in agricultural practice. Nitrogen (N)-fixing bacteria and arbuscular mycorrhizal (AM) fungi have the potential to improve plant growth and drought tolerance. The aim of the study was to assess the effects of N-fixing bacteria and AM fungi on the growth, grain yield and protein content of chickpea under water deficit. Plants inoculated with Mesorhizobium mediterraneum or Rhizophagus irregularis without water deficit and inoculated with M. mediterraneum under moderate water deficit had significant increases in biomass. Inoculation with microbial symbionts brought no benefits to chickpea under severe water deficit. However, under moderate water deficit grain crude protein was increased by 13%, 17% and 22% in plants inoculated with M. mediterraneum, R. irregularis and M. mediterraneum + R. irregularis, respectively. Inoculation with N-fixing bacteria and AM fungi has the potential to benefit agricultural production of chickpea under water deficit conditions and to contribute to increased grain protein content. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

N-cadherin in adult rat cardiomyocytes in culture. II. Spatio-temporal appearance of proteins involved in cell-cell contact and communication. Formation of two distinct N-cadherin/catenin complexes.

Science.gov (United States)

Hertig, C M; Butz, S; Koch, S; Eppenberger-Eberhardt, M; Kemler, R; Eppenberger, H M

1996-01-01

The spatio-temporal appearance and distribution of proteins forming the intercalated disc were investigated in adult rat cardiomyocytes (ARC). The 'redifferentiation model' of ARC involves extensive remodelling of the plasma membrane and of the myofibrillar apparatus. It represents a valuable system to elucidate the formation of cell-cell contact between cardiomyocytes and to assess the mechanisms by which different proteins involved in the cell-cell adhesion process are sorted in a precise manner to the sites of function. Appearance of N-cadherin, the catenins and connexin43 within newly formed adherens and gap junctions was studied. Here first evidence is provided for a formation of two distinct and separable N-cadherin/catenin complexes in cardiomyocytes. Both complexes are composed of N-cadherin and alpha-catenin which bind to either beta-catenin or plakoglobin in a mutually exclusive manner. The two N-cadherin/catenin complexes are assumed to be functionally involved in the formation of cell-cell contacts in ARC; however, the differential appearance and localization of the two types of complexes may also point to a specific role during ARC differentiation. The newly synthesized beta-catenin containing complex is more abundant during the first stages in culture after ARC isolation, while the newly synthesized plakoglobin containing complex progressively accumulates during the morphological changes of ARC. ARC formed a tissue-like pattern in culture whereby the new cell-cell contacts could be dissolved through Ca2+ depletion. Presence of cAMP and replenishment of Ca2+ content in the culture medium not only allowed reformation of cell-cell contacts but also affected the relative protein ratio between the two N-cadherin/catenin complexes, increasing the relative amount of newly synthesized beta-catenin over plakoglobin at a particular stage of ARC differentiation. The clustered N-cadherin/catenin complexes at the plasma membrane appear to be a prerequisite for the

21 CFR 862.1515 - Nitrogen (amino-nitrogen) test system.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Nitrogen (amino-nitrogen) test system. 862.1515... Systems § 862.1515 Nitrogen (amino-nitrogen) test system. (a) Identification. A nitrogen (amino-nitrogen) test system is a device intended to measure amino acid nitrogen levels in serum, plasma, and urine...

Effect of Nitrogen Fertilizers on the Lysine Synthesis in Silo-Maize

Energy Technology Data Exchange (ETDEWEB)

Cencelj, J.; Jelenic, Dj. [Institute for the Application of Nuclear Energy in Agriculture, Veterinary Medicine and Forestry, Belgrade, Yugoslavia (Serbia)

1968-07-01

In investigations on amino acids of silo-maize, different nitrogen fertilizers were studied to determine their effect on amino acid composition and variation during the growth period. The experiment was carried out with silo-maize, hybrid W 464A, grown on sandy soil, which had not been treated for six years with either fertilizers or manure. Before cultivation phosphorus and potassium fertilizers were applied, and the nitrogen fertilizers, ammonium sulphate, ammonium nitrate, calcium cyanamide and urea, were applied at the most appropriate time of application. The first samples were taken at the time of flowering, the second after flowering, and the third, fourth and fifth in the lactic, wax, and full maturity phases, respectively. The percentages of crude protein of the maize gradually decreased while the nitrogen-free extraction matter increased during this period. The protein content of the maize was highest with sodium nitrate and urea fertilization and lowest when calcium cyanamide was used. Investigations to determine whether or not an increase in crude protein content was correlated with an increased content of lysine have shown that there is a correlation when plants are fertilized with calcium cyanamide. The content of essential amino acids was more satisfactory in plants fertilized with urea than with sodium nitrate. According to the statistical analysis, the best improvement in lysine content was obtained with urea (0.23%), the least satisfactory with calcium cyanamide (0.17%), and PK fertilizers without nitrogen (0.15%). (author)

Uptake of fertilizer nitrogen and soil nitrogen by rice using 15N-labelled nitrogen fertilizer

International Nuclear Information System (INIS)

Reddy, K.R.; Patrick, W.H. Jr.

1980-01-01

Data from five field experiments using labelled nitrogen fertilizer were used to determine the relative effects of soil nitrogen and fertilizer nitrogen on rice yield. Yield of grain was closely correlated with total aboveground nitrogen uptake (soil + fertilizer), less closely correlated with soil nitrogen uptake and not significantly correlated with fertilizer nitrogen uptake. When yield increase rather than yield was correlated with fertilizer nitrogen uptake, the correlation coefficient was statistically significant. (orig.)

[Progress in inversion of vegetation nitrogen concentration by hyperspectral remote sensing].

Science.gov (United States)

Wang, Li-Wen; Wei, Ya-Xing

2013-10-01

Nitrogen is the necessary element in life activity of vegetation, which takes important function in biosynthesis of protein, nucleic acid, chlorophyll, and enzyme etc, and plays a key role in vegetation photosynthesis. The technology about inversion of vegetation nitrogen concentration by hyperspectral remote sensing has been the research hotspot since the 70s of last century. With the development of hyperspectral remote sensing technology in recent years, the advantage of spectral bands subdivision in a certain spectral region provides the powerful technology measure for correlative spectral characteristic research on vegetation nitrogen. In the present paper, combined with the newest research production about monitoring vegetation nitrogen concentration by hyperspectral remote sensing published in main geography science literature in recent several years, the principle and correlated problem about monitoring vegetation nitrogen concentration by hyperspectral remote sensing were introduced. From four aspects including vegetation nitrogen spectral index, vegetation nitrogen content inversion based on chlorophyll index, regression model, and eliminating influence factors to inversion of vegetation nitrogen concentration, main technology methods about inversion of vegetation nitrogen concentration by hyperspectral remote sensing were detailedly introduced. Correlative research conclusions were summarized and analyzed, and research development trend was discussed.

Laboratory Investigation of Mineralization of Refractory Nitrogen from Sewage Treatment Plants.

Science.gov (United States)

Benoit, Gaboury; Wang, Peng

2017-12-01

Laboratory studies were conducted and modeled to evaluate whether refractory organic nitrogen in tertiary-treated wastewater effluent could become bioavailable by conversion to mineral forms. Multiday incubations of effluent collected from the Branford and New Haven, Connecticut, waste water treatment plants (WWTP) revealed low but steady conversion of organic nitrogen to nitrate (NO 3 - ). In Branford, the principal form of organic nitrogen was dissolved, and in New Haven it was particulate. Modeling suggested that in both the cases conversion to NO 3 - from organic forms occurred at several per cent per day, and appeared to happen via the intermediary NH 4 + . The results suggest that organic nitrogen may be an important source of bioavailable N, contributing to the problem of hypoxia in Long Island Sound and other estuaries.

Laboratory Investigation of Mineralization of Refractory Nitrogen from Sewage Treatment Plants

Science.gov (United States)

Benoit, Gaboury; Wang, Peng

2017-12-01

Laboratory studies were conducted and modeled to evaluate whether refractory organic nitrogen in tertiary-treated wastewater effluent could become bioavailable by conversion to mineral forms. Multiday incubations of effluent collected from the Branford and New Haven, Connecticut, waste water treatment plants (WWTP) revealed low but steady conversion of organic nitrogen to nitrate (NO3 -). In Branford, the principal form of organic nitrogen was dissolved, and in New Haven it was particulate. Modeling suggested that in both the cases conversion to NO3 - from organic forms occurred at several per cent per day, and appeared to happen via the intermediary NH4 +. The results suggest that organic nitrogen may be an important source of bioavailable N, contributing to the problem of hypoxia in Long Island Sound and other estuaries.

Effect of l-glutamic acid supplementation on performance and nitrogen balance of broilers fed low protein diets.

Science.gov (United States)

Bezerra, R M; Costa, F G P; Givisiez, P E N; Freitas, E R; Goulart, C C; Santos, R A; Souza, J G; Brandão, P A; Lima, M R; Melo, M L; Rodrigues, V P; Nogueira, E T; Vieira, D V G

2016-06-01

The aim of this study was to evaluate the effect of protein reduction and supplementation of l-glutamic acid in male broiler diets. A total of 648 chicks of the Cobb 500 strain were distributed in a completely randomized design with six treatments and six replications with eighteen birds per experimental unit. The study comprised pre-starter (1-7 days), starter (8-21 days), growth (22-35 days) and final (36-45 days) phases. The first treatment consisted of a control diet formulated according to the requirements of essential amino acids for each rearing phase. The second and third treatments had crude protein (CP) reduced by 1.8 and 3.6 percentage points (pp) in relation to the control diet respectively. In the fourth treatment, l-glutamic acid was added to provide the same glutamate level as the control diet, and in the last two treatments, the broilers were supplemented with 1 and 2 pp of glutamate above that of the control diet respectively. The reduction in CP decreased the performance of broilers and the supplementation of l-glutamic acid did not influence performance when supplied in the diets with excess of glutamate. The lowest excreted nitrogen values were observed in the control diet, and treatments 2 and 3, respectively, in comparison with treatments with the use of l-glutamic acid (5 and 6). Retention efficiency of nitrogen was better in the control diet and in the treatment with a reduction of 1.8 pp of CP. It was verified that the serum uric acid level decreased with the CP reduction. A reduction in CP levels of up to 21.3%, 18.8%, 18.32% and 17.57% is recommended in phases from 1 to 7, 8 to 21, 22 to 35 and at 36 to 42 days, respectively, with a level of glutamate at 5.32%, 4.73%, 4.57%, 4.38%, also in these phases. Journal of Animal Physiology and Animal Nutrition © 2015 Blackwell Verlag GmbH.

Proteomic analysis of Herbaspirillum seropedicae reveals ammonium-induced AmtB-dependent membrane sequestration of PII proteins.

Science.gov (United States)

Huergo, Luciano F; Noindorf, Lilian; Gimenes, Camila; Lemgruber, Renato S P; Cordellini, Daniela F; Falarz, Lucas J; Cruz, Leonardo M; Monteiro, Rose A; Pedrosa, Fábio O; Chubatsu, Leda S; Souza, Emanuel M; Steffens, Maria B R

2010-07-01

This study was aimed at describing the spectrum and dynamics of proteins associated with the membrane in the nitrogen-fixing bacterium Herbaspirillum seropedicae according to the availability of fixed nitrogen. Using two-dimensional electrophoresis we identified 79 protein spots representing 45 different proteins in the membrane fraction of H. seropedicae. Quantitative analysis of gel images of membrane extracts indicated two spots with increased levels when cells were grown under nitrogen limitation in comparison with nitrogen sufficiency; these spots were identified as the GlnK protein and as a conserved noncytoplasmic protein of unknown function which was encoded in an operon together with GlnK and AmtB. Comparison of gel images of membrane extracts from cells grown under nitrogen limitation or under the same regime but collected after an ammonium shock revealed two proteins, GlnB and GlnK, with increased levels after the shock. The P(II) proteins were not present in the membrane fraction of an amtB mutant. The results reported here suggest that changes in the cellular localization of P(II) might play a role in the control of nitrogen metabolism in H. seropedicae.

Nitrogen utilization in pigs fed diets with soybean and rapeseed products leading to different ileal endogenous nitrogen losses

NARCIS (Netherlands)

Grala, W.; Verstegen, M.W.A.; Jansman, A.J.M.; Huisman, J.; Wasilewko, J.

1998-01-01

Nitrogen (N) balance was determined in 36 pigs (BW 24 to 30 kg) fed diets inducing different ileal endogenous N losses (ENL). We tested the hypothesis that enhanced ENL may be indicative of a higher recycling of endogenous proteins that will induce a greater urinary N loss and a lower efficiency of

Molecular nitrogen fixation and nitrogen cycle in nature

Energy Technology Data Exchange (ETDEWEB)

Virtanen, A I

1952-01-01

The origin of nitrogen oxides in the atmosphere is discussed. Evidently only a small proportion of the nitrate-and nitrite-nitrogen found in the precipitation is formed through electric discharges from molecular nitrogen, photochemical nitrogen fixation being probably of greater importance. Formation of nitrate nitrogen through atmospheric oxidation of nitrous oxide (N/sub 2/O) evaporating from the soil is also considered likely. Determination of nitrogen compounds at different altitudes is indispensable for gaining information of the N/sub 2/-fixation in the atmosphere and, in general, of the origin of nitrogen oxides and their decomposition. International cooperation is needed for this as well as for the quantitative determination of the nitrogen compounds removed from the soil by leaching and brought by waters into the seas.

Nitrogen acquisition in Agave tequilana from degradation of endophytic bacteria.

Science.gov (United States)

Beltran-Garcia, Miguel J; White, James F; Prado, Fernanda M; Prieto, Katia R; Yamaguchi, Lydia F; Torres, Monica S; Kato, Massuo J; Medeiros, Marisa H G; Di Mascio, Paolo

2014-11-06

Plants form symbiotic associations with endophytic bacteria within tissues of leaves, stems, and roots. It is unclear whether or how plants obtain nitrogen from these endophytic bacteria. Here we present evidence showing nitrogen flow from endophytic bacteria to plants in a process that appears to involve oxidative degradation of bacteria. In our experiments we employed Agave tequilana and its seed-transmitted endophyte Bacillus tequilensis to elucidate organic nitrogen transfer from (15)N-labeled bacteria to plants. Bacillus tequilensis cells grown in a minimal medium with (15)NH4Cl as the nitrogen source were watered onto plants growing in sand. We traced incorporation of (15)N into tryptophan, deoxynucleosides and pheophytin derived from chlorophyll a. Probes for hydrogen peroxide show its presence during degradation of bacteria in plant tissues, supporting involvement of reactive oxygen in the degradation process. In another experiment to assess nitrogen absorbed as a result of endophytic colonization of plants we demonstrated that endophytic bacteria potentially transfer more nitrogen to plants and stimulate greater biomass in plants than heat-killed bacteria that do not colonize plants but instead degrade in the soil. Findings presented here support the hypothesis that some plants under nutrient limitation may degrade and obtain nitrogen from endophytic microbes.

Supercapacitors based on nitrogen-doped reduced graphene oxide and borocarbonitrides

Science.gov (United States)

Gopalakrishnan, K.; Moses, Kota; Govindaraj, A.; Rao, C. N. R.

2013-12-01

Nitrogen-doped reduced graphene oxide (RGO) samples with different nitrogen content, prepared by two different methods, as well as nitrogen-doped few-layer graphene have been investigated as supercapacitor electrodes. Two electrode measurements have been carried out both in aqueous (6M KOH) and in ionic liquid media. Nitrogen-doped reduced graphene oxides exhibit satisfactory specific capacitance, the values reaching 126F/g at a scan rate of 10mV/s in aqueous medium. Besides providing supercapacitor characteristics, the study has shown the nitrogen content and surface area to be important factors. High surface-area borocarbonitrides, BxCyNz, prepared by the urea route appear to be excellent supercapacitor electrode materials. Thus, BC4.5N exhibits a specific capacitance of 169F/g at a scan rate of 10mV/s in aqueous medium. In an ionic liquid medium, nitrogen-doped RGO and BC4.5N exhibit specific capacitance values of 258F/g and 240F/g at a scan rate of 5mV/s. The ionic liquid enables a larger operating voltage range of 0.0-2.5V compared to 0.0-1V in aqueous medium.

The Association between Total Protein and Vegetable Protein Intake and Low Muscle Mass among the Community-Dwelling Elderly Population in Northern Taiwan

Directory of Open Access Journals (Sweden)

Ru-Yi Huang

2016-06-01

Full Text Available Sarcopenia, highly linked with fall, frailty, and disease burden, is an emerging problem in aging society. Higher protein intake has been suggested to maintain nitrogen balance. Our objective was to investigate whether pre-sarcopenia status was associated with lower protein intake. A total of 327 community-dwelling elderly people were recruited for a cross-sectional study. We adopted the multivariate nutrient density model to identify associations between low muscle mass and dietary protein intake. The general linear regression models were applied to estimate skeletal muscle mass index across the quartiles of total protein and vegetable protein density. Participants with diets in the lowest quartile of total protein density (<13.2% were at a higher risk for low muscle mass (odds ratio (OR 3.03, 95% confidence interval (CI 1.37–6.72 than those with diets in the highest quartile (≥17.2%. Similarly, participants with diets in the lowest quartile of vegetable protein density (<5.8% were at a higher risk for low muscle mass (OR 2.34, 95% CI 1.14–4.83 than those with diets in the highest quartile (≥9.4%. Furthermore, the estimated skeletal muscle mass index increased significantly across the quartiles of total protein density (p = 0.023 and vegetable protein density (p = 0.025. Increasing daily intakes of total protein and vegetable protein densities appears to confer protection against pre-sarcopenia status.

Soluble Non-ammonia Nitrogen in Ruminal and Omasal Digesta of Korean Native Steers Supplemented with Soluble Proteins

Directory of Open Access Journals (Sweden)

C. W. Choi

2012-09-01

Full Text Available An experiment was conducted to study the effect of soluble protein supplements on concentration of soluble non-ammonia nitrogen (SNAN in the liquid phase of ruminal (RD and omasal digesta (OD of Korean native steers, and to investigate diurnal pattern in SNAN concentration in RD and OD. Three ruminally cannulated Korean native steers in a 3×3 Latin square design consumed a basal diet of rice straw and corn-based concentrate (control, and that supplemented (kg/d DM basis with intact casein (0.24; IC or acid hydrolyzed casein (0.46; AHC. Ruminal digesta was sampled using a vacuum pump, whereas OD was collected using an omasal sampling system at 2.0 h intervals after a morning feeding. The SNAN fractions (free amino acid (AA, peptide and soluble protein in RD and OD were assessed using the ninhydrin assay. Concentrations of free AA and total SNAN in RD were significantly (p<0.05 lower than those in OD. Although free AA concentration was relatively high, mean peptide was quantitatively the most important fraction of total SNAN in both RD and OD, indicating that degradation of peptide to AA rather than hydrolysis of soluble protein to peptide or deamination may be the most limiting step in rumen proteolysis of Korean native steers. Diurnal variation in peptide concentration in OD for the soluble protein supplemented diets during the feeding cycle peaked 2 h post-feeding and decreased thereafter whereas that for the control was relatively constant during the entire feeding cycle. Diurnal variation in peptide concentration was rather similar between RD and OD.

Effect of Plant Density, Rate and Split Application of Nitrogen Fertilizer on Quality Characteristics and Nitrogen Use Efficiency of Safflower under Weed Competition

Directory of Open Access Journals (Sweden)

M Fuladvand

2015-09-01

Full Text Available In order to evaluation of plant density, rate and method of nitrogen fertilizer split application on quality characteristics and nitrogen use efficiency of safflower (Sofeh variety under weed competition a field experiment was carried out in field research Yasouj University in 2013. This experiment was a factorial based on randomized complete block design with three replications. First factor was a two levels plant density (20 and 40 plants m-2 and second factor was nitrogen rate application on nine levels. That included; non nitrogen application and 75 and 150 kgN ha-1 nitrogen application that both used with four split method. Split methods were included; S1 (%50 in pre planting stage - %50 in stem elongation stage, S2 (%25 in pre planting stage - %75 in stem elongation stage, S3 (%25 in pre planting stage - %50 in stem elongation stage -%25 in flowering stage and S4 (%25 in pre planting stage - %25 in stem elongation stage - %25 in flowering stage. Also in this experiment, weed did not control. Results showed that whit increasing crop density, oil yield and protein grain yield increased by 20 percent and nitrogen utilization efficiency increased by 10 percent. The highest oil yield (50.25 g m-2 was obtained from 75 kg ha-1 nitrogen with three-stage split application (S4. Finally, results showed that increasing nitrogen fertilizer application decreased nitrogen utilization efficiency but three-stage split method application increased this trait.

