WorldWideScience

Sample records for protactinium 237

  1. PRECIPITATION OF PROTACTINIUM

    Science.gov (United States)

    Moore, R.L.

    1958-07-15

    An lmprovement in the separation of protactinium from aqueous nitric acid solutions is described. 1t covers the use of lead dioxide and tin dioxide as carrier precipitates for the protactinium. In carrying out the process, divalent lead or divalent tin is addcd to the solution and oxidized, causing formation of a carrier precipitate of lead dioxide or stannic oxide, respectively.

  2. The electroreduction of pentavalent protactinium; Reduction electrolytique du protactinium pentavalent

    Energy Technology Data Exchange (ETDEWEB)

    Musikas, C [Commissariat a l' Energie Atomique, Centre d' Etudes Nucleaires de Fontenay-aux-Roses, 92 (France)

    1966-05-01

    The reduction of pentavalent protactinium to tetravalent protactinium, in sulfuric and hydrochloric media, on a milligram scale was demonstrated by electrolysis in a separate-compartment cell. There was no indication that protactinium may exist at the trivalent state in these solutions. Polarograms in fluoride solutions showed only one reduction wave. The principle of a volumetric method for the titration of protactinium is given. (author) [French] La reduction du protactinium pentavalent en protactinium tetravalent, dans des solutions sulfuriques et chlorhydriques a ete realisee a l'echelle du milligramme, par electrolyse, dans une cellule a compartiments separes. Aucun indice ne permet de penser que le protactinium puisse exister dans ces solutions a l'etat trivalent. De plus les polarogrammes traces en milieu fluorhydrique ne font apparaitre qu'une seule vague de reduction. Le principe d'une methode volumetrique de dosage du protactinium est donne. (auteur)

  3. The electroreduction of pentavalent protactinium

    International Nuclear Information System (INIS)

    Musikas, C.

    1966-05-01

    The reduction of pentavalent protactinium to tetravalent protactinium, in sulfuric and hydrochloric media, on a milligram scale was demonstrated by electrolysis in a separate-compartment cell. There was no indication that protactinium may exist at the trivalent state in these solutions. Polarograms in fluoride solutions showed only one reduction wave. The principle of a volumetric method for the titration of protactinium is given. (author) [fr

  4. The metabolism and gastrointestinal absorption of neptunium and protactinium in adult baboons

    International Nuclear Information System (INIS)

    Ralston, L.G.; Cohen, N.; Bhattacharyya, H.; Larsen, R.P.; Ayres, L.; Oldham, R.D.; Moretti, E.S.

    1985-01-01

    The metabolism of neptunium and protactinium was studied in adult female baboons following intravenous injection and intragastric intubation. Neptunium-239, Np-237, and Pa-233 were prepared as either citrate-buffer, nitrate, or bicarbonate solutions with oxidation states of (V) and (VI). Samples of blood, urine, feces and autopsy tissues were measured by gamma spectrometry. Retention of neptunium and protactinium was determined in vivo using whole and partial body gamma-scintillation spectrometry with [NaI-CsI(T1)] detectors. Fed and fasted baboons were administered solutions of Np(VI) bicarbonate (10/sup -8/ to 10/sup -1/ mg/kg) and Pa(V) citrate-buffer (10/sup -9/ mg/kg) by gavage. The gastrointestinal absorption value for neptunium in two fasted baboons, sacrificed at 1 day post administration, was determined to be 0.92 +- 0.04%. Of the total amount of neptunium absorbed, 52 +- 3% was retained in bone, 6 + 2% was in liver, and 42 +- 0.1% was excreted in urine. The metabolism of neptunium followed oral and iv administrations was found to be similar. This observation was also true for baboons which had received oral and iv doses of protactinium. A method was developed to estimate GI absorption values for both nuclides in baboons, which were not sacrificed, by comparison of activities present in bioassay samples after injection and gavage. Absorption values calculated by this method for neptunium and protactinium in fasted baboons were 1.8 +- 0.8% and 0.65 +- 0.01%, respectively. Values for fed animals were 1 to 2 orders of magnitude less than those for fasted animals. Further experiments are currently underway to evaluate this assay technique

  5. A new isotope of protactinium: 239Pa

    International Nuclear Information System (INIS)

    Yuan, S.; Yang, W.; Mou, W.; Zhang, X.; Li, Z.; Yu, X.; Gu, J.; Guo, Y.; Gan, Z.; Liu, H.; Guo, J.

    1995-01-01

    A new nuclide 239 Pa was produced by 50MeV/u 18 O bombardment of uranium. A radiochemical separation method was employed for preparing sources of 239 Pa. The protactinium isotope 239 Pa has been identified for the first time by the results observed from the decay of the 239 Pa and its daughter 239 U. The half-life of 239 Pa has been determined to be 106±30min. (orig.)

  6. CATION EXCHANGE METHOD FOR THE RECOVERY OF PROTACTINIUM

    Science.gov (United States)

    Studier, M.H.; Sullivan, J.C.

    1959-07-14

    A cation exchange prccess is described for separating protactinium values from thorium values whereby they are initially adsorbed together from an aqueous 0.1 to 2 N hydrochloric acid on a cation exchange resin in a column. Then selectively eluting the thorium by an ammonium sulfate solution and subsequently eluting the protactinium by an oxalate solution.

  7. Recovery of protactinium from molten fluoride nuclear fuel compositions

    Science.gov (United States)

    Baes, C.F. Jr.; Bamberger, C.; Ross, R.G.

    1973-12-25

    A method is provided for separating protactinium from a molten fluonlde salt composition consisting essentially of at least one alkali and alkaline earth metal fluoride and at least one soluble fluoride of uranium or thorium which comprises oxidizing the protactinium in said composition to the + 5 oxidation state and contacting said composition with an oxide selected from the group consisting of an alkali metal oxide, an alkaline earth oxide, thorium oxide, and uranium oxide, and thereafter isolating the resultant insoluble protactinium oxide product from said composition. (Official Gazette)

  8. Synthesis, crystallographic and magnetic properties of protactinium pnictides

    International Nuclear Information System (INIS)

    Hery, Yves.

    1979-03-01

    From a theoretical point of view, protactinium lies in a very important place in the periodic system for it seems to be the first element of the actinide series where the 5f state is occupied. We have studied protactinium pnictides, particularly arsenides and antimonides. PaAs 2 , Pa 3 As 4 , PaSb 2 and Pa 3 Sb 4 were synthetized and their crystallographic properties were determined and discussed. We have measured the magnetic susceptibilities of PaC, PaAs 2 and PaSb 2 . Protactinium exhibits a dual character. In its monocarbide, which is a weakly diamagnet, it behaves as a transition element while in the temperature independent paramagnets PaAs 2 and PaSb 2 , it behaves like a 'f' element. This 'f' element character increases with increasing metal-metal distances. Furthermore the radial expansion of the protactinium 5f orbital seems to be more important than the Uranium one, and consequently the corresponding protactinium 5f electrons are less localized. In addition, some protactinium chalcogenides (βPaS 2 , γPaSe 2 and PaOSe) have been identified [fr

  9. The sorption of polonium, actinium and protactinium onto geological materials

    International Nuclear Information System (INIS)

    Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.

    1999-01-01

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  10. The sorption of polonium, actinium and protactinium onto geological materials

    Energy Technology Data Exchange (ETDEWEB)

    Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.

    1999-07-01

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results.

  11. Separation of Protactinium from Neutron Irradiated Thorium Oxide

    International Nuclear Information System (INIS)

    Dominguez, G.; Gutierrez, L.; Ropero, M.

    1983-01-01

    The chemical separation of thorium and protactinium can be carried out by leaching most of the last one, about 95%, with aqueous HF from neutron irradiated thorium oxide. This leaching reaction la highly favored by the transformation reaction of the ThO 2 material into ThF 4 . For both reactions, leaching and transformation, the reagents concentration, agitation speed and temperature influences were studied and the activation energies were found. (Author) 18 refs

  12. Preconcentration of natural protactinium from thorium concentrate with subsequent determination using Gamma (γ) spectrometry

    International Nuclear Information System (INIS)

    Raja, Naine; Swain, Kallola; Kayasth, S.R.; Pathassarathy, R.; Mathur, P.K.; Anil Kumar, S.

    1999-01-01

    A simple and efficient method has been developed to preconcentrate natural protactinium ( 231 Pa) from large size of thorium concentrate (5.0-100.0g) on Dowex 1 X 8 in acid medium. Gamma spectrometry, a powerful determination technique, has been used for quantitative determination of protactinium

  13. The geochemical behavior of protactinium 231 and its chosen geochemical analogue thorium in the biosphere

    International Nuclear Information System (INIS)

    Gillberg-Wickman, M.

    1983-03-01

    To be able to judge whether protactinium 231 might represent a major contribution to the human radiation risk from high level radioactive waste a literature study of the geochemical behavior of protactinium has been made. The interest in protactinium determinations has, as far, been in the field of marine geochemistry and geochronology. These investigations show that thorium may be used as a chemical analogue. The content of protactinium 231 is determined by the 235 U content and consequently the occurrence of protactinium in nature is directly associated to the geochemistry of uranium. The pronounced hydrolytic tendency of protactinium and its great sorption and coprecipitation capacity ought to prevent or at least appreciably delay its transport from a back-filled nuclear waste vault to the uppermost surface of the earth. It also has a tendency to form colloids or particulates which may be strongly fixed on a rock surface. In adsorption and desorption processes kinetics must play an important role. Our knowledge in this field is quite limited. Under the physico-chemical conditions in the sea, protactinium is rapidly scavenged from the water column by particulates. It accumulates in the sediments. (author)

  14. Recovery of protactinium-231 and thorium-230 from cotter concentrate: pilot plant operatins and process development

    International Nuclear Information System (INIS)

    Hertz, M.R.; Figgins, P.E.; Deal, W.R.

    1983-01-01

    The equipment and methods used to recover and purify 339 g of thorium-230 and 890 mg of protactinium-231 from 22 of the 1251 drums of Cotter Concentrate are described. The process developed was (1) dissolution at 100 0 C in concentrated nitric acid and dilution to 2 to 3 molar acid, (2) filtration to remove undissolved solids (mostly silica filter aid), (3) extraction of uranium with di-sec-butyl-phenyl phophonate (DSBPP) in carbon tetrachloride, (4) extraction of both thorium and protactinium with tri-n-octylphosphine oxide (TOPO) in carbon tetrachloride followed by selective stripping of the thorium with dilute of sulfuric acid, (5) thorium purification using oxalic acid, (6) stripping protactinium from the TOPO with oxalic acid, and (7) protactinium purification through a sequence of steps. The development of the separation procedures, the design of the pilot plant, and the operating procedures are described in detail. Analytical procedures are given in an appendix. 8 figures, 4 tables

  15. Protactinium and the intersection of actinide and transition metal chemistry

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, Richard E.; De Sio, Stephanie; Vallet, Valérie

    2018-02-12

    The role of the 5f and 6d orbitals in the chemistry of the actinide elements has been of considerable interest since their discovery and synthesis. Relativistic effects cause the energetics of the 5f and 6d orbitals to change as the actinide series is traversed left to right imparting a rich and complex chemistry. The 5f and 6d atomic states cross in energy at protactinium (Pa), making it a potential intersection between transition metal and actinide chemistries. Herein, we report the synthesis of a Pa-peroxo cluster, A(6)(Pa4O(O-2)(6)F-12) [A = Rb, Cs, (CH3)(4)N], formed in pursuit of an actinide polyoxometalate. Quantum chemical calculations at the density functional theory level demonstrate equal 5f and 6d orbital participation in the chemistry of Pa and increasing 5f orbital participation for the heavier actinides. Periodic changes in orbital character to the bonding in the early actinides highlights the influence of the 5f orbitals in their reactivity and chemical structure.

  16. Preliminary study of the preparation of uranium 232 by irradiation of protactinium 231

    International Nuclear Information System (INIS)

    Guillot, Ph.

    1965-01-01

    A bibliography about preparation of uranium 232 is done. This even-even isotope of uranium is suitable for radioactive tracer, neutron source through α,n reaction and heat source applications. The irradiation of protactinium 231, the chemical separation and the purification of uranium are studied. (author) [fr

  17. Metabolism and gastrointestinal absorption of neptunium and protactinium in adult baboons

    International Nuclear Information System (INIS)

    Ralston, L.G.; Cohen, N.; Bhattacharyya, M.H.; Larsen, R.P.; Ayres, L.; Oldham, R.D.; Moretti, E.S.

    1985-01-01

    The metabolism of neptunium and protactinium was studied in adult female baboons following intravenous injection and intragastric intubation. Immediately following intravenous injection (10 -1 to 10 -10 mg Np per kg body wt), neptunium cleared rapidly from blood, deposited primarily in the skeleton (54 +- 5%) and liver (3 +- 0.2%), and was excreted predominantly via urine (40 +- 3%). For the first year post injection, neptunium was retained with a biological half-time of approx.100 days in liver and 1.5 +- 0.2 yr in bone. In comparison, injected protactinium (10 -9 mg/kg) was retained in blood in higher concentrations and was initially eliminated in urine to a lesser extent (6 +- 3%). In vivo measurements indicated that protactinium was retained in bone (65 +- 0.3%) with a half-time of 3.5 +- 0.6 yr. Differences in the physicochemical states of the neptunium or protactinium solutions injected did not alter the metabolic behavior of these nuclides. The gastrointestinal absorption value for neptunium in two fasted baboons, sacrificed at 1 day post administration, was determined to be 0.92 +- 0.04%. Of the total amount of neptunium absorbed, 52 +- 3% was retained in bone, 6 +- 2% was in liver, and 42 +- 0.1% was excreted in urine. A method was developed to estimate GI absorption values for both nuclides in baboons which were not sacrificed. Absorption values calculated by this method for neptunium and protactinium in fasted baboons were 1.8 +- 0.8% and 0.65 +- 0.01%, respectively. Values for fed animals were 1 to 2 orders of magnitude less than those for fasted animals. 14 refs., 3 figs., 4 tabs. (DT)

  18. Metabolism and gastrointestinal absorption of neptunium and protactinium in adult baboons

    Energy Technology Data Exchange (ETDEWEB)

    Ralston, L.G.; Cohen, N.; Bhattacharyya, M.H.; Larsen, R.P.; Ayres, L.; Oldham, R.D.; Moretti, E.S.

    1985-01-01

    The metabolism of neptunium and protactinium was studied in adult female baboons following intravenous injection and intragastric intubation. Immediately following intravenous injection (10/sup -1/ to 10/sup -10/ mg Np per kg body wt), neptunium cleared rapidly from blood, deposited primarily in the skeleton (54 +- 5%) and liver (3 +- 0.2%), and was excreted predominantly via urine (40 +- 3%). For the first year post injection, neptunium was retained with a biological half-time of approx.100 days in liver and 1.5 +- 0.2 yr in bone. In comparison, injected protactinium (10/sup -9/ mg/kg) was retained in blood in higher concentrations and was initially eliminated in urine to a lesser extent (6 +- 3%). In vivo measurements indicated that protactinium was retained in bone (65 +- 0.3%) with a half-time of 3.5 +- 0.6 yr. Differences in the physicochemical states of the neptunium or protactinium solutions injected did not alter the metabolic behavior of these nuclides. The gastrointestinal absorption value for neptunium in two fasted baboons, sacrificed at 1 day post administration, was determined to be 0.92 +- 0.04%. Of the total amount of neptunium absorbed, 52 +- 3% was retained in bone, 6 +- 2% was in liver, and 42 +- 0.1% was excreted in urine. A method was developed to estimate GI absorption values for both nuclides in baboons which were not sacrificed. Absorption values calculated by this method for neptunium and protactinium in fasted baboons were 1.8 +- 0.8% and 0.65 +- 0.01%, respectively. Values for fed animals were 1 to 2 orders of magnitude less than those for fasted animals. 14 refs., 3 figs., 4 tabs. (DT)

  19. Preparation of high purity metallic protactinium. Crystal structure and dissolution enthalpy of the metal

    International Nuclear Information System (INIS)

    Bohet, J.

    1977-01-01

    Some 300 mg of Pa have been produced in a high purity metallic state. Protactinium monocarbide has been obtained by the carboreduction of Pa 2 O 5 . Protactinium iodide, produced by the direct reaction of iodine on the carbide, has been sublimated at 420 0 C and thermally dissociated at 1200 0 C on a W wire. In these conditions Pa metal has been deposited with a yield greater than 85% and presents a bct structure stable at room temperature (a=3.921+-0.001A and c=3.235+-0.001A). The fcc phase (Fm3m type) (a=5.018+-0.001A) has been obtained by quenching metallic samples (bct) heated in argon at 1500 0 C. The chemical analysis and the transformation of the fcc into bct phase by controlled heat treatments show the presence of this high temperature phase in the metal. Protactinium mononitride (5.58% N) produced by direct reaction of N on Pa at 1100 0 C presents the same fcc crystal structure but the lattice parameter is higher (a=5.047+-0.001A). The dissolution heat of metallic Pa (bct) has been determined in the aqueous solution HCl 12M - HF 0.05M at 298.15+-0.05 K. The standard formation enthalpies of the ionic species Pa(IV) and Pa(V) are respectively equal to -672+-15 kJ.mol -1 and -821+-15 kJ.mol -1

  20. Preliminary study of the preparation of uranium 232 by irradiation of protactinium 231; Etude preliminaire a la preparation d'uranium 232 par irradiation de protactinium 231

    Energy Technology Data Exchange (ETDEWEB)

    Guillot, Ph. [Commissariat a l' Energie Atomique, Fontenay aux Roses (France). Centre d' Etudes Nucleaires

    1965-07-01

    A bibliography about preparation of uranium 232 is done. This even-even isotope of uranium is suitable for radioactive tracer, neutron source through {alpha},n reaction and heat source applications. The irradiation of protactinium 231, the chemical separation and the purification of uranium are studied. (author) [French] Une etude bibliographique de la preparation d'uranium 232 a ete effectuee. Cet isotope pair-pair de l'uranium peut etre utilise en tant que traceur, source d'energie et source de neutrons, lorsqu'il est melange a un element leger tel le beryllium. Une etude du taux de formation des isotopes produits, lors de l'irradiation du protactinium 231 - une des manieres d'obtenir l'uranium 232 - a ete faite a l'aide d'un programme passe sur ordinateur. Les problemes poses par la separation chimique et la purification de l'uranium ont ete egalement envisages dans ce rapport. (auteur)

  1. Energies and electric dipole transitions for low-lying levels of protactinium IV and uranium V

    Energy Technology Data Exchange (ETDEWEB)

    Uerer, Gueldem; Oezdemir, Leyla [Sakarya Univ. (Turkey). Physics Dept.

    2012-01-15

    We have reported a relativistic multiconfiguration Dirac-Fock (MCDF) study on low-lying level structures of protactinium IV (Z = 91) and uranium V (Z = 92) ions. Excitation energies and electric dipole (E1) transition parameters (wavelengths, oscillator strengths, and transition rates) for these low-lying levels have been given. We have also investigated the influence of the transverse Breit and quantum electrodynamic (QED) contributions besides correlation effects on the level structure. A comparison has been made with a few available data for these ions in the literature. (orig.)

  2. Design study of Thorium-232 and Protactinium-231 based fuel for long life BWR

    Energy Technology Data Exchange (ETDEWEB)

    Trianti, N.; Su' ud, Z.; Riyana, E. S. [Nuclear Physics and Biophysics Research Division Department of Physics - Institut Teknologi Bandung (ITB) Jalan Ganeca 10 Bandung 40132 (Indonesia)

    2012-06-06

    A preliminary design study for the utilization of thorium added with {sup 231}Pa based fuel on BWR type reactor has been performed. In the previous research utilization of fuel based Thorium-232 and Uranium-233 show 10 years operation time with maximum excess-reactivity about 4.075% dk/k. To increase reactor operation time and reduce excess-reactivity below 1% dk/k, Protactinium (Pa-231) is used as Burnable Poison. Protactinium-231 has very interesting neutronic properties, which enable the core to reduce initial excess-reactivity and simultaneously increase production of {sup 233}U to {sup 231}Pa in burn-up process. Optimizations of the content of {sup 231}Pa in the core enables the BWR core to sustain long period of operation time with reasonable burn-up reactivity swing. Based on the optimization of fuel element composition (Th and Pa) in various moderation ratio we can get reactor core with longer operation time, 20 {approx} 30 years operation without fuel shuffling or refuelling, with average power densities maximum of about 35 watt/cc, and maximum excess-reactivity 0.56% dk/k.