Sequestration of soil nitrogen as tannin-protein complexes may improve the competitive ability of sheep laurel (Kalmia angustifolia) relative to black spruce (Picea mariana).

Science.gov (United States)

Joanisse, G D; Bradley, R L; Preston, C M; Bending, G D

2009-01-01

The role of litter tannins in controlling soil nitrogen (N) cycling may explain the competitive ability of Kalmia relative to black spruce (Picea mariana), although this has not been demonstrated experimentally. Here, the protein-precipitation capacities of purified tannins and leaf extracts from Kalmia and black spruce were compared. The resistance to degradation of tannin-protein precipitates from both species were compared by monitoring carbon (C) and N dynamics in humus amended with protein, purified tannins or protein-tannin precipitates. The purity of the precipitates was verified using solid-state (13)C nuclear magnetic resonance (NMR) spectra. The ability of mycorrhizal fungi associated with both species to grow on media amended with tannin-protein complexes as the principal N source was also compared. The protein precipitation capacity of Kalmia tannins was superior to those of black spruce. Humus amended with protein increased both mineral and microbial N, whereas humus amended with tannin-protein precipitates increased dissolved organic N. Mycorrhizal fungi associated with Kalmia showed better growth than those associated with black spruce when N was provided as tannin-protein precipitates. These data suggest that Kalmia litter increases the amount of soil N sequestered as tannin-protein complexes, which may improve the competitive ability of Kalmia relative to black spruce by favouring N uptake by mycorrhizas associated with the former.

Soil and fertilizer nitrogen

International Nuclear Information System (INIS)

Winteringham, F.P.W.

1984-01-01

As a result of the intensified practices and effectively diminishing land resources per capita, increasing weights of both native soil- and added fertilizer-nitrogen will be lost to agriculture and its products, and will find their way into the environment. Soil-nitrogen levels and contingent productivity can nevertheless be maintained in the face of these losses on the basis of improved soil-N management. In some local situations nitrate levels in water for drinking purposes are likely to continue rising. In some cases agriculture and clearance practices are only one of several sources. In others they are clearly mainly responsible. In developing countries these losses represent those of a relatively increasingly costly input. This is due to the fact that industrial fertilizer nitrogen production is a particularly high energy-consuming process. In the more advanced industrialized countries they represent an addition to the problems and costs of environmental quality and health protection. The programmes, information and data reviewed here suggest that these problems can be contained by improved and extended soil and water management in agriculture on the basis of existing technology. In particular there appears to be enormous scope for the better exploitation of existing legumes both as non-legume crop alternatives or as biofertilizers which also possess more desirable C:N ratios than chemical fertilizer

The effect of nitrogen rate on transgenic corn Cry3Bb1 protein expression.

Science.gov (United States)

Marquardt, Paul T; Krupke, Christian H; Camberato, James J; Johnson, William G

2014-05-01

Combining herbicide-resistant and Bacillus thuringiensis (Bt) traits in corn (Zea mays L.) hybrids may affect insect resistance management owing to volunteer corn. Some Bt toxins may be expressed at lower levels by nitrogen-deficient corn roots. Corn plants with sublethal levels of Bt expression could accelerate the evolution of Bt resistance in target insects. The present objective was to quantify the concentration of Bt (Cry3Bb1) in corn root tissue with varying tissue nitrogen concentrations. Expression of Cry3Bb1 toxin in root tissue was highly variable, but there were no differences in the overall concentration of Cry3Bb1 expressed between roots taken from Cry3Bb1-positive volunteer and hybrid corn plants. The nitrogen rate did affect Cry3Bb1 expression in the greenhouse, less nitrogen resulted in decreased Cry3Bb1 expression, yet this result was not documented in the field. A positive linear relationship of plant nitrogen status on Cry3Bb1 toxin expression was documented. Also, high variability in Cry3Bb1 expression is potentially problematic from an insect resistance management perspective. This variability could create a mosaic of toxin doses in the field, which does not fit into the high-dose refuge strategy and could alter predictions about the speed of evolution of resistance to Cry3Bb1 in western corn rootworm Diabrotica virgifera virgifera LeConte. © 2013 Society of Chemical Industry.

Nitrogen Research Programme STOP

International Nuclear Information System (INIS)

Erisman, J.W.; Van der Eerden, L.

2000-01-01

Nitrogen pollution is one of the main threats to the environment now in the Netherlands as well as other parts of Europe. In order to address the main gaps on the issues of nitrogen pollution related to the local scale, the Ministries of Housing, Physical Planning and Environment (VROM) and of Agriculture, Nature Management and Fisheries (LNV) have initiated a research programme, the Dutch Nitrogen Research Programme (STOP), which aims to provide a scientific basis to develop and implement policy on a local scale for the realisation and conservation of the EHS ('Dutch Mainframe of Natural Landscapes'). The results of the programme show that the description of emissions from manure in the field is difficult to describe and show large uncertainties. On the contrary, emissions from housings could be modelled well, if local actual data were available. The OPS model to describe the dispersion and deposition was evaluated with the measurements and the limitations were quantified. It appears that the model works well on the long term, whereas on the short term (hours) and short distance (tenths of meters) there is large uncertainty, especially in complex terrain. Critical loads for nitrogen for ecosystems were evaluated. Furthermore, the effect of management options was quantified. A method to determine critical loads as a function of soil conditions, such as acidification and water availability was derived. This resulted in a combination of the soil model SMART and the so-called 'nature planner' (Natuurplanner). It was concluded that the combination of SMART, the nature planner and OPS provide a good tool to develop and support policy on the local scale. 4 refs

Stimulation effect of synthetic cytokinins on the uptake and incorporation of nitrogen-15-labelled ammonium nitrate and urea in wheat leaves

International Nuclear Information System (INIS)

Iglewski, S.M.; Szarvas, T.; Pozsar, B.I.

1977-01-01

The turnover of different labelled nitrogen sources in wheat leaves has been investigated using the isotopic tracer technique. The 15 N at.% was determined in free ammonium ion, in the nitrate and the nitrite levels, and also in the non-disintegrated urea. The accumulation and the incorporation of stable nitrogen was measured in the TCA insoluble protein fraction. According to the experimental data the intensity of incorporation of urea nitrogen is relatively higher than that of the different inorganic compounds. The utilization of ammonium ion was 76% compared with the urea, whereas that of the nitrate nitrogen was 60% in the wheat leaves. The incorporation rate of the two nitrogen atoms from ammonium nitrate was 32% lower than that of the urea nitrogen, in the leaf protein of Bezostaia-1 wheat variety. The turnover of urea through the transamination was very rapid, the amination with ammonium ion was slower, and the first phase of the nitrate reduction was relatively more retarded than the nitrite reduction. The endogenous cytokinin-like biological activity and some synthetic cytokinins (kinetin, benzyladenine) have a remarkably stimulating effect on the incorporation of the different 15 N-labelled nitrogen sources into the leaf protein fraction. (author)

Effects of dietary crude protein and rumen-degradable protein concentrations on urea recycling, nitrogen balance, omasal nutrient flow, and milk production in dairy cows.

Science.gov (United States)

Mutsvangwa, T; Davies, K L; McKinnon, J J; Christensen, D A

2016-08-01

The objective of this study was to determine how interactions between dietary crude protein (CP) and rumen-degradable protein (RDP) concentrations alter urea-nitrogen recycling, nitrogen (N) balance, omasal nutrient flow, and milk production in lactating Holstein cows. Eight multiparous Holstein cows (711±21kg of body weight; 91±17d in milk at the start of the experiment) were used in a replicated 4×4 Latin square design with a 2×2 factorial arrangement of dietary treatments and 29-d experimental periods. Four cows in one Latin square were fitted with ruminal cannulas to allow ruminal and omasal sampling. The dietary treatment factors were CP (14.9 vs. 17.5%; dry matter basis) and RDP (63 vs. 69% of CP) contents. Dietary RDP concentration was manipulated by including unprocessed or micronized canola meal. Diet adaptation (d 1-20) was followed by 8d (d 21-29) of sample and data collection. Continuous intrajugular infusions of [(15)N(15)N]-urea (220mg/d) were conducted for 4d (d 25-29) with concurrent total collections of urine and feces to estimate N balance and whole-body urea kinetics. Proportions of [(15)N(15)N]- and [(14)N(15)N]-urea in urinary urea, and (15)N enrichment in feces were used to calculate urea kinetics. For the low-CP diets, cows fed the high-RDP diet had a greater DM intake compared with those fed the low-RDP diet, but the opposite trend was observed for cows fed the high-CP diets. Dietary treatment had no effect on milk yield. Milk composition and milk component yields were largely unaffected by dietary treatment; however, on the low-CP diets, milk fat yield was greater for cows fed the low-RDP diet compared with those fed the high-RDP diet, but it was unaffected by RDP concentration on the high-CP diets. On the high-CP diets, milk urea nitrogen concentration was greater in cows fed the high-RDP diet compared with those fed the low-RDP diet, but it was unaffected by RDP concentration on the low-CP diets. Ruminal NH3-N concentration tended to

Combined effect of protein and oxygen on reactive oxygen and nitrogen species in the plasma treatment of tissue

Science.gov (United States)

Gaur, Nishtha; Szili, Endre J.; Oh, Jun-Seok; Hong, Sung-Ha; Michelmore, Andrew; Graves, David B.; Hatta, Akimitsu; Short, Robert D.

2015-09-01

The influence of protein and molecular, ground state oxygen (O2) on the plasma generation, and transport of reactive oxygen and nitrogen species (RONS) in tissue are investigated. A tissue target, comprising a 1 mm thick gelatin film (a surrogate for real tissue), is placed on top of a 96-well plate; each well is filled with phosphate buffered saline (PBS, pH 7.4) containing one fluorescent or colorimetric reporter that is specific for one of three RONS (i.e., H2O2, NO2-, or OH•) or a broad spectrum reactive oxygen species reporter (2,7-dichlorodihydrofluorescein). A helium cold atmospheric plasma (CAP) jet contacts the top of the gelatin surface, and the concentrations of RONS generated in PBS are measured on a microplate reader. The data show that H2O2, NO2-, or OH• are generated in PBS underneath the target. Independently, measurements are made of the O2 concentration in the PBS with and without the gelatin target. Adding bovine serum albumin protein to the PBS or gelatin shows that protein either raises or inhibits RONS depending upon the O2 concentration. Our results are discussed in the context of plasma-soft tissue interactions that are important in the development of CAP technology for medicine, biology, and food manufacturing.

Plant allometry, leaf nitrogen and phosphorus stoichiometry, and interspecific trends in annual growth rates.

Science.gov (United States)

Niklas, Karl J

2006-02-01

Life forms as diverse as unicellular algae, zooplankton, vascular plants, and mammals appear to obey quarter-power scaling rules. Among the most famous of these rules is Kleiber's (i.e. basal metabolic rates scale as the three-quarters power of body mass), which has a botanical analogue (i.e. annual plant growth rates scale as the three-quarters power of total body mass). Numerous theories have tried to explain why these rules exist, but each has been heavily criticized either on conceptual or empirical grounds. N,P-STOICHIOMETRY: Recent models predicting growth rates on the basis of how total cell, tissue, or organism nitrogen and phosphorus are allocated, respectively, to protein and rRNA contents may provide the answer, particularly in light of the observation that annual plant growth rates scale linearly with respect to standing leaf mass and that total leaf mass scales isometrically with respect to nitrogen but as the three-quarters power of leaf phosphorus. For example, when these relationships are juxtaposed with other allometric trends, a simple N,P-stoichiometric model successfully predicts the relative growth rates of 131 diverse C3 and C4 species. The melding of allometric and N,P-stoichiometric theoretical insights provides a robust modelling approach that conceptually links the subcellular 'machinery' of protein/ribosomal metabolism to observed growth rates of uni- and multicellular organisms. Because the operation of this 'machinery' is basic to the biology of all life forms, its allometry may provide a mechanistic explanation for the apparent ubiquity of quarter-power scaling rules.

Nitrogen

Science.gov (United States)

Apodaca, Lori E.

2013-01-01

The article presents an overview of the nitrogen chemical market as of July 2013, including the production of ammonia compounds. Industrial uses for ammonia include fertilizers, explosives, and plastics. Other topics include industrial capacity of U.S. ammonia producers CF Industries Holdings Inc., Koch Nitrogen Co., PCS Nitrogen, Inc., and Agrium Inc., the impact of natural gas prices on the nitrogen industry, and demand for corn crops for ethanol production.

Exchange of nitrogenous substances between the body pool and the digestive tract in ruminants

International Nuclear Information System (INIS)

Boda, K.; Varady, J.; Havassy, I.; Kosta, K.; Fejes, J.; Kowalczyk, J.

1976-01-01

For a period of three months the only source of nitrogen in a group of sheep fed on a synthetic protein-free diet was perorally administered urea, and for a further period of three months intravenously administered urea. It was found that there was practically no variation in the weight of the animals and in the nitrogen balance. The total content of nitrogen and amino-nitrogen in the rumen with intravenous nitrogenous feeding showed that the rumen is adequately supplied with endogenous nitrogen. A clear-cut increase - by a factor of 2 - was observed in the endogenous metabolism as a whole. In experiments on sheep with a fistula of the rumen, duodenum or ileum, it was found that nitrogenous matter (total and microbic), synthesized from the 15 N of intravenously administered urea, is transported by the digestive apparatus with the common nitrogenous substances. In the rumen-duodenum part these substances are mainly secreted and in the intestinal part reabsorbed. Of the 15 N that passed through the duodenum, 73-84% was reabsorbed. Of the administered material, 4.8-5.7% was eliminated in the faeces. In experiments on sheep with an isolated intestine, it was observed that the secretion of blood urea, mainly in the forward part of the jejunum, is relatively high (3.4-3.9mg/h, whereas the rate of NH 3 production due to hydrolysis is relatively low (0.28-0.35mg/h). Of the 15 N-urea introduced via the fistula into the forward part of the jejunum, the average amount of 15 N remaining in the organism is 63%. Equal amounts of 15 N were eliminated in the urine, altogether 37%. It is assumed that the exchange of nitrogen between the digestive apparatus and the body pool is an important link in the nitrogen metabolism of ruminants. The blood urea and synthesized nitrogenous substances are important sources of nitrogen for digestive processes and for protein synthesis. The entire digestive apparatus participates in the utilization of ureal nitrogen. (author)

Whole-body protein turnover in malnourished patients with child class B and C cirrhosis on diets low to high in protein energy.

Science.gov (United States)

Dichi, J B; Dichi, I; Maio, R; Correa, C R; Angeleli, A Y; Bicudo, M H; Rezende, T A; Burini, R C

2001-03-01

The purpose of this study was to determine the rate of whole-body protein turnover in moderately and severely alcoholic, malnourished, cirrhotic patients fed with different amounts of protein or energy. Six male patients (Child classes B and C) and four age- and sex-matched healthy control subjects were studied for 18 d in fasting and feeding states; a single oral dose of [(15)N]glycine was used as a tracer and urinary ammonia was the end product. The kinetic study showed that patients had higher protein catabolism while fasting (patients: 3.14 +/- 1.2 g of lean body mass/9 h; controls: 1.8 +/- 0.3 g of lean body mass/9 h; P hyperproteic/hyperenergetic diet when compared with fasting. Nitrogen retention was consistent with the lower protein-catabolism rate; a statistically significant increase in nitrogen balance was observed when patients were fed with the hyperproteic/hyperenergetic diet compared with fasting (4.3 +/- 3.2 g of nitrogen/d and -2.2 +/- 1.9 g of nitrogen/d, respectively; P hyperproteic/hyperenergetic diet is likely needed to improve their clinical and nutritional status.

Protein (Cyanobacteria): 428309600 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available :1418 ... nitrogen fixation protein Microcoleus sp. PCC 7113 MTATNTTTETTTEEILAKPLMQELVKQIRGQDSYGTYRTWSDELLLKPFIVSKERKRKISVDGDVDLVTKARI...MAFYRAIAARIEQETGLLGQVIIDLSHEGFGWALVFCGRLLVVAKTLRDAQRFGFDSFEKLDAEGEKLLQKGIDLAKRYPEVGNI

The geobiological nitrogen cycle: From microbes to the mantle.

Science.gov (United States)

Zerkle, A L; Mikhail, S

2017-05-01

Nitrogen forms an integral part of the main building blocks of life, including DNA, RNA, and proteins. N 2 is the dominant gas in Earth's atmosphere, and nitrogen is stored in all of Earth's geological reservoirs, including the crust, the mantle, and the core. As such, nitrogen geochemistry is fundamental to the evolution of planet Earth and the life it supports. Despite the importance of nitrogen in the Earth system, large gaps remain in our knowledge of how the surface and deep nitrogen cycles have evolved over geologic time. Here, we discuss the current understanding (or lack thereof) for how the unique interaction of biological innovation, geodynamics, and mantle petrology has acted to regulate Earth's nitrogen cycle over geologic timescales. In particular, we explore how temporal variations in the external (biosphere and atmosphere) and internal (crust and mantle) nitrogen cycles could have regulated atmospheric pN 2 . We consider three potential scenarios for the evolution of the geobiological nitrogen cycle over Earth's history: two in which atmospheric pN 2 has changed unidirectionally (increased or decreased) over geologic time and one in which pN 2 could have taken a dramatic deflection following the Great Oxidation Event. It is impossible to discriminate between these scenarios with the currently available models and datasets. However, we are optimistic that this problem can be solved, following a sustained, open-minded, and multidisciplinary effort between surface and deep Earth communities. © 2017 The Authors Geobiology Published by John Wiley & Sons Ltd.

Optimation of Nitrogen and Phosphorus in Azolla Growth as Biofertilizer

Directory of Open Access Journals (Sweden)

Hany Handajani

2013-03-01

Full Text Available Nitrogen is one of the most important minerals for living organisms. Azolla is known as a small water fern which can fix nitrogen through the symbiotic association with the blue green algae Anabaena. Experimental studies were carried out in the glass house, investigating the growth of Azolla using different levels of nitrogen and phosphorus in the media. The experiment used 12 treatments with 3 levels of nitrogen (0, 5, and 10 mg atom/L and 4 levels of phosphorus (0, 10, 20, and 30 mg atom/l in a factorial design with 3 replicates. The results show that the highest biomass for fresh weight (13.28 g, dry weight (1,126 g, and the fastest doubling time (7.71 days were found in combination of 10 mg atom/L N and 30 mg atom/L P. Meanwhile, the highest protein content was found in combination of 5 mg atom/L N and 20 mg atom/L P. After the third day heterocyst cells in Anabaena could only be found in those two combinations, but the highest heterocyst cells was found in the lower N and P combination similar to the highest protein content. Further experiment is suggested to introduce Azolla as bio-fertilizer for acid water system, such as peat land water.

Characterisation of a major enzyme of bovine nitrogen metabolism

CSIR Research Space (South Africa)

Mathomu, LM

2010-09-01

Full Text Available of cellular protein metabolism (Curthoys & Watford, 1995; Meister, 1974). Glutamine functions as a major inter-organ transport form of nitrogen, carbon and serves as a source of energy between tissues such as brain, liver, kidney and even muscles...

Nitro-treatment of composted poultry litter, effects on Salmonella, E. coli and nitrogen

Science.gov (United States)

Poultry litter is a potentially valuable crude protein feed for ruminants whose gut microbes transform the nitrogen in uric acid into microbial protein. However, poultry litter must be treated to kill pathogens before feeding. Composting effectively kills pathogens but risks volatilization losses ...

Some aspects of nitrogen metabolism in the bovine rumen

International Nuclear Information System (INIS)

Nikolic, J.A.

1976-01-01

Studies on the use of urea as a source of nitrogen for microbial protein synthesis showed that utilization was more efficient when the protein-N content of the diet was low. However, when the total nitrogen of the dietary dry matter was reduced below 1.9%, there was a drop in the protein-N content of rumen dry matter and a reduction in the daily flow of protein through the duodenum. The mean post-prandial rumen ammonia concentrations were below 5mg NH 3 -N/100ml. In vitro work with 15 N-labelled urea and ammonia salts showed that the overall utilization rate of ammonia was not significantly affected by mean concentrations between 1.6 and 16.7mg/ml, but that net utilization was lower below 5.8mg/100ml. It is suggested that increased lysis of susceptible micro-organisms or increased proteolysis of feed proteins may account for these findings. The concentrations of ammonia-N, protein-N and volatile fatty acids in the rumen were not affected by increases in the amount of calcium, phosphorus, potassium or sulphur in the diet, although the concentrations of these elements were significantly increased in the rumen. A wide dietary Ca/P ratio (3.26) tended to reduce the stability of rumen contents leading to a low pH and foaming. Increases in mean sulphide concentration from 3.6 to 8.0mg/l had no effect on overall protein synthesis rate as indicated by the 35 S incorporation rate. (author)

The influence of nitrogen entrainment on argon plasmas created by the 'Torche à Injection Axiale' (TIA)

NARCIS (Netherlands)

Jonkers, J.; Hartgers, A.; Selen, L.J.M.; Mullen, van der J.J.A.M.; Schram, D.C.

1999-01-01

When a plasma is sustained in the open air, nitrogen will diffuse into the plasma. Especially for plasmas sustained by the `Torche à Injection Axiale' (TIA) this appears to be the case, since this turbulent jet draws gases from the surroundings. In the argon plasma the entrained nitrogen is probably

Methods of clinical chemistry and isotopic technique for investigation of the nitrogen metabolism in man using 15N

International Nuclear Information System (INIS)

Faust, H.; Bornhak, H.; Hirschberg, K.; Jung, K.; Junghans, P.; Krumbiegel, P.; Reinhardt, R.

1981-03-01

The present manual is a catalogue of methods representing theoretical and practical aspects of application of the stable isotope 15 N in medicine as well as a reference book for users of 15 N techniques in life sciences. Special emphasis is given to the planning of 15 N tracer experiments and their interpretation, sources of error and standard values of nitrogen compounds, information on sampling of medical materials, methods of separation and determination of proteins and non-protein nitrogen compounds in serum and urine, and details of the isotopic analysis of nitrogen by emission and mass spectrometry. (author)

Irradiation and Post-Irradiation Storage of Chicken: Effects on Fat and Proteins

International Nuclear Information System (INIS)

Abou-Tarboush, H.M.; Al-Kahtani, H.A.; Abou-Arab, A.A.; Atia, M.; Bajaber, A.S.; Ahmed, M.A.; El-Mojaddidi, M.A.

1997-01-01

Chicken were subjected to gamma irradiation doses of 2.5, 5.0, 7.5 and 10.0 KGy and post-irradiation storage of 21 days at 4±2º. The effects on fat and protein of chicken were studied. Rate of formation of total volatile basic-nitrogen was less in irradiated samples particularly in samples treated with 5.0KGy during the entire storage. Fatty acid profiles of chicken lipids were not significantly (P≤ 0.05) affected by irradiation especially at doses of 5.0 KGy. However, irradiation caused a large increase in thiobarbituric acid (TBA) values which continued gradually during storage. Changes in amino acids were minimal. Irradiated and unirradiated samples showed the appearance of protein subunits with molecular weights in the range of 10.0 to 88.0 and 10.0 to 67.0 KD, respectively. No changes were observed in the sarcoplasmic protein but the intensity of bands in all irradiated samples decreased after 21 days of storage

SynechoNET: integrated protein-protein interaction database of a model cyanobacterium Synechocystis sp. PCC 6803

OpenAIRE

Kim, Woo-Yeon; Kang, Sungsoo; Kim, Byoung-Chul; Oh, Jeehyun; Cho, Seongwoong; Bhak, Jong; Choi, Jong-Soon

2008-01-01

Background Cyanobacteria are model organisms for studying photosynthesis, carbon and nitrogen assimilation, evolution of plant plastids, and adaptability to environmental stresses. Despite many studies on cyanobacteria, there is no web-based database of their regulatory and signaling protein-protein interaction networks to date. Description We report a database and website SynechoNET that provides predicted protein-protein interactions. SynechoNET shows cyanobacterial domain-domain interactio...

Studies on the roles of GlnK and GlnB in regulating Klebsiella pneumoniae NifL-dependent nitrogen control.

NARCIS (Netherlands)

Arcondeguy, T.; van Heeswijk, W.C.; Merrick, M.

1999-01-01

In Klebsiella pneumoniae, nitrogen fixation (nif) genes are regulated in response to fixed nitrogen and oxygen. The activity of the nif-specific transcriptional activator NifA is modulated by NifL, which mediates both oxygen and nitrogen control. The signal transduction protein GlnK is required to

Vegetable versus animal protein diet in cirrhotic patients with chronic encephalopathy. A randomized cross-over comparison.

Science.gov (United States)

Bianchi, G P; Marchesini, G; Fabbri, A; Rondelli, A; Bugianesi, E; Zoli, M; Pisi, E

1993-05-01

In a randomized cross-over comparison, the effects of a mainly vegetable protein diet were compared with an animal protein diet in eight patients with cirrhosis and chronic permanent encephalopathy, under optimum lactulose therapy. After a run-in period, patients were fed two equi-caloric, equi-nitrogenous diets for 7 days (71 g total proteins), containing either 50 g protein of animal origin or 50 g vegetable proteins. In the last 3 days of each period, nitrogen balance was significantly better during the vegetable protein diet (+0.2 (SD 1.4) g vs. -1.7 (2.4); P vegetable proteins, whereas insulin, plasma amino acids and ammonia were lower. The clinical grading of encephalopathy improved slightly on vegetable proteins, and psychometric tests improved significantly, but remained grossly abnormal. Compliance to dietary manipulation was good. The data prove that a mainly vegetable protein diet is worthwhile in cirrhotic patients with chronic encephalopathy under optimum lactulose therapy. Improved nitrogen balance may be related to more effective nitrogen use for protein synthesis, probably due to blunted hormonal response, and largely outweighs the effects on encephalopathy.

Rumen microbial protein synthesis and nitrogen efficiency as affected by tanniferous and non-tanniferous forage legumes incubated individually or together in Rumen Simulation Technique.

Science.gov (United States)

Grosse Brinkhaus, Anja; Bee, Giuseppe; Schwarm, Angela; Kreuzer, Michael; Dohme-Meier, Frigga; Zeitz, Johanna O

2018-03-01

A limited availability of microbial protein can impair productivity in ruminants. Ruminal nitrogen efficiency might be optimised by combining high-quality forage legumes such as red clover (RC), which has unfavourably high ruminal protein degradability, with tanniferous legumes like sainfoin (SF) and birdsfoot trefoil (BT). Silages from SF and from BT cultivars [Bull (BB) and Polom (BP)] were incubated singly or in combination with RC using the Rumen Simulation Technique (n = 6). The tanniferous legumes, when compared to RC, changed the total short-chain fatty acid profile by increasing propionate proportions at the expense of butyrate. Silage from SF contained the most condensed tannins (CTs) (136 g CT kg -1 dry matter) and clearly differed in various traits from the BT and RC silages. The apparent nutrient degradability (small with SF), microbial protein synthesis, and calculated content of potentially utilisable crude protein (large with SF) indicated that SF had the greatest efficiency in ruminal protein synthesis. The effects of combining SF with RC were mostly linear. The potential of sainfoin to improve protein supply, demonstrated either individually or in combination with a high-performance forage legume, indicates its potential usefulness in complementing protein-deficient ruminant diets and high-quality forages rich in rumen-degradable protein. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

Development of a quantitative multi-compound method for the detection of 14 nitrogen-rich adulterants by LC-MS/MS in food materials.

Science.gov (United States)

Frank, Nancy; Bessaire, Thomas; Tarres, Adrienne; Goyon, Alexandre; Delatour, Thierry

2017-11-01

The increasing number of food frauds using exogenous nitrogen-rich adulterants to artificially raise the protein content for economically motivated adulteration has demonstrated the need for a robust analytical methodology. This method should be applicable for quality control in operations covering a wide range of analyte concentrations to be able to analyse high levels as usually found in adulteration, as well as low levels due to contamination. The paper describes a LC-MS/MS method covering 14 nitrogen-rich adulterants using a simple and fast sample preparation based on dilution and clean-up by dispersive SPE. Quantification is carried out by isotopic dilution reaching LOQs of 0.05-0.20 mg/kg in a broad range of food matrices (infant formula, liquid milk, dairy ingredient, high protein meal, cereal, infant cereal, and meat/fish powder). Validation of seven commodity groups was performed according to SANCO 12571/2013, giving satisfactory results demonstrating the method's fitness for purpose at the validated range at contamination level. Method ruggedness was further assessed by transferring the developed method into another laboratory devoted to routine testing for quality control. Next to the method description, emphasis is placed on challenges and problems appearing during method development as well as validation. They are discussed in detail and solutions are provided.

Atomic structure of nitrate-binding protein crucial for photosynthetic productivity

Energy Technology Data Exchange (ETDEWEB)

Koropatkin, Nicole M.; Pakrasi, Himadri B.; Smith, Thomas J.

2006-06-27

Cyanobacteria, blue-green algae, are the most abundant autotrophs in aquatic environments and form the base of all aquatic food chains by fixing carbon and nitrogen into cellular biomass. The single most important nutrient for photosynthesis and growth is nitrate, which is severely limiting in many aquatic environments particularly the open ocean (1, 2). It is therefore not surprising that NrtA, the solute-binding component of the high-affinity nitrate ABC transporter, is the single-most abundant protein in the plasma membrane of these bacteria (3). Here we describe the first structure of a nitratespecific receptor, NrtA from Synechocystis sp. PCC 6803, complexed with nitrate and determined to a resolution of 1.5Å. NrtA is significantly larger than other oxyanionbinding proteins, representing a new class of transport proteins. From sequence alignments, the only other solute-binding protein in this class is CmpA, a bicarbonatebinding protein. Therefore, these organisms created a novel solute-binding protein for two of the most important nutrients; inorganic nitrogen and carbon. The electrostatic charge distribution of NrtA appears to force the protein off of the membrane while the flexible tether facilitates the delivery of nitrate to the membrane pore. The structure not only details the determinants for nitrate selectivity in NrtA, but also the bicarbonate specificity in CmpA. Nitrate and bicarbonate transport are regulated by the cytoplasmic proteins NrtC and CmpC, respectively. Interestingly, the residues lining the ligand binding pockets suggest that they both bind nitrate. This implies that the nitrogen and carbon uptake pathways are synchronized by intracellular nitrate and nitrite.3 The nitrate ABC transporter of cyanobacteria is composed of four polypeptides (Figure 1): a high-affinity periplasmic solute-binding lipoprotein (NrtA), an integral membrane permease (NrtB), a cytoplasmic ATPase (NrtD), and a unique ATPase/solute-binding fusion protein (Nrt

Steady-state and dynamic gene expression programs in Saccharomyces cerevisiae in response to variation in environmental nitrogen

Science.gov (United States)

Airoldi, Edoardo M.; Miller, Darach; Athanasiadou, Rodoniki; Brandt, Nathan; Abdul-Rahman, Farah; Neymotin, Benjamin; Hashimoto, Tatsu; Bahmani, Tayebeh; Gresham, David

2016-01-01

Cell growth rate is regulated in response to the abundance and molecular form of essential nutrients. In Saccharomyces cerevisiae (budding yeast), the molecular form of environmental nitrogen is a major determinant of cell growth rate, supporting growth rates that vary at least threefold. Transcriptional control of nitrogen use is mediated in large part by nitrogen catabolite repression (NCR), which results in the repression of specific transcripts in the presence of a preferred nitrogen source that supports a fast growth rate, such as glutamine, that are otherwise expressed in the presence of a nonpreferred nitrogen source, such as proline, which supports a slower growth rate. Differential expression of the NCR regulon and additional nitrogen-responsive genes results in >500 transcripts that are differentially expressed in cells growing in the presence of different nitrogen sources in batch cultures. Here we find that in growth rate–controlled cultures using nitrogen-limited chemostats, gene expression programs are strikingly similar regardless of nitrogen source. NCR expression is derepressed in all nitrogen-limiting chemostat conditions regardless of nitrogen source, and in these conditions, only 34 transcripts exhibit nitrogen source–specific differential gene expression. Addition of either the preferred nitrogen source, glutamine, or the nonpreferred nitrogen source, proline, to cells growing in nitrogen-limited chemostats results in rapid, dose-dependent repression of the NCR regulon. Using a novel means of computational normalization to compare global gene expression programs in steady-state and dynamic conditions, we find evidence that the addition of nitrogen to nitrogen-limited cells results in the transient overproduction of transcripts required for protein translation. Simultaneously, we find that that accelerated mRNA degradation underlies the rapid clearing of a subset of transcripts, which is most pronounced for the highly expressed NCR

Effects of nitrogen and irrigation on gluten protein composition and their relationship to yellow berry disorder in wheat (triticum aestivum)

International Nuclear Information System (INIS)

Wong, B.R.; Felix, F.R.; Chavez, T

2014-01-01

In Mexico and the rest of the world, the presence of yellow berry (YB) in wheat grains (Triticum aestivum) has been related with poor quality, this defect is associated with low protein content in the grains. However, the quality of the wheat depends not only on the protein content, but also on the composition of the gluten proteins. The effect of the various agronomic factors on the composition of wheat gluten has been a subject of study worldwide. However, in Mexico, wheat quality still remains an issue, as there is a lack of knowledge regarding the optimal agronomic conditions to produce wheat with good-quality gluten. For this reason, the effects of nitrogen (N) rates and irrigations on the amount of gliadin subclasses, glutenin subunits (two main groups) and grain protein content as well as the relation of these proteins to the YB content in wheat grains were investigated. The experiment was conducted on arable farmland in the Valley of Empalme, Sonora, Mexico (27 degree 58' N, 110 degree 49' W; 10 m altitude), during the fall-winter period of 2009-2010. Tarachi, the hard wheat cultivar studied, was selected for its relative susceptibility to the presence of elevated YB content in mature wheat kernels. Three levels of N (75, 150 or 250 kg ha-1) and three levels of irrigation (1, 2 or 3 auxiliary irrigations) were studied. Using a N rate of 150 kg ha-1 with 3 auxiliary irrigations, wheat with good-quality gluten was obtained. The results suggest that the YB disorder is primarily related to the amount of protein in the wheat grain. (author)

The abundance of nitrogen in starburst nucleus galaxies

Science.gov (United States)

Coziol, R.; Reyes, R. E. Carlos; Considère, S.; Davoust, E.; Contini, T.

1999-05-01

We show that the excess of nitrogen emission observed in a large sample of Starburst Nucleus Galaxies (SBNGs) can only be explained at a given metallicity by an overabundance of nitrogen with respect to normal H ii regions in the disks of late-type spirals. The N/O ratios in the SBNGs are comparable to the values found in the bulges of normal early-type spirals, which suggests that what we observe could be the main production of nitrogen in the bulges of these galaxies. The variation of the N/O ratio as a function of metallicity in SBNGs follows a primary + secondary relation, but the increase of nitrogen does not appear as a continuous process. In SBNGs, nitrogen is probably produced by different populations of intermediate-mass stars, which were formed during past sequences of bursts of star formation. This assumption pushes the origin of the main bursts 2-3 Gyrs back in the past. On a cosmological scale, this time interval corresponds to redshifts z ~ 0.2-0.3, where a significant increase of star formation activity occurred. The origin of the SBNG phenomenon would thus have cosmological implications, it would be related to a more active phase of star formation in the Universe sometime in its recent past. Based on observations obtained at the 193cm telescope of Observatoire de Haute-Provence, operated by INSU (CNRS)

Effect of whole body gamma-irradiation and/or dietary protein deficiency on the levels of plasma non-protein nitrogen and amino acids; plasma and urinary ammonia and urea in desert rodent and albino rats

International Nuclear Information System (INIS)

Roushdy, H.M.; El-Husseini, M.; Saleh, F.

1984-01-01

The effect of gamma-irradiation exposure on the levels of non-protein nitrogen (N.P.N.) and amino acids in plasma; ammonia and urea in plasma and urine was studied in the desert rodent, Psammomys obesus obesus and albino rats subjected to dietary protein deficiency, N.P.N. and amino acids in plasma were shown to increase by irradiation exposure. The effect of radiation on blood ammonia was less marked, but it caused a significant increase in ammonia excretion in urine. Radiation exposure in albino rats caused a marked increase in urea concentration in plasma of animals fed the high protein diet and irradiated at 780 r. In urine, the tested radiation levels caused an initial increase in urea concentration followed by a subsequent decrease. In psammomys, radiation exposure exerted a little effect on the plasma urea level, whereas significant increase in the daily urea excretion was recorded. It seems that urea level in plasma is more stabilized in psammomys than in albino rats

Evidence of chemical exchange in recombinant Major Urinary Protein and quenching thereof upon pheromone binding

Energy Technology Data Exchange (ETDEWEB)

Perazzolo, Chiara, E-mail: Chiara.Perazzolo@epfl.ch; Verde, Mariachiara [Ecole Polytechnique Federale de Lausanne, Institut des Sciences et Ingenierie Chimiques (Switzerland); Homans, Steve W. [University of Leeds, Institute of Molecular and Cellular Biology (United Kingdom); Bodenhausen, Geoffrey [Ecole Polytechnique Federale de Lausanne, Institut des Sciences et Ingenierie Chimiques (Switzerland)

2007-05-15

The internal dynamics of recombinant Major Urinary Protein (rMUP) have been investigated by monitoring transverse nitrogen-15 relaxation using multiple-echo Carr-Purcell-Meiboom-Gill (CPMG) experiments. While the ligand-free protein (APO-rMUP) features extensive evidence of motions on the milliseconds time scale, the complex with 2-methoxy-3-isobutylpyrazine (HOLO-rMUP) appears to be much less mobile on this time scale. At 308 K, exchange rates k{sub ex} = 500-2000 s{sup -1} were typically observed in APO-rMUP for residues located adjacent to a {beta}-turn comprising residues 83-87. These residues occlude an entry to the binding pocket and have been proposed to be a portal for ligand entry in other members of the lipocalin family, such as the retinol binding protein and the human fatty-acid binding protein. Exchange rates and populations are largely uncorrelated, suggesting local 'breathing' motions rather than a concerted global conformational change.

Evidence of chemical exchange in recombinant Major Urinary Protein and quenching thereof upon pheromone binding

International Nuclear Information System (INIS)

Perazzolo, Chiara; Verde, Mariachiara; Homans, Steve W.; Bodenhausen, Geoffrey

2007-01-01

The internal dynamics of recombinant Major Urinary Protein (rMUP) have been investigated by monitoring transverse nitrogen-15 relaxation using multiple-echo Carr-Purcell-Meiboom-Gill (CPMG) experiments. While the ligand-free protein (APO-rMUP) features extensive evidence of motions on the milliseconds time scale, the complex with 2-methoxy-3-isobutylpyrazine (HOLO-rMUP) appears to be much less mobile on this time scale. At 308 K, exchange rates k ex = 500-2000 s -1 were typically observed in APO-rMUP for residues located adjacent to a β-turn comprising residues 83-87. These residues occlude an entry to the binding pocket and have been proposed to be a portal for ligand entry in other members of the lipocalin family, such as the retinol binding protein and the human fatty-acid binding protein. Exchange rates and populations are largely uncorrelated, suggesting local 'breathing' motions rather than a concerted global conformational change

Development of photosynthetic activity in Porphyridium purpureum (Rhodophyta) following nitrogen starvation

Energy Technology Data Exchange (ETDEWEB)

Levy, I.; Gantt, E. (Smithsonian Institution, Washington, DC (USA))

1990-03-01

The effects of nitrogen limitation on laboratory cultures of Porphyridium purpureum Bory, Drew and Ross were studied under continuous white light illumination (35 {mu}E {times} m{sup {minus}2} {times} s{sup {minus}1}). Growth ceased, respiration exceeded photosynthesis, chlorophyll content was reduced by 80%, and phycoerythrin content was reduced by 99% over a period of 14 days under nitrogen limitation. Recovery upon addition of nitrogen resulted in increased phycobiliprotein content, appearance of phycobilisomes attached to the thylakoids, increased oxygen evolution, and increased fluorescence emission from photosystem 1 (720 nm) and photosystem 2 (685 nm) upon excitation by green light. Growth resumes after 72 h and was concomitant with an increase of chlorophyll, phycoerythrin and phycobilisomes per thylakoid area. The results suggest that photosystem 1 was less affected by nitrogen starvation than photosystem 2 and that the recovery was largely dependent on the restoration of phycobilisomes and other photosystem components.