  3. Sorption of cesium, radium, protactinium, uranium, neptunium and plutonium on rapakivi granite

    International Nuclear Information System (INIS)

    Huitti, T.; Hakanen, M.

    1996-12-01

    The aim of the study is to determine the sorption of cesium, radium, protactinium, uranium, neptunium and plutonium on rapakivi granite in the brackish groundwater of Haestholmen (site of the Loviisa-1, Loviisa-2 reactors). The studies were carried out under aerobic (Cs, Ra, Pa, U, Np, Pu) and anaerobic (Np, Pa, Pu, Tc) laboratory conditions. The cation exchange capasity was determined for the rock and the diffusion of tritiated water in the rocks of different degree of alteration. The sorption and diffusion properties of the rocks are briefly compared with those of host rocks at other sites under investigation by the Finnish company Posiva Oy for the final disposal of spent fuel. (29 refs.)

  4. 49 CFR 237.131 - Design.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Design. 237.131 Section 237.131 Transportation... TRANSPORTATION BRIDGE SAFETY STANDARDS Repair and Modification of Bridges § 237.131 Design. Each repair or... component of a bridge shall be designed by a railroad bridge engineer. The design shall specify the manner...

  5. 49 CFR 238.237 - Automated monitoring.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Automated monitoring. 238.237 Section 238.237 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Equipment § 238.237 Automated monitoring. (a) Except as further specified in this paragraph, on or after...

  6. 47 CFR 24.237 - Interference protection.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Interference protection. 24.237 Section 24.237... SERVICES Broadband PCS § 24.237 Interference protection. (a) All licensees are required to coordinate their... protection criterion shall be such that the interfering signal will not produce more than 1.0 dB degradation...

  7. Separation of Protactinium from Neutron Irradiated Thorium Oxide; Separacion de Protactinio de Oxido de Torio Irradiado con Neutrones

    Energy Technology Data Exchange (ETDEWEB)

    Dominguez, G; Gutierrez, L; Ropero, M

    1983-07-01

    The chemical separation of thorium and protactinium can be carried out by leaching most of the last one, about 95%, with aqueous HF from neutron irradiated thorium oxide. This leaching reaction la highly favored by the transformation reaction of the ThO{sub 2} material into ThF{sub 4}. For both reactions, leaching and transformation, the reagents concentration, agitation speed and temperature influences were studied and the activation energies were found. (Author) 18 refs.

  8. 48 CFR 237.7100 - Scope.

    Science.gov (United States)

    2010-10-01

    ... DEFENSE SPECIAL CATEGORIES OF CONTRACTING SERVICE CONTRACTING Laundry and Dry Cleaning Services 237.7100 Scope. This subpart— (a) Applies to contracts for laundry and dry cleaning services within the United...

  9. 48 CFR 237.7502 - Policy.

    Science.gov (United States)

    2010-10-01

    ... DEFENSE SPECIAL CATEGORIES OF CONTRACTING SERVICE CONTRACTING Acquisition and Management of Industrial Resources 237.7502 Policy. (a) Comply with DoD Directive 4275.5, Acquisition and Management of Industrial...

  10. Criticality of a 237Np sphere

    International Nuclear Information System (INIS)

    Sanchez, Rene G.; Loaiza, David J.; Kimpland, Robert H.; Hayes, David K.; Cappiello, Charlene C.; Myers, William L.; Jaegers, Peter J.; Clement, Steven D.; Butterfield, Kenneth B.

    2003-01-01

    A critical mass experiment using a 6-kg 237 Np sphere has been performed. The purpose of the experiment is to get a better estimate of the critical mass of 237 Np. To attain criticality, the 237 Np sphere was surrounded with 93 wt% 235 U shells. A 1/M as a function of uranium mass was performed. An MCNP neutron transport code was used to model the experiment. The MCNP code yielded a k eff of 0.99089 ± 0.0003 compared with a k eff 1.0026 for the experiment. Based on these results, it is estimated that the critical mass of 237 Np ranges from kilogram weights in the high fifties to low sixties. (author)

  11. Chemical aspects of 237 Np Moessbauer spectroscopy

    International Nuclear Information System (INIS)

    Karraker, D.G.

    1984-01-01

    The 237 Np Moessbauer effect has been especially useful in studies of neptunium chemistry, by virtue of its excellent resolution and straightforward experimental techniques. Neptunium can have valences from +3 to +7, and a broad range of compounds can be prepared that are analogous to those of other actinide elements. Studies on neptunium compounds, for example, have a ready application to the analogous compounds of uranium and plutonium. The emphasis in this paper will be on the application of the 237 Np Moessbauer effect to problems in neptunium chemistry

  12. Formation cross-sections and chromatographic separation of protactinium isotopes formed in proton-irradiated thorium metal

    Energy Technology Data Exchange (ETDEWEB)

    Radchenko, Valery; Engle, Jonathan W.; Wilson, Justin J.; Maassen, Joel R.; Nortier, Meiring F.; Birnbaum, Eva R.; John, Kevin D.; Fassbender, Michael E. [Los Alamos National Laboratory, NM (United States)

    2016-08-01

    Targeted alpha therapy (TAT) is a treatment method of increasing interest to the clinical oncology community that utilizes α-emitting radionuclides conjugated to biomolecules for the selective killing of tumor cells. Proton irradiation of thorium generates a number of α-emitting radionuclides with therapeutic potential for application via TAT. In particular, the radionuclide {sup 230}Pa is formed via the {sup 232}Th(p, 3n) nuclear reaction and partially decays to {sup 230}U, an α emitter which has recently received attention as a possible therapy nuclide. In this study, we estimate production yields for {sup 230}Pa and other Pa isotopes from proton-irradiated thorium based on cross section measurements. We adopt existing methods for the chromatographic separation of protactinium isotopes from proton irradiated thorium matrices to combine and optimize them for effective fission product decontamination.

  13. 49 CFR 237.9 - Waivers.

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION BRIDGE SAFETY STANDARDS General § 237.9 Waivers. (a) Any person subject to a requirement of this... compliance is in the public interest and is consistent with railroad safety, the Administrator may grant the... Administrator publishes a notice in the Federal Register containing the reasons for granting the waiver. ...

  14. 32 CFR 237a.4 - Procedures.

    Science.gov (United States)

    2010-07-01

    ...); (c) Industrial programs which are in support of Government policy (example—international exhibits..., authorized by part 237 of this subchapter to apprise defense contractors, trade associations and other... governing research, development and production, and the procurement of goods and services, and serve as a...

  15. 7 CFR 205.237 - Livestock feed.

    Science.gov (United States)

    2010-01-01

    ..., Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) ORGANIC FOODS PRODUCTION ACT PROVISIONS NATIONAL ORGANIC PROGRAM Organic Production and Handling Requirements § 205.237 Livestock feed. (a... specific stage of life; (3) Feed plastic pellets for roughage; (4) Feed formulas containing urea or manure...

  16. Criticality of a 237Np sphere

    International Nuclear Information System (INIS)

    Sanchez, Rene; Loaiza, David; Kimpland, Robert; Hayes, David; Cappiello, Charlene; Chadwick, Mark

    2006-01-01

    For the past five years, scientists at Los Alamos National Laboratory have mounted an unprecedented effort to get a better estimate of the critical mass of 237 Np. To accomplish this task, a 6-kg neptunium sphere was recently cast at the Chemical and Metallurgy Research (CMR) facility, which is part of the Los Alamos National Laboratory. The neptunium sphere was clad with tungsten and nickel to reduce the dose rates from the 310 keV gamma rays from the first daughter of neptunium, namely, 233 Pa. 237 Np is a byproduct of power production in nuclear reactors. It is primarily produced by successive neutron captures in 235 U or through the (n,2n) reaction in 238 U. These nuclear reactions lead to the production of 237 U, which decays by beta emission into 237 Np, namely, 235 U(n,γ) 236 U, 236 U(n,γ) 237 U→β→ 237 Np, 238 U (n,2n) 237 U→β→ 237 Np. It is estimated that a typical 1000 MW(e) produces on the order of 12 to 13 kg of neptunium in a year. Some of this neptunium in irradiated fuel elements has been separated and is presently stored in containers in a liquid form. This method of storage is quite adequate because the fission cross section for 237 Np at thermal energies is quite low and any moderation of the neutron population by diluting the configurations with water would increase the critical mass to infinity. However, for long term storage, the neptunium liquid solutions must be converted into oxides and metals because these form are less movable and less likely to leak out of containers. Metals and oxides made out of neptunium have finite critical masses but there is a great uncertainty about these values because of the lack of experimental criticality data. Knowing precisely the critical mass of neptunium not only will help to validate mass storage limits or optimize storage configurations for safe disposition of these materials, but will also save thousands of dollars in transportation and disposition costs. The experimental results presented in

  17. Neutron Data Evaluation of 237Np

    International Nuclear Information System (INIS)

    Maslov, V.M.; Tetereva, N.A.; Kolesov, A.M.; Pronyaev, V.G.; Zolotarev, K.I.; Granier, T.; Hambsch, F.-J.

    2010-11-01

    The diverse measured data base of n+ 237 Np was evaluated using a statistical theory and generalized least squares codes. Consistent description of the total, fission and partial inelastic scattering data in 1-3 MeV energy range provides an important constraint for the absorption cross section, which is quite important for the robust estimate of the capture cross section in the 0.5-500 keV energy range. Important constraints for the measured capture cross section come from the average radiative S0 and S1 strength functions. The evaluated inelastic cross sections of available evaluations are in severe disagreement with measured data on the inelastic scattering of neutrons with excitation of specific groups of levels. A change of the inelastic data shape at E n ∼1.5 MeV might be explained by the sharp increase of the level density of the residual odd-even nuclide 237 Np due to the onset of three-quasi-particle excitations. The influence of exclusive (n, xnf) pre-fission neutrons on prompt fission neutron spectra (PFNS) and (n, xn) spectra is modeled. Contributions of emissive/non-emissive fission and exclusive spectra of (n, xnf) reactions are defined by a consistent description of the 237 Np (n, F), 237 Np (n, 2n) 236s Np reactions and the ratio of the yields of short-lived (1 - ) and long-lived (6 - ) 236 Np states measured at 14 MeV. Excited levels of 236 Np are modeled using predicted Gallher-Moshkowski doublets. This work is performed under the project Agreement B-1604 with the International Science and Technology Center (Moscow). The financing party is EU. Partial support of International Atomic Energy Agency under Research Contract 14809 is acknowledged by JINER. (author)

  18. Np-237 in peat and lichen in Finland

    DEFF Research Database (Denmark)

    Salminen, S.; Paatero, J.; Roos, Per

    2009-01-01

    Activity concentrations of 237Np in peat and lichen samples in Finland were determined and contributions from nuclear weapons testing in 1950–1960s and the Chernobyl accident were estimated. 237Np was determined with ICP-MS using 235Np as a tracer. Activity concentrations of 237Np in peat samples...

  19. 48 CFR 1252.237-70 - Qualifications of contractor employees.

    Science.gov (United States)

    2010-10-01

    ... contractor employees. 1252.237-70 Section 1252.237-70 Federal Acquisition Regulations System DEPARTMENT OF....237-70 Qualifications of contractor employees. As prescribed in (TAR) 48 CFR 1237.110(a), insert the following clause: Qualifications of Contractor Employees (APR 2005) a. Definitions. As used in this clause...

  20. 14 CFR 23.237 - Operation on water.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Operation on water. 23.237 Section 23.237... STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES Flight Ground and Water Handling Characteristics § 23.237 Operation on water. A wave height, demonstrated to be safe for operation, and any...

  1. Analysis list: nhr-237 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available nhr-237 Embryo,Larvae + ce10 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target.../nhr-237.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target/nhr-237.5.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/ce10/target/nhr-237.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/nhr-237.E...mbryo.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/nhr-237.Larvae.tsv http://dbarchive.bioscie...ncedbc.jp/kyushu-u/ce10/colo/Embryo.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/Larvae.gml ...

  2. 48 CFR 252.237-7011 - Preparation history.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Preparation history. 252... Provisions And Clauses 252.237-7011 Preparation history. As prescribed in 237.7003(b), use the following clause: Preparation History (DEC 1991) For each body prepared, or for each casket handled in a group...

  3. 48 CFR 252.237-7007 - Termination for default.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Termination for default... of Provisions And Clauses 252.237-7007 Termination for default. As prescribed in 237.7003(b), use the following clause: Termination for Default (DEC 1991) (a) This clause supplements and is in addition to the...

  4. 48 CFR 1452.237-71 - Utilization of Woody Biomass.

    Science.gov (United States)

    2010-10-01

    ... Biomass. 1452.237-71 Section 1452.237-71 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR... Utilization of Woody Biomass. As prescribed in § 1437.7202, insert the following clause: Utilization of Woody Biomass (MAY 2005) (a) The contractor may remove and utilize woody biomass, if: (1) Project work is...

  5. 43 CFR 23.7 - Approval of exploration plan.

    Science.gov (United States)

    2010-10-01

    ... measures to be taken to prevent or control fire, soil erosion, pollution of surface and ground water... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Approval of exploration plan. 23.7 Section 23.7 Public Lands: Interior Office of the Secretary of the Interior SURFACE EXPLORATION, MINING AND...

  6. 48 CFR 252.237-7005 - Performance and delivery.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Performance and delivery... of Provisions And Clauses 252.237-7005 Performance and delivery. As prescribed in 237.7003(b), use the following clause: Performance and Delivery (DEC 1991) (a) The Contractor shall furnish the...

  7. Sorption and Migration Mechanisms of 237 Np through Sandy Soil

    International Nuclear Information System (INIS)

    Chantaraprachoom, Nanthavan; Tanaka, Tadao

    2003-06-01

    In order to evaluate migration behavior of radioactive nuclides in the disposal of low-level radioactive waste into a shallow land burial, the sorption characteristic and migration behavior of 237 Np through sandy soil was studied. Two experimental methods were performed by using batch and column systems. The distribution coefficients (K d ) obtained from the adsorption and desorption process are rather small about 16 and 21 cm 3 /g respectively. Size distribution of 237 Np species in the influent solution was measured by ultra-filtration technique. Migration mechanism of 237 Np was studied by column experiments. The experimental condition was the influence of volume of eluting solution; 100, 300, 500, 1000 and 2000 ml respectively. The result from five column experiments confirm that the sorption characteristics of 237 Np are mainly controlled by a reversible ion-exchange reaction and the migration of 237 Np in the sandy soil can be estimated by using the K d concept

  8. Thermodynamic and structural properties in complexing media; Comportement chimique du protactinium (V) en presence d'ions sulfate

    Energy Technology Data Exchange (ETDEWEB)

    Di Giandomenico, M.V

    2007-10-15

    Protactinium is experiencing a renewal of interest in the frame of long-term energy production. Modelling the behaviour of this element in the geosphere requires thermodynamic and structural data relevant to environmental conditions. Now deep clayey formation are considered for the disposal of radioactive waste and high values of natural sulphate contents have been determined in pore water in equilibrium with clay surface. Because of its tendency to polymerisation, hydrolysis and sorption on all solid supports, the equilibria constants relative to monomer species were determined at tracer scale (ca. 10 - 12 M) with {sup 233}Pa. The complexation constants of Pa(V) and sulphate ions were calculated starting from a systematic study of the apparent distribution coefficient D in the system TTA/Toluene/H{sub 2}O/Na{sub 2}SO{sub 4}/HClO{sub 4}/NaClO{sub 4} and as a function of ionic strength, temperature, free sulphate, protons and chelatant concentration. First of all, the interaction between free species H{sup +}, SO{sub 4}{sup -}, Na{sup +} leads to the formation of HSO{sub 4}{sup -} and NaSO{sub 4}{sup -}, for which concentrations depend upon the related thermodynamic constants. For this purpose a computer code was developed in order to determine all free species concentration. This iterative code takes into account the influence of temperature and ionic strength (SIT modelling) on thermodynamic constants. The direct measure of Pa(V) in the organic and aqueous phase by g-spectrometry had conducted to estimate the apparent distribution coefficient D as function of free sulphate ions. Complexation constants have been determined after a mathematical treatment of D. The extrapolation of these constants at zero ionic strength have been realized by SIT modelling at different temperatures. Besides, enthalpy and entropy values were calculated. Parallelly, the structural study of Pa(V) was performed using 231 Pa. XANES and EXAFS spectra show unambiguously the absence of the

  9. Biokinetics of 237Np in mussels and shrimp

    International Nuclear Information System (INIS)

    Guary, J.C.; Fowler, S.W.

    1977-01-01

    Neptunium-237 kinetics were studied in marine shrimp and mussels using a thick source alpha counting technique. Bioaccumulation of 237 Np from water was relatively slow in both species, reaching whole body concentration factors of only 15 to 20 after three months. Surface adsorption was implicated in the initial uptake. Both uptake and loss of the radioisotope were not significantly affected by temperature; this may be a reflection of the physical nature of the uptake. By virtue of the large amounts of accumulated 237 Np associated with the exoskeleton of shrimp, molting will play an important role in the biogeochemical cycling of this transuranic in the marine environment. Rapid growth of organisms like mussels acts to reduce the 237 Np concentration in tissues during a period of decontamination

  10. The significance of lead-210, polonium-210 and protactinium-231 in emissions from coal-fired power stations: a comparison with natural environmental sources

    International Nuclear Information System (INIS)

    Corbett, J.O.

    1981-04-01

    Recently published calculations have suggested that a hypothetical individual may receive an effective radiation dose equivalent of 23 mrem/y from coal-fired power station emissions through the ingestion of lead-210, polonium-210 and protactinium-231. It is shown that the model used in those calculations is over-pessimistic by one or two orders of magnitude when applied to the deposition of Pb-210 and Po-210 derived from the decay of radon naturally present in the atmosphere. A more recent assessment of metabolic data for Pa-231 suggests that estimated doses from this nuclide also can be reduced by about a factor of twenty. It is concluded that the maximum effective dose equivalent from power station emissions probably does not exceed 1-2 mrem/y. (author)

  11. 32 CFR 237a.3 - Objective and policy.

    Science.gov (United States)

    2010-07-01

    ...) MISCELLANEOUS PUBLIC AFFAIRS LIAISON WITH INDUSTRY § 237a.3 Objective and policy. (a) It is important that...D. Such understanding can be achieved by (1) wide dissemination of information to the business community, consistent with national security, and (2) cooperation with industry in public relations...

  12. 49 CFR 237.155 - Documents and records.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION BRIDGE SAFETY STANDARDS Documentation, Records, and Audits of Bridge Management Programs § 237.155 Documents and records. Each track owner required to implement a bridge management... protected by a security system that incorporates a user identity and password, or a comparable method, to...

  13. 48 CFR 1852.237-71 - Pension portability.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Pension portability. 1852... 1852.237-71 Pension portability. As prescribed at 1837.110-70(b), insert the following clause: Pension Portability (JAN 1997) (a) In order for pension costs attributable to employees assigned to this contract to...

  14. 48 CFR 352.237-70 - Pro-Children Act.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Pro-Children Act. 352.237...-Children Act. As prescribed in 337.103-70(a), the Contracting Officer shall insert the following clause: Pro-Children Act (January 2006) (a) Public Law 103-227, Title X, Part C, also known as the Pro...