Chemical composition and deoxynivalenol in wheat of Central- Southern Paraná: nitrogen fertilization in top dressing associated with Azospirillum brasilense

Directory of Open Access Journals (Sweden)

Thiago Montagner Souza

2014-02-01

Full Text Available The impact of agricultural management practices on the quality of grain was evaluated in wheat (Triticum aestivum L. BRS Tangará from the South Central region of Paraná State (Ponta Grossa in the crop years of 2010 and 2011. The field trial was carried out in succession with soybean (2010 and corn (2011. The treatments included inoculation of seeds with Azospirillum brasilense and increasing levels of nitrogen application in top dressing (0, 30, 60, 90 and 120 kg ha-1. The experimental design was in randomized block, factorial 2 x 5 (inoculation x N levels, with four replications. The parameters evaluated were water activity, moisture, protein, and grain contamination by deoxynivalenol (DON. The data were subjected to analysis of variance, comparison of means by Tukey’s test (p<0.05 and regression for nitrogen levels. The inoculation of seeds with A. brasilense increased the protein content in grain in 2010 (+1.6%; 16.9 g 100g-1 and 2011 (+1.7%, 15.7 g 100g-1, independently of the nitrogen level (p<0.01. Levels of nitrogen in 2010 presented a positive linear response with protein content, increasing by 14.2% using non-inoculated seeds (p<0.01, R2=0.955 and 14.4% for those inoculated with A. brasilense (p<0.01, R2=0.906. However, in 2011 a quadratic response was observed between nitrogen levels and protein content (p<0.01, R2=0.99, with stabilization or reduction in protein content using high levels of nitrogen (?120 kg ha-1. The contamination by DON was greater using high levels of nitrogen (3574 ?g kg-1, 120 kg ha-1; non-inoculated seeds in 2011, with a quadratic response between nitrogen levels and contamination of grains (p<0.05, R2=0.772. Furthermore, 37.5% of the samples presented contamination by DON higher than the maximum tolerated limit established by Brazilian legislation (2000 ?g kg-1; whole-wheat grain. The data demonstrates that proper management of nitrogen enhances intrinsic effects arising from plant breeding.

Dry matter yield and forage quality traits of oat (Avena sativa L. under integrative use of microbial and synthetic source of nitrogen

Directory of Open Access Journals (Sweden)

M. Bilal

2017-07-01

Full Text Available The natural microbes are potential contributor to build up soil nitrogen through transformation of molecular nitrogen to plant available forms. Therefore, in the present study, we investigated the contribution of biofertilizer to reduce the synthetic nitrogen application without deteriorating the yield and forage quality. The supplementary nitrogen rates included 0, 40, 80 and 120 kg ha−1 and the seed inoculation was carried out with the mixture of Azospirillum + Azotobacter spp. The experiment was laid out in randomized complete block design with factorial arrangement. The results indicated that organic matter contents and ether extractable fat were negatively associated with both nitrogen and inoculation factors. The inoculation produced 6.58%, 9.58%, 2.51%, 16.94%, 10.26%, 17.59%, 14.02%, 33.81% and 66.18% more No. tillers, plant height, leaf to stem ratio, dry matter yield, mineral matter contents, crude fibre, crude protein, crude protein yield and total digestible crude protein yield, respectively over uninoculation. The interactive effects indicated that inoculation alone without nitrogen application produced 19.16% and 6.87% more dry matter yield and crude protein (%, respectively. The beneficiary effects of biofertilizers on growth and dry matter of oat were more pronounced at intermediate level of inorganic nitrogen which was gradually decreased at higher nitrogen levels. The CP, CPY and DCPY achieved with inoculation alone were statistically equivalent to plots fertilized with 0 and 40 kg N ha−1. It is clear that plots sown with inoculated seeds must be fertilized with 80 kg N to produce higher dry matter and economic returns. However, the highest protein contents in dry matter were recorded with highest fertilization level along with inoculation. By giving due attention to stimulatory effects of bacterial species in the present study, it is therefore, recommended to integrate the use of biofertilizers with supplemental

A visual study of radial inward choked flow of liquid nitrogen.

Science.gov (United States)

Hendricks, R. C.; Simoneau, R. J.; Hsu, Y. Y.

1973-01-01

Data and high speed movies were acquired on pressurized subcooled liquid nitrogen flowing radially inward through a 0.0076 cm gap. The stagnation pressure ranged from 0.7 to 4 MN/sq m. Steady radial inward choked flow appears equivalent to steady choked flow through axisymmetric nozzles. Transient choked flows through the radial gap are not uniform and the discharge pattern appears as nonuniform impinging jets. The critical mass flow rate data for the transient case appear different from those for the steady case. On the mass flow rate vs pressure map, the slope and separation of the isotherms appear to be less for transient than for steady radial choked flow.

Rumen Microbial Protein Production in Rumen-Simulating-Technique (RUSITEC) Using 15N-Urea Nitrogen, as Influenced By Hay and Barley Ratios in Feed

International Nuclear Information System (INIS)

Al-Masri, M. R.; Abel, HJ.; Steinberg, W.

2004-01-01

Metabolism of dietary nitrogen using labeled 15 N and the changes in the microbial protein mass and NH3-N were studied in five rumen-simulating-technique(RUSITEC)-fermenters, which were run simultaneously in three identically repeated experiments. Each experiment consisted of a 6-day adaptation period followed directly by a 3-day collection period. The feed of the fermenters (G1, G2, G3, G4 and G5) varied in the ratio of barley. The barley increased by 20% between the fermenters. Grass hay+barley (g/d) in the feed of the fermenters was 10+2 (G1), 8+4 (G2), 6+6 (G3), 4+8 (G4) and 2+10 (G5). The results indicated that there were no significant (P>0.05) changes in the amounts of microbial nitrogen (92-118 mg/d) and microbial mass syntheses which were (mg/d): 1154 (G1), 1063 (G2), 1152 (G3), 1127 (G4) and 1362 (G5). Increasing the proportion of barley in the fermenters (G4 and G5) decreased NH3-N amounts (G2 and G3) significantly (P<0.05). The energy was not efficiently used in G5 having a lower ratio of the microbial nitrogen and microbial mass to the total short chain fatty acids than that other fermenters. (authors)

The effect of nitrogen on the development and photosynthetic activity ...

African Journals Online (AJOL)

Whole plant net photosynthetic rates appeared to vary according to the units in which the activity is expressed. The optimum levels of photosynthetic activity differed with the stage of development, depending on the basis of expression. The form and concentration of nitrogen applied influenced morphological development ...

Reduction of nitrogen excretion and emission in poultry: A review for organic poultry.

Science.gov (United States)

Chalova, Vesela I; Kim, Jihyuk; Patterson, Paul H; Ricke, Steven C; Kim, Woo K

2016-01-01

Organic poultry is an alternative to conventional poultry which is rapidly developing as a response to customers' demand for better food and a cleaner environment. Although organic poultry manure can partially be utilized by organic horticultural producers, litter accumulation as well as excessive nitrogen still remains a challenge to maintain environment pureness, animal, and human health. Compared to conventional poultry, diet formulation without nitrogen overloading in organic poultry is even more complicated due to specific standards and regulations which limit the application of some supplements and imposes specific criteria to the ingredients in use. This is especially valid for methionine provision which supplementation as a crystalline form is only temporarily allowed. This review is focused on the utilization of various protein sources in the preparation of a diet composed of 100% organic ingredients which meet the avian physiology need for methionine, while avoiding protein overload. The potential to use unconventional protein sources such as invertebrates and microbial proteins to achieve optimal amino acid provision is also discussed.

Effect of compounds astragalus extract and cysteamine on finishing pigs growth and protein turnover

International Nuclear Information System (INIS)

Wang Cheng; Wang Zhisheng; Zhou Anguo; Liu Guilian; Xue Bai

2008-01-01

32 PIC pigs, weighted 59.82±1.32 kg on average, were subjected randomly to 4 treatments for determining the effects of extrogenous metabolism-regulating agents on pig performance, protein turn-over and nitrogen retention by using isotope ( 15 N-Gly) technique and nitrogen balance trial. The 4 treatments were: (1) basal diet; (2) basal diet plus cysteamine (70mg/kg, CS group); (3) basal diet plus non-stable astragalus extracts 250mg/kg (NCAE group); (4) basal diet plus stably astragalus extracts 250mg/kg (CAE group). Astragalus extracts and cysteamine, especially NCAE, redounded to increase pig performance, especially increase average day gain (P<0.05). Both astragalus extracts and cysteamine accelerated protein aggradation rate and amino acid utilization rate, as well as biological value. Astragalus extracts helped to accelerate the synthesis rate of amino acid into body protein and reduce the excretion rate of endogenous urine nitrogen. The mechanism of increasing protein deposition of cysteamine is reducing body protein degradation rate (26.71% reduction, compared to control group), while that of astragalus extracts is bilateral, reducing protein degradation rate (24.84% and 3.66% reduction for NCAE and CAE) and accelerating protein synthesis rate (22.86% and 19.18% increase for NCAE and CAE). Both astragalus extracts and cysteamine contributed the increasing nitrogen retention, net nitrogen utilization and biological value. (authors)

Measurements of body protein for clinical investigation

International Nuclear Information System (INIS)

Mernagh, J.R.; Harrison, J.E.; McNeill, M.G.; Jeejeebhoy, K.N.; Krishnan, S.S.

1986-01-01

Body protein (nitrogen) is determined by bilaterally irradiating the body with neutrons using Pu-Be sources and measuring the resultant 10.8 MeV gamma rays from the reaction 14 N(n,8) 15 N. In the authors lab the whole body can be scanned or separate segments of the body can be measured independently. A nitrogen index has been developed based on body size and is used as a predictor of normal total body nitrogen (TBN). They have found that TBN, when normalized to body size in this way, provides a reliable index of protein status which cannot be accurately determined by body weight, anthropometry, or body potassium measurements. Changes in body composition with age were studied by measuring the composition of 56 healthy female volunteers aged 20-80. Measurements were made for K( 40 K), Ca and N. It was shown that protein and bone mineral decrease with age but that this is not reflected in K or anthropometry measurements. Results of other studies to be presented include: body protein measurements pre and post TPN (total parenteral nutrition), nutritional status of patients on long term CAPD (continuous ambulatory peritoneal dialysis) and changes in body composition as a result of TPN in patients with small cell lung cancer receiving chemotherapy. Clinical results show that indirect measurements of body protein based on weight, potassium, or anthropometry, do not give an accurate measure of body protein. For an accurate measurement, direct measurement of body protein is necessary

Protein and energy metabolism in two lines of chickens selected for growth on high or low protein diets

DEFF Research Database (Denmark)

Chwalibog, André; Eggum, B O; Sørensen, Peter

1983-01-01

Genetic adaptation was investigated in broilers selected for seven generations on a normal (A) or a low (B) protein diet. Protein and energy metabolism were studied in males from these selected lines fed on a diet of intermediate protein content. All selected birds retained more nitrogen than those...

Utilization of protein-rich residues in biotechnological processes.

Science.gov (United States)

Pleissner, Daniel; Venus, Joachim

2016-03-01

A drawback of biotechnological processes, where microorganisms convert biomass constituents, such as starch, cellulose, hemicelluloses, lipids, and proteins, into wanted products, is the economic feasibility. Particularly the cost of nitrogen sources in biotechnological processes can make up a large fraction of total process expenses. To further develop the bioeconomy, it is of considerable interest to substitute cost-intensive by inexpensive nitrogen sources. The aim of this mini-review was to provide a comprehensive insight of utilization methods of protein-rich residues, such as fish waste, green biomass, hairs, and food waste. The methods described include (i) production of enzymes, (ii) recovery of bioactive compounds, and/or (iii) usage as nitrogen source for microorganisms in biotechnological processes. In this aspect, the utilization of protein-rich residues, which are conventionally considered as waste, allows the development of value-adding processes for the production of bioactive compounds, biomolecules, chemicals, and materials.

Effect of Wild Mustard (Sinapis arvensis Competition and Nitrogen Levels on

Directory of Open Access Journals (Sweden)

F Soleymani

2012-06-01

Full Text Available To investigate the effect of wild mustard plant density and nitrogen fertilizer on morphological characters, yield and yield components of canola a split-plot experiment based on a randomized complete block design with 3 replications was carried out in Bu-Ali Sina university of Hamedan, in 2009. 4 levels of nitrogen fertilization (100, 150, 200 and 250 kgN h-1 were assigned to main-plots and plant density of wild mustard at 5 levels (0, 4, 8, 16 and 32 plants m-2 to the sub-plots. Results showed that the effects of wild mustard competition on yield and components of canola was significant. 32 plants m-2 of wild mustard reduced grain and biologic yield, number of pod per plant, number of seed per pod and 1000seed weight about 28.7, 30, 40.9, 22.2 and 16 percent respectively. With more nitrogen application, number of pod per plant, number of seed per pod, 1000seed weight and grain yield was increased. By increasing nitrogen from 100 to 250 kg ha-1, grain yield was increased more than 53 percent. Increasing density of wild mustard significantly reduced all above mentioned morphological and qualitative characters, except protein percentage. By increasing nitrogen fertilizer, plant height, number of branches per plant, pod length, oil yield and protein percentage of canola were increased significantly. Overall nevertheless negative effect of weed on canola yield, seems that the application 200 kgN/ha in addition to increasing grain yield and canola oil, had less decline in weed interference.

Global transcriptional analysis of nitrogen fixation and ammonium repression in root-associated Pseudomonas stutzeri A1501

Directory of Open Access Journals (Sweden)

Lu Wei

2010-01-01

Full Text Available Abstract Background Biological nitrogen fixation is highly controlled at the transcriptional level by regulatory networks that respond to the availability of fixed nitrogen. In many diazotrophs, addition of excess ammonium in the growth medium results in immediate repression of nif gene transcription. Although the regulatory cascades that control the transcription of the nif genes in proteobacteria have been well investigated, there are limited data on the kinetics of ammonium-dependent repression of nitrogen fixation. Results Here we report a global transcriptional profiling analysis of nitrogen fixation and ammonium repression in Pseudomonas stutzeri A1501, a root-associated and nitrogen-fixing bacterium. A total of 166 genes, including those coding for the global nitrogen regulation (Ntr and Nif-specific regulatory proteins, were upregulated under nitrogen fixation conditions but rapidly downregulated as early as 10 min after ammonium shock. Among these nitrogen fixation-inducible genes, 95 have orthologs in each of Azoarcus sp. BH72 and Azotobacter vinelandii AvoP. In particular, a 49-kb expression island containing nif and other associated genes was markedly downregulated by ammonium shock. Further functional characterization of pnfA, a new NifA-σ54-dependent gene chromosomally linked to nifHDK, is reported. This gene encodes a protein product with an amino acid sequence similar to that of five hypothetical proteins found only in diazotrophic strains. No noticeable differences in the transcription of nifHDK were detected between the wild type strain and pnfA mutant. However, the mutant strain exhibited a significant decrease in nitrogenase activity under microaerobic conditions and lost its ability to use nitrate as a terminal electron acceptor for the support of nitrogen fixation under anaerobic conditions. Conclusions Based on our results, we conclude that transcriptional regulation of nif gene expression in A1501 is mediated by the nif

Electron delocalization in α-nitrogen

International Nuclear Information System (INIS)

Storchak, V.; Brewer, J.H.; Morris, G.D.; British Columbia Univ., Vancouver, BC

1995-06-01

A new technique has been developed for measuring electron drift mobility in crystals on a microscopic scale through its effect on muonium (Mu = μ + + e - ) atom formation via transport of electrons to thermalized positive muons (μ + ). Electron transport mechanisms are shown to be fundamentally different in the α and β phases of solid nitrogen, giving of about 5 orders of magnitude difference in electron mobilities. Contrary to previously reported results of macroscopic time-of-flight measurements, excess electrons appear to be delocalized in α-N 2 . (author). 22 refs., 3 figs

Effect of nitrogen salts on the growth of Ceratonia siliqua L. Shoot cultures

Directory of Open Access Journals (Sweden)

Vinterhalter Branka

2007-01-01

Full Text Available Effects of reduced nitrogen salt nutriton on the growth, lenticel hypertrophy and anthocyanin accumulation of carob (Ceratonia siliqua L. shoot cultures were investigated in conditions of light and darkness. Growth of shoot cultures was not significantly affected until nitrogen salts were reduced to less than ¼ of full-strength MS (Murashige and Skoog, 1962 values. Cultures in darkness were less affected and their main shoots even increased in length. Appearance of hypertrophied lenticels in light decreased, while in darkness they were absent in all treatments. Reduced nitrogen salt nutrition strongly affected anthocyanin accumulation of shoots and leaves, which greatly increased in both light and darkness. .

Influence of sulfur and nitrogen supply on the susceptibility of Pisum sativum to SO/sub 2/

Energy Technology Data Exchange (ETDEWEB)

Klein, H; Jaeger, H J; Steubing, L

1974-01-01

The susceptibility of Pisum to SO/sub 2/ injury was examined in relation to the sulfur and nitrogen nutrition. The injury was measured by comparing the dry matter yield to control and treated plants. SO/sub 2/ effects on metabolism were established by determining the content of organic and inorganic sulfur and, indirectly, by measuring total nitrogen, amino acid nitrogen, and protein nitrogen. The plants grown in nutrient solutions deficient in sulfur or nitrogen showed a decreased sensitivity to SO/sub 2/ pollution compared to the control. The higher content of amino acid nitrogen and organic sulfur of the plants grown in a nitrogen-deficient solution suggests that an increased synthesis of sulfur containing amino acids occurs. The slighter injury of the plants deficient in sulfur may be explained by the delayed sulfur supply.

Enhanced Temperature During Grain Filling Reduces Protein Concentration of Durum Wheat

Directory of Open Access Journals (Sweden)

Franco Miglietta

2011-02-01

Full Text Available Durum wheat is cultivated over more than 13 millions of hectares (ha world wide and Italy is the main European producer with 3.5 millions tons per year. The protein concentration of durum wheat is very important, it ensures high nutritional value and is highly appreciated by the pasta production industries. The protein concentration of wheat is determined during the grain filling period when carbon and nitrogen compounds are translocated into the grains. Air temperature affects translocation rates and contributes to final protein concentration of wheat grains. Two common commercial varieties of durum and bread wheat were exposed from anthesis to harvest, to a source of infrared radiation in the field. This allowed to investigate the relative effect of temperature on translocation of carbon and nitrogen compound during grain filling. The heat treatment imposed affected marginally dry mass accumulation of the grains in bread wheat and didn’t affect dry mass in durum wheat. Grain protein was affected by heat treatment in durum but not in bread wheat. Carbon accumulation rate was higher for durum than for bread wheat. The protein concentration was greater in durum than in bread wheat and we can assume that the absolute nitrogen accumulation rates were higher for the former species. Such difference may be either caused by a faster nitrogen uptake rate and translocation or a more efficient relocation of nitrogen accumulated in reserve organs.