  15. 48 CFR 1552.237-76 - Government-Contractor Relations.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Government-Contractor... 1552.237-76 Government-Contractor Relations. As prescribed in 1537.110(g), insert the following clause: Government-Contractor Relations (JUN 1999) (a) The Government and the Contractor understand and agree that...

  16. 48 CFR 2452.237-75 - Clearance of contractor personnel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Clearance of contractor... Clauses 2452.237-75 Clearance of contractor personnel. As prescribed in 2437.110(e), insert the following clause in solicitations and contracts. Clearance of Contractor Personnel (OCT 1999) (a) General. This...

  17. 48 CFR 852.237-70 - Contractor responsibilities.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contractor....237-70 Contractor responsibilities. As prescribed in 837.110, insert the following clause: Contractor Responsibilities (APR 1984) The contractor shall obtain all necessary licenses and/or permits required to perform...

  18. 48 CFR 2152.237-70 - Continuity of services.

    Science.gov (United States)

    2010-10-01

    ...-out services for up to 10 months after this contract expires and (2) negotiate in good faith a plan... contract. The Contractor also must, except if prohibited by applicable law, disclose necessary personnel... PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 2152.237-70 Continuity of services. As...

  19. 48 CFR 237.7101 - Solicitation provisions and contract clauses.

    Science.gov (United States)

    2010-10-01

    ... contracts for laundry and dry cleaning services to be provided on a count-of-articles basis. (d) Use the clause at 252.237-7015, Loss or Damage (Weight of Articles), in solicitations and contracts for laundry... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Solicitation provisions...

  20. Updated and revised neutron reaction data for 237Np

    Directory of Open Access Journals (Sweden)

    Chen Guochang

    2017-01-01

    Full Text Available Nuclear data with high accuracy for minor actinides play an important role in nuclear technology applications, including reactor design and operation, fuel cycle, estimation of the amount of minor actinides in high burn-up reactors and the minor actinides transmutation. Based on the evaluated experimental data, the updated and revised evaluation of a full set of n+237Np nuclear data from 10−5 eV ∼ 20 MeV are carried out and recommended. Mainly revised quantities are neutron multiplicities from fission reaction, inelastic, fission, (n, 2n and (n, γ reaction cross sections as well as angular distribution and so on. The promising results are obtained when the renewal evaluated data of 237Np will be used to instead of the evaluated data in CENDL-3.1 database.

  1. Sorption of 237Pu by the diatom Asterionella formosa

    International Nuclear Information System (INIS)

    Conway, H.L.; Wahlgren, M.A.; Peterson, N.; Nelson, D.M.

    1976-01-01

    Knowledge of the behavior of the man-made radionuclide plutonium within aquatic environments is of fundamental importance in assessing its potential hazards and ecological impact. The sorption of plutonium by phytoplankton and other algae is the dominant factor in the biological transport of plutonium in the aquatic environment, and it has been suggested that sorption by phytoplankton may be responsible for the seasonal loss of plutonium from the epilimnion of Lake Michigan. A unialgal diatom culture was spiked with 237 Pu tracer solution in an attempt to simulate the behavior of fallout plutonium observed in field studies. The results were encouraging in that the 237 Pu in the filtered lake water medium exhibited strongly anionic properties similar to fallout plutonium in Lake Michigan, with limited sorption on container walls. The purpose of the present study was to extend the investigations of the sorption of plutonium by phytoplankton in a controlled environment using continuous culture techniques

  2. 48 CFR 2452.237-73 - Conduct of Work and Technical Guidance.

    Science.gov (United States)

    2010-10-01

    ... conditions of the contract. (c) The GTR will issue technical guidance in writing or, if issued orally, he/she... Technical Guidance. 2452.237-73 Section 2452.237-73 Federal Acquisition Regulations System DEPARTMENT OF... Provisions and Clauses 2452.237-73 Conduct of Work and Technical Guidance. As prescribed in 2437.110(d...

  3. Characterization of oxalate-based 237NpO2 powder

    International Nuclear Information System (INIS)

    Rankin, D.T.; Burney, G.A.; Smith, P.K.; Sisson, R.D.

    1976-01-01

    238 Pu, a radioisotope heat source, is produced by irradiating reactor targets containing 237 NpO 2 . The neptunium oxide is obtained by precipitating and calcining 237 Np(IV) oxalate. The effects of oxalate precipitation parameters on particle morphology and size distribution of 237 NpO 2 powder were established to provide process controls for fabricating reactor targets

  4. 48 CFR 1352.237-72 - Security processing requirements-national security contracts.

    Science.gov (United States)

    2010-10-01

    ... requirements-national security contracts. 1352.237-72 Section 1352.237-72 Federal Acquisition Regulations... Provisions and Clauses 1352.237-72 Security processing requirements—national security contracts. As prescribed in 48 CFR 1337.110-70(d), use the following clause: Security Processing Requirements—National...

  5. 48 CFR 352.237-71 - Crime Control Act-reporting of child abuse.

    Science.gov (United States)

    2010-10-01

    ...-reporting of child abuse. 352.237-71 Section 352.237-71 Federal Acquisition Regulations System HEALTH AND... Clauses 352.237-71 Crime Control Act—reporting of child abuse. As prescribed in 337.103-70(b), the Contracting Officer shall insert the following clause: Crime Control Act of 1990—Reporting of Child Abuse...

  6. Evaluation of nuclear data of 244Pu and 237Pu

    International Nuclear Information System (INIS)

    Nakagawa, Tsuneo; Konshin, V.A.

    1995-10-01

    The evaluation of nuclear data for 244 Pu and 237 Pu was made in the neutron energy region from 10 -5 eV to 20 MeV. For the both nuclides, the total, elastic and inelastic scattering, fission, capture, (n,2n) and (n,3n) reaction cross sections were evaluated on the basis of theoretical calculation. The resonance parameters were given for 244 Pu. The angular and energy distributions of secondary neutrons were also estimated for the both nuclides. The results were compiled in the ENDF-5 format and will be adopted in JENDL Actinoid File. (author)

  7. Biokinetics of 237Np in two marine benthic invertebrates

    International Nuclear Information System (INIS)

    Guary, J.C.; Fowler, S.W.

    1976-01-01

    The long-lived alpha-emitting actinide 237 Np (T 1/2 = 2.2 x 10 6 y) enters the aquatic environment directly from nuclear testing and reprocessing plant wastes as well as indirectly by in situ generation from 241 Am. Earlier studies on 239 Np in the Columbia river ecosystem demonstrated that neptunium accumulated in aquatic species such as algae, sponges and insect larvae but was not detectable in higher trophic level organisms. Based on these findings and the fact that neptunium is chemically similar to the rare earth elements, it has been suggested that this actinide would not easily become incorporated into aquatic biota

  8. 15 CFR 23.7 - Notice to Department of Commerce organizational units of implementation and procedures.

    Science.gov (United States)

    2010-01-01

    ... organizational units of implementation and procedures. 23.7 Section 23.7 Commerce and Foreign Trade Office of the... Department of Commerce organizational units of implementation and procedures. Following are roles and...) Otherwise determine and control the use of missing children materials and information by the Operating Unit...

  9. Preparation of /sup 237/Np samples by electrodeposition and its determination by alpha spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Mertzig, W; Matsuda, H T; Araujo, B.F. de; Araujo, J.A. de [Instituto de Pesquisas Energeticas e Nucleares, Sao Paulo (Brazil). Centro de Engenharia Quimica

    1980-01-01

    An analytical method followed by alpha spectrometry was developed for the determination of trace amounts of actinides. A technique for quantitative electrodeposition of /sup 237/Np, under optimal conditions, using a carrier, is presented. This method will be applied for the control of trace amounts of /sup 237/Np in the solutions from the reprocessing (Purex process) of irradiated uranium.

  10. Measurements of {sup 237}Np secondary neutron spectra

    Energy Technology Data Exchange (ETDEWEB)

    Kornilov, N.V.

    1997-03-01

    The activities carried out during the first year of the project are summarized. The main problems for Np spectra measurements arise from high intrinsic gamma-ray activity of the sample and admixture of the oxygen and iron nuclei. The inelastically scattered neutrons and the fission neutrons spectra for {sup 237}Np were measured by time-of-flight spectrometer of the IPPE at incident neutron energies {approx_equal}1.5 MeV, and {approx_equal}0.5 MeV. A solid tritium target and a Li-metallic target were used as neutron sources. The neutron scattering on C sample (C(n,n) standard reaction) was measured to normalize the Np data. The experimental data should be simulated by Monte Carlo method to correct the experimental data for oxygen and iron admixture as well as for multiple scattering of the neutrons in the sample. Therefore the response function of the spectrometer, and the neutron energy distribution from the source were investigated in detail. (author)

  11. Pigmented villonodular synovitis: a retrospective multicenter study of 237 cases.

    Directory of Open Access Journals (Sweden)

    Guo-ping Xie

    Full Text Available To review clinical characteristics of pigmented villonodular synovitis (PVNS in China.Electronic medical records (EMR of four Chinese institutes were queried for patients with histologically proven PVNS between January 2005 and February 2014. Their data were collected including gender, age at diagnosis, clinical presentation, affected site, symptom duration, comorbidities, treatment strategy, recurrence and routine laboratories.A total of 237 patients with biopsy-proven PVNS were investigated. The gender ratio was 1.35 for a female predominance (101 males and 136 females. The average age was 36 years (range, 2 to 83 years. The median delay from initial clinical symptom to diagnosis was 18 months. Main affected areas were the knee (73.84% and the hip (18.14%. Forty patients had a clear history of joint trauma. Six patients were concurrently diagnosed with PVNS and avascular necrosis (AVN. Five patients suffered from PVNS following implantation of orthopaedic devices including artificial prosthesis, plate and wire. One hundred and twenty-nine patients underwent arthroscopic synovectomy and 108 open synovectomy. Altogether 48 patients (26 males and 22 females had recurrence of disease. The relapse rate was 24% (knee and 6.98% (hip, 20.93% (open surgery and 19.44% (arthroscopy, respectively. Erythrocyte sedimentation rate (ESR and C-reactive protein (CRP rate were elevated in 45.83% and 38.41% of the patients respectively.To our knowledge, this study is the largest sample size of PVNS patients reported as well as the largest sample of PVNS with concurrent AVN reported to date. Our outcomes suggest that PVNS shows a female predominance, occurs mostly between 20-40 years and favors the knee and hip. Recurrence is frequent, particularly in the knee. Serum ESR and CRP may be elevated in some patients. Additionally, the present study supports the theory of an association between PVNS and orthopedic surgery, which is not limited to joint replacement.

  12. Early retention of 237Pu + 239Pu in mature beagles

    International Nuclear Information System (INIS)

    Lloyd, R.D.; McFarland, S.S.; Atherton, D.R.; Bruenger, F.W.; Taylor, G.N.; Mays, C.W.

    1978-01-01

    Five mature beagles, ranging in age from 57 to 84 months, were injected intravenously with about 0.05-0.1 μCi/kg of 239 Pu(IV) citrate to which tracer amounts of the photon-emitter 237 Pu had been added. Plutonium retention in liver and in non-liver tissue (mainly skeleton) was measured periodically in the living dogs for nearly 4 months after injection by a combination of total-body and partial-body counting. All excreta were collected during the first 21 days and analysed for their Pu content. One dog was sacrificed at 14 days and another at 118 days for distribution studies. About 17% (14-20%) of the injected Pu was excreted in the urine and feces in the first 3 weeks, about the same as that excreted in a corresponding time by beagles injected as young adults (14%), but substantially more than beagles injected as juveniles (11%). In contrasts to juvenile beagles injected at 3 months of age, in which early retention was about 12% in liver and 68% in the skeleton, mature beagles retained about 30% in liver and 50% in the skeleton. Retention in young adult beagles injected at 17 months of age was similar to that of mature dogs. Relative distribution of skeletal plutonium among various bones was similar in the mature animals to that seen previously in young adults, but quite different from that of juveniles. A notable exception was the humerus for which there was no significant difference (P>0.2) in the % of retained skeletal Pu represented by the humerus among the juvenile, young adult and mature dogs. (author)

  13. Neptunium-237 in the marine environment determination in animal and plant species in the English Channel

    International Nuclear Information System (INIS)

    Germian, P.

    1990-01-01

    The uptake of 237 Np was studied in marine plants and animals belonging to several phyla. Samples were collected from the end of January 1986 to March 1986 in a sampling station near the fuel reprocessing plant at La Hague. 237 Np was determined by neutron activation analysis. The transfer modes of 237 Np to the various species as a function of their trophic levels are discussed as well as the distribution among the organs in the species consumed and the radiological impact of human consumption. (author) 27 refs.; 2 figs.; 1 tab

  14. Conversion-electron experiment to characterize the decay of the 237Np shape isomer

    International Nuclear Information System (INIS)

    Henry, E.A.; Becker, J.A.; Bauer, R.W.; Gardner, D.G.; Decman, D.J.; Meyer, R.A.; Roy, N.; Sale, K.E.

    1987-01-01

    Conversion electrons from the decay of low-lying levels of 237 Np have been measured to detect the population of these levels by gamma-ray decay of the 237 Np shape isomer. Analysis of the 208-keV transition L conversion-electron peak gives an upper limit of about 17 μb for the population of the 3/2 - 267-keV level in 237 Np from the shape isomer decay. Model calculations are compared with the measured limit. Improvements are suggested for this experiment. 9 refs., 4 figs

  15. Distribution of global fallout 237Np, Pu isotopes, and 241Am in lake and sea sediments

    International Nuclear Information System (INIS)

    Yamamoto, Masayoshi; Yamauchi, Y.; Chatani, K.; Komura, K.; Ueno, Kaoru; Sakanoue, Masanobu

    1991-01-01

    In order to investigate the sedimentary behaviour of neptunium, 237 Np together with Pu isotopes and 241 Am were measured for the sediment cores collected from Lake Mikata (freshwater), from Lake Kugushi (brakish water) and from Nyu Bay (sea water). In all sediment core samples 237 Np was detected, and its concentrations were far below those of 239,240 Pu and 241 Am measured for the same samples. Inventories of 237 Np in the lakes were estimated to be 0.53, 0.29 and 0.34 MBq/km 2 , respectively. The activity ratios of 237 Np/ 239,240 Pu, except for Lake Mikata, are two or three times lower than the value of 0.3-0.4% observed for surface soils of 0-20 cm depth, suggesting that Np is more soluble compared with Pu. (author) 21 refs.; 6 figs.; 3 tabs

  16. 238U and 237Np nuclear fission by 90-270 MeV electrons

    International Nuclear Information System (INIS)

    Kuznetsov, V.L.; Nedorezov, V.G.; Nikitina, N.V.; Noga, V.I.; Ranyuk, Yu.N.; Telegin, Yu.N.; Smirnov, A.N.; Ehjsmont, V.P.

    1981-01-01

    A technique for measuring cross sections of 238 U and 237 Np nuclei fission caused by 90-270 MeV electrons is described. Measurement results are given. The results obtained are discussed on the basis of the virtual photon method. It is shown that the difference in cross sections of 238 U and 237 Np electrofission is due to the different contribution of the giant resonance [ru

  17. 237 Np analytical method using 239 Np tracers and application to a contaminated nuclear disposal facility

    Energy Technology Data Exchange (ETDEWEB)

    Snow, Mathew S.; Morrison, Samuel S.; Clark, Sue B.; Olson, John E.; Watrous, Matthew G.

    2017-06-01

    Environmental 237Np analyses are challenged by low 237Np concentrations and lack of an available yield tracer; we report a rapid, inexpensive 237Np analytical approach employing the short lived 239Np (t1/2 = 2.3 days) as a chemical yield tracer followed by 237Np quantification using inductively coupled plasma-mass spectrometry. 239Np tracer is obtained via separation from a 243Am stock solution and standardized using gamma spectrometry immediately prior to sample processing. Rapid digestions using a commercial, 900 watt “Walmart” microwave and Parr microwave vessels result in 99.8 ± 0.1% digestion yields, while chromatographic separations enable Np/U separation factors on the order of 106 and total Np yields of 95 ± 4% (2σ). Application of this method to legacy soil samples surrounding a radioactive disposal facility (the Subsurface Disposal Area at Idaho National Laboratory) reveal the presence of low level 237Np contamination within 600 meters of this site, with maximum 237Np concentrations on the order of 103 times greater than nuclear weapons testing fallout levels.

  18. 237Np analytical method using 239Np tracers and application to a contaminated nuclear disposal facility.

    Science.gov (United States)

    Snow, Mathew S; Morrison, Samuel S; Clark, Sue B; Olson, John E; Watrous, Matthew G

    2017-06-01

    Environmental 237 Np analyses are challenged by low 237 Np concentrations and lack of an available yield tracer; we report a rapid, inexpensive 237 Np analytical approach employing the short lived 239 Np (t 1/2  = 2.3 days) as a chemical yield tracer followed by 237 Np quantification using inductively coupled plasma-mass spectrometry. 239 Np tracer is obtained via separation from a 243 Am stock solution and standardized using gamma spectrometry immediately prior to sample processing. Rapid digestions using a commercial, 900 W "Walmart" microwave and Parr microwave vessels result in 99.8 ± 0.1% digestion yields, while chromatographic separations enable Np/U separation factors on the order of 10 6 and total Np yields of 95 ± 4% (2σ). Application of this method to legacy soil samples surrounding a radioactive disposal facility (the Subsurface Disposal Area at Idaho National Laboratory) reveal the presence of low level 237 Np contamination within 600 m of this site, with maximum 237 Np concentrations on the order of 10 3 times greater than nuclear weapons testing fallout levels. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. Integral test for Np237 and Am241 cross sections in JENDL, ENDF and JEF libraries

    International Nuclear Information System (INIS)

    Iwasaki, Tomohiko; Unesaki, Hironobu; Kitada, Takanori

    2002-01-01

    Experiments using Kyoto University critical assembly (KUCA) were performed for measuring the capture and fission reaction rates of 237 Np and 241 Am. A back-to-back fission chamber was employed for the measurement of the fission rate of 237 Np and 241 Am relative to 235 U. The capture rate of 237 Np relative to 197 Au was measured by using activation method. Eleven cores, of which the spectra were changed systematically, were mocked up for the present measurements. Five cores among the eleven were utilized for the fission reaction rate measurement. The experiment was analyzed using the Monte Carlo code MVP, the transport code TWOTRAN and the diffusion code CITATION using the libraries based on JENDL3.2, ENDF/B-VI and JEF2.2. As the results, for 237 Np, JENDL3.2 showed good agreement for both capture and fission. However, for the fission rate of 241 Am, JENDL3.2 underestimates 15-20%. On the other hand, ENDF/B-VI and JEF2.2 show different C/Es for 237 Np and 241 Am. (author)

  20. Neutron induced fission of 237Np – status, challenges and opportunities

    Directory of Open Access Journals (Sweden)

    Ruskov Ivan

    2018-01-01

    Full Text Available Nowadays, there is an increased interest in a complete study of the neutron-induced fission of 237Np. This is due to the need of accurate and reliable nuclear data for nuclear science and technology. 237Np is generated (and accumulated in the nuclear reactor core during reactor operation. As one of the most abundant long-lived isotopes in spent fuel (“waste”, the incineration of 237Np becomes an important issue. One scenario for burning of 237Np and other radio-toxic minor actinides suggests they are to be mixed into the fuel of future fast-neutron reactors, employing the so-called transmutation and partitioning technology. For testing present fission models, which are at the basis of new generation nuclear reactor developments, highly accurate and detailed neutron-induced nuclear reaction data is needed. However, the EXFOR nuclear database for 237Np on neutron-induced capture cross-section, σγ, and fission cross-section, σf, as well as on the characteristics of capture and fission resonance parameters (Γγ, Γf, σoΓf, fragments mass-energy yield distributions, multiplicities of neutrons vn and γ-rays vγ, has not been updated for decades.

  1. Analysis of Np-237 ENDF for the theortical interpretation of critical assembly experiments.

    Energy Technology Data Exchange (ETDEWEB)

    Mihaila, B. (Bogdan); Chadwick, M. B. (Mark B.); MacFarlane, R. E. (Robert E.); Kawano, T. (Toshihiko)

    2004-01-01

    We report on the present status of our effort toward an improved Np-237 evaluated nuclear data file (ENDF). The aim here is to bridge the gap between calculated and observed k-eff values, as measured at the Np-U critical assembly at LANL, TA-18. As such, we perform a critical analysis of the existing body of experimental data and recommended evaluations. We are targeting in principal the fission nu-bar and cross section in Np-237, as well as the inelastic scattering which is particularly important since Np-237 is a threshold fissioner. This analysis will be employed in a future sensitivity study of the calculated k-eff with respect to variations of the afore mentioned nuclear data.

  2. Role of transitional levels in 237Np (γ,f): Perspectives for studying highly deformed systems

    International Nuclear Information System (INIS)

    Arruda-Neto, J. D. T.; Mesa, J.; Garcia, F.; Rodriguez, O.; Geraldo, L. P.; Garcia, C.; Guzman, F.; Rodrigues, T. E.; Shtejer, K.; Semmler, R.

    2006-01-01

    The transition levels at the top of the two 237 Np fission barriers were obtained for the first time by means of the so-called semimicroscopic combined method, which we have developed and implemented. To overcome the difficulties in dealing with large nuclear deformations, we used our developed BARRIER code, which calculates single-particle spectra in a deformed Woods-Saxon potential using a coordinate system based on Cassini ovaloids as nuclear shape parametrization. The results enabled us to describe the experimentally observed near-barrier photofission cross-section structures for 237 Np, as well as a subbarrier shelf, the latter being consistently interpreted in terms of the accumulation of levels at the top of the inner and outer double fission barrier of 237 Np

  3. Role of ser-237 in the substrate specificity of the carbapenem-hydrolyzing class A beta-lactamase Sme-1.

    Science.gov (United States)

    Sougakoff, W; Naas, T; Nordmann, P; Collatz, E; Jarlier, V

    1999-08-17

    The role of the serine residue found at position 237 in the carbapenemase Sme-1 has been investigated by constructing a mutant in which Ser-237 was replaced by an alanine. The S237A mutant showed a catalytic behavior against penicillins and aztreonam very similar to that of Sme-1. By contrast, S237A was characterized by a reduced catalytic efficiency against cephems, such as cephalothin and cephaloridine. In addition, the weak activity of Sme-1 against the cephamycin cefoxitin was hardly detectable with the mutant enzyme. Finally, the Ser-237-->Ala mutation resulted in a marked decrease in catalytic activity against imipenem, showing that Ser-237 contributes to the carbapenemase activity of the class A beta-lactamase Sme-1.

  4. 27 CFR 24.237 - Spirits added to juice or concentrated fruit juice.

    Science.gov (United States)

    2010-04-01

    ... AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Spirits § 24.237 Spirits added to juice or... fruit juice to which spirits have been added will be included in the appropriate tax class of any wine inventory and will be properly identified. Juice or concentrated juice to which wine spirits are added will...

  5. Transmutation of 129I, 237Np, 238Pu, 239Pu, and 241Am using ...

    Indian Academy of Sciences (India)

    Results of transmutation studies of 129I, 237Np, 238Pu, 239Pu and 241Am are presented. Keywords. ... J Adam et al. Table 1. Samples properties for 0.7 and 1 GeV experiments. ..... If we suppose that this conclusion is true also for ratios in ...

  6. A study of the multipolar composition of the electrofission cross section of 237Np

    International Nuclear Information System (INIS)

    Paschoal, S.L.

    1987-01-01

    The electrofission cross section for 237 Np was measured over the energy range from 0,6 to 60,0 MeV. The multipolar composition of this cross section was investigated using the virtual photons formalism with three different techniques of analysis: unfolding and two versions of multiple parameter regression. (A.C.A.S.) [pt

  7. LOFT CIS analysis 4''-WH-237-E inside containment penetration S-17B

    International Nuclear Information System (INIS)

    Nitzel, M.E.

    1978-01-01

    The stress analysis performed on the 4''-WH-237-E piping system inside containment penetration S-17B is presented. Deadweight, thermal expansion, and seismic loads were considered. Results of this analysis show that the subject piping system will meet ASME Code, Section III, Class 2 requirements

  8. 50 CFR 23.7 - What office do I contact for CITES information?

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false What office do I contact for CITES... FAUNA AND FLORA (CITES) Introduction § 23.7 What office do I contact for CITES information? Contact the following offices to receive information about CITES: Type of information Office to contact (a) CITES...

  9. 40 CFR 81.237 - Northeast Georgia Intrastate Air Quality Control Region.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Northeast Georgia Intrastate Air... Air Quality Control Regions § 81.237 Northeast Georgia Intrastate Air Quality Control Region. The Northeast Georgia Intrastate Air Quality Control Region consists of the territorial area encompassed by the...

  10. Multimode approach to Am-241 and Np-237 fission induced by 660-MeV protons

    Czech Academy of Sciences Publication Activity Database

    Karapetyan, G. S.; Balabekyan, A. R.; Demekhina, N. A.; Adam, Jindřich

    2009-01-01

    Roč. 72, č. 6 (2009), s. 911-916 ISSN 1063-7788 R&D Projects: GA MŠk(CZ) LA08002 Institutional research plan: CEZ:AV0Z10480505 Keywords : FISSION * Am-241 * Np-237 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.539, year: 2009

  11. Role of once-daily glycopyrronium bromide (NVA237 in the management of COPD

    Directory of Open Access Journals (Sweden)

    D’Urzo A

    2013-08-01

    Full Text Available Anthony D'UrzoDepartment of Family and Community Medicine, University of Toronto, Toronto, ON, CanadaAbstract: Progressive airflow limitation is a hallmark feature of chronic obstructive pulmonary disease (COPD that ultimately leads to breathlessness, impaired quality of life, and reduced exercise capacity. Pharmacotherapy is used in patients with COPD to prevent and control symptoms, reduce both the frequency and severity of exacerbations, improve health status, and increase exercise tolerance. These strategies are intended to address management issues which promote both current disease control and a reduction in the risk of disease deterioration in the future. At the present time, long-acting β2-agonists (LABAs and long-acting muscarinic antagonists (LAMAs are available for maintenance therapy in patients with persistent symptoms. Tiotropium was the first LAMA to be approved for management of COPD, and many studies have described its beneficial effects on multiple clinically relevant outcomes. Glycopyrronium bromide (NVA237, a new LAMA, has been developed and received regulatory approval for management of COPD in a number of countries around the world. Results from pivotal Phase III trials suggest that NVA237 is safe and well tolerated in patients with moderate to severe COPD, and provides rapid and sustained improvements in lung function. Further, these changes are associated with statistically and clinically meaningful improvements in dyspnea, health-related quality of life, and exercise tolerance. Treatment with NVA237 also results in a significant reduction in risk of exacerbations and the need for rescue medication, and has been comparable with tiotropium with respect to safety and efficacy outcomes. Finally, emerging data indicate that NVA237 is efficacious both as monotherapy and in combination with indacaterol.Keywords: glycopyrronium bromide, NVA237, chronic obstructive pulmonary disease, inhaled long-acting bronchodilators

  12. 29 CFR 779.237 - Enterprise engaged in commerce or in the production of goods for commerce.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Enterprise engaged in commerce or in the production of goods for commerce. 779.237 Section 779.237 Labor Regulations Relating to Labor (Continued) WAGE AND... commerce or in the production of goods for commerce. Under section 3(s) the “enterprise” to be covered must...

  13. Study of the hydrolysis of protactinium (V), at tracer scale, by solvent extraction method with thenoyl-tri-fluoro-acetone (TTA) as chelating agent. Characterization of the partition of TTA in the system TTA / H2O / toluene / Na+ / H+ / ClO4-

    International Nuclear Information System (INIS)

    Jaussaud, Ch.

    2003-01-01

    Hydrolysis of protactinium (V) according to the reactions: PaO(OH) 2+ +H 2 O ↔ PaO(OH) 2 + + H + (K 2 ] PaO(OH) 2+ +2H 2 O ↔ PaO(OH) 5 + H + (K 3 ) has been studied, at tracer scale, by solvent extraction method, with thenoyl-tri-fluoro-acetone (TTA) as chelating agent. A previous study concerning the partition of TTA between two immiscible phases (corresponding to TTA/toluene/Na + /H + /ClO 4 - system) has allowed a complete characterization of this system (partition constants, standard thermodynamic values, TTA hydration degree in toluene). Owing to specific properties of protactinium (V) (sorption onto various materials, formation of colloids), an extremely rigorous protocol has been established, protocol which could be used for other hydrolysable elements. Hydrolysis constants were deduced from a systematic study of partition of Pa(V) as a function TTA and proton concentration, ionic strength and temperature. Extrapolations to zero ionic strength were performed using SIT model and the specific interaction coefficients ε (i,j) as well as the Pitzer parameters β (0) and β (1) were determined. Standard thermodynamic data relative to hydrolysis equilibriums of Pa(V) were also estimated. (author)

  14. Np-237 incineration study in various beams in ADS setup QUINTA

    Directory of Open Access Journals (Sweden)

    Kilim Stanisław

    2018-03-01

    Full Text Available Neptunium-237 samples were irradiated in a spallation neutron field produced in accelerator-driven system (ADS setup QUINTA. Five experiments were carried out on the accelerators at the JINR in Dubna - one in carbon (C6+, three in deuteron, and one in a proton beam. The energy in carbon was 24 GeV, in deuteron 2, 4 and 8 GeV, respectively, and 660 MeV in the proton beam. The incineration study method was based on gamma-ray spectrometry. During the analysis of the spectra several fission products and one actinide were identified. Fission product activities yielded the number of fissions. The actinide (Np-238, a result of neutron capture by Np-237, yielded the number of captures. The main goal of this work was to find out if and how the incineration rate depended on parameters of the accelerator beam.

  15. Transmutation of actinide 237Np with a fusion reactor and a hybrid reactor

    International Nuclear Information System (INIS)

    Feng, K.M.; Huang, J.H.

    1994-01-01

    The use of fusion reactors to transmute fission reactor wastes to stable species is an attractive concept. In this paper, the feasibility of transmutation of the long-lived actinide radioactive waste Np-237 with a fusion reactor and a hybrid reactor has been investigated. A new waste management concept of burning HLW (High Level Waste), utilizing released energy and converting Np-237 into fissile fuel Pu-239 through transmutation has been adopted. The detailed neutronics and depletion calculation of waste inventories was carried out with a modified version of one-dimensional neutron transport and burnup calculation code system BISON1.5 in this study. The transmutation rate of Np with relationship to neutron wall loading, Pu and Np with relationship to neutron wall load, Pu and Np concentration in the transmutation zone have been explored as well as relevant results are also given

  16. The 'overlooked trio' of hypothetical terrorist nuclear weapons - reactor grade plutonium, neptunium-237 and tritium

    International Nuclear Information System (INIS)

    Sholly, S.

    2002-01-01

    Full text: Considerations revolving around physical protection of nuclear material are quite commonly and naturally focused on protecting weapons-grade plutonium (WGPu) and highly enriched uranium (HEU) from theft and diversion. These two materials are the center of attention because of their well-known (and demonstrated) potential for use in first-generation nuclear explosive devices of which potential terrorists are widely thought to be capable. They are also the center of attention because of retirements of these materials from military use as the Russian Federation and the United States reduce the number of nuclear weapons in their arsenals. Three other materials - an 'overlooked trio' - must also be borne in mind within this context: (1) reactor-grade plutonium (RGPu); (2) neptunium-237 (Np-237); and (3) tritium (H-3). Although there are still some authorities who either contend that RGPu cannot be used in a nuclear explosive or that there are (for a terrorist) insurmountable difficulties in doing so, the knowledgeable scientific and technical community, recognizes the potential utility of RGPu for hypothetical terrorist nuclear devices. A much smaller community of experts recognizes the usefulness of Np-237 for nuclear devices, but Np-237 is as straight-forwardly and easily usable as HEU and similarly abundant (but not often in separated form). Tritium can be used (with a modest increase in design sophistication) in a conventional first-generation nuclear device with any of the weapons-usable materials (WGPu, HEU, RGPu or Np-237) to increase the yield and/or increase the reliability of a non-fizzle yield. Given the presence of RGPu and Np-237 in abundant quantities in spent commercial reactor fuel, widely available knowledge of how to separate these materials, and a world-wide total of more than 400 nuclear power plants, spent reactor fuel also requires stringent controls. This is especially true of old spent fuel which has far less radiation dose

  17. Quality control for measurement of soil samples containing 237Np and 241Am as radiotracer

    International Nuclear Information System (INIS)

    Sha Lianmao; Zhang Caihong; Song Hailong; Ren Xiaona; Han Yuhu; Zhang Aiming; Chu Taiwei

    2003-01-01

    This paper reports quality control (QC) for the measurement of soil samples containing 237 Np and 241 Am as radiotracers in migration test of transuranic nuclides. All of the QC were done independently by the QA members of analytical work. It mainly included checking 5%-10% of the total analyzed samples; preparing blank samples, blind replicate sample and spiked samples used as quality control samples to check the quality of analytical work

  18. (237)Np(n,f) Cross Section: New Data and Present Status

    CERN Document Server

    Paradela, C; Carrapico, C; Eleftheriadis, C; Leeb, H; Calvino, F; Herrera-Martinez, A; Savvidis, I; Vlachoudis, V; Haas, B; Vannini, G; Le Naour, C; Gramegna, F; Wiescher, M; Pigni, M T; Audouin, L; Mengoni, A; Quesada, J; Becvar, F; Plag, R; Cennini, P; Mosconi, M; Duran, I; Rauscher, T; Couture, A; Capote, R; Sarchiapone, L; Vlastou, R; Domingo-Pardo, C; Dillmann, I; Pavlopoulos, P; Karamanis, D; Krticka, M; Jericha, E; Ferrari, A; Martinez, T; Trubert, D; Oberhummer, H; Karadimos, D; Plompen, A; Isaev, S; Terlizzi, R; Kaeppeler, F; Cortes, G; Cox, J; Voss, F; Pretel, C; Colonna, N; Berthoumieux, E; Vaz, P; Heil, M; Lopes, I; Lampoudis, C; Walter, S; Calviani, M; Gonzalez-Romero, E; Embid-Segura, M; Stephan, C; Igashira, M; Papachristodoulou, C; Aerts, G; Tavora, L; Berthier, B; Rudolf, G; Andrzejewski, J; Villamarin, D; Ferreira-Marques, R; Tain, J L; O'Brien, S; Gunsing, F; Reifarth, R; Perrot, L; Lindote, A; Neves, F; Poch, A; Kerveno, M; Rubbia, C; Koehler, P; Dahlfors, M; Wisshak, K; Salgado, J; Dridi, W; Ventura, A; Andriamonje, S; Assimakopoulos, P; Santos, C; Ferrant, L; Lozano, M; Patronis, N; Chiaveri, E; Guerrero, C; Kadi, Y; Vicente, M C; Praena, J; Baumann, P; Oshima, M; Rullhusen, P; Furman, W; David, S; Marrone, S; Tassan-Got, L; Cano-Ott, D; Pavlix, A; Alvarez-Velarde, F; Massimi, C; Mastinu, P; Pancin, J; Papadopoulos, C; Tagliente, G; Haight, R; Chepel, V; Kossionides, E; Badurek, G; Marganiec, J; Lukic, S; Tarrio, D; Alvarez, H

    2011-01-01

    In this document, we present the final result obtained at the n_TOF experiment; for the neutron-induced fission cross section of the (237)Np, from the fission threshold up to 1 GeV. The method applied to get tins result is briefly discussed. n_TOF data are compared to the last experimental measurements using other TOF facilities or the surrogate method, reported experiments performed with monoenergetic sources and the FISCAL systematic, including a discussion about the existing discrepancies.

  19. 'n Nota oor die vertaling van Jeremia 2:37 ("Met jou hande op jou hoof"

    Directory of Open Access Journals (Sweden)

    H.F. Stander

    1998-08-01

    Full Text Available A note on the translation of Jeremiah 2:37 ("With your hands on your head" In Jeremiah 2:37 God says to Israel: "You will leave that place (= Egypt with your hands upon your head". In this article various Bible translations and commentaries are scrutinized to determine how modem exegetes interpret this phrase. Thereafter the author discusses Egyptian depictions of mourners in funeral processions with their hands on their heads. He shows how an exploration of Egyptian Art can contribute to a better understanding of Jeremiah 2:37. This study also shows that the two dynamic Afrikaans translations of the Bible ("Die Lewende Bybel" and "Die Nuwe Afrikaanse Vertaling" are wide off the mark in their interpretation of the phrase "with your hands on your head". The author also argues that exegetes should not only rely on written texts when they study the ancient world in which the Scriptures originated, but that they should also explore works of art.

  20. Distribution of global fallout sup 237 Np, Pu isotopes, and sup 241 Am in lake and sea sediments

    Energy Technology Data Exchange (ETDEWEB)

    Yamamoto, Masayoshi; Yamauchi, Y; Chatani, K; Komura, K; Ueno, Kaoru; Sakanoue, Masanobu [Kanazawa Univ., Ishikawa (Japan). Low Level Radioactivity Lab.; Igarashi, Syuiti [Fukui Prefectural Inst. of Public Health (Japan)

    1991-01-01

    In order to investigate the sedimentary behaviour of neptunium, {sup 237}Np together with Pu isotopes and {sup 241}Am were measured for the sediment cores collected from Lake Mikata (freshwater), from Lake Kugushi (brakish water) and from Nyu Bay (sea water). In all sediment core samples {sup 237}Np was detected, and its concentrations were far below those of {sup 239,240}Pu and {sup 241}Am measured for the same samples. Inventories of {sup 237}Np in the lakes were estimated to be 0.53, 0.29 and 0.34 MBq/km{sup 2}, respectively. The activity ratios of {sup 237}Np/{sup 239,240}Pu, except for Lake Mikata, are two or three times lower than the value of 0.3-0.4% observed for surface soils of 0-20 cm depth, suggesting that Np is more soluble compared with Pu. (author) 21 refs.; 6 figs.; 3 tabs.

  1. New radiochemical methods for determination of 237Np a 241Pu using extraction chromatography (Presentation)

    International Nuclear Information System (INIS)

    Strisovska, J.

    2013-01-01

    Thesis was focused on the development of a new methodology for the separation of anthropogenic transuranium radionuclides 237 Np a 241 Pu from different kinds of matrices. The analytical methods used in this study were based on extraction chromatography and were optimized according to the sample type. The proposed radiochemical procedure is a combination of two algorithms, which represent the separation of radionuclides by using extraction chromatographic sorbents TEVA resin and TRU resin supplied by Eichrom Technologies LLC. 239 Np a 237 Np were selectively captured on sorbent TEVA resin in oxidation state 4+. TRU resin was used for purification of plutonium fraction from interfering americium radionuclide. 242 Pu and 239 Np radionuclides as tracers have been used to monitor the radiochemical yields of separation. Before every radiochemical separation tracer radionuclide 239 Np was obtained by separation from the parent radionuclide 2 43 Am, which is in radioactive equilibrium to 239 Np. The average yield of chemical separation was 69,3% for 239 Np at 277 keV energy line and 65,9% at 228 keV energy line. The NPL AH-B08069 (2008) samples which consist of the mixture of alpha-radionuclides were used for the modification and optimization of separation method used for separation of Np and Pu in model samples. This method provided high radiochemical yields of 239,240 Pu (95,0 ± 3,5)% and 237 Np (87,9 ± 3,0)%.. Reliability of the method was verified by applying our modified separation procedures on reference materials IAEA-375 and IAEA-414 supplied by International Atomic Energy Agency. A good agreement between the results is obtained by this procedure and the certified values were found. Samples of contaminated soils from the area of Nuclear power plant A-1 Jaslovske Bohunice which is stored temporarily before disposal were analyzed using developed separation procedure. Specific activity of investigated radionuclides was determined in these samples. (author)

  2. Transuranium element chalcogenides. Crystallochemistry and Moessbauer spectrometry of neptunium 237 chalcogenides

    International Nuclear Information System (INIS)

    Thevenin, T.; Pages, M.; Damien, D.