Abundances in field dwarf stars. II. Carbon and nitrogen abundances

Energy Technology Data Exchange (ETDEWEB)

Laird, J.B.

1985-02-15

Intermediate-dispersion spectra of 116 field dwarf stars, plus 10 faint field giants and 3 Hyades dwarfs, have been used to derive carbon and nitrogen abundances relative to iron. The program sample includes both disk and halo stars, spanning a range in (Fe/H) of +0.50 to -2.45. Synthetic spectra of CH and NH bands have been used to determine carbon and nitrogen abundances. The C/Fe ratio is solar over the range of metallicity studied, with an estimated intrinsic scatter of 0.10 dex. Down to (Fe/H)roughly-equal-1.8, below which the nitrogen abundance could not be measured, the N/Fe ratio is also constant for the majority of stars, indicating that nitrogen production is largely primary. Four halo stars are found to be enhanced in nitrogen relative to iron, by factors between 5 and 50, although their carbon abundances appear to be normal. These results are discussed in connection with the chemical evolution of the Galaxy and the sites of C, N, and Fe nucleosynthesis. The results require that C, N, and Fe be produced in stars of similar mass. Our current understanding of N production, then, implies that most Type I supernovae have intermediate-mass progenitors. The nitrogen in the N-enhanced halo stars is very probably primordial, indicating that the interstellar medium at early epochs contained substantial inhomogeneities.

Abundances in field dwarf stars. II. Carbon and nitrogen abundances

International Nuclear Information System (INIS)

Laird, J.B.

1985-01-01

Intermediate-dispersion spectra of 116 field dwarf stars, plus 10 faint field giants and 3 Hyades dwarfs, have been used to derive carbon and nitrogen abundances relative to iron. The program sample includes both disk and halo stars, spanning a range in [Fe/H] of +0.50 to -2.45. Synthetic spectra of CH and NH bands have been used to determine carbon and nitrogen abundances. The C/Fe ratio is solar over the range of metallicity studied, with an estimated intrinsic scatter of 0.10 dex. Down to [Fe/H]roughly-equal-1.8, below which the nitrogen abundance could not be measured, the N/Fe ratio is also constant for the majority of stars, indicating that nitrogen production is largely primary. Four halo stars are found to be enhanced in nitrogen relative to iron, by factors between 5 and 50, although their carbon abundances appear to be normal. These results are discussed in connection with the chemical evolution of the Galaxy and the sites of C, N, and Fe nucleosynthesis. The results require that C, N, and Fe be produced in stars of similar mass. Our current understanding of N production, then, implies that most Type I supernovae have intermediate-mass progenitors. The nitrogen in the N-enhanced halo stars is very probably primordial, indicating that the interstellar medium at early epochs contained substantial inhomogeneities

Nutritional management of acute kidney injury in the critically ill: a ...

African Journals Online (AJOL)

2013-07-08

Jul 8, 2013 ... urea nitrogen appearance (UNA) of 6 g or less nitrogen loss than the nitrogen ... The AKIN criteria have similar urine output criteria to the RIFLE classification .... Whole body protein synthesis increases by 15-37% in critically.

Biological Nitrogen Fixation on Legume

Directory of Open Access Journals (Sweden)

Armiadi

2009-03-01

Full Text Available Nitrogen (N is one of the major limiting factors for crop growth and is required in adequate amount, due to its function as protein and enzyme components. In general, plants need sufficient nitrogen supply at all levels of growth, especially at the beginning of growth phase. Therefore, the availability of less expensive N resources would reduce the production cost. The increasing use of chemical fertilizer would probably disturb soil microorganisms, reduce the physical and chemical characteristics of soil because not all of N based fertilizer applied can be absorbed by the plants. Approximately only 50% can be used by crops, while the rest will be altered by microorganism into unavailable N for crops or else dissappear in the form of gas. Leguminous crops have the capacity to immobilize N2 and convert into the available N if innoculated with Rhizobium. The amount of N2 fixed varies depending on legume species and their environment.

Full replacement of menhaden fish meal protein by low-gossypol cottonseed flour protein in the diet of juvenile black sea bass Centropristis striata

Science.gov (United States)

Eight iso-nitrogeneous (46% crude protein) and iso-lipidic (14% crude lipid) diets were formulated and prepared to replace menhaden fish meal (FM) protein (59.5% CP) by low-gossypol glandless meal (GCSM) protein (50.4% CP), solvent-extracted cottonseed meal (SCSM) protein (53.8% protein) and high go...

Effect of the Ratio of Non-fibrous Carbohydrates to Neutral Detergent Fiber and Protein Structure on Intake, Digestibility, Rumen Fermentation, and Nitrogen Metabolism in Lambs.

Science.gov (United States)

Ma, T; Tu, Y; Zhang, N F; Deng, K D; Diao, Q Y

2015-10-01

This study aimed to investigate the effect of the ratio of non-fibrous carbohydrates to neutral detergent fibre (NFC/NDF) and undegraded dietary protein (UDP) on rumen fermentation and nitrogen metabolism in lambs. Four Dorper×thin-tailed Han crossbred lambs, averaging 62.3±1.9 kg of body weight and 10 mo of age, were randomly assigned to four dietary treatments of combinations of two levels of NFC/NDF (1.0 and 1.7) and two levels of UDP (35% and 50% of crude protein [CP]). Duodenal nutrient flows were measured with dual markers of Yb and Co, and microbial N (MN) synthesis was estimated using (15)N. High UDP decreased organic matter (OM) intake (p = 0.002) and CP intake (p = 0.005). Ruminal pH (p<0.001), ammonia nitrogen (NH3-N; p = 0.008), and total volatile fatty acids (p<0.001) were affected by dietary NFC/NDF. The ruminal concentration of NH3-N was also affected by UDP (p<0.001). The duodenal flow of total MN (p = 0.007) was greater for lambs fed the high NFC/NDF diet. The amount of metabolisable N increased with increasing dietary NFC:NDF (p = 0.02) or UDP (p = 0.04). In conclusion, the diets with high NFC/NDF (1.7) and UDP (50% of CP) improved metabolisable N supply to lambs.

Effect of the Ratio of Non-fibrous Carbohydrates to Neutral Detergent Fiber and Protein Structure on Intake, Digestibility, Rumen Fermentation, and Nitrogen Metabolism in Lambs

Directory of Open Access Journals (Sweden)

T. Ma

2015-10-01

Full Text Available This study aimed to investigate the effect of the ratio of non-fibrous carbohydrates to neutral detergent fibre (NFC/NDF and undegraded dietary protein (UDP on rumen fermentation and nitrogen metabolism in lambs. Four Dorper×thin-tailed Han crossbred lambs, averaging 62.3±1.9 kg of body weight and 10 mo of age, were randomly assigned to four dietary treatments of combinations of two levels of NFC/NDF (1.0 and 1.7 and two levels of UDP (35% and 50% of crude protein [CP]. Duodenal nutrient flows were measured with dual markers of Yb and Co, and microbial N (MN synthesis was estimated using 15N. High UDP decreased organic matter (OM intake (p = 0.002 and CP intake (p = 0.005. Ruminal pH (p<0.001, ammonia nitrogen (NH3-N; p = 0.008, and total volatile fatty acids (p<0.001 were affected by dietary NFC/NDF. The ruminal concentration of NH3-N was also affected by UDP (p<0.001. The duodenal flow of total MN (p = 0.007 was greater for lambs fed the high NFC/NDF diet. The amount of metabolisable N increased with increasing dietary NFC:NDF (p = 0.02 or UDP (p = 0.04. In conclusion, the diets with high NFC/NDF (1.7 and UDP (50% of CP improved metabolisable N supply to lambs.

Influence of UV-A or UV-B light and of the nitrogen source on the induction of ferredoxin-dependent glutamate synthase in etiolated tomato cotyledons

International Nuclear Information System (INIS)

Migge, A.; Carrayol, E.; Hirel, B.; Lohmann, M.; Meya, G.; Becker, T.W.

1998-01-01

The influence of ultraviolet A (UV-A) or B (UV-B) light and of the nitrogen source on the induction of ferredoxin-dependent glutamate synthase (Fd-GOGAT, EC 1.4.7.1) was examined in etiolated cotyledons of tomato (Lycopersicon escu- lentum L.). The Fd-GOGAT activity increased upon illumination of etiolated tomato cotyledons with UV-A or UV-B light. This stimulation of Fd-GOGAT activity was correlated with an increase in both the Fd-GOGAT transcript level and the Fd-GOGAT protein abundance. These results suggest that UV-A or UV-B light stimulates the de novo synthesis of Fd-GOGAT in etiolated tomato cotyledons. Both UV-A and UV-B light failed to influence the activity of NADH-GOGAT (EC 1.4.1.14) in etiolated tomato cotyledons. Taken together, our data indicate that the tomato genes encoding Fd- or NADH-dependent glutamate synthase are regulated differently by UV-A or UV-B light. No difference with respect to both the Fd-GOGAT transcript and protein abundance was found between cotyledons of tomato seedlings grown with either nitrate or ammonium as the sole N-source in the dark or in white light. In addition, the increase in the Fd-GOGAT protein pool induced by white light in etiolated nitrate-grown tomato seedling cotyledons was similar to that induced by white light in etiolated ammonium-grown tomato seedling cotyledons. These results show that the tomato Fd-GOGAT protein level does not depend strongly on the nature of the nitrogen source and that there appears to be no major stimulatory effect on the Fd-GOGAT protein pool produced by nitrate during the illumination of etiolated tomato cotyledons

Genetic variations in ARE1 mediate grain yield by modulating nitrogen utilization in rice.

Science.gov (United States)

Wang, Qing; Nian, Jinqiang; Xie, Xianzhi; Yu, Hong; Zhang, Jian; Bai, Jiaoteng; Dong, Guojun; Hu, Jiang; Bai, Bo; Chen, Lichao; Xie, Qingjun; Feng, Jian; Yang, Xiaolu; Peng, Juli; Chen, Fan; Qian, Qian; Li, Jiayang; Zuo, Jianru

2018-02-21

In crops, nitrogen directly determines productivity and biomass. However, the improvement of nitrogen utilization efficiency (NUE) is still a major challenge in modern agriculture. Here, we report the characterization of are1, a genetic suppressor of a rice fd-gogat mutant defective in nitrogen assimilation. ARE1 is a highly conserved gene, encoding a chloroplast-localized protein. Loss-of-function mutations in ARE1 cause delayed senescence and result in 10-20% grain yield increases, hence enhance NUE under nitrogen-limiting conditions. Analysis of a panel of 2155 rice varieties reveals that 18% indica and 48% aus accessions carry small insertions in the ARE1 promoter, which result in a reduction in ARE1 expression and an increase in grain yield under nitrogen-limiting conditions. We propose that ARE1 is a key mediator of NUE and represents a promising target for breeding high-yield cultivars under nitrogen-limiting condition.

The Growth Rate and Efficiency of Rumen Microbial Protein Digestion of Red Clover Silage (Trifolium pratense cv. Sabatron)

International Nuclear Information System (INIS)

Asih Kurniawati

2004-01-01

(Trifolium pratense cv. Sabatron). Red clover silage supplemented with different level of carbohydrates has been examined using the in-vitro gas production technique. Cumulative gas production, hydro.gen sulfite production, and ammonia was followed and used as indicators of microbial growth rate and extent of protein degradation. Microbial nitrogen production, VFA, and efficiency microbial production was used as indicator of nitrogen use efficiency. 15 N was used as a microbial marker to estimate the amount of nitrogen incorporation into microbial protein. Supplementation of Red clover with increasing 5 levels; 0 g; 0.625 g; 0.15 g; 0.225 g and 0.3 g of maize starch led to graded increase in microbial growth and protein degradation. This was reflected in the increasing gas production and the accumulation of hydrogen sulfite. Diurnal change in ammonia production reflected the microbial utilization of ammonia for protein synthesis. Protein microbe (P<0.001) as VFA (P<0.001) increased due to carbohydrate addition as well as utilization of nitrogen (P<0.001). There was also the efficiency of nitrogen utilization which increased significantly. This result suggested that energy supply can increased efficiency of nitrogen use in the rumen and may reduce nitrogen losses into the environment. (author)

New method for the quality check of food proteins of the maintenance metabolism. 4. Investigation of isolated proteins as well as some protein sources of plant and animal origin

Energy Technology Data Exchange (ETDEWEB)

Simon, O; Hernandez, M; Bergner, H [Humboldt-Universitaet, Berlin (German Democratic Republic). Sektion Tierproduktion und Veterinaermedizin

1981-01-01

Male adult rats (370 g body weight) were fed on maintenance level (460 kJ ME/kgsup(0,75). In a 10 days preliminary period they received a casein/methionine (95/5) diet supplemented with 10 mg /sup 15/N excess per 0.178 kg metabolic body weight in form of ammonium acetate. Thereafter the animals were put on 8 isonitrogenous diets containing as protein sources casein, soya protein, gelatine, whole-egg, fish meal, pea, wheat and yeast. The /sup 15/N excretion via urine and feces was used to evaluate the dietary proteins for maintenance. /sup 15/N in urine was lowest in animals fed on wheat diet and highest after feeding whole-egg diet. From these data a so called '/sup 15/N excretion biological valence (BV)' was calculated, which indicated the highest quality for wheat and soy protein in meeting the needs of the intermediary maintenance metabolism. On the other hand, dietary protein sources influence the loss of endogenous nitrogen as metabolic fecal nitrogen (MFN). It was found to be lowest in animals fed on diets containing isolated proteins (6 mg MFN/100 g body weight) and highest after feeding protein sources of plant origin with a high content in crude fibre (10 mg MFN/100 g). Both, losses of /sup 15/N via urine and via feces were combined in a parameter called 'total BV'. According to this parameter the differences in quality for maintenance were only little between the protein sources tested (casein 100, soy protein 100, pea 99, wheat 99, whole egg 92, fish meal 89, gelatin 89). It was concluded that in the state of maintenance the supply with essential amino acids is not critical and that the supply with dispensable amino acids (or nonspecific nitrogen) is of great importance.

Prolonged bed rest decreases skeletal muscle and whole body protein synthesis

Science.gov (United States)

Ferrando, A. A.; Lane, H. W.; Stuart, C. A.; Davis-Street, J.; Wolfe, R. R.

1996-01-01

We sought to determine the extent to which the loss of lean body mass and nitrogen during inactivity was due to alterations in skeletal muscle protein metabolism. Six male subjects were studied during 7 days of diet stabilization and after 14 days of stimulated microgravity (-6 degrees bed rest). Nitrogen balance became more negative (P protein synthesis (PS; P protein also decreased by 46% (P protein breakdown and inward transport. Whole body protein synthesis determined by [15N]alanine ingestion on six subjects also revealed a 14% decrease (P protein breakdown change significantly. These results indicate that the loss of body protein with inactivity is predominantly due to a decrease in muscle PS and that this decrease is reflected in both whole body and skeletal muscle measures.

Rediscovery and Revival of Analytical Refractometry for Protein Determination: Recombining Simplicity With Accuracy in the Digital Era.

Science.gov (United States)

Anderle, Heinz; Weber, Alfred

2016-03-01

Among "vintage" methods of protein determination, quantitative analytical refractometry has received far less attention than well-established pharmacopoeial techniques based on protein nitrogen content, such as Dumas combustion (1831) and Kjeldahl digestion (1883). Protein determination by quantitative refractometry dates back to 1903 and has been extensively investigated and characterized in the following 30 years, but has since vanished into a few niche applications that may not require the degree of accuracy and precision essential for pharmaceutical analysis. However, because high-resolution and precision digital refractometers have replaced manual instruments, reducing time and resource consumption, the method appears particularly attractive from an economic, ergonomic, and environmental viewpoint. The sample solution can be measured without dilution or other preparation procedures than the separation of the protein-free matrix by ultrafiltration, which might even be omitted for a constant matrix and excipient composition. Copyright © 2016 American Pharmacists Association®. Published by Elsevier Inc. All rights reserved.

Deprotonated imidodiphosphate in AMPPNP-containing protein structures

International Nuclear Information System (INIS)

Dauter, Miroslawa; Dauter, Zbigniew

2011-01-01

In certain AMPPNP-containing protein structures, the nitrogen bridging the two terminal phosphate groups can be deprotonated. Many different proteins utilize the chemical energy provided by the cofactor adenosine triphosphate (ATP) for their proper function. A number of structures in the Protein Data Bank (PDB) contain adenosine 5′-(β,γ-imido)triphosphate (AMPPNP), a nonhydrolysable analog of ATP in which the bridging O atom between the two terminal phosphate groups is substituted by the imido function. Under mild conditions imides do not have acidic properties and thus the imide nitrogen should be protonated. However, an analysis of protein structures containing AMPPNP reveals that the imide group is deprotonated in certain complexes if the negative charges of the phosphate moieties in AMPPNP are in part neutralized by coordinating divalent metals or a guanidinium group of an arginine

Morphogenesis of Tanzania guinea grass under nitrogen doses and plant densities

Directory of Open Access Journals (Sweden)

Thiago Gomes dos Santos Braz

2011-07-01

Full Text Available The objective of this work was to evaluate effects of nitrogen fertilization and plant density on morphogenesis of Tanzania guinea grass. It was used a random block design with 12 treatments and two replications in a 4 × 3 factorial arrangement, with four doses of nitrogen (N (without N application, 80, 160 or 320 kg/ha.year and three plant densities (9, 25 or 49 plants/m². Harvest was performed at 25 cm from the ground when the canopy intercepted 95% of the incident light. Rates of leaf appearance and pseudostem elongation were positively and linearly influenced by nitrogen, whereas phillochron and leaf life span were influenced linearly and negatively. Leaf elongation responded positively to two factors, whereas leaf senescence rate and number of live leaves were not influenced by the factors evaluated. Number of total, basal and aerial tillers were greater at the density of 9 plants/m² and at the nitrogen dose of 320 kg/ha.year. Nitrogen increases production of leaves and tillers in Tanzania guinea grass defoliated at 95% of light interception, but high density of plants reduces the number of tiller per bunch.

Visualization of channels connecting cells in filamentous nitrogen-fixing cyanobacteria.

Science.gov (United States)

Omairi-Nasser, Amin; Haselkorn, Robert; Austin, Jotham

2014-07-01

Cyanobacteria, formerly called blue-green algae, are abundant bacteria that carry out green plant photosynthesis, fixing CO2 and generating O2. Many species can also fix N2 when reduced nitrogen sources are scarce. Many studies imply the existence of intracellular communicating channels in filamentous cyanobacteria, in particular, the nitrogen-fixing species. In a species such as Anabaena, growth in nitrogen-depleted medium, in which ∼10% of the cells differentiate into anaerobic factories for nitrogen fixation (heterocysts), requires the transport of amino acids from heterocysts to vegetative cells, and reciprocally, the transport of sugar from vegetative cells to heterocysts. Convincing physical evidence for such channels has been slim. Using improved preservation of structure by high-pressure rapid freezing of samples for electron microscopy, coupled with high-resolution 3D tomography, it has been possible to visualize and measure the dimensions of channels that breach the peptidoglycan between vegetative cells and between heterocysts and vegetative cells. The channels appear to be straight tubes, 21 nm long and 14 nm in diameter for the latter and 12 nm long and 12 nm in diameter for the former.-Omairi-Nasser, A., Haselkorn, R., Austin, J. II. Visualization of channels connecting cells in filamentous nitrogen-fixing cyanobacteria. © FASEB.