    1981-09-01

    To study actinide compounds , neptunium 237 has been studied by Moessbauer resonance. The different oxidation degrees of neptunium (7, 6, 5, 4 and 3) have a very important effect on isomeric displacements. In the study of chalcogenides, the isomeric displacement value of NpS 3 confirms the valency 4+ of neptunium in this compound. Results obtained with Np 3 S 5 show two valency state +3 and +4 in this compound. There is a good agreement with the two crystalline sites determined by crystallography [fr

  3. Rapid separation method for {sup 237}Np and Pu isotopes in large soil samples

    Energy Technology Data Exchange (ETDEWEB)

    Maxwell, Sherrod L., E-mail: sherrod.maxwell@srs.go [Savannah River Nuclear Solutions, LLC, Building 735-B, Aiken, SC 29808 (United States); Culligan, Brian K.; Noyes, Gary W. [Savannah River Nuclear Solutions, LLC, Building 735-B, Aiken, SC 29808 (United States)

    2011-07-15

    A new rapid method for the determination of {sup 237}Np and Pu isotopes in soil and sediment samples has been developed at the Savannah River Site Environmental Lab (Aiken, SC, USA) that can be used for large soil samples. The new soil method utilizes an acid leaching method, iron/titanium hydroxide precipitation, a lanthanum fluoride soil matrix removal step, and a rapid column separation process with TEVA Resin. The large soil matrix is removed easily and rapidly using these two simple precipitations with high chemical recoveries and effective removal of interferences. Vacuum box technology and rapid flow rates are used to reduce analytical time.

  4. α-decay chain and associated cluster emission from neutron deficient 237Cf nucleus

    International Nuclear Information System (INIS)

    Jain, Deepika; Sharma, Manoj K.

    2015-01-01

    We have studied the α-decay chain of 237 Cf nucleus, which has been observed in the 3n evaporation channel when the semi-magic projectile 36 S strikes on 204 Pbv nucleus. The calculations are carried out by using preformed cluster model (PCM), with choices of spherical and quadruple deformation with in cold optimum orientation approach. The calculated half-lives of α-decay chain find relatively in nice agreement with experimental data for the deformed fragmentation approach. Along with α emission, the possibility of heavier clusters is also worked out and corresponding half-lives are predicted. (author)

  5. Evaluation of nuclear data of {sup 244}Pu and {sup 237}Pu

    Energy Technology Data Exchange (ETDEWEB)

    Nakagawa, Tsuneo; Konshin, V.A. [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1995-10-01

    The evaluation of nuclear data for {sup 244}Pu and {sup 237}Pu was made in the neutron energy region from 10{sup -5} eV to 20 MeV. For the both nuclides, the total, elastic and inelastic scattering, fission, capture, (n,2n) and (n,3n) reaction cross sections were evaluated on the basis of theoretical calculation. The resonance parameters were given for {sup 244}Pu. The angular and energy distributions of secondary neutrons were also estimated for the both nuclides. The results were compiled in the ENDF-5 format and will be adopted in JENDL Actinoid File. (author).

  6. Evaluation of methods for retention of radioiodine during processing of irradiated 237Np

    International Nuclear Information System (INIS)

    Thompson, G.H.; Kelley, J.A.

    1975-06-01

    Methods of removing radioiodine from 237 Np-- 238 Pu dissolver solution and process off-gas were investigated. This program is part of a continuing effort to reduce releases of radionuclides from plant operations. Experimental data show: Greater than 99.9 percent of the radioiodine in dissolver solution can be removed by precipitation, in situ, of manganese dioxide. Silver zeolite will sorb greater than 99.9 percent of radioiodine in process off-gas. Other solid sorbents and nitric acid-mercuric nitrate scrubber solutions do not remove appreciable amounts of radioiodine from process off-gas, because radioiodine is present principally as relatively unreactive organic iodine compounds. (U.S.)

  7. Numerical simulation of CALIBAN reactivity perturbation experiments using neptunium-237 samples

    International Nuclear Information System (INIS)

    Humbert, Philippe; Mechitoua, Boukhmes

    2003-01-01

    In order to contribute to the validation of nuclear data used in critical mass computation, reactivity perturbation experiments using 237 Np samples have been performed at CEA-Valduc using the fast pulsed reactor CALIBAN operated in continuous mode. In this paper we report these experiments together with the numerical calculations. The calculations were carried out using PANDA, a S N code developed at CEA-Bruyeres-le-Chatel for classic criticality and stochastic neutronics applications and with MCNP4C which is a commonly used Monte Carlo code. A good agreement was found between experimental and deterministic results. (author)

  8. Helicobacter pylori and primary gastric lymphoma. A histopathologic and immunohistochemical analysis of 237 patients.

    Science.gov (United States)

    Nakamura, S; Yao, T; Aoyagi, K; Iida, M; Fujishima, M; Tsuneyoshi, M

    1997-01-01

    Few previous articles have analyzed the relation between infection with Helicobacter pylori (H. pylori) and primary gastric lymphoma in a large number of patients. Resected and biopsied specimens from 237 patients with primary gastric lymphoma were investigated for H. pylori using hematoxylin and eosin stain, modified Giemsa stain, and immunohistochemistry. These specimens were compared with specimens from 29 patients with chronic active gastritis, 33 with peptic ulcers, and 41 with gastric carcinoma. H. pylori was detected in 145 of 237 patients (61%) with gastric lymphoma. The frequency of H. pylori positivity was higher in patients with lymphoma restricted to the mucosa and submucosa (76%) than in those with lymphoma invading beyond the submucosa (48%) (P gastritis (100%) (P gastritis and peptic ulcer. The H. pylori grading score for patients with lymphoma (0.9 +/- 1.0) was lower than for those with chronic active gastritis (1.9 +/- 0.8) (P < 0.001), peptic ulcers (2.2 +/- 1.0) (P < 0.001), or gastric carcinoma (1.2 +/- 1.1) (P < 0.05). These results suggest that H. pylori is more likely to be associated with early states of primary gastric lymphoma than with advanced states. Thus, H. pylori may disappear during the progression of primary gastric lymphoma.

  9. Field study of the migration of 237Np, 238Pu and 241Am in a weak loess aquifer

    International Nuclear Information System (INIS)

    Liu, C.L.; Wang, Z.M.; Li, S.S.; Yang, Y.E.; Li, B.; Jiang, H.; Jiang, L.; Wang, L.; Li, D.

    2004-01-01

    The migration of 237 Np, 238 Pu and 241 Am in a weak loess aquifer was investigated in-situ in an Underground Research Facility. Quartz containing 237 Np, 238 Pu, 241 Am and 3 H was introduced into the aquifer with a stainless steel tube. The local water flow in the aquifer was monitored using a 3-dimensional sampling system. The contaminated area of the aquifer was obtained wholly with the help of a pre-installed stainless steel frame and cut into small pieces (samples) 3-dimensionally and analyzed. 3 H in the water samples was determined with a liquid scintillation analyzer (Tri-Camb 2250). Radioactivity of 237 Np and 241 Am in the soil samples were determined with a low energy photon detector (HPGe), 238 Pu was analyzed with a low background αandβ detector after chemical separation. The result of the 3-year experiment indicated that 237 Np, 238 Pu and 241 Am were strongly absorbed by the loess aquifer. The retardation factor of 237 Np in the loess aquifer was 1.54 x 10 4 . (author)

  10. A Single Recessive Mutated Gene (Sd237-1) Controlling Semi-Dwarf Plant Stature of Rice

    International Nuclear Information System (INIS)

    Sobrizal

    2009-01-01

    Dwarfism is a valuable trait in crop breeding, because it increases lodging resistance and decreases damages due to wind and rain. During the course of this study, a semi-dwarf mutant was successfully induced through 200 Gy gamma ray irradiated KI 237 seeds. KI 237 is a pure line with high yield potency, developed through an Indica-Japonica cross of IR36 / Koshihikari. The selected semi-dwarf plant reached 60 - 62 % of plant height of original plant KI 237 at the mature stage. The length of inter nodes, panicle, and seed were also compared between these two plants. The retardation of the 1 st (uppermost) inter nodes was 24 %, moreover, the retardation of panicle and seed length were only 10 % and 2 %, respectively. The elongation pattern of the inter nodes in this mutant was almost the same as sd1 (Dee-geo-woo-gen), the original parent of the first release modern rice variety, but their performances were different. Based on the segregation analysis in M 2 and M 3 generation it was concluded that this mutant was controlled by a single recessive mutated gene. This gene was designated as sd 237-1 . This mutant should be useful as a genetic resource for the improvement of KI 237 line through back-cross breeding as well as be developed further in breeding program directly to be a new high yielding mutant variety. (author)

  11. Phthalocyaninato complexes of thorium, protactinium and uranium

    International Nuclear Information System (INIS)

    Beck, O.F.

    1985-01-01

    For the preparation of Bis(phthalocyaninato)-actinoid(IV) complexes, AnPc 2 , a new optimizing synthesis procedure was developed, with which it was possible to prepare spectrally pure, that is, H 2 Pc-free, ThPc 2 , UPc 2 and the isostructurally similar 231 PaPc 2 .PaPc 2 . This was verified with the help of electron spectra, which were compared to preparations which were synthesized in another manner. The corresponding perfluorinated compounds were also produced for thorium and uranium by use of tetrafluorophthalic acid nitrile instead of phthalic acid nitrile as initial product. Electron and infrared spectra show the typical bands of the non-substituted complexes. By the attempt to produce a mono(phthalocyaninato)-thorium complex with the use of ThI 4 as initial material a pyridine-extracted pure ThPcI 2 (py) 2 was obtained with a typical mono(phthalocyaninato) complex electron spectrum, an extremely moisture sensitive compound which in water or acids decomposes and produces H 2 Pc. (orig./RB) [de

  12. Use of the electrodeposition technique in the preparation of samples of 237Np and its determination by alpha spectrometry

    International Nuclear Information System (INIS)

    Mertzig, W.; Matsuda, H.T.; Araujo, B.F. de; Araujo, J.A. de.

    1981-05-01

    The electroplating technique to prepare 237 Np source and its determination by alpha spectrometry is presented. The samples were prepared using a lucite-eletrolitic cell manufactured at IPEN, specially to trace amounts of actinides. A polished brass disk coated with Ni film has been used as cathodo and a fixed Pt wire as anode. The electroplated samples were alpha counted using a surface barrier detector. The optimum conditions to obtain the quantitative deposition of 237 Np have been achieved by studying the effects of some parameters as current density, pH and concentration of eletrolitic solution and time of eletrodeposition, using a carrier technique. After preliminary purification, the method is applied to control trace amounts of 237 Np in the Purex process solutions. (Author) [pt

  13. Savannah River Plant 200 Area technical manual. Part SP. Processing of Np/sup 237/ and Pu/sup 238/

    Energy Technology Data Exchange (ETDEWEB)

    Hill, A.J. (comp.)

    1963-01-03

    This manual covers the technology involved in the 200 Area process for the recovery of Np/sup 237/ from certain aqueous waste streams in the separations plants, for the recovery of NP/sup 237/ and Pu/sup 238/ from irradiated NpO/sub 2/-Al slugs and for the fabrication of NpO/sub 2/-Al slugs. The manual contains sections on the fundamental chemistry, the primary recovery of Np by ion exchange, the decontamination of Np by ion exchange, the processing of NpO/sub 2/-Al targets, the separation and purification of Np/sup 237/ and Pu/sup 238/, the finishing of Np, the preparation of NpO/sub 2/, the disposal of spent resin, and the safety aspects of the handling of hydrazine. The section on the fabrication of NpO/sub 2/-Al slugs will be added later. 76 refs., 22 figs.

  14. 239Np application as tracer of 237Np in liquid effluents and nuclear wastes

    International Nuclear Information System (INIS)

    Diodati, Jorge M; Sartori, F.M.

    2003-01-01

    In this paper a technique to separate and measure 237 Np using 239 Np as a tracer, is presented. After the radiochemical separation, a liquid scintillation measurement with pulse decay discrimination and a γ measurement on the same vial is performed. The method also allows an electrodeposition for an α and γ measurement. The chemical recoveries obtained by LSC and γ spectrometry in vial are similar to those obtained by α and γ spectrometry on electroplated disc. The MDA is 0.08 Bq/l by α spectrometry and 0.22 Bq/l by LSC, with 2 σconfidence interval, and 93.7 % measurement efficiency and 98.0% chemical recovery. (author)

  15. Measurement and analysis of reactivity worth of 237Np sample in cores of TCA and FCA

    International Nuclear Information System (INIS)

    Sakurai, Takeshi; Mori, Takamasa; Okajima, Shigeaki; Tani, Kazuhiro; Suzaki, Takenori; Saito, Masaki

    2009-01-01

    The reactivity worth of 22.87 grams of 237 Np oxide sample was measured and analyzed in seven uranium cores in the Tank-Type Critical Assembly (TCA) and two uranium cores in the Fast Critical Assembly (FCA) at the Japan Atomic Energy Agency. The TCA cores provided a systematic variation in the neutron spectrum between the thermal and resonance energy regions. The FCA cores, XXI and XXV, provided a hard neutron spectrum of the fast reactor and a soft one of the resonance energy region, respectively. Analyses were carried out using the JENDL-3.3 nuclear data library with a Monte Carlo method for the TCA cores and a deterministic method for the FCA cores. The ratios of calculated to experimental (C/E) reactivity worth were between 0.97 and 0.91, and showed no apparent dependence on the neutron spectrum. (author)

  16. Identification of Nilsson orbitals in the superdeformed minimum of {sup 237}Pu

    Energy Technology Data Exchange (ETDEWEB)

    Morgan, Thomas James

    2008-03-31

    In this thesis, a spectroscopy experiment in the second minimum of the double humped fission barrier of {sup 237}Pu is presented, in which, for the first time, single - particle states for a neutron - rich shape isomer with odd neutron number were identified and characterised by their Nilsson quantum numbers. While rotational ({sup 236f}U and {sup 240f}Pu) and vibrational excitations ({sup 240f}Pu) had already been identified earlier in the even-even neighbouring nuclei, now the fission isomers in {sup 237}Pu (t{sub 1/2}=115 ns/1.12 {mu}s) were investigated in a {gamma}-spectroscopy experiment at the Cologne Tandem accelerator. Using the {sup 235}U({alpha},2n) reaction with a pulsed R beam, states in the second minimum were populated. Following the prompt decay of excited states into the ground states of the two shape isomers, the nucleus decays with its halflife, the resulting fission fragments were detected in a specially built 4{pi} parallel plate detector. The extremely rare isomeric {gamma} decays were measured in coincidence with the fission fragments using the highly efficient MINIBALL spectrometer. The background-subtracted {gamma}-ray spectrum was disentangled into contributions from the two shape isomers and 9 excited rotational bands were identified built on the ground states of the two isomers. The ground state spins of the two shape isomers were determined to be I=5/2 (115 ns isomer) and I=9/2 (1120 ns isomer). From the 149 identified {gamma} transitions, independent level schemes were constructed for the two fission isomers in {sup 237}Pu. The consistency of these level schemes was supported by the connecting {gamma} transitions between rotational bands. Furthermore, both level schemes could be combined to a common level scheme, in which the ground state of the long-lived 9/2 isomer was placed 54.0(3) keV above the ground state of the short-lived 5/2 isomer. The resulting level scheme was compared to Hartree-Fock-Bogolyubov single

  17. Identification of Nilsson orbitals in the superdeformed minimum of 237Pu

    International Nuclear Information System (INIS)

    Morgan, Thomas James

    2008-01-01

    In this thesis, a spectroscopy experiment in the second minimum of the double humped fission barrier of 237 Pu is presented, in which, for the first time, single - particle states for a neutron - rich shape isomer with odd neutron number were identified and characterised by their Nilsson quantum numbers. While rotational ( 236f U and 240f Pu) and vibrational excitations ( 240f Pu) had already been identified earlier in the even-even neighbouring nuclei, now the fission isomers in 237 Pu (t 1/2 =115 ns/1.12 μs) were investigated in a γ-spectroscopy experiment at the Cologne Tandem accelerator. Using the 235 U(α,2n) reaction with a pulsed R beam, states in the second minimum were populated. Following the prompt decay of excited states into the ground states of the two shape isomers, the nucleus decays with its halflife, the resulting fission fragments were detected in a specially built 4π parallel plate detector. The extremely rare isomeric γ decays were measured in coincidence with the fission fragments using the highly efficient MINIBALL spectrometer. The background-subtracted γ-ray spectrum was disentangled into contributions from the two shape isomers and 9 excited rotational bands were identified built on the ground states of the two isomers. The ground state spins of the two shape isomers were determined to be I=5/2 (115 ns isomer) and I=9/2 (1120 ns isomer). From the 149 identified γ transitions, independent level schemes were constructed for the two fission isomers in 237 Pu. The consistency of these level schemes was supported by the connecting γ transitions between rotational bands. Furthermore, both level schemes could be combined to a common level scheme, in which the ground state of the long-lived 9/2 isomer was placed 54.0(3) keV above the ground state of the short-lived 5/2 isomer. The resulting level scheme was compared to Hartree-Fock-Bogolyubov single-particle calculations, Nilsson model and Woods-Saxon potential calculations. This

  18. Measurements of fast neutron-induced fission data of Np-237

    Energy Technology Data Exchange (ETDEWEB)

    Win, Than; Saito, Keiichiro; Baba, Mamoru; Iwasaki, Tomohiko; Ibaraki, Masanobu; Miura, Takako; Sanami, Toshiya; Nauchi, Yasushi; Hirakawa, Naohiro [Tohoku Univ., Sendai (Japan). Faculty of Engineering

    1998-03-01

    We have performed the following measurements for {sup 237}Np using the 4.5 MV Dynamitron accelerator of Tohoku University as the pulsed neutron source: (1) Prompt fission neutron spectrum for 0.62 MeV incident neutrons, and (2) Neutron-Induced fission cross-section between 10 and 100 keV. The prompt fission neutron spectrum was measured using TOF method with a heavily shielded NE213 scintillation detector. The Maxwellian temperature T{sub m} derived is 1.28 MeV, which is lower than that of 1.38 MeV in JENDL-3.2. The fission cross sections were measured between 10 - 100 keV. The results are between JENDL-3.2 and ENDF/B-VI. (author)

  19. Study of the excited levels of 233Pa by the 237Np alpha decay

    International Nuclear Information System (INIS)

    Gonzalez, J.; Gaeta, R.; Vano, E.; Los Arcos, J. M.