β-Glucan production of Saccharomyces cerevisiae in medium with different nitrogen sources in air-lift fermentor

Directory of Open Access Journals (Sweden)

AHMAD THONTOWI

2007-10-01

Full Text Available β-Glucan is one of the most abundant polysaccharides in yeast Saccharomyces cerevisiae cell wall. The aim of this research is to explore an alternative nitrogen sources for β-glucan production. S. cerevisiae were grown in fermentation medium with different nitrogen sources. Peptone 2%, glutamic acid 0,5%, urea 0,2%, and diammonium hydrogen phosphate (DAHP 0,02% were used for nitrogen source in the medium. A two liter air-lift fermentor was used in the fermentation process for 84 hours (T = 300C, pH 7, and 1.5 vvm for the aeration. During the fermentation, optical density, extraction of β-glucan, glucose and protein in hydrolisate cultured were determined. β-glucan production level is similar with the growth rate of yeast and followed by decreasing glucose and protein content in hydrolysis cultured. The highest and lowest β-glucan content were obtained from peptone (933.33 mg/L and glutamic acid (633.33 mg/L as a nitrogen source in cells cultured after fermentation completed respectively. Yeast cells cultured with urea and DAHP as a nitrogen source give the same content of β-glucan about 733.33 mg/L. β-glucan concentration produced in medium with urea was a higher than that produced using glutamic acid and DAHP as a nitrogen source. The result indicated that urea can be used as an alternative nitrogen source for the production of β-glucan. Urea is easily available and cheaper than peptone, glutamic acid and DAHP.

Nitrogen availability for nitrogen fixing cyanobacteria upon growth ...

African Journals Online (AJOL)

The filamentous cyanobacterium Nostoc PCC 7120 is able to convert dinitrogen to ammonia in the absence of combined nitrogen. The expression of 20% of coding sequences from all major metabolic categories was examined in nitrogen fixing and non-nitrogen fixing growth conditions. The expression data were correlated ...

Nitrogen in highly crystalline carbon nanotubes

International Nuclear Information System (INIS)

Ducati, C; Koziol, K; Stavrinadis, A; Friedrichs, S; Windle, A H; Midgley, P A

2006-01-01

Multiwall carbon nanotubes (MWCNTs) with an unprecedented degree of internal order were synthesised by chemical vapour deposition (CVD) adding a nitrogen-containing compound to the hydrocarbon feedstock. Ferrocene was used as the metal catalyst precursor. The remarkable crystallinity of these nanotubes lies both in the isochirality and in the crystallographic register of their walls, as demonstrated by electron diffraction and high resolution electron microscopy experiments. High resolution transmission electron microscopy analysis shows that the walls of the nanotubes consist of truncated stacked cones, instead of perfect cylinders, with a range of apex angles that appears to be related to the nitrogen concentration in the synthesis process. The structure of armchair, zigzag and chiral nanotubes is modelled and discussed in terms of density of topological defects, providing an interesting comparison with our microscopy experiments. A growth mechanism based on the interplay of base- and tip-growth is proposed to account for our experimental observations

Dynamics of amino acid and protein metabolism of laying hens after the application of 15N-labelled wheat protein. 1

International Nuclear Information System (INIS)

Hennig, A.; Gruhn, K.; Kirchner, E.

1987-01-01

In a 6-day preliminary period with a pelleted ration 12 colostomized laying hybrids received 15 N-labelled wheat protein over 4 days. The labelling of the wheat was 14.37 atom-% 15 N excess ( 15 N'). During the 4-day application of 15 N-labelled wheat protein each hen consumed 12.08 g N, 3.52 g lysine, 2.12 g histidine, 4.41 g arginine, of which were 540 mg 15 N', 18.1 mg lysine 15 N', 21.5 mg histidine 15 N' and 47.9 mg arginine 15 N'. Heavy nitrogen was determined in urine and its uric acid N in the daily urine samples of the individual animals. The average daily urine N excretion was 54% of the total nitrogen consumed with the ration. The labelling of the urine N reached a plateau on the fourth day of the experiment with 3.2 atom-% 15 N'. On an average of the total experiment the quota of heavy nitrogen of the uric acid in the total 15 N' of the urine was 83.4% and that of uric acid nitrogen in the total urine nitrogen 80.8%. (author)

Experimental identification of nitrogen-vacancy complexes in nitrogen implanted silicon

Science.gov (United States)

Adam, Lahir Shaik; Law, Mark E.; Szpala, Stanislaw; Simpson, P. J.; Lawther, Derek; Dokumaci, Omer; Hegde, Suri

2001-07-01

Nitrogen implantation is commonly used in multigate oxide thickness processing for mixed signal complementary metal-oxide-semiconductor and System on a Chip technologies. Current experiments and diffusion models indicate that upon annealing, implanted nitrogen diffuses towards the surface. The mechanism proposed for nitrogen diffusion is the formation of nitrogen-vacancy complexes in silicon, as indicated by ab initio studies by J. S. Nelson, P. A. Schultz, and A. F. Wright [Appl. Phys. Lett. 73, 247 (1998)]. However, to date, there does not exist any experimental evidence of nitrogen-vacancy formation in silicon. This letter provides experimental evidence through positron annihilation spectroscopy that nitrogen-vacancy complexes indeed form in nitrogen implanted silicon, and compares the experimental results to the ab initio studies, providing qualitative support for the same.

Nitrogen nutrition effects on development, growth and nitrogen accumulation of vegetables

NARCIS (Netherlands)

Biemond, H.

1995-01-01

In order to be able to match nitrogen supply and nitrogen requirement of vegetable crops, insight is necessary in the responses to nitrogen of important processes of growth and development. This study focused on effects of amount of nitrogen applied and fractionation of nitrogen supply on

Plant densities and modulation of symbiotic nitrogen fixation in soybean

Directory of Open Access Journals (Sweden)

Marcos Javier de Luca

2014-06-01

Full Text Available Soybean nitrogen (N demands can be supplied to a large extent via biological nitrogen fixation, but the mechanisms of source/sink regulating photosynthesis/nitrogen fixation in high yielding cultivars and current crop management arrangements need to be investigated. We investigated the modulation of symbiotic nitrogen fixation in soybean [Glycine max (L. Merrill] at different plant densities. A field trial was performed in southern Brazil with six treatments, including non-inoculated controls without and with N-fertilizer, both at a density of 320,000 plants ha−1, and plants inoculated with Bradyrhizobium elkanii at four densities, ranging from 40,000 to 320,000 plants ha−1. Differences in nodulation, biomass production, N accumulation and partition were observed at stage R5, but not at stage V4, indicating that quantitative and qualitative factors (such as sunlight infrared/red ratio assume increasing importance during the later stages of plant growth. Decreases in density in the inoculated treatments stimulated photosynthesis and nitrogen fixation per plant. Similar yields were obtained at the different plant densities, with decreases only at the very low density level of 40,000 plants ha−1, which was also the only treatment to show differences in seed protein and oil contents. Results confirm a fine tuning of the mechanisms of source/sink, photosynthesis/nitrogen fixation under lower plant densities. Higher photosynthesis and nitrogen fixation rates are capable of sustaining increased plant growth.

Protein digestion in ruminants

African Journals Online (AJOL)

a balance between synthesis and hydrolysis. Aside from .... be used to follow the synthesis of this protein fraction. (Clarke, 1977a) .... form of digestive enzymes, urea and ammonia (Egan, ..... decreasing urine-nitrogen excretion (Thornton, Bird,.

Influence of basal application of organic wastes on absorption and translocation of 15N-tagged nitrogen fertilizer in tea plants

International Nuclear Information System (INIS)

Watanabe, Ikuo; Ikegaya, Kenjiro; Hiramine, Shigeo

1979-01-01

Influence of the basal application of rape seed oil cake and shavings pig manure compost on the absorption, translocation and utilization of top-dressed 15 N-tagged ammonium sulfate in tea plants were studied. Nitrogen uptake and dry weights of new shoots increased in rape seed oil cake and shavings pig manure compost treatments as compared with ammonium sulfate treatments. The high rate of nitrogen absorption per the weight of rootlets in rape seed oil cake treatments suggested that the enhanced root activity might contribute to the increase. And the increase in shavings pig manure compost treatments could be due to the increase of the quantity of rootlets. The absorbed tagged nitrogen was 34% of total absorbed nitrogen in rape seed oil cake treatments, and 67% in shavings pig manure treatments. The results suggested that available nitrogen contents in soil originated from the basal nitrogen might be low in shavings pig manure compost treatments in comparison with rape seed oil cake treatments. Total nitrogen and nitrogen contents of amino acid fraction of ''a bud and two leaves'' of new shoots were relatively high in shavings pig manure compost treatments. With the growth of new shoots, nitrogen contents of protein fraction decreased in old leaves, branches and trunks in ammonium sulfate and rape seed oil cake treatments. This fact suggested that the storage protein might be present in these organs. (author)

Arginine appearance and nitric oxide synthesis in critically ill infants can be increased with a protein-energy–enriched enteral formula12345

Science.gov (United States)

de Betue, Carlijn TI; Joosten, Koen FM; Deutz, Nicolaas EP; Vreugdenhil, Anita CE; van Waardenburg, Dick A

2013-01-01

Background: Arginine is considered an essential amino acid during critical illness in children, and supplementation of arginine has been proposed to improve arginine availability to facilitate nitric oxide (NO) synthesis. Protein-energy–enriched enteral formulas (PE-formulas) can improve nutrient intake and promote anabolism in critically ill infants. However, the effect of increased protein and energy intake on arginine metabolism is not known. Objective: We investigated the effect of a PE-formula compared with that of a standard infant formula (S-formula) on arginine kinetics in critically ill infants. Design: A 2-h stable-isotope tracer protocol was conducted in 2 groups of critically ill infants with respiratory failure because of viral bronchiolitis, who received either a PE-formula (n = 8) or S-formula (n = 10) in a randomized, blinded, controlled setting. Data were reported as means ± SDs. Results: The intake of a PE-formula in critically ill infants (aged 0.23 ± 0.14 y) resulted in an increased arginine appearance (PE-formula: 248 ± 114 μmol · kg−1 · h−1; S-formula: 130 ± 53 μmol · kg−1 · h−1; P = 0.012) and NO synthesis (PE-formula: 1.92 ± 0.99 μmol · kg−1 · h−1; S-formula: 0.84 ± 0.36 μmol · kg−1 · h−1; P = 0.003), whereas citrulline production and plasma arginine concentrations were unaffected. Conclusion: In critically ill infants with respiratory failure because of viral bronchiolitis, the intake of a PE-formula increases arginine availability by increasing arginine appearance, which leads to increased NO synthesis, independent of plasma arginine concentrations. This trial was registered at www.trialregister.nl as NTR515. PMID:23945723

Effect of Nitrogen Foliar Application on Canola Yield (Brassica napus L. and Nitrogen Efficiency across Different Sowing Dates

Directory of Open Access Journals (Sweden)

S Doori

2016-12-01

of dusty application (1/3 after appearance of seedling on the soil, 1/3 in 3-4 leaves stage after thinning and 1/3 at the beginning of steam elongation and 100 kg.ha-1 super phosphate triple in all plot was applied before planting. Each plot was consist of 8 planting line with 20 cm apart from each other and 4 m length. The data were analyzed by using SAS and mean comparison of data based on LSD test in 5% probably level. Results and Discussion Late sowing date and nitrogen foliar have significant effect on the yield and efficiency and uptake index of nitrogen. With delay in sowing because the flowering and silique formation stage faced with the heat tension, the vegetative phase, production of photosynthesis matter and growth all treatment like: yield, oil yield, biological yield, oil seed percent, nitrogen harvest index, nitrogen use efficiency, nitrogen utilization of agronomy efficiency and amount of nitrogen uptake, were decrease. But it should be pointed out that with delay in sowing the percentage of nitrogen seed and nitrogen of all bushes was increased. The highest yield with mean of 3406.6 kg.ha-1 was relevant to first sowing date and least yield with mean 1803 and 1499.1 kg.ha-1 was achieved of second and third sowing date, respectively. In foliar treatment the highest yield was obtained from N foliar in budding and flowering stages and the least yield was obtained from control treatment. Foliar in budding and flowering stages by increasing the green surfaces of plant, more benefit of sun radiation, increasing in photosynthetic activity were increase and in this way the seed yield and oil yield were increase. As well nitrogen harvest index was increased with increasing of assigned nitrogen to silique in canola and the reduction in wasting of nitrogen will be increased by consume it in appropriate time. With nitrogen foliar application because of availability of nitrogen in appropriate amount and adequate utilization of plant of nitrogen, caused to increase

Effects of lanthanum(III) on nitrogen metabolism of soybean seedlings under elevated UV-B radiation.

Science.gov (United States)

Cao, Rui; Huang, Xiao-hua; Zhou, Qing; Cheng, Xiao-ying

2007-01-01

The hydroponic culture experiments of soybean bean seedlings were conducted to investigate the effect of lanthanum (La) on nitrogen metabolism under two different levels of elevated UV-B radiation (UV-B, 280-320 nm). The whole process of nitrogen metabolism involves uptake and transport of nitrate, nitrate assimilation, ammonium assimilation, amino acid biosynthesis, and protein synthesis. Compared with the control, UV-B radiation with the intensity of low level 0.15 W/m2 and high level 0.45 W/m2 significantly affected the whole nitrogen metabolism in soybean seedlings (p nitrogen-metabolism-related enzymes, such as: nitrate reductase (NR) to the nitrate reduction, glutamine systhetase (GS) and glutamine synthase (GOGAT) to the ammonia assimilation, while it increased the content of free amino acids and decreased that of soluble protein as well. The damage effect of high level of UV-B radiation on nitrogen metabolism was greater than that of low level. And UV-B radiation promoted the activity of the anti-adversity enzyme glutamate dehydrogenase (GDH), which reduced the toxicity of excess ammonia in plant. After pretreatment with the optimum concentration of La (20 mg/L), La could increase the activity of NR, GS, GOGAT, and GDH, and ammonia assimilation, but decrease nitrate and ammonia accumulation. In conclusion, La could relieve the damage effect of UV-B radiation on plant by regulating nitrogen metabolism process, and its alleviating effect under low level was better than that under the high one.

Effects of UV-B radiation on growth, photosynthesis, UV-B-absorbing compounds and NADP-malic enzyme in bean (Phaseolus vulgaris L.) grown under different nitrogen conditions.

Science.gov (United States)

Pinto, M E; Casati, P; Hsu, T P; Ku, M S; Edwards, G E

1999-02-01

The effects of UV-B radiation on growth, photosynthesis, UV-B-absorbing compounds and NADP-malic enzyme have been examined in different cultivars of Phaseolous vulgaris L. grown under 1 and 12 mM nitrogen. Low nitrogen nutrition reduces chlorophyll and soluble protein contents in the leaves and thus the photosynthesis rate and dry-matter accumulation. Chlorophyll, soluble protein and Rubisco contents and photosynthesis rate are not significantly altered by ambient levels of UV-B radiation (17 microW m-2, 290-320 nm, 4 h/day for one week). Comparative studies show that under high nitrogen, UV-B radiation slightly enhances leaf expansion and dry-matter accumulation in cultivar Pinto, but inhibits these parameters in Vilmorin. These results suggest that the UV-B effect on growth is mediated through leaf expansion, which is particularly sensitive to UV-B, and that Pinto is more tolerant than Vilmorin. The effect of UV-B radiation on UV-B-absorbing compounds and on NADP-malic enzyme (NADP-ME) activity is also examined. Both UV-B radiation and low-nitrogen nutrition enhance the content of UV-B-absorbing compounds, and among the three cultivars used, Pinto exhibits the highest increases and Arroz the lowest. The same trend is observed for the specific activity and content of NADP-ME. On a leaf-area basis, the amount of UV-B-absorbing compounds is highly correlated with the enzyme activity (r2 = 0.83), suggesting that NADP-ME plays a key role in biosynthesis of these compounds. Furthermore, the higher sensitivity of Vilmorin than Pinto to UV-B radiation appears to be related to the activity of NADP-ME and the capacity of the plants to accumulate UV-B-absorbing compounds.

Physiocochemical properties of blood serum proteins of coal miners

Energy Technology Data Exchange (ETDEWEB)

Nandakova, V N; Zemliakova, L F; Sukhanov, V V; Min' ko, L A

1979-07-01

Using disk electrophoresis in the polyacrylamide gel, blood serum proteins were studied in miners working under conditions of the combine (the control group) and drilling-and-blasting (the contact with carbon oxide, nitrogen oxides) driving technique under normal temperature conditions. 26 to 27 protein fractions characterized by mobility, thermolability under definite conditions of the experiment and the contitative content were obtained. It is shown that the contact with carbon oxide and nitrogen oxides causes changes in the properties of certain proteins (II3, globulins - 2 alpha 1, 3 alpha 1, 2 beta, 2 alpha 2, 5 alpha 2, 6 alpha 2, 7 alpha 2) of miners' blood serum. Some of these proteins are supposed to participate in the adaptation reactions of the organism.

Microbial Nitrogen-Cycle Gene Abundance in Soil of Cropland Abandoned for Different Periods.

Science.gov (United States)

Huhe; Borjigin, Shinchilelt; Buhebaoyin; Wu, Yanpei; Li, Minquan; Cheng, Yunxiang

2016-01-01

In Inner Mongolia, steppe grasslands face desertification or degradation because of human overuse and abandonment after inappropriate agricultural management. The soils in these abandoned croplands exist in heterogeneous environments characterized by widely fluctuating microbial growth. Quantitative polymerase chain reaction analysis of microbial genes encoding proteins involved in the nitrogen cycle was used to study Azotobacter species, nitrifiers, and denitrifiers in the soils from steppe grasslands and croplands abandoned for 2, 6, and 26 years. Except for nitrifying archaea and nitrous oxide-reducing bacteria, the relative genotypic abundance of microbial communities involved in nitrogen metabolism differed by approximately 2- to 10-fold between abandoned cropland and steppe grassland soils. Although nitrogen-cycle gene abundances varied with abandonment time, the abundance patterns of nitrogen-cycle genes separated distinctly into abandoned cropland versus light-grazing steppe grassland, despite the lack of any cultivation for over a quarter-century. Plant biomass and plant diversity exerted a significant effect on the abundance of microbial communities that mediate the nitrogen cycle (P nitrogen cycle in recently abandoned croplands.

Nitrite uptake by nitrogen-depleted wheat seedlings

Energy Technology Data Exchange (ETDEWEB)

Jackson, W A; Johnson, R E; Volk, R J

1974-01-01

Intact, 14-day-old nitrogen-depleted wheat (Triticum vulgare cv. Blueboy) seedlings were exposed to solutions of 0.5 mM KNO/sub 2/, 0.05 mM CaSO/sub 4/ and 1 mM sodium 2-(N-morpholino)-ethanesulfonate, pH 6.1. Nitrite uptake was determined from depletion of the ambient solution or from incorporation of /sup 15/N in the tissue. An initial nitrite uptake shoulder was followed by a relatively slow uptake rate which subsequently increased to a substantially greater rate. This accelerated phase was maintained through 24 h. Nitrite accumulated to a slight extent in the root tissues during the first few hours but declined to low values when the accelerated rate was fully developed, indicating an increase in nitrite reductase activity paralleling the increase in nitrite uptake capacity. About 50% of the nitrogen absorbed as nitrite was translocated to the shoots by 9 to 12 h. Development of the accelerated nitrite uptake rate was restricted in excised roots, in intact plants kept in darkness, by 400 ..mu..g puromycin ml/sup -1/ and by 1 mM L-ethionine. When puromycin and L-ethionine were added after the accelerated phase had been initiated, their effects were not as detrimental as when they were added at first exposure to KNO/sub 2/. The two inhibitors restricted translocation more than uptake. The data indicate an involvement of protein synthesis and a requirement for movement of a substance from shoots to roots for maximal development of the accelerated nitrite uptake phase. A requirement for protein synthesis in the transport of soluble organic nitrogen from roots to shoots is also suggested.

[Indicators of protein metabolism in infants with intrauterine dystrophy red various dietary mixtures].