    1978-01-01

    The excited levels in 233 P a following the 237 N p alpha decay have been studied, by performing different experiences to complete available data and supply new information. Thus, two direct alpha spectrum measurement, one alpha-gamma bidimensional coincidence experiment, three gamma-gamma and gamma-X ray coincidences and some other measurements of the gamma spectrum, direct and coincident with alpha-particles have been made. These last experiences have allowed to obviate usual radiochemical separation methods, the 233 P a radioactive descendent interferences being eliminated by means of the coincidence technic. As a result, a primary decay scheme has been elaborated, including 15 new gamma transitions and two new levels, not observed in the most recent works. (Author) 60 refs

  20. Improvement of evaluated neutron nuclear data for {sup 237}Np and {sup 241}Am

    Energy Technology Data Exchange (ETDEWEB)

    Nakagawa, Tsuneo; Iwamoto, Osamu; Hasegawa, Akira [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2002-01-01

    The nuclear data of {sup 237}Np and {sup 241}Am that are particularly important among the minor actinides were investigated by comparing JENDL-3.2 with the recent evaluated data and available experimental data. As a result of the study, several defects of JENDL-3.2 data were revealed. They were improved on the basis of experimental data or recent evaluated data. For the both nuclides, main quantities revised in the present work were the resonance parameters, cross sections, angular and energy distributions of secondary neutrons, number of neutrons per fission. The data were given in the neutron energy range from 10{sup -5} eV to 20 MeV, and compiled in the ENDF-6 format. (author)

  1. A comparative study of the carcinogenetic effects of 241Am, 239Pu and 237Np

    International Nuclear Information System (INIS)

    Wang Yumin; Wei Zhikang; Chen Xueyi; Yao Yongheng; Liu Peibin; Xu Lin; Lun Mingyao

    1984-01-01

    In this experiment, 420 wistar rats were used to study the comparative carcinogenetic effects of 241 Am, 239 Pu and 237 Np. These nuclides were injected to animals intravenously, subcutaneously or directly into the lung (Stansen's lung puncture method) in doses of 1.0, 5.0 and 8.5 μCi/kg, respectively. As soluble nitrate, the nuclides were rapidly transfered from the site of injection into the bone and the liver. Osteosarcomas were found in some animals 8 months to one year after intoxication. Diagnosis of osteosarcoma is based on the histopatological examination and X-ray photography. In the Am-poisoned rats the incidence of osteosarcoma is about 31-74%, varied with different doses and different routes of intoxication; in Pu-poisoned rats, the incidence of osteosarcoma is about 55-66%. while in Np-poisoned rats, it is about 36-53%. Primary lung cancers were also found in those animals poisoned by means of Stansen's lung puncture method with the above three nuclides. The incidence of primary lung cancers is about 6% in Am-and Pu-poisoned rats and 13% in Np-poisoned rats. The incidence of metastasis of osteosarcoma in lung is about 25-65% for Am-poisoned rats, 45-55% for Pu-poisoned rats and 41-80% for Np-poisoned rats. The life-span of above poisoned rats was significantly shorter than that of the normal control animals. The chemical weight for 241 Am, 239 Pu and 237 Np in same unit of radioactivity (1.0 μCi) equals to 0.308 μg, 15.9 μg and 1418.7 μg, respectively. For this reason, we have to pay more attention to the chemical mass effect in carcinogenesis of the above three nuclides

  2. Transfer of 241Am and 237Pu from euphausiid moults to a carbonate-rich marine sediment

    International Nuclear Information System (INIS)

    Hargrave, B.T.

    1986-01-01

    Concentrations of 241 Am and 237 Pu adsorbed onto moulted exoskeletons from the euphausiid Meganyctiphanes norvegica decreased exponentially with 50% retention times of 3-7 d when moults were incubated in filtered seawater with small amounts of carbonate-rich sediment. Over 95% of sediment weight was present as -2 ) was greatest in the medium-fine sand fraction which had the highest carbonate content. These particles constituted -2 surface: atoms μm -3 in solution) was 10 3 -10 4 times higher than similar quotients for 241 Am and 237 Pu sorbed to surfaces of organic particles are transferred to sediments. (author)

  3. The inhalation of insoluble iron oxide particles in the sub-micron ranges. Part II - Plutonium-237 labelled aerosols

    International Nuclear Information System (INIS)

    Waite, D.A.; Ramsden, D.

    1971-10-01

    The results of a series of inhalation studies using iron oxide particles in the size range 0.1 to 0.3 um (count median diameter) are described. In this series the aerosols were labelled with plutonium 237. In vivo detection, excretion analysis and crude location studies were obtainable and the results compared to the earlier studies using chromium 51 labelled aerosols. Plutonium 237 can be considered as a simulator for plutonium 239 and attempts are made to extrapolate the results to the problem of the estimation of plutonium 239 in the human lung. (author)

  4. Measurement of fast neutron induced fission cross sections of 232Th, 238U, 237Np and 243Am

    International Nuclear Information System (INIS)

    Kanda, Kazutaka; Sato, Osamu; Yoshida, Kazuo; Imaruoka, Hiromitsu; Terayama, Hiromichi; Yoshida, Masashi; Hirakawa, Naohiro

    1984-01-01

    Neutron induced fission cross sections of 232 Th, 238 U, 237 Np and 243 Am relative to 235 U were measured in the energy range from 1.5 to 6.6 MeV. The present results are compared with experimental results of others and evaluated data in JENDL-2 and ENDF/B-IV. (author)

  5. 49 CFR 237.73 - Protection of bridges from over-weight and over-dimension loads.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Protection of bridges from over-weight and over... (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION BRIDGE SAFETY STANDARDS Capacity of Bridges § 237.73 Protection of bridges from over-weight and over-dimension loads. (a) Each track owner...

  6. Determination of traces of 237Np in environmental samples by ICP-MS after separation using TOA extraction chromatography

    International Nuclear Information System (INIS)

    Ji, Y.Q.; Li, J.Y.; Luo, S.G.; Wu, T.; Liu, J.L.

    2001-01-01

    A simple, rapid, cost-efficient, and robust method for separation of 237 Np with an extraction chromatographic column (TOA: tri-n-octylamine on Teflon powder) is outlined in detail and further improved for direct ICP-MS analysis. The column efficiently retained 237 Np in 2 mol L -1 HNO 3 medium and all of the 237 Np was easily eluted with 0.02 mol L -1 oxalic acid in 0.16 mol L -1 HNO 3 at 95 C. The separated solutions were free from most matrix elements and were aspirated into the ICP-MS directly. The decontamination factor for 238 U is more than 10 4 . The instrumental detection limit for 237 Np was 0.46 pg mL -1 , which corresponds to 1.2 x 10 -5 Bq mL -1 . The method is more rapid than traditional radiometric techniques. It is also considered to be more suitable for environmental monitoring than existing methods based on TOA. (orig.)

  7. Determination of traces of 237Np in environmental samples by ICP-MS after separation using TOA extraction chromatography.

    Science.gov (United States)

    Ji, Y Q; Li, J Y; Luo, S G; Wu, T; Liu, J L

    2001-09-01

    A simple, rapid, cost-efficient, and robust method for separation of 237Np with an extraction chromatographic column (TOA: tri-n-octylamine on Teflon powder) is outlined in detail and further improved for direct ICP-MS analysis. The column efficiently retained 237Np in 2 mol L(-1) HNO3 medium and all of the 237Np was easily eluted with 0.02 mol L(-1) oxalic acid in 0.16 mol L(-1) HNO3 at 95 degrees C. The separated solutions were free from most matrix elements and were aspirated into the ICP-MS directly. The decontamination factor for 238U is more than 10(4). The instrumental detection limit for 237Np was 0.46 pg mL(-1), which corresponds to 1.2 x 10(-5) Bq mL(-1). The method is more rapid than traditional radiometric techniques. It is also considered to be more suitable for environmental monitoring than existing methods based on TOA.

  8. Development of ionization technique for measurement of fast neutron induced fission products yields of {sup 237}Np

    Energy Technology Data Exchange (ETDEWEB)

    Goverdovski, A.A.; Khryachkov, V.A.; Ketlerov, V.V.; Mitrofanov, V.F.; Ostapenko, Yu.B.; Semenova, N.N.; Fomichev, A.N.; Rodina, L.F. [Institute of Physics and Power Engineering, Obninsk (Russian Federation)

    1997-03-01

    Twin gridded ionization chamber and corresponding software was designed for measurements of masses, kinetic energies and nuclear charges of fission fragments from fast neutron induced fission of {sup 237}Np. The ionization detector design, electronics, data acquisition and processing system and the test results are presented in this paper. (J.P.N.)

  9. Measurement of the fission cross-section ratio for 237Np/235U around 14 MeV neutron energies

    International Nuclear Information System (INIS)

    Desdin, L.; Szegedy, S.; Csikai, J.

    1989-01-01

    Fission cross-section ratio was determined for 237 Np/ 235 U around 14 MeV neutron energies with a back-to-back ionization chamber. Neutrons were produced by a 180 KV accelerator using T(d,n) 4 He reaction. No significant energy dependence was found in the cross section ratio

  10. Post-Irradiation Examination of 237Np Targets for 238Pu Production

    Energy Technology Data Exchange (ETDEWEB)

    Morris, Robert Noel [ORNL; Baldwin, Charles A [ORNL; Hobbs, Randy W [ORNL; Schmidlin, Joshua E [ORNL

    2015-01-01

    Oak Ridge National Laboratory is recovering the US 238Pu production capability and the first step in the process has been to evaluate the performance of a 237Np target cermet pellet encased in an aluminum clad. The process proceeded in 3 steps; the first step was to irradiate capsules of single pellets composed of NpO2 and aluminum power to examine their shrinkage and gas release. These pellets were formed by compressing sintered NpO2 and aluminum powder in a die at high pressure followed by sintering in a vacuum furnace. Three temperatures were chosen for sintering the solution precipitated NpO2 power used for pellet fabrication. The second step was to irradiate partial targets composed of 8 pellets in a semi-prototypical arrangement at the two best performing sintering temperatures to determine which temperature gave a pellet that performed the best under the actual planned irradiation conditions. The third step was to irradiate ~50 pellets in an actual target configuration at design irradiation conditions to assess pellet shrinkage and gas release, target heat transfer, and dimensional stability. The higher sintering temperature appeared to offer the best performance after one cycle of irradiation by having the least shrinkage, thus keeping the heat transfer gap between the pellets and clad small minimizing the pellet operating temperature. The final result of the testing was a target that can meet the initial production goals, satisfy the reactor safety requirements, and can be fabricated in production quantities. The current focus of the program is to verify that the target can be remotely dissembled, the pellets dissolved, and the 238Pu recovered. Tests are being conducted to examine these concerns and to compare results to code predictions. Once the performance of the full length targets has been quantified, the pellet 237Np loading will be revisited to determine if it can be

  11. Standard Test Method for Measuring Reaction Rates by Radioactivation of Neptunium-237

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2008-01-01

    1.1 This test method covers procedures for measuring reaction rates by assaying a fission product (F.P.) from the fission reaction 237Np(n,f)F.P. 1.2 The reaction is useful for measuring neutrons with energies from approximately 0.7 to 6 MeV and for irradiation times up to 30 to 40 years. 1.3 Equivalent fission neutron fluence rates as defined in Practice E 261 can be determined. 1.4 Detailed procedures for other fast-neutron detectors are referenced in Practice E 261. 1.5 The values stated in SI units are to be regarded as standard. No other units of measurement are included in this standard. 1.6 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  12. The z = 1.6748 C I Absorber Toward the QSO PKS 1756+237

    Science.gov (United States)

    Roth, Katherine C.; Bauer, James M.; Jim, Kevin T. C.

    We have detected C I ground-state absorption at zabs = 1.6748 toward the QSO PKS 1756+237 (zem = 1.725), making this only the fourth known C I QSO absorber. The absence of excited-state fine-structure C I lines is compatible with the redshifted Cosmic Microwave Background Radiation at an expected temperature of TCMBR (1+z) = 7.291 K (Mather et al. 1994, ApJ, 354, L37). We find a 2 σ upper-limit on the C I excitation temperature of Tex <= 7.73(+0.53, -0.46) K (Roth & Bauer 1999, ApJ, submitted). Our Keck HIRES spectra (8.3 km s-1 FWHM) obtained in May 1997 also reveal the existence of Ni II and Fe II lines with a sub-solar Ni/Fe abundance ratio, presumably indicative of dust. We have obtained deep, high resolution (0.3'' FWHM) images in H+K' with the UH 2.2m Tip-Tilt system of the QSO field in order to identify the system responsible for the zabs = 1.6748 absorption. We detect two faint candidate systems within 1.5'' and 3'' (≅ 15 and 30 kpc, Hcirc = 65) of the QSO.

  13. Fission mode analysis of the reaction 237Np(n,f) - possibilities and perspectives

    International Nuclear Information System (INIS)

    Siegler, P.

    1996-01-01

    Fission fragment properties for the reaction 237 Np(n,f) have been measured at the Van de Graaff Laboratory of the IRMM. Using a double gridded ionization chamber the mass, kinetic energy and the angular distribution for both fission fragments could be determined simultaneously for an incident neutron energy range from E n =0.3 MeV upto E n =5.5 MeV. Complete datasets have been acquired for 13 different neutron energies covering sub barrier fission as well as fission in the plateau region. A detailed analysis of the fragment distributions and the respective momenta has been carried out, checking the coherence against the excitation energy of the compound nucleus. The consideration of multi-modal fission offers an improved possibility for the description of the fragment distributions backed up by theoretical calculations on the basis of the multi-model random-neck rupture model of Brosa, Grossmann and Mueller. The changes of the fission fragment properties under investigation are completely described and an interpretation of the findings is presented. (author)

  14. New experimental determination of the neutronic resonance parameters of {sup 237}Np below 500 eV; Nouvelle determination experimentale des parametres de resonances neutroniques de {sup 237}Np en dessous de 500 eV

    Energy Technology Data Exchange (ETDEWEB)

    Gressier, V

    1999-10-01

    For studies of future nuclear reactors dedicated to nuclear waste transmutation, an improvement of the accuracy of the neutron radiative capture cross section of {sup 237}Np appears necessary. In the framework of a collaboration between the Commissariat a l'Energie atomique (CEA) and Institute for Reference Materials and Measurement (IRMM, Geel, Bergium), a new determination of the resonance parameters of {sup 237}Np has been performed. Two types of experiments are carried out at GELINA, the IRMM pulsed neutron source, using the time of flight method: a transmission experiment which is related to the neutron total cross section and a capture experiment which gives the neutron radiative capture cross section. The resonance parameters presented in this work are extracted from the transmission data between 0 and 500 eV with the least square code REFIT, using the Reich-Moore formalism. In parallel, the Doppler effect is investigated. The commonly used free gas model appears inadequate below 20 eV for neptunium dioxide at room temperature. By the use of the program DOPUSH, which calculates the Doppler broadening with a harmonic crystal model according to Lamb's theory, we are able to produce abetter fit of the experimental data for the resonances of {sup 237}Np in NpO{sub 2} at low energy or temperatures. In addition to the resonance parameters, a study of their mean value and distribution is included in this work. (authors)

  15. Independent Yields of Kr and Xe Fragments at Photofission of Odd Nuclei ^{237}Np and ^{243}Am

    CERN Document Server

    Gangrsky, Yu P; Myshinskii, G V; Penionzhkevich, Yu E

    2004-01-01

    he independent yields of fragments Kr (A=89-93) and Xe (A=135-142) at photofission of odd nuclei 237Np and 243Am are presented. The experiments were performed using the bremsstrahlung of 25 MeV electrons on the microtron of FLNR, JINR. A technique was used that included the transportation of fragments which escaped from the target with the gas flow through a capillary and the condensation of inert gases in a cryostat at the temperature of liquid nitrogen. Kr and Xe isotopes were identified by the spectra of their daughter products. The mass number distributions of the independent yields of Kr and Xe isotopes and of the complementary fragments (Y and La at the photofission of ^{237}Np and Nb and Pr at the photofission of ^{243}Am) were obtained.

  16. 242Pu as tracer for simultaneous determination of 237Np and 239,240Pu in environmental samples

    DEFF Research Database (Denmark)

    Chen, Q.J.; Dahlgaard, H.; Nielsen, S.P.

    2002-01-01

    A procedure has been developed using Pu-242 as tracer for simultaneous determination of Np-237 and Pu-239,Pu-240 in environmental samples. The validity of the method has been demonstrated by ICPMS and alpha-spectroscopy for up to 10 gram soil and sediment, seawater up to 200 litres. The paper...... from Np and Pu) R-before/R-after = 1.004 +/- 3.3% (S.D n = 20) and 1 litre seawater R-before/R-after = 1.019+/-1.9% (S.D., n = 12). Results from the intercomparison samples LAEA-135, LAEA-381 and from environmental samples are presented....... describes a suitable chemical procedure for Np and Pu including a quantitative pre-concentration of neptunium and plutonium, preparation of Np4+ and Pu4+, NP(NO3)(6)(2-) and Pu(NO3)(6)(2-), The ratio of Np-237/Pu-242 (or Np-237/Pu-239) before and after the procedure has been determined using 10 g soil (free...

  17. Osteosarcoma induction by plutonium-239, americium-241 and neptunium-237 : the problem of deriving risk estimates for man

    International Nuclear Information System (INIS)

    Taylor, D.M.

    1988-01-01

    Spontaneous bone cancer (osteosarcoma) represents only about 0.3% of all human cancers, but is well known to be inducible in humans by internal contamination with radium-226 and radium-224. plutonium-239, americium-241 and neptunium-237 form, or will form, the principal long-lived alpha particle emitting components of high activity waste and burnt-up nuclear fuel elements. These three nuclides deposit extensively in human bone and although, fortunately, no case of a human osteosarcoma induced by any of these nuclides is known, evidence from animal studies suggests that all three are more effective than radium-226 in inducing osteosarcoma. The assumption that the ratio of the risk factors, the number of osteosarcoma expected per 10000 person/animal Gy, for radium-226 and any other bone-seeking alpha-emitter will be independent of animal species has formed the basis of all the important studies of the radiotoxicity of actinide nuclides in experimental animals. The aim of this communication is to review the risk factors which may be calculated from the various animal studies carried out over the last thirty years with plutonium-237, americium-241 and neptunium-237 and to consider the problems which may arise in extrapolating these risk factors to homo sapiens

  18. A novel Meloidogyne graminicola effector, MgMO237, interacts with multiple host defence-related proteins to manipulate plant basal immunity and promote parasitism.

    Science.gov (United States)

    Chen, Jiansong; Hu, Lili; Sun, Longhua; Lin, Borong; Huang, Kun; Zhuo, Kan; Liao, Jinling

    2018-02-27

    Plant-parasitic nematodes can secrete effector proteins into the host tissue to facilitate their parasitism. In this study, we report a novel effector protein, MgMO237, from Meloidogyne graminicola, which is exclusively expressed within the dorsal oesophageal gland cell and markedly up-regulated in parasitic third-/fourth-stage juveniles of M. graminicola. Transient expression of MgMO237 in protoplasts from rice roots showed that MgMO237 was localized in the cytoplasm and nucleus of the host cells. Rice plants overexpressing MgMO237 showed an increased susceptibility to M. graminicola. In contrast, rice plants expressing RNA interference vectors targeting MgMO237 showed an increased resistance to M. graminicola. In addition, yeast two-hybrid and co-immunoprecipitation assays showed that MgMO237 interacted specifically with three rice endogenous proteins, i.e. 1,3-β-glucan synthase component (OsGSC), cysteine-rich repeat secretory protein 55 (OsCRRSP55) and pathogenesis-related BetvI family protein (OsBetvI), which are all related to host defences. Moreover, MgMO237 can suppress host defence responses, including the expression of host defence-related genes, cell wall callose deposition and the burst of reactive oxygen species. These results demonstrate that the effector MgMO237 probably promotes the parasitism of M. graminicola by interacting with multiple host defence-related proteins and suppressing plant basal immunity in the later parasitic stages of nematodes. © 2018 BSPP AND JOHN WILEY & SONS LTD.

  19. Differences in the behavior of 233Pa, 237Np and 239 Pu in bentonite contaminated by sulfate-reducing bacteria

    International Nuclear Information System (INIS)

    Kudo, A.; Fujikawa, Y.; Takigami, H.; Zheng, J.; Asano, H.; Arai, K.; Yoshikawa, H.; Ito, M.

    1998-01-01

    The behaviors of 233 Pa, 237 Np and 239 Pu in high level radioactive wastes from nuclear fuel reprocessing were investigated by a laboratory experiment. Radioactive wastes are glassified and disposed of in geological repositories encased in bentonite as an additional artificial barrier to protect the environment. There is, however, the possibility that some anaerobic bacteria, especially sulfate-reducing bacteria, may flourish within the bentonite during the long disposal period (more than a century). The effects of sulfate-reducing bacteria on the behavior of the radionuclides within bentonite were investigated using the distribution coefficient (Kd) of 233 Pa, 237 Np and 239 Pu. The Kd was obtained with a 0.22 m membrane filter separating radionuclide contents in solid and liquid phases. The anaerobic bacteria, including sulfate-reducing bacteria, used for this investigation originated from the anaerobic treatment of pulp and paper waste and operated for more than one year at Eh around -85 mV. The bentonite used for this study was produced in Japan. The active anaerobic bacteria clearly accumulates considerable amounts of 233 Pa and 239 Pu by producing high Kd values of nearly 100,000, while Kds of 233 Pa and 239 Pu for the sterilized anaerobic bacteria were less than 10,000. In other words, live anaerobic bacteria can hold considerably higher amounts of the radionuclides compared to dead bacteria. Furthermore, high Kd values were obtained for anaerobic bacteria at pH 5-9. In contrast, Kd values for the radionuclide 237 Np were not influenced by the anaerobic bacteria but were controlled by chemical environmental conditions such as like pH. Another comparison was conducted for the radionuclides for mixtures of non-sterilized bacteria with bentonite. (author)

  20. Sequential Injection Method for Rapid and Simultaneous Determination of 236U, 237Np, and Pu Isotopes in Seawater

    DEFF Research Database (Denmark)

    Qiao, Jixin; Hou, Xiaolin; Steier, Peter

    2013-01-01

    An automated analytical method implemented in a novel dual-column tandem sequential injection (SI) system was developed for simultaneous determination of 236U, 237Np, 239Pu, and 240Pu in seawater samples. A combination of TEVA and UTEVA extraction chromatography was exploited to separate and purify...... target analytes, whereupon plutonium and neptunium were simultaneously isolated and purified on TEVA, while uranium was collected on UTEVA. The separation behavior of U, Np, and Pu on TEVA–UTEVA columns was investigated in detail in order to achieve high chemical yields and complete purification...

  1. Depth profiling of residual activity of ^{237}U fragments as a range verification technique for ^{238}U primary ion beam

    Directory of Open Access Journals (Sweden)

    I. Strašík

    2012-07-01

    Full Text Available Experimental and simulation data concerning fragmentation of ^{238}U ion beam in aluminum, copper, and stainless-steel targets with the initial energy 500 and 950  MeV/u are collected in the paper. A range-verification technique based on depth profiling of residual activity is presented. The irradiated targets were constructed in the stacked-foil geometry and analyzed using gamma-ray spectroscopy. One of the purposes of these experiments was depth profiling of residual activity of induced nuclides and projectile fragments. Among the projectile fragments, special attention is paid to the ^{237}U isotope that has a range very close to the range of the primary ^{238}U ions. Therefore, the depth profiling of the ^{237}U isotope can be utilized for experimental verification of the ^{238}U primary-beam range, which is demonstrated and discussed in the paper. The experimental data are compared with computer simulations by FLUKA, SRIM, and ATIMA, as well as with complementary experiments.

  2. Neutron induced fission cross sections for 232Th, 235,238U, 237Np, and 239Pu

    International Nuclear Information System (INIS)

    Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Hill, N.W.; Carlson, A.D.; Wasson, O.A.

    1989-01-01

    Neutron-induced fission cross section ratios for samples of 232 Th, 235,238 U, 237 Np and 239 Pu have been measured from 1 to 400 MeV. The fission reaction rate was determined for all samples simultaneously using a fast parallel plate ionization chamber at a 20-m flight path. A well characterized annular proton recoil telescope was used to measure the neutron fluence from 3 to 30 MeV. Those data provided the shape of the 235 U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n,f) at 14.178 MeV. From 30 to 400 MeV cross section values were determined using the neutron fluence measured with a plastic scintillator. Cross section values of 232 Th, 235,238 U, 237 Np and 239 Pu were computed from the ratio data using the authors' values for 235 U(n,f). In addition to providing new results at high neutron energies, these data highlight several areas of deficiency in the evaluated nuclear data files and provide new information for the 235 U(n,f) standard

  3. NKS-Norcmass reference material for analysis of Pu-isotopes and 237Np by mass spectrometry

    International Nuclear Information System (INIS)

    Ross, P.; Nygren, U.; Appelblad, P.; Skipperud, L.; Sjoegren, A.

    2006-04-01

    The aim of the reference material in the Norcmass-project was to produce a low-level ( 239 Pu) sample of sufficient amount to allow individual laboratories to perform several tests without risk of using up the material. Although there are several reference materials available (eg IAEA) few have 239 Pu/ 240 Pu data and almost none have 237 Np/ 239 Pu-data. Those who have (eg IAEA-384) have very high concentrations and are not useful for testing analytical methods designed for low-level measurements where a large sample mass may be required. The reference material consist of the top 10cm of 2mm sieved soil pooled together from 12 different Danish locations collected during 2003. The Soil was blended and sieved through 0.6 and finally through a 0.4 mm sieve. A total amount of 17 kg soil was produced. Several aliquots of the material was subject to analysis by alpha spectrometry and ICP-MS. The material contain 239 + 240 Pu at a concentration of 0.24 ± 0.01 mBq/g and a 240 Pu/ 239 Pu atom ratio of 0.19 ± 0.006. The ratio 237 Np/ 239 Pu was determined to 0.32 ± 0.01. (au)

  4. Efficacy and safety of once-daily NVA237 in patients with moderate-to-severe COPD: the GLOW1 trial

    Directory of Open Access Journals (Sweden)

    D'Urzo Anthony

    2011-12-01

    Full Text Available Abstract Background NVA237 is a once-daily dry-powder formulation of the long-acting muscarinic antagonist glycopyrronium bromide in development for the treatment of chronic obstructive pulmonary disease (COPD. The glycopyrronium bromide in COPD airways clinical study 1 (GLOW1 evaluated the efficacy, safety and tolerability of NVA237 in patients with moderate-to-severe COPD. Methods Patients with COPD with a smoking history of ≥ 10 pack-years, post-bronchodilator forced expiratory volume in 1 second (FEV1 1/forced vital capacity 1 antagonists permitted in patients stabilized on them prior to study entry. The primary outcome measure was trough FEV1 at Week 12. Results A total of 822 patients were randomized to NVA237 (n = 552 or placebo (n = 270. Least squares mean (± standard error trough FEV1 at Week 12 was significantly higher in patients receiving NVA237 (1.408 ± 0.0105 L, versus placebo (1.301 ± 0.0137 L; treatment difference 108 ± 14.8 mL, p 1 were apparent at the end of Day 1 and sustained through Week 26. FEV1 was significantly improved in the NVA237 group versus placebo throughout the 24-hour periods on Day 1 and at Weeks 12 and 26, and at all other visits and timepoints. Transition dyspnoea index focal scores and St. George's Respiratory Questionnaire scores were significantly improved with NVA237 versus placebo at Week 26, with treatment differences of 1.04 (p Conclusions Once-daily NVA237 was safe and well tolerated and provided rapid, sustained improvements in lung function, improvements in dyspnoea, and health-related quality of life, and reduced the risk of exacerbations and the use of rescue medication. Trial registration ClinicalTrials.gov: NCT01005901

  5. Photofission Cross Sections for 237Np in the Energy Interval from 5.27 to 10.83 MeV

    International Nuclear Information System (INIS)

    Geraldo, L.P.; Semmler, R.; Goncalez, O. L.; Mesa, J.; Arruda-Neto, J.D.T.; Garcia, F.; Rodriguez, O.

    2000-01-01

    Photofission cross sections for 237 Np have been measured as a function of energy, in the interval from 5.27 to 10.83 MeV. The gamma-ray spectra were those produced by thermal neutron capture, in 30 different target materials, at a tangential beam hole of the Instituto de Pesquisas Energeticas e Nucleares IEA-R1 2-MW research reactor. The set of experimental data has been unfolded employing least-squares methods and the covariance matrix methodology. The determined photofission cross sections for 237 Np, together with the complete correlation matrix for the involved errors, are presented and are compared with previous measurements reported in the literature. A statistical calculation for the 237 Np photofission cross sections was performed, and the results are compared with the experimental data

  6. First experiments on transmutation studies of iodine-129 and neptunium-237 using relativistic protons of 3.7 GeV

    International Nuclear Information System (INIS)

    Krivopustov, M.I.; Adam, J.; Bradnova, V.

    1997-01-01

    First experiments on the transmutation of long-lived 129 I and 237 Np using relativistic protons of 3.7 GeV are described. Relativistic protons generate in extended Pb-targets substantial neutron fluences. These neutrons get moderated in paraffin and are used for transmutation as follows: 129 (n, γ) 130 I(β - ) → 130 Xe(stable) and 237 Np(n, γ) 238 Np(β - ) →. The isotopes 130 I (T 1/2 =12.36 h) and 238 Np (T 1/2 =2.117 days) were identified radiochemically. One can estimate the transmutation cross section (n, γ) in the given neutron field as σ( 129 I(n, γ))=(10±2)b and σ( 237 Np(n, γ))=(140±30)b. The experiments were carried out in November 1996 at the Synchrophasotron, Laboratory of High Energies (LHE), Dubna, Russia

  7. Montecarlo calculation of the isomeric cross sections ratio for the reaction 237Np(n,2n)236Np

    International Nuclear Information System (INIS)

    Cleri, F.

    1988-01-01

    A Montecarlo calculation of the isomeric cross section ratio for the (n,2n) reaction on 237 Np has been carried out based on the Hauser-Feshbach formulation. A standard energy-dependent optical model potential was used, with zero deformation parameters and no spin-orbit coupling. Investigation was made about the role of the energy cut-off value, of the higher multipole (E2) transition, of the gamma-ray versus second neutron emission, of the value of the spin cutt-off parameter. The results give the correct qualitative energy dependence of the branching ratio, with the assumption that the 1 - level is the ground state. The spin cut-off value obtained indicates a less pronounced deviation of the nuclear moment of inertia from the rigid-body value, with respect to older evaluations for high-mass nuclei. (author)

  8. Ultra-trace determination of neptunium-237 and plutonium isotopes in urine samples by compact accelerator mass spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Dai, X.; Christl, M.; Kramer-Tremblay, S., E-mail: sheila.kramer-tremblay@cnl.ca [Canadian Nuclear Laboratories, Chalk River, Ontario (Canada); Synal, H-A. [ETH Zurich, Lab. of Ion Beam Physics, Zurich (Switzerland)

    2015-12-15

    Ultra-trace analysis of actinides, such as Pu isotopes and {sup 237}Np, in bioassay samples is often needed for radiation protection programs at nuclear facilities. Accelerator mass spectrometry (AMS), particularly the compact ETH Zurich system “Tandy”, has evolved over the years as one of the most sensitive, selective, and robust techniques for actinide analysis. Employment of the AMS technique can reduce the demands on sample preparation chemistry and increase sample analysis throughput, due to very low instrumental detection limit, high rejection of interferences, and low susceptibility to adverse sample matrices. Initial research and development tests were performed to explore and demonstrate the analytical capability of AMS for Pu and Np urine bioassay. In this study, urine samples spiked with femtogram levels of Np and Pu isotopes were prepared and measured using compact ETH AMS system and the results showed excellent analytical capability for measuring Np and Pu isotopes at femtogram/litre levels in urine. (author)

  9. Review of fission product yields and delayed neutron data for the actinides NP-237, PU-242, AM-242M, AM-243, CM-243 and CM-245

    International Nuclear Information System (INIS)

    Mills, R.W.

    1990-07-01

    A review of fission product yields and delayed neutron data for Np-237, Pu-242, Am-242m, Am-243, Cm-243 and Cm-245 has been undertaken. Gaps in understanding and inconsistencies in existing data were identified and priority areas for further experimental, theoretical and evaluation investigation detailed

  10. High resolution measurement of the 237Np(n,f) cross section from 100keV to 2MeV

    International Nuclear Information System (INIS)

    Plattard, S.; Pranal, Y.; Blons, J.

    1975-01-01

    237 Np fission is one of the reactions utilized in the threshold detector method of neutron spectrometry for the determination of fast neutron spectra in nuclear reactors. Therefore, an accurate knowledge of the energy-dependent fission cross section is essential for a precise generation of the spectral indices of this method. A high resolution measurement of the fission cross section is presented [fr

  11. Localization of the X-linked ocular albinism gene (OA1) between DXS278/DXS237 and DXS143/DXS16 by linkage analysis

    NARCIS (Netherlands)

    Bergen, A. A.; Samanns, C.; van Dorp, D. B.; Ferguson-Smith, M. A.; Gal, A.; Bleeker-Wagemakers, E. M.

    1990-01-01

    Linkage analysis was performed in six families segregating for X-linked ocular albinism of the Nettleship-Falls type using four polymorphic DNA markers from the distal Xp. Linkage was found between the disease locus (OA1) and the loci DXS237 (theta max = 0.06, Zmax = 2.82), DXS278 (theta max = 0.03,

  12. Measurement of 237Np fission rate ratio relative to 235U fission rate in cores with various thermal neutron spectrum at the Kyoto University Critical Assembly

    International Nuclear Information System (INIS)

    Unesaki, Hironobu; Shiroya, Seiji; Iwasaki, Tomohiko; Fujiwara, Daisuke; Kitada, Takanori; Kuroda, Mitsuo; Kohashi, Akio; Kato, Takeshi; Ikeuchi, Yoshitaka

    2000-01-01

    Integral measurements of 237 Np fission rate ratio relative to 235 U fission rate have been performed at Kyoto University Citrical Assembly. The fission rates have been measured using the back-to back type double fission chamber at five thermal cores with different H/ 235 U ratio so that the neutron spectra of the cores were systematically varied. The measured fission rate ratio per atom was 0.00439 to 0.0298, with a typical uncertainty of 2 to 3%. The measured data were compared with the calculated results using SRAC/TWOTRAN and MVP based on JENDL-3.2, which gave the averaged C/E values of 0.93 and 0.95, respectively. Obtained results of C/E using 237 Np cross sections from JENDL-3/2, ENDF/B-VI.5 and JEF2.2 show that the latter two gave smaller results than JENDL-3.2 by about 4%, which clearly reflects the discrepancy in the evaluated cross section among the libraries. This difference arises from both fast fission and resonance region. Although further improvement is recommended, 237 Np fission cross section in JENDL-3.2 is considered to be superior to those in the other libraries and can be adopted for use in design calculations for minor actinide transmutation system using thermal reactors with prediction precision of 237 Np fission rate with in 10%. (author)

  13. Measurement of the neutron-induced fission cross section of 237Np relative to 235U from 0.02 to 30 MeV

    International Nuclear Information System (INIS)

    Behrens, J.W.; Magana, J.W.; Browne, J.C.

    1977-01-01

    The 237 Np/ 235 U fission cross section ratio has been measured from 0.02 to 30 MeV. Using the threshold method, a value of 1.294 +- 0.019 is obtained for the average cross section ratio in the interval from 1.75 to 4.00 MeV

  14. The Synergistic Effect of Valsartan and LAF237 [(S)-1-[(3-Hydroxy-1-Adamantyl)Ammo]acetyl-2-Cyanopyrrolidine] on Vascular Oxidative Stress and Inflammation in Type 2 Diabetic Mice

    Science.gov (United States)

    Shen, Min; Sun, Dongdong; Li, Weijie; Liu, Bing; Wang, Shenxu; Zhang, Zheng; Cao, Feng

    2012-01-01

    Aim. To investigate the combination effects and mechanisms of valsartan (angiotensin II type 1 receptor blocker) and LAF237 (DPP-IV inhibitor) on prevention against oxidative stress and inflammation injury in db/db mice aorta. Methods. Db/db mice (n = 40) were randomized to receive valsartan, LAF237, valsartan plus LAF237, or saline. Oxidative stress and inflammatory reaction in diabetic mice aorta were examined. Results. Valsartan or LAF237 pretreatment significantly increased plasma GLP-1 expression, reduced apoptosis of endothelial cells isolated from diabetic mice aorta. The expression of NAD(P)H oxidase subunits also significantly decreased resulting in decreased superoxide production and ICAM-1 (fold change: valsartan : 7.5 ± 0.7, P valsartan : 5.2 ± 1.2, P valsartan: 3.2 ± 0.6, LAF237: 4.7 ± 0.8; P valsartan and LAF237 resulted in a more significant increase of GLP-1 expression. The decrease of the vascular oxidative stress and inflammation reaction was also higher than monotherapy with valsartan or LAF237. Conclusion. These data indicated that combination treatment with LAF237 and valsartan acts in a synergistic manner on vascular oxidative stress and inflammation in type 2 diabetic mice. PMID:22474415

  15. Numerical methods to analyze alpha spectra and application to the study of neptunium 237 and neptunium 236

    International Nuclear Information System (INIS)

    Garcia-Torano, E.

    1990-01-01

    A set of numerical methods to analize alpha spectra measured with semiconductor detectors are presented. The methods can be divided in two groups, the first being based in the X 2 minimization ands the second in the use of the Fourier Transform. The methods based in the minimization of X 2 can, in turn, be divided according to the model used to fit the spectra. Some of them use a monoenergetic line for the intercomparison with the other peaks in the same spectrum. The others take into account the analytical function developed to represent an alpha line. Both allow the determination of positions and areas of the components, as well as the uncertainties of the results. The Fast Fourier Transform is applied to the second group of methods, which include the smoothing of experimental data, and the deconvolution of spectra. Examples are given of the application of these methods to real spectra. The alpha spectra of 237 Np and 236 Np are studied by using some of the methods described in this work. (Author)

  16. The quadrupole moment and strong interaction parameters from muonic and pionic X-ray studies of 237Np

    International Nuclear Information System (INIS)

    Laat, C.T.A.M. de; Taal, A.; Duinker, W.; Konijn, J.; Petitjean, C.; Reist, H.W.; Mueller, W.; Commission of the European Communities, Geel

    1987-01-01

    The X-ray spectrum of muonic and pionic 237 Np has been investigated with muons and pions stopped in a NpO 2 target. The nuclear spectroscopic quadrupole moment was determined to be Q=3.886±0.006 b from the splittings of the muonic 5g→4f hyperfine complexes. The B(E2)↓-values for the first and second excited states were evaluated as 3.17±0.08 and 2.77±0.10 e 2 b 2 , respectively. A comparison between the muonic and pionic 5g→4f hyperfine complexes yields the strong interaction parameter for the pionic 4f state. For the first time a change of sign as function of Z for the strong interaction quadrupole shift ε 2 (4f) has been observed. The standard optical model predictions agree reasonably well with the measured strong interaction monopole shift, ε 0 (4f), and width, Γ 0 (4f), while they disagree with the experimental value for ε 2 . A stronger s-wave repulsion in the optical potential could explain this effect. (orig.)

  17. Precise 238U(n,2n)237U reaction cross-section measurements using the activation facility at TUNL

    Science.gov (United States)

    Krishichayan, Fnu; Bhike, M.; Tornow, W.

    2014-09-01

    Accurate neutron-induced 238U(n,2n)237U reaction data are required for many practical applications, especially in the field of nuclear energy, including advanced heavy water reactors, where 238U is used as the breeding material to regenerate the fissile material 239Pu. Precise (n,2n) cross-section measurements of 238U are underway at TUNL with mono-energetic neutrons in the 8.0 to 14.0 MeV energy range in steps of 0.25 MeV using the activation technique. After activation of the 0.5 inch diameter and 442 mg 238U foil, the activity of the 208 keV characteristic γ-line is tracked for 6 weeks with a high efficient HPGe clover detector to determine the initial activity needed for the cross-section determination. Results of the cross-section measurements, determined relative to 27Al and 197Au neutron activation monitor foils, and the comparison with theoretical models will be presented during the meeting.

  18. Fragment properties in the fission of 237Np with fast neutrons - an experimental investigation of fission dynamics

    International Nuclear Information System (INIS)

    Naqvi, A.A.