Science.gov (United States)

Krukowa, A; Symonowicz, H; Wachnik, Z; Koziej, M

1979-01-01

In the previous work published in No 7 of "Development Period Medicine" ( Problemy Medycyny Wieku Rozwojowego ) the results of nitrogen balance studies in S-f-D infants fed different milk formulas were described. The present study concerns other protein metabolism indices in the same infants. The infants were divided into four groups according to the formula they were fed. The composition of formulas is shown in table I. In the infants besides the balance study, serum urea nitrogen, protein and albumin level, were estimated once a month. Also urea, creatine and creatinine, and hydroxyproline in 24-hours urine collections were examined. Excretion of creatine, creatinine and hydroxyproline was summarized in 5 boys from the group of 38 investigated infants in the first five months of life when meat-free diet was fed. The above mentioned indices permit for better assessment of the effect of the diet on protein metabolism and the requirement of protein for S-f-D infants. The results of protein metabolism indices were compared with the indices obtained in F.S. infants similarly fed. Group S of S-f-D infants was compared with group A of F.S. infants and the other groups of S-f-D infants were compared with each other. In S-f-D infants fed formula S, a lower level of serum urea nitrogen was observed in comparison with F.S. infants of group A in spite of greater protein intake in S-f-D infants. This should prove a greater protein requirement in S-f-D infants. Decreased protein content and cow's milk fat modification also had profitable influence on protein utilization because serum urea nitrogen and nitrogen in urine were low in S-f-D infants fed this formula. Urine urea nitrogen as a part of total urine nitrogen is bigger in group S and C infants, and the lowest in group G infants (formula with lower fat and total protein content). Serum protein and albumin level was generally higher in S-f-D infants than in FS ones. Particularly high level of these parameters was observed

Exploring a suitable nitrogen fertilizer rate to reduce greenhouse gas emissions and ensure rice yields in paddy fields

Energy Technology Data Exchange (ETDEWEB)

Zhong, Yiming; Wang, Xiaopeng; Yang, Jingping, E-mail: jpyang@zju.edu.cn; Zhao, Xing; Ye, Xinyi

2016-09-15

The application rate of nitrogen fertilizer was believed to dramatically influence greenhouse gas (GHG) emissions from paddy fields. Thus, providing a suitable nitrogen fertilization rate to ensure rice yields, reducing GHG emissions and exploring emission behavior are important issues for field management. In this paper, a two year experiment with six rates (0, 75, 150, 225, 300, 375 kg N/ha) of nitrogen fertilizer application was designed to examine GHG emissions by measuring carbon dioxide (CO{sub 2}), methane (CH{sub 4}), nitrous oxide (N{sub 2}O) flux and their cumulative global warming potential (GWP) from paddy fields in Hangzhou, Zhejiang in 2013 and 2014. The results indicated that the GWP and rice yields increased with an increasing application rate of nitrogen fertilizer. Emission peaks of CH{sub 4} mainly appeared at the vegetative phase, and emission peaks of CO{sub 2}, and N{sub 2}O mainly appeared at reproductive phase of rice growth. The CO{sub 2} flux was significantly correlated with soil temperature, while the CH{sub 4} flux was influenced by logging water remaining period and N{sub 2}O flux was significantly associated with nitrogen application rates. This study showed that 225 kg N/ha was a suitable nitrogen fertilizer rate to minimize GHG emissions with low yield-scaled emissions of 3.69 (in 2013) and 2.23 (in 2014) kg CO{sub 2}-eq/kg rice yield as well as to ensure rice yields remained at a relatively high level of 8.89 t/ha in paddy fields. - Highlights: • Exploiting co-benefits of rice yield and reduction of greenhouse gas emission. • Global warming potential and rice yield increased with nitrogen fertilizer rate up. • Emission peaks of CH{sub 4,} CO{sub 2} and N{sub 2}O appeared at vegetative and reproductive phase. • 225 kg N/ha rate benefits both rice yields and GWP reduction.

Effects of rumen-degradable protein:rumen-undegradable protein ratio and corn processing on production performance, nitrogen efficiency, and feeding behavior of Holstein dairy cows.

Science.gov (United States)

Savari, M; Khorvash, M; Amanlou, H; Ghorbani, G R; Ghasemi, E; Mirzaei, M

2018-02-01

This study was conducted to investigate the effects of the ratio of rumen-degradable protein (RDP) to rumen-undegradable protein (RUP) and corn processing method on production performance, nitrogen (N) efficiency, and feeding behavior of high-producing Holstein dairy cows. Twelve multiparous Holstein cows (second parity; milk yield = 48 ± 3 kg/d) were assigned to a replicated 4 × 4 Latin square design with a 2 × 2 factorial arrangement of treatments. Factor 1 was corn processing method [ground corn (GC) or steam flaked corn (SFC) with a flake density of about 390 g/L], and factor 2 was RDP:RUP ratio [low ratio (LR) = 60:40; high ratio (HR) = 65:35] based on crude protein (%). The crude protein concentrations were kept constant across the treatments (16.7% of DM). No significant interactions of main treatment effects occurred for lactation performance data. Cows fed 2 different RDP:RUP ratios exhibited similar dry matter intake (DMI), but those fed SFC showed decreased feed intake compared with those receiving GC (25.1 ± 0.48 vs. 26.2 ± 0.47 kg/d, respectively). Cows fed HR diets produced more milk than did those fed LR diets (44.4 ± 1.05 vs. 43.2 ± 1.05 kg/d, respectively). Milk fat content decreased but milk protein content increased in cows fed SFC compared with those fed GC. Feed efficiency (i.e., milk yield/DMI) was enhanced with increasing ratio of RDP:RUP (1.68 ± 0.04 vs. 1.74 ± 0.04 for LR and HR, respectively). Apparent N efficiency was higher in cows fed HR than in those fed LR (30.4 ± 0.61 vs. 29.2 ± 0.62, respectively). Compared with cows fed the GC-based diet, those receiving SFC exhibited lower values of N intake, N-NH 3 concentration, and fecal N excretion. Cows receiving SFC-based diets spent more time ruminating (min/kg of DMI) than did those fed GC. Although these results showed no interaction effects of RDP:RUP ratio and corn processing method on performance, higher RDP:RUP ratios and ground corn can be effective feeding strategies for

Ectopic phytocystatin expression increases nodule numbers and influences the responses of soybean (Glycine max) to nitrogen deficiency.

Science.gov (United States)

Quain, Marian D; Makgopa, Matome E; Cooper, James W; Kunert, Karl J; Foyer, Christine H

2015-04-01

Cysteine proteases and cystatins have many functions that remain poorly characterised, particularly in crop plants. We therefore investigated the responses of these proteins to nitrogen deficiency in wild-type soybeans and in two independent transgenic soybean lines (OCI-1 and OCI-2) that express the rice cystatin, oryzacystatin-I (OCI). Plants were grown for four weeks under either a high (5 mM) nitrate (HN) regime or in the absence of added nitrate (LN) in the absence or presence of symbiotic rhizobial bacteria. Under the LN regime all lines showed similar classic symptoms of nitrogen deficiency including lower shoot biomass and leaf chlorophyll. However, the LN-induced decreases in leaf protein and increases in root protein tended to be smaller in the OCI-1 and OCI-2 lines than in the wild type. When LN-plants were grown with rhizobia, OCI-1 and OCI-2 roots had significantly more crown nodules than wild-type plants. The growth nitrogen regime had a significant effect on the abundance of transcripts encoding vacuolar processing enzymes (VPEs), LN-dependent increases in VPE2 and VPE3 transcripts in all lines. However, the LN-dependent increases of VPE2 and VPE3 transcripts were significantly lower in the leaves of OCI-1 and OCI-2 plants than in the wild type. These results show that nitrogen availability regulates the leaf and root cysteine protease, VPE and cystatin transcript profiles in a manner that is in some cases influenced by ectopic OCI expression. Moreover, the OCI-dependent inhibition of papain-like cysteine proteases favours increased nodulation and enhanced tolerance to nitrogen limitation, as shown by the smaller LN-dependent decreases in leaf protein observed in the OCI-1 and OCI-2 plants relative to the wild type. Copyright © 2015 Elsevier Ltd. All rights reserved.

Genetic variations in the dynamics of dry matter accumulation, nitrogen assimilation and translocation in new T. aestivum L. varieties. II. Nitrogen assimilation and translocation in relation to grain yield and protein content

International Nuclear Information System (INIS)

Nankova, M.; Kostov, K.; Penchev, E.

1999-01-01

The study was carried out under greenhouse and field conditions and showed considerable genotype differences between the vrs. Enola, Karat, Svilena and Pliska (T. aestivum L.) with regard to N assimilation during heading, which played an important role in grain yield formation (0.852). Grain yield depends considerably on N translocation (NT) in the period heading-full maturity (0.864) and on its part affects the intensity of N uptake in grain during grain filling-full maturity. In both experiments cv. Svilena demonstrated high NR from the leaves, which was the reason for more than 52 % of N in grain. In the field experiment cv. Svilena confirmed this tendency, the NR being highest in the 2-3 leaf stage, followed by the flag leaf and the down leaves. The intensity of N uptake in grain during grain filling-full maturity was highest in the vrs. Enola and Karat. This intensity was in strong correlation with NA during heading, and with NT in V m during heading-full maturity. It also affected to a high degree the protein content in grain, as well as grain yield. In both experiments a strong negative correlation was established between the NHI/GHI ratio, and grain yield and nitrogen assimilation during heading; a positive correlation was determined with grain NHI. Under the conditions of increasing N dressing, the vrs. Enola, Karat, and Svilena had higher N expense for formation of a production unit, 63 up to 91 % of the N being used for formation of grain with high protein content. Protein yield correlated strongly not only with protein in grain, but also with the intensity of uptake in grain during grain filling - full maturity. The highest protein yield was registered in cv. Karat. By their N expense for production of 100 kg protein, the new varieties did not differ from the standard variety Pliska. The results from the study showed a higher genetic potential of the agrochemically promising varieties Karat, Enola and Svilena than the standard variety Pliska. Refs. 10

Evaluating Nitrogen Management Options for Reducing Nitrate Leaching from Northeast U.S. Pastures

Directory of Open Access Journals (Sweden)

William L. Stout

2001-01-01

Full Text Available Substantial amounts of nitrate nitrogen NO3-N can leach from intensively grazed pasture in the northeast U.S. where there is about 30 cm of groundwater recharge, annually. Management options for reducing NO3-N leaching were evaluated for this environment using the Cornell Net Carbohydrate and Protein System Model and a recently developed nitrogen leaching index. Management options utilizing energy supplementation of grazing dairy cows could improve nitrogen efficiency within the cow, but would not necessarily reduce NO3-N leaching at the pasture scale if stocking rate was not controlled. The management option of using white clover to supply nitrogen to the pasture decreased NO3-N leaching, but produced less dry matter yield, which in turn reduced stocking rate. The economic returns of reducing NO3-N with these options need to be evaluated in light of milk prices and commodity and fertilizer nitrogen costs. At current prices and costs, the economic benefit from the energy supplementation options is substantial.

Thermal expansion and phase transformations of nitrogen-expanded austenite studied with in situ synchrotron X-ray diffraction

DEFF Research Database (Denmark)

Brink, Bastian; Ståhl, Kenny; Christiansen, Thomas Lundin

2014-01-01

Nitrogen-expanded austenite, _N, with high and low nitrogen contents was produced from AISI 316 grade stainless steel powder by gaseous nitriding in ammonia/hydrogen gas mixtures. In situ synchrotron X-ray diffraction was applied to investigate the thermal expansion and thermal stability...... as a fitting parameter. The stacking fault density is constant for temperatures up to 680 K, whereafter it decreases to nil. Surprisingly, a transition phase with composition M4N (M = Fe, Cr, Ni, Mo) appears for temperatures above 770 K. The linear coefficient of thermal expansion depends on the nitrogen...

Mechanism of nitrogen removal in wastewater lagoon: a case study.

Science.gov (United States)

Vendramelli, Richard A; Vijay, Saloni; Yuan, Qiuyan

2017-06-01

Ammonia being a nutrient facilitates the growth of algae in wastewater and causes eutrophication. Nitrate poses health risk if it is present in drinking water. Hence, nitrogen removal from wastewater is required. Lagoon wastewater treatment systems have become common in Canada these days. The study was conducted to understand the nitrogen removal mechanisms from the existing wastewater treatment lagoon system in the town of Lorette, Manitoba. The lagoon system consists of two primary aerated cells and two secondary unaerated cells. Surface samples were collected periodically from lagoon cells and analysed from 5 May 2015 to 9 November 2015. The windward and leeward sides of the ponds were sampled and the results were averaged. It was found that the free ammonia volatilization to the atmosphere is responsible for most of the ammonia removal. Ammonia and nitrate assimilation into biomass and biological growth in the cells appears to be the other mechanisms of nitrogen removal over the monitoring period. Factors affecting the nitrogen removal efficiency were found to be pH, temperature and hydraulic residence time. Also, the ammonia concentration in the effluent from the wastewater treatment lagoon was compared with the regulatory standard.

Nitrogen oxidative activation in the radiolysis process of dioxide hydrocarbon composition, oxygen-nitrogen over 3-d transition metals

International Nuclear Information System (INIS)

Rustamov, V.R.; Garibov, A.A.; Kerimov, V.K.; Aliyev, S.M.; Nasirova, Kh.Y.

2004-01-01

The radiochemical process of nitrogen fixation in carbon dioxide, oxygen-nitrogen composition in 3-d metal (iron, nickel) was studied. Bifunctional character of surface's role in the generation of radiolysis products was postulated: a) Chemisorption's of molecular ions (N 2 + , CO 2 + , O 2 + ) on the surface of metal and their dissociative neutralization. b) Coordination of nitrogen and carbon oxide being generated in nitrosyl and carbonyl-nitrosyl complex of iron and nickel. Total yield of the products is over the rang 6,4†7,5, to explain radiolysis' what contribution of only neutral products is impossible. Evidently in the generation of final products, defined contribution brings in molecular ions N 2 + (N + ) and CO 2 + . Interaction character of these ions with nickel proposes the formation of the relation between unpaired electrons N 2 + and CO 2 + with unfilled d-sub level of this metals with the nickel nitride generation [N i -N=N + ] and binding energy in ion diazotate decreases to twice. The yield of nitrogen dioxide on radiolysis of the air gave G NO2 =0,8±0,2 molecule/100eV which is proper to the date in the literature. Kinetic curve appears rapidly in the saturation. Air radiolysis over iron gave the following results: G NO 2 = 2,75 ± 0,25, G N 2 O = 9,0 ± 1,0 molecule/100eV. Thus total yield of radiolysis products is Σ G = 10,5 ± 12,0 molecule/100eV. (author)

Nitrogen oxidative activation in the radiolysis process of dioxide hydrocarbon composition, oxygen-nitrogen over 3-D transition metals

International Nuclear Information System (INIS)

Rustamov, V.R.; Garibov, A.A.; Kerimov, V.K.; Aliyev, S.M.; Nasirova, Kh.Y.

2004-01-01

Full text: The radiochemical process of nitrogen fixation in carbon dioxide, oxygen-nitrogen composition in 3-d metal (iron, nickel) was studied. Bifunctional character of surface's role in the generation of radiolysis products was postulated: a) Chemisorption's of molecular ions (N 2 + , CO 2 + , O 2 + ) on the surface of metal and their dissociative neutralization. b) Coordination of nitrogen and carbon oxide being generated in nitrosyl and carbonyl-nitrosyl complex of iron and nickel. Total yield of the products is over the rang 6,4†7,5, to explain radiolysis' what contribution of only neutral products is impossible. Evidently in the generation of final products, defined contribution brings in molecular ions N 2 + (N + ) and CO 2 + . Interaction character of these ions with nickel proposes the formation of the relation between unpaired electrons N 2 + and CO 2 + with unfilled d-sub level of this metals with the nickel nitride generation [N i -N=N + ] and binding energy in ion diazotate decreases to twice. The yield of nitrogen dioxide on radiolysis of the air gave G NO2 =0,8±0,2 molecule/100eV which is proper to the date in the literature. Kinetic curve appears rapidly in the saturation. Air radiolysis over iron gave the following results: G NO 2 = 2,75 ± 0,25, G N 2 O = 9,0 ± 1,0 molecule/100eV. Thus total yield of radiolysis products is Σ G = 10,5 ± 12,0 molecule/100eV

Microbial Biofertilizer Decreases Nicotine Content by Improving Soil Nitrogen Supply.

Science.gov (United States)

Shang, Cui; Chen, Anwei; Chen, Guiqiu; Li, Huanke; Guan, Song; He, Jianmin

2017-01-01

Biofertilizers have been widely used in many countries for their benefit to soil biological and physicochemical properties. A new microbial biofertilizer containing Phanerochaete chrysosporium and Bacillus thuringiensis was prepared to decrease nicotine content in tobacco leaves by regulating soil nitrogen supply. Soil NO 3 - -N, NH 4 + -N, nitrogen supply-related enzyme activities, and nitrogen accumulation in plant leaves throughout the growing period were investigated to explore the mechanism of nicotine reduction. The experimental results indicated that biofertilizer can reduce the nicotine content in tobacco leaves, with a maximum decrement of 16-18 % in mature upper leaves. In the meantime, the total nitrogen in mature lower and middle leaves increased with the application of biofertilizer, while an opposite result was observed in upper leaves. Protein concentration in leaves had similar fluctuation to that of total nitrogen in response to biofertilizer. NO 3 - -N content and nitrate reductase activity in biofertilizer-amended soil increased by 92.3 and 42.2 %, respectively, compared to those in the control, whereas the NH 4 + -N and urease activity decreased by 37.8 and 29.3 %, respectively. Nitrogen uptake was improved in the early growing stage, but this phenomenon was not observed during the late growth period. Nicotine decrease is attributing to the adjustment of biofertilizer in soil nitrogen supply and its uptake in tobacco, which result in changes of nitrogen content as well as its distribution in tobacco leaves. The application of biofertilizer containing P. chrysosporium and B. thuringiensis can reduce the nicotine content and improve tobacco quality, which may provide some useful information for tobacco cultivation.

Constitutive and nitrogen catabolite repression-sensitive production of Gat1 isoforms.

Science.gov (United States)

Rai, Rajendra; Tate, Jennifer J; Georis, Isabelle; Dubois, Evelyne; Cooper, Terrance G

2014-01-31

Nitrogen catabolite repression (NCR)-sensitive transcription is activated by Gln3 and Gat1. In nitrogen excess, Gln3 and Gat1 are cytoplasmic, and transcription is minimal. In poor nitrogen, Gln3 and Gat1 become nuclear and activate transcription. A long standing paradox has surrounded Gat1 production. Gat1 was first reported as an NCR-regulated activity mediating NCR-sensitive transcription in gln3 deletion strains. Upon cloning, GAT1 transcription was, as predicted, NCR-sensitive and Gln3- and Gat1-activated. In contrast, Western blots of Gat1-Myc(13) exhibited two constitutively produced species. Investigating this paradox, we demonstrate that wild type Gat1 isoforms (IsoA and IsoB) are initiated at Gat1 methionines 40, 95, and/or 102, but not at methionine 1. Their low level production is the same in rich and poor nitrogen conditions. When the Myc(13) tag is placed after Gat1 Ser-233, four N-terminal Gat1 isoforms (IsoC-F) are also initiated at methionines 40, 95, and/or 102. However, their production is highly NCR-sensitive, being greater in proline than glutamine medium. Surprisingly, all Gat1 isoforms produced in sufficient quantities to be confidently analyzed (IsoA, IsoC, and IsoD) require Gln3 and UASGATA promoter elements, both requirements typical of NCR-sensitive transcription. These data demonstrate that regulated Gat1 production is more complex than previously recognized, with wild type versus truncated Gat1 proteins failing to be regulated in parallel. This is the first reported instance of Gln3 UASGATA-dependent protein production failing to derepress in nitrogen poor conditions. A Gat1-lacZ ORF swap experiment indicated sequence(s) responsible for the nonparallel production are downstream of Gat1 leucine 61.

Evaluate Effect of Water Stress and Different Amounts of Nitrogen Fertilizer on Seed Quality of Black Cumin (Nigella Sativa L

Directory of Open Access Journals (Sweden)

M Heidari

2014-03-01

Full Text Available In order to study the effects of water stress and different levels of nitrogen fertilizer on grian yield and accumulation macronutrients included: nitrogen, phosphorus and potassium and micronutrient included: iron, zinc, manganese and copper, oil, protein and thymoquinone contents in seed of black cumin, a field experiment was conducted as split plot design with three replications at Agricultural Research Station, Zahak, Zabol during growing season of 2010-2011. Water stress treatments included: W1= control, W2= no irrigation at stem elongation stage to flowering, W3= irrigation at flowering stage until the beginning of grain filling and W4= no irrigation at flowering and grain filling as the main plots and four levels of nitrogen application fertilizer, including N1= control or without any fertilizer consumption, N2= 30 kg N/ha, N3= 60 kg N/ha and N4= 90 kg N/ha in sub plot. Results showed that water stress had significant effect on the grain yield and accumulation of macro and micronutrient in the seed of Black Cumin. Except for and iron, the highest amounts of nitrogen, phosphorus, potassium, manganese, copper and zinc and the lowest amount of grain yield were obtained at W4 treatment and manganese at W3 treatment. In this experiment the interaction effect between stress and nitrogen fertilizer except grain yield and potassium had significant impact on others elements. The results indicated that water stress at flowering and grain filling (W4 stages, the maximum amount of micro and macronutrients in seed was obtained at N1 and N2 nitrogen treatment. Also, water stress and nitrogen treatments increased the percentage of protein, oil and thymoquinone contents of seed, but during the onset of water stress and the use of nitrogen fertilizer, the highest percentage of protein in and thymoquinone were obtained in W4N4.

Evaluation of body composition and nitrogen content of renal patients on chronic dialysis as determined by total body neutron activation

International Nuclear Information System (INIS)

Cohn, S.H.; Brennan, B.L.; Yasumura, S.; Vartsky, D.; Vaswani, A.N.; Ellis, K.J.

1983-01-01

Total body protein (nitrogen), body cell mass (potassium), fat, and water were measured in 15 renal patients on maintenance hemodialysis (MHD). Total body nitrogen was measured by means of prompt γ neutron activation analysis; total body water was determined with tritium labeled water; total body potassium was measured by whole body counting. The extracellular water was determined by a technique utilizing the measurement of total body chloride and plasma chloride. When compared with corresponding values of a control group of the same age, sex, and height, the protein content, body cell mass, and total body fat of the MHD patients were within the normal range. The only significant change was an increase in the extracellular water/body cell mass ratio in the male MHD patients compared to the control. The lack of significant difference of the nitrogen values of the MHD patients compared to matched controls suggests that dialysis minimizes any residual effects of uremic toxicity or protein-calorie malnutrition. These findings further suggest that there is a need to reevaluate the traditional anthropometric and biochemical standards of nutritional status for MHD patients. It was concluded that it is particularly important to measure protein stores of MHD patients with low protein intake to ascertain nutritional status. Finally, in vivo measurement of total body nitrogen and potassium for determination of body composition provides a simple, direct, and accurate assessment of the nutritional status of MHD patients

Heterologous aggregates promote de novo prion appearance via more than one mechanism.

Directory of Open Access Journals (Sweden)

Fatih Arslan

2015-01-01

Full Text Available Prions are self-perpetuating conformational variants of particular proteins. In yeast, prions cause heritable phenotypic traits. Most known yeast prions contain a glutamine (Q/asparagine (N-rich region in their prion domains. [PSI+], the prion form of Sup35, appears de novo at dramatically enhanced rates following transient overproduction of Sup35 in the presence of [PIN+], the prion form of Rnq1. Here, we establish the temporal de novo appearance of Sup35 aggregates during such overexpression in relation to other cellular proteins. Fluorescently-labeled Sup35 initially forms one or a few dots when overexpressed in [PIN+] cells. One of the dots is perivacuolar, colocalizes with the aggregated Rnq1 dot and grows into peripheral rings/lines, some of which also colocalize with Rnq1. Sup35 dots that are not near the vacuole do not always colocalize with Rnq1 and disappear by the time rings start to grow. Bimolecular fluorescence complementation failed to detect any interaction between Sup35-VN and Rnq1-VC in [PSI+][PIN+] cells. In contrast, all Sup35 aggregates, whether newly induced or in established [PSI+], completely colocalize with the molecular chaperones Hsp104, Sis1, Ssa1 and eukaryotic release factor Sup45. In the absence of [PIN+], overexpressed aggregating proteins such as the Q/N-rich Pin4C or the non-Q/N-rich Mod5 can also promote the de novo appearance of [PSI+]. Similar to Rnq1, overexpressed Pin4C transiently colocalizes with newly appearing Sup35 aggregates. However, no interaction was detected between Mod5 and Sup35 during [PSI+] induction in the absence of [PIN+]. While the colocalization of Sup35 and aggregates of Rnq1 or Pin4C are consistent with the model that the heterologous aggregates cross-seed the de novo appearance of [PSI+], the lack of interaction between Mod5 and Sup35 leaves open the possibility of other mechanisms. We also show that Hsp104 is required in the de novo appearance of [PSI+] aggregates in a [PIN

Metagenomic profiling of a microbial assemblage associated with the California mussel: a node in networks of carbon and nitrogen cycling.

Directory of Open Access Journals (Sweden)

Catherine A Pfister

2010-05-01

Full Text Available Mussels are conspicuous and often abundant members of rocky shores and may constitute an important site for the nitrogen cycle due to their feeding and excretion activities. We used shotgun metagenomics of the microbial community associated with the surface of mussels (Mytilus californianus on Tatoosh Island in Washington state to test whether there is a nitrogen-based microbial assemblage associated with mussels. Analyses of both tidepool mussels and those on emergent benches revealed a diverse community of Bacteria and Archaea with approximately 31 million bp from 6 mussels in each habitat. Using MG-RAST, between 22.5-25.6% were identifiable using the SEED non-redundant database for proteins. Of those fragments that were identifiable through MG-RAST, the composition was dominated by Cyanobacteria and Alpha- and Gamma-proteobacteria. Microbial composition was highly similar between the tidepool and emergent bench mussels, suggesting similar functions across these different microhabitats. One percent of the proteins identified in each sample were related to nitrogen cycling. When normalized to protein discovery rate, the high diversity and abundance of enzymes related to the nitrogen cycle in mussel-associated microbes is as great or greater than that described for other marine metagenomes. In some instances, the nitrogen-utilizing profile of this assemblage was more concordant with soil metagenomes in the Midwestern U.S. than for open ocean system. Carbon fixation and Calvin cycle enzymes further represented 0.65 and 1.26% of all proteins and their abundance was comparable to a number of open ocean marine metagenomes. In sum, the diversity and abundance of nitrogen and carbon cycle related enzymes in the microbes occupying the shells of Mytilus californianus suggest these mussels provide a node for microbial populations and thus biogeochemical processes.

Effect of temperature stress on protein methyl esters

International Nuclear Information System (INIS)

Welch, W.; Kracaw, K.

1986-01-01

Protein methyl esters have been implicated in a number of physiological processes. They have measured the effect of temperature stress on the levels of protein methyl esters in the mesophilic fungus Penicillium chrysogenum (PCPS) and the thermophilic fungus P. duponti (PD). PD and PCPS were incubated with [methyl- 3 H]methionine. The mycelia were collected by filtration, frozen in liquid nitrogen and ground to a fine powder. The nitrogen powder was extracted with either phosphate buffer or with SDS, glycerol, phosphate, 2-mercaptoethanol. Insoluble material was removed by centrifugation. The supernatants were assayed for protein methyl esters. The released [ 3 H]methanol was extracted into toluene:isoamyl alcohol (3:2) and quantitated by liquid scintillation. The production of volatile methanol was confirmed by use of Conway diffusion cells. Soluble proteins accounted for about one-fourth of the total protein methyl ester extracted by SDS. In PCPS, the SDS extracted proteins have about three times the level of esterification of the soluble proteins whereas in PD there is little difference between soluble and SDS extracted protein. The level of protein esterification in PD is about one-tenth that observed in PCPS. Temperature stress caused large changes in the level of protein esterification. The data suggest protein methyl esters may contribute to the adaptation to environmental stress

Effects of nitro-treatment on Salmonella, E. coli and nitrogen metabolism during composting of poultry litter

Science.gov (United States)

Poultry litter contains appreciable amounts of uric acid which makes it a good crude protein supplement for ruminants whose gut microbes transform the nitrogen in uric acid into high quality microbial protein. However, poultry litter must be treated to kill bacterial pathogens before feeding. Pres...

Potato proteins : their properties and nutritive value

NARCIS (Netherlands)

Labib, A.I.

1962-01-01

Physical and biological investigations were carried out on the nitrogenous substances in the potato tuber. The importance of the potato as a food was considered in the introduction. By paper electrophoresis proteins in potato tuber sap could be separated into at least six fractions. The protein

Microbiological Diversity Demonstrates the Potential which Collaboratively Metabolize Nitrogen Oxides ( NOx) under Smog Environmental Stress

Science.gov (United States)

Chen, X. Z.; Zhao, X. H.; Chen, X. P.

2018-03-01

Recently, smoggy weather has become a daily in large part of China because of rapidly economic growth and accelerative urbanization. Stressed on the smoggy situation and economic growth, the green and environment-friendly technology is necessary to reduce or eliminate the smog and promote the sustainable development of economy. Previous studies had confirmed that nitrogen oxides ( NOx ) is one of crucial factors which forms smog. Microorganisms have the advantages of quickly growth and reproduction and metabolic diversity which can collaboratively Metabolize various NOx. This study will design a kind of bacteria & algae cultivation system which can metabolize collaboratively nitrogen oxides in air and intervene in the local nitrogen cycle. Furthermore, the nitrogen oxides can be transformed into nitrogen gas or assembled in protein in microorganism cell by regulating the microorganism types and quantities and metabolic pathways in the system. Finally, the smog will be alleviated or eliminated because of reduction of nitrogen oxides emission. This study will produce the green developmental methodology.

[Effects of reduced nitrogen application and soybean intercropping on nitrogen balance of sugarcane field].

Science.gov (United States)

Liu, Yu; Zhang, Ying; Yang, Wen-ting; Li, Zhi-xian; Guan, Ao-mei

2015-03-01

A four-year (2010-2013) field experiment was carried out to explore the effects of three planting patterns (sugarcane, soybean monoculture and sugarcane-soybean 1:2 intercropping) with two nitrogen input levels (300 and 525 kg . hm-2) on soybean nitrogen fixation, sugarcane and soybean nitrogen accumulation, and ammonia volatilization and nitrogen leaching in sugarcane field. The results showed that the soybean nitrogen fixation efficiency (NFE) of sugarcane-soybean inter-cropping was lower than that of soybean monoculture. There was no significant difference in NFE among the treatments with the two nitrogen application rates. The nitrogen application rate and inter-cropping did not remarkably affect nitrogen accumulation of sugarcane and soybean. The ammonia volatilization of the reduced nitrogen input treatment was significantly lower than that of the conventional nitrogen input treatment. Furthermore, there was no significant difference in nitrogen leaching at different nitrogen input levels and among different planting patterns. The sugarcane field nitrogen balance analysis indicated that the nitrogen application rate dominated the nitrogen budget of sugarcane field. During the four-year experiment, all treatments leaved a nitrogen surplus (from 73.10 to 400.03 kg . hm-2) , except a nitrogen deficit of 66.22 kg . hm-2 in 2011 in the treatment of sugarcane monoculture with the reduced nitrogen application. The excessive nitrogen surplus might increase the risk of nitrogen pollution in the field. In conclusion, sugarcane-soybean intercropping with reduced nitrogen application is feasible to practice in consideration of enriching the soil fertility, reducing nitrogen pollution and saving production cost in sugarcane field.

The moderated relationship of appearance valence on appearance self consciousness: development and testing of new measures of appearance schema components.

Directory of Open Access Journals (Sweden)

Timothy P Moss

Full Text Available This paper describes the creation and psychometric properties of two independent measures of aspects of appearance schematicity--appearance salience and valence, assessed by the CARSAL and CARVAL, and their relation to appearance self-consciousness. Five hundred and ninety two participants provided data in a web based task. The results demonstrate the sound psychometric properties of both scales. This was demonstrated by good item total characteristics, good internal reliability of each scale, and the independence of the two scales shown through principal components analysis. Furthermore, the scales show independent and moderated relationships with valid measures of appearance related psychosocial distress. Negatively valenced appearance information was associated with increased appearance self-consciousness. More crucially, the impact of negative valence on appearance self-consciousness was exacerbated by the moderating effect increased salience of appearance.

Genetic variation of dry matter and nitrogen accumulation of double haploid wheat lines

International Nuclear Information System (INIS)

Nankova, M.; Milkova, V.; Ivanov, P.; Penchev, E.

1999-01-01

The study considers the genotype peculiarities in the dynamics of dry matter and nitrogen accumulation in plant parts during the different stages of 10 DH wheat lines characterized as initial breeding material of high quality. These were obtained from 2 crosses - 7-P 2 - 11 x H-81/32-4 and 7-P 2 - 11 x H-81/32-24. Considerable genotype variations were established both between the lines and the parental forms, and in comparison to the standard quality variety Slavyanka-196. Lines 41-191 and 41-344 are of special interest because of their high grain yield and high intensity of biomass accumulation (kg/dka/day) and high intensity of nitrogen uptake (g/dka/day) mainly in the second half of the grain filling period. These fines stand out among the new DH fines with their high protein yields. In line 41-181 the ratio NHI/GHI changes positively with a high degree of certainty in both phases of grain maturity. This line is characterized with the highest value of nitrogen (mg) in vegetation mass per unit mature grain. A positive correlation was established between the NHI/GHI ratio and protein content in grain. Line 41-344 is the most economic one with regard to nitrogen formation per 100 kg grain with the lowest expense for formation of the respective quantity of straw. Refs. 5 (author)

Transcriptomic analyses of nitrogen assimilation processes in a Chinese strain of Aureococcus anophagefferens

Directory of Open Access Journals (Sweden)

Li-Na Chen

2015-09-01

Full Text Available Aureococcus anophagefferens is a harmful alga that dominates plankton communities during brown tides in North America, Africa, and Asia. In order to figure out the processes of nitrogen assimilation in a Chinese strain of A. anophagefferens, RNA-seq technology was used to examine transcriptomic differences in A. anophagefferens that was grown on urea, nitrate, or a mixture of urea and nitrate, and that was under N-replete, limited and recovery conditions. We noted that transcripts upregulated by nitrate and N-limitation included those encoding proteins involved in amino acid, nucleotide and aminosugar transport, degradation of amides and cyanates, and nitrate assimilation pathway. The data suggest that A. anophagefferens possesses an ability to utilize a variety of dissolved organic nitrogen. Moreover, transcripts for synthesis of proteins, glutamate-derived amino acids, spermines and sterols were upregulated by urea. Transcripts encoding key enzymes that are involved in the ornithine–urea cycle (OUC and TCA cycle were differentially regulated by urea and nitrogen concentration, which suggests that the OUC may be linked to the TCA cycle and involved in reallocation of intracellular carbon and nitrogen. These genes regulated by urea may be crucial for the rapid proliferation of A. anophagefferens when urea is provided as the N source. Here, we provide the experimental procedures and analytical processes in detail. The data set is deposited in GEO with the accession number GSE60576.

Effect of diets differing in rumen soluble nitrogen on utilization of ...

African Journals Online (AJOL)

Lapop

2015-12-14

Dec 14, 2015 ... The treatments had various proportions of urea to Optigen® II ... utilize the rumen NH3-N, resulting in a loss of N for synthesis of microbial protein .... the urine are positively related to microbial nitrogen flow, because of the ...

Effect of dietary proteins on the incorporation of amino acids in plasma proteins of ruminants

International Nuclear Information System (INIS)

Mehra, Usha R.; Singh, U.B.; Kumar, S.

1979-01-01

Experiments were conducted on nine male calves (Hariana x Holstein) of about one and a half years of age and fed different amounts of crude protein. 14 C-DL-leucine was injected into the blood of the animals and specific radioactivity of plasma protein measured. There was linear correlation between nitrogen ingested, digested and retained by the animals and the specific radioactivity of total plasma proteins. The experiments suggest the possible use of the incorporation of amino acids into plasma proteins as an index of nutritional status of the animals. (auth.)

Insulin responsiveness of protein metabolism in vivo following bedrest in humans

International Nuclear Information System (INIS)

Shangraw, R.E.; Stuart, C.A.; Prince, M.J.; Peters, E.J.; Wolfe, R.R.

1988-01-01

To test the influence of bedrest on insulin regulation of leucine metabolism, six normal young men were subjected to a five-step hyperinsulinemic euglycemic clamp before and after 7 days of strict bedrest. A primed-constant infusion of [1- 13 C]leucine was used. Before bedrest, the basal rate of appearance (R a ) of intracellular leucine and leucine oxidation were 2.79±0.17 and 0.613±0.070 μmol·kg -1 ·min -1 , respectively. Insulin caused a dose-dependent reduction of the intracellular leucine R a and leucine oxidation to a minimum of 1.64±0.08 and 0.322±0.039 μmol·kg -1 ·min -1 , respectively, in nonbedrested subjects. Insulin also caused a dose-dependent reduction of plasma leucine concentration. After bedrest, subjects exhibited decreased glucose tolerance and increased endogenous insulin secretion, but basal and insulin-suppressed intracellular leucine R a and leucine oxidation rates were not different from control. Magnetic resonance imaging of the back and lower extremities revealed a 1-4% decrease in muscle volume and a 2-5% increase in fat volume secondary to bedrest. Bedrest also resulted in a negative nitrogen balance as compared with the control period. Thus because negative nitrogen balance and skeletal muscle atrophy occurred in six rested subjects in the absence of changes in the two indices of protein breakdown used in this study, it seems likely that muscle protein synthesis was inhibited

Disruption of the nitrogen regulatory gene AcareA in Acremonium chrysogenum leads to reduction of cephalosporin production and repression of nitrogen metabolism.

Science.gov (United States)

Li, Jinyang; Pan, Yuanyuan; Liu, Gang

2013-12-01

AcareA, encoding a homologue of the fungal nitrogen regulatory GATA zinc-finger proteins, was cloned from Acremonium chrysogenum. Gene disruption and genetic complementation revealed that AcareA was required for nitrogen metabolism and cephalosporin production. Disruption of AcareA resulted in growth defect in the medium using nitrate, uric acid and low concentration of ammonium, glutamine or urea as sole nitrogen source. Transcriptional analysis showed that the transcription of niaD/niiA was increased drastically when induced with nitrate in the wild-type and AcareA complemented strains but not in AcareA disruption mutant. Consistent with the reduction of cephalosporin production, the transcription of pcbAB, cefD2, cefEF and cefG encoding the enzymes for cephalosporin production was reduced in AcareA disruption mutant. Band shift assays showed that AcAREA bound to the promoter regions of niaD, niiA and the bidirectional promoter region of pcbAB-pcbC. Sequence analysis showed that all the AcAREA binding sites contain the consensus GATA elements. These results indicated that AcAREA plays an important role both in the regulation of nitrogen metabolism and cephalosporin production in A. chrysogenum. Copyright © 2013 Elsevier Inc. All rights reserved.

Anodic ammonia oxidation to nitrogen gas catalyzed by mixed biofilms in bioelectrochemical systems

International Nuclear Information System (INIS)

Zhan, Guoqiang; Zhang, Lixia; Tao, Yong; Wang, Yujian; Zhu, Xiaoyu; Li, Daping

2014-01-01

In this paper we report ammonia oxidation to nitrogen gas using microbes as biocatalyst on the anode, with polarized electrode (+600 mV vs. Ag/AgCl) as electron acceptor. In batch experiments, the maximal rate of ammonia-N oxidation by the mixed culture was ∼ 60 mg L −1 d −1 , and nitrogen gas was the main products in anode compartment. Cyclic voltammetry for testing the electroactivity of the anodic biofilms revealed that an oxidation peak appeared at +600 mV (vs. Ag/AgCl), whereas the electrode without biofilms didn’t appear oxidation peak, indicating that the bioanode had good electroactivities for ammonia oxidation. Microbial community analysis of 16S rRNA genes based on high throughput sequencing indicated that the combination of the dominant genera of Nitrosomonas, Comamonas and Paracocus could be important for the electron transfer from ammonia oxidation to anode

Influence of Water Activated by Far infrared Porous Ceramics on Nitrogen Absorption in the Pig Feed.

Science.gov (United States)