    1980-03-01

    Fission fragment properties such as mass distribution, kinetic energy distribution or number of prompt emitted neutrons as a function of fragment mass can be used to characterize the scission point configuration. The present experiment allows for the first time to investigate these quantities for neutron induced fission in the MeV range. In this way the influence of excitation energy of the saddle point deformation of the fissioning system ( 237 Np + n) can be studied. Neutrons with energies of 0.8 and 5.5 MeV were produced by the Karlsruhe pulsed 3MV Van de Graaff accelerator. Kinetic energies and velocities of correlated fragments were determined by solid state detectors using the time-of-flight technique. The experimentally determined distributions of fragment properties were compared to a recent model suggested by Wilkins et al. which assumes only relatively weak coupling between internal and collective degrees of freedom. At least qualitative agreement is found for most of the results. (orig.) [de

  19. First simultaneous measurement of fission and gamma probabilities of 237U and 239Np via surrogate reactions

    Directory of Open Access Journals (Sweden)

    Marini P.

    2016-01-01

    Full Text Available Fission and gamma decay probabilities of 237U and 239Np have been measured, for the first time simultaneously in dedicated experiments, via the surrogate reactions 238U(3He, 4He and 238U(3He,d, respectively. While a good agreement between our data and neutron-induced data is found for fission probabilities, gamma decay probabilities are several times higher than the corresponding neutron-induced data for each studied nucleus. We study the role of the different spin distributions populated in the surrogate and neutron-induced reactions. The compound nucleus spin distribution populated in the surrogate reaction is extracted from the measured gamma-decay probabilities, and used as input parameter in the statistical model to predict fission probabilities to be compared to our data. A strong disagreement between our data and the prediction is obtained. Preliminary results from an additional dedicated experiment confirm the observed discrepancies, indicating the need of a better understanding of the formation and decay processes of the compound nucleus.

  20. The Synergistic Effect of Valsartan and LAF237 [(S-1-[(3-Hydroxy-1-AdamantylAmmo]acetyl-2-Cyanopyrrolidine] on Vascular Oxidative Stress and Inflammation in Type 2 Diabetic Mice

    Directory of Open Access Journals (Sweden)

    Min Shen

    2012-01-01

    Full Text Available Aim. To investigate the combination effects and mechanisms of valsartan (angiotensin II type 1 receptor blocker and LAF237 (DPP-IV inhibitor on prevention against oxidative stress and inflammation injury in db/db mice aorta. Methods. Db/db mice (n=40 were randomized to receive valsartan, LAF237, valsartan plus LAF237, or saline. Oxidative stress and inflammatory reaction in diabetic mice aorta were examined. Results. Valsartan or LAF237 pretreatment significantly increased plasma GLP-1 expression, reduced apoptosis of endothelial cells isolated from diabetic mice aorta. The expression of NAD(PH oxidase subunits also significantly decreased resulting in decreased superoxide production and ICAM-1 (fold change: valsartan : 7.5 ± 0.7, P<0.05; LAF237: 10.2 ± 1.7, P<0.05, VCAM-1 (fold change: valsartan : 5.2 ± 1.2, P<0.05; LAF237: 4.8 ± 0.6, P<0.05, and MCP-1 (fold change: valsartan: 3.2 ± 0.6, LAF237: 4.7 ± 0.8; P<0.05 expression. Moreover, the combination treatment with valsartan and LAF237 resulted in a more significant increase of GLP-1 expression. The decrease of the vascular oxidative stress and inflammation reaction was also higher than monotherapy with valsartan or LAF237. Conclusion. These data indicated that combination treatment with LAF237 and valsartan acts in a synergistic manner on vascular oxidative stress and inflammation in type 2 diabetic mice.

  1. Comment: 237 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available for Life Science licensed under CC Attribution2.1 Japan 絵や写真の投稿もできます。右は、没になったティラノザウルス(目がかわいい)です。 ttamura 2008/11/11 12:11:40 2011/09/14 21:10:36 ...

  2. The field migration tests of 237Np, 238Pu, 241Am and 90Sr in aerated loess, aquifer and engineering barrier materials

    International Nuclear Information System (INIS)

    Li Shushen; Wang Zhiming; Zhao Yingjie; Fan Zhiwen; Liu Chunli; An Yongfeng; Yang Yue'e; Wu Qinghua

    2003-01-01

    This paper introduces the field migration tests of 237 Np, 238 Pu, 241 Am and 90 Sr in aerated loess, aquifer and engineering barrier materials. The tests in the aerated loess and engineering barrier materials were carried out under both natural and artificial sprinkling (15 mm/d) conditions. The tests in aquifer were carried out in both assemblies packed with undisturbed aquifer media and a definite undisturbed area. The results indicate that after 3 years tests no significant migrations were seen for all nuclides in engineering barrier materials under two kinds of conditions and in aerated loess under natural conditions. For the aerated loess under artificial sprinkling conditions, 2.7 cm (center of mass) migration in the area directly below the sand tracer layer (named as area 1) and 13 cm (peak) migration in the area outside the area 1 for 90 Sr were observed; There was no migration for 237 Np, 238 Pu and 241 Am. It was discovered that the sand layer used as carrier of nuclide tracer has barrier effect on unsaturated water and an influence on nuclide migration. This has been demonstrated by the inter comparison experiment with both sand and loess as tracer carrier. In the tracer tests of undisturbed aquifer area there was no significant migration of 237 Np, 238 Pu, 241 Am and 90 Sr after 1023 days. In the assembly 8 there was no significant migration for 238 Pu and 241 Am and a small backward migration 0.95 cm for 237 Np and 4.7 cm migration (center of mass) for 90 Sr were observed. The tests also indicate that there is no significant difference of nuclide migration in ordinary and degraded cement

  3. Coulex fission of 234U, 235U, 237Np, and 238Np studied within the SOFIA experimental program

    International Nuclear Information System (INIS)

    Martin, Julie-Fiona

    2014-01-01

    SOFIA (Studies On FIssion with Aladin) is an experimental project which aims at systematically measuring the fission fragments' isotopic yields as well as their total kinetic energy, for a wide variety of fissioning nuclei. The PhD work presented in this dissertation takes part in the SOFIA project, and covers the fission of nuclei in the region of the actinides: 234 U, 235 U, 237 Np and 238 Np. The experiment is led at the heavy-ion accelerator GSI in Darmstadt, Germany. This facility provides intense relativistic primary beam of 238 U. A fragmentation reaction of the primary beam permits to create a secondary beam of radioactive ions, some of which the fission is studied. The ions of the secondary beam are sorted and identified through the FR-S (Fragment Separator), a high resolution recoil spectrometer which is tuned to select the ions of interest.The selected - fissile - ions then fly further to Cave-C, an experimental area where the fission experiment itself takes place. At the entrance of the cave, the secondary beam is excited by Coulomb interaction when flying through an target; the de-excitation process involves low-energy fission. Both fission fragments fly forward in the laboratory frame, due to the relativistic boost inferred from the fissioning nucleus.A complete recoil spectrometer has been designed and built by the SOFIA collaboration in the path of the fission fragments, around the existing ALADIN magnet. The identification of the fragments is performed by means of energy loss, time of flight and deviation in the magnet measurements. Both fission fragments are fully (in mass and charge) and simultaneously identified.This document reports on the analysis performed for (1) the identification of the fissioning system, (2) the identification of both fission fragments, on an event-by-event basis, and (3) the extraction of fission observables: yields, TKE, total prompt neutron multiplicity. These results, concerning the actinides, are discussed, and

  4. Preparation of protactinium measurement source by electroplating method

    International Nuclear Information System (INIS)

    Li Zongwei; Yang Weifan; Fang Keming; Yuan Shuanggui; Guo Junsheng; Pan Qiangyan

    1998-01-01

    An electroplating method for the preparation of Pa sources is described, and the main factors (such as pH value of solution, electroplating time and current density) influencing the electroplating of Pa are tested and discussed with 233 Pa as a tracer. A thin and uniform electroplating Pa-Layer of 1 mg/cm 2 thick on thin stainless steel disk was obtained. The Pa source was measured by a HPGe detector to determine the chemical efficiency

  5. Protactinium-231 found in natural thorium irradiated in JMTR

    International Nuclear Information System (INIS)

    Suzuki, Susumu; Mitsugashira, Toshiaki; Hara, Mitsuo; Satoh, Isamu; Shiokawa, Yoshinobu; Satoh, Michiko

    1987-01-01

    Natural thorium dioxides, which differed in the content of 230 Th, were irradiated in JMTR(Japan Material Testing Reactor). 232 U, 233 U, 231 Pa, 233 Pa, and remaining Th were measured radiometrically. High production of 231 Pa and high consumption of 230 Th were observed and it was necessary to assume large resonance capture of 230 Th in order to explain the production of 231 Pa and the consumption of 230 Th. (author)

  6. Probing the dynamic interface between trimethylamine dehydrogenase (TMADH) and electron transferring flavoprotein (ETF) in the TMADH-2ETF complex: role of the Arg-alpha237 (ETF) and Tyr-442 (TMADH) residue pair.

    Science.gov (United States)

    Burgess, Selena G; Messiha, Hanan Latif; Katona, Gergely; Rigby, Stephen E J; Leys, David; Scrutton, Nigel S

    2008-05-06

    We have used multiple solution state techniques and crystallographic analysis to investigate the importance of a putative transient interaction formed between Arg-alpha237 in electron transferring flavoprotein (ETF) and Tyr-442 in trimethylamine dehydrogenase (TMADH) in complex assembly, electron transfer, and structural imprinting of ETF by TMADH. We have isolated four mutant forms of ETF altered in the identity of the residue at position 237 (alphaR237A, alphaR237K, alphaR237C, and alphaR237E) and with each form studied electron transfer from TMADH to ETF, investigated the reduction potentials of the bound ETF cofactor, and analyzed complex formation. We show that mutation of Arg-alpha237 substantially destabilizes the semiquinone couple of the bound FAD and impedes electron transfer from TMADH to ETF. Crystallographic structures of the mutant ETF proteins indicate that mutation does not perturb the overall structure of ETF, but leads to disruption of an electrostatic network at an ETF domain boundary that likely affects the dynamic properties of ETF in the crystal and in solution. We show that Arg-alpha237 is required for TMADH to structurally imprint the as-purified semiquinone form of wild-type ETF and that the ability of TMADH to facilitate this structural reorganization is lost following (i) redox cycling of ETF, or simple conversion to the oxidized form, and (ii) mutagenesis of Arg-alpha237. We discuss this result in light of recent apparent conflict in the literature relating to the structural imprinting of wild-type ETF. Our studies support a mechanism of electron transfer by conformational sampling as advanced from our previous analysis of the crystal structure of the TMADH-2ETF complex [Leys, D. , Basran, J. , Sutcliffe, M. J., and Scrutton, N. S. (2003) Nature Struct. Biol. 10, 219-225] and point to a key role for the Tyr-442 (TMADH) and Arg-alpha237 (ETF) residue pair in transiently stabilizing productive electron transfer configurations. Our work

  7. Study of the hydrolysis of protactinium (V), at tracer scale, by solvent extraction method with thenoyl-tri-fluoro-acetone (TTA) as chelating agent. Characterization of the partition of TTA in the system TTA / H{sub 2}O / toluene / Na{sup +} / H{sup +} / ClO{sub 4}{sup -}; Contribution a l'etude thermodynamique de l'hydrolyse de Pa(V) a l'echelle des traces par la technique d'extraction liquide-liquide avec la thenoyltrifluoroacetone (TTA). Caracterisation du partage de la thenoyltrifluoroacetone dans le systeme TTA / H{sub 2}O / toluene / Na{sup +} / H{sup +} / ClO{sub 4}{sup -}

    Energy Technology Data Exchange (ETDEWEB)

    Jaussaud, Ch

    2003-01-01

    Hydrolysis of protactinium (V) according to the reactions: PaO(OH){sup 2+} +H{sub 2}O {r_reversible} PaO(OH){sub 2}{sup +} + H{sup +} (K{sub 2}] PaO(OH){sup 2+} +2H{sub 2}O {r_reversible} PaO(OH){sub 5} + H{sup +} (K{sub 3}) has been studied, at tracer scale, by solvent extraction method, with thenoyl-tri-fluoro-acetone (TTA) as chelating agent. A previous study concerning the partition of TTA between two immiscible phases (corresponding to TTA/toluene/Na{sup +}/H{sup +}/ClO{sub 4}{sup -} system) has allowed a complete characterization of this system (partition constants, standard thermodynamic values, TTA hydration degree in toluene). Owing to specific properties of protactinium (V) (sorption onto various materials, formation of colloids), an extremely rigorous protocol has been established, protocol which could be used for other hydrolysable elements. Hydrolysis constants were deduced from a systematic study of partition of Pa(V) as a function TTA and proton concentration, ionic strength and temperature. Extrapolations to zero ionic strength were performed using SIT model and the specific interaction coefficients {epsilon}{sub (i,j)} as well as the Pitzer parameters {beta}{sup (0)} and {beta}{sup (1)} were determined. Standard thermodynamic data relative to hydrolysis equilibriums of Pa(V) were also estimated. (author)

  8. Data Evaluation of Actinide Cross Sections: 238Pu, 237Pu, and 236Pu

    Energy Technology Data Exchange (ETDEWEB)

    Guaglioni, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Jurgenson, E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Descalle, M. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Thompson, I. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ormand, E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Escher, J. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Younes, W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Mattoon, C. M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Beck, B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Burke, J. T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bailey, T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-10-04

    This report documents the recent evaluation of the 236Pu, 237Pu, and 238Pu cross section sets. Nuclear data evaluation is the fundamental interface that takes measured nuclear cross section data and turns them into a continuous curve that 1) is consistent with other measurements and nuclear reaction theory/models, and 2) is required by down-stream users. All experiments that generate nuclear data need to include an evaluation step for their data to be broadly useful to the end users.

  9. The bioavailability of the transuranic elements 237Pu and 241Am for the pond snail, Lymnaea stagnalis L., and their behaviour in selected natural surface waters

    International Nuclear Information System (INIS)

    Thiels, G.M.

    1983-01-01

    An attempt was made to characterise the bioavailability of 237 Pu and 241 Am for the pond snail Lymnaea stagnalis L. in selected surface waters. The uptake, distribution and retention patterns were studied through the contamination route water-snail. The effects of a number of parameters, such as seasonal variation, water type (pH, conductivity, ionic composition) and presence of food, on the bioavailability of the transuranics were evaluated. Finally, an assessment was made concerning the chemical speciation of plutonium and americium in the selected freshwaters

  10. The evaluation of the 237Np fission cross section in the 20 KeV - 20 MeV energy range

    International Nuclear Information System (INIS)

    Dushin, V.N.; Kalinin, V.A.; Shpakov, V.I.

    1997-01-01

    The results of the development of nuclear data evaluation based on the generalized least squares method is presented. The method to interpolate experimental data measured at arbitrary energy points, and their transfer to a fixed energy grid is described. The results of the 237 Np fission cross section measurements performed until 1988 were critically analyzed. A 781 x 781 covariant matrix was derived from the correlation analysis of the experimental results. The results of the evaluation, and the associated correlation matrix was obtained using the generalized least square method. (author). 34 refs, 4 figs, 2 tabs

  11. Neutron induced fission cross sections for /sup 232/Th, /sup 235,238/U, /sup 237/Np and /sup 239/Pu from 1 to 400 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.

    1988-01-01

    Neutron-induced fission cross section ratios for samples of /sup 232/Th, /sup 235,238/U, /sup 237/Np and /sup 239/Pu have been measured from 1 to 400 MeV. The fission reaction rate was determined for all samples simultaneously using a fast parallel plate ionization chamber at a 20-m flight path. A well characterized annular proton recoil telescope was used to measure the neutron fluence up to 30 MeV. These data provided the shape of the /sup 235/U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known values were determined using the neutron fluence measured with a second proton recoil telescope. Cross section values for /sup 232/Th, /sup 238/U, /sup 237/Np, and /sup 239/Pu were computed from the ratio data using our values for /sup 235/U(n,f). In addition to providing new results at high neutron energies, these data resolve long standing discrepancies among different data sets. 1 ref., 1 fig.

  12. Adsorption-desorption characteristics of plutonium and americium with sediment particles in the estuarine environment: studies using plutonium-237 and americium-241

    International Nuclear Information System (INIS)

    Murray, C.N.; Fukai, R.

    1975-01-01

    The particle formation of plutonium and americium, their adsorption onto fresh water sediments and the desorption from the sediments in sea water were studied in the Laboratory under simulated river-estuary conditions, using γ-emitting plutonium-237 and americium-241. The results of the experiments show that the particle formation of plutonium depends on its valence states, on pH and on the salinity of the medium. For river water at pH4, some 25%, 20% and 30% of the added 237 Pu was in particulate form, larger than 0.45 μm, for Pu (III), Pu (IV) and Pu (VI), respectively, while 65%, 90% and 50% of the respective valence states was associated with particles at pH 8. In sea water the general pattern remains similar, although Pu (VI) is more soluble in sea water owing to higher ligand concentrations for carbonate and bicarbonate complexes. The pH-dependency of particle formation of Am (III) is more steep than that of plutonium and seems to be influenced by colloidal substances occurring in the experimental media. The adsorption-desorption characteristics of plutonium and americium with the sediment in river water as well as sea water reflect the characteristics of their particle formation, being dependent upon such properties as valence states, the pH and salinity of the medium. A sewage effluent added to the media has small but measurable effects on the adsorption-desorption processes of plutonium. (author)

  13. Standard practice for the determination of 237Np, 232Th, 235U and 238U in urine by inductively coupled plasma-Mass spectrometry (ICP-MS) and gamma ray spectrometry.

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2005-01-01

    1.1 This practice covers the separation and preconcentration of neptunium-237 (237Np), thorium-232 (232Th), uranium-235 (235U) and uranium-238 (238U) from urine followed by quantitation using ICP-MS. 1.2 This practice can be used to support routine bioassay programs. The minimum detectable concentrations (MDC) for this method, taking the preconcentration factor into account, are approximately 1E-2Bq for 237Np (0.38ng), 2E-6Bq for 232Th (0.50ng), 4E-5Bq for 235U (0.50ng) and 6E-6Bq for 238U (0.48ng). 1.3 This standard does not purport to address all of the safety problems, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  14. Transmutation of 129I and 237Np using spallation neutrons produced by 1.5, 3.7 and 7.4 GeV protons

    International Nuclear Information System (INIS)

    Ochs, M.; Schmidt, Th.; Wan, J.-S.

    1999-01-01

    Small samples of approximately 1 g of 129 I and 237 Np, two long-lived radioactive waste nuclides, were exposed to spallation neutron fluences from relatively small metal targets of lead or uranium, surrounded with a paraffin moderator 6 cm thick irradiated with 1.5, 3.7 and 7.4 GeV protons. The (n, γ) transmutation rates have been determined for the two radioactive waste nuclides. Conventional radiochemical La and U sensors and a variety of solid-state nuclear track detectors were irradiated simultaneously with secondary neutrons. The observed secondary neutron fluences appear to be systematically larger, as compared to the calculations with the well-known cascade codes (LAHET from Los Alamos and DCM-CEM from Dubna)

  15. Transmutation of 129I and 237Np using spallation neutrons produced by 1.5, 3.7 and 7.4 GeV protons

    International Nuclear Information System (INIS)

    Wan, J.-S.; Schmidt, T.Th.; Langrock, E.-J.; Vater, P.; Brandt, R.; Adam, J.; Bradnova, V.; Bamblevski, V.P.; Gelovani, L.; Gridnev, T.D.; Kalinnikov, V.G.; Krivopustov, M.I.; Kulakov, B.A.; Sosnin, A.N.; Perelygin, V.P.; Pronskikh, V.S.; Stegailov, V.I.; Tsoupko-Sitnikov, V.M.; Modolo, G.; Odoj, R.; Phlippen, P.-W.; Zamani-Valassiadou, M.; Adloff, J.C.; Debeauvais, M.; Hashemi-Nezhad, S.R.; Guo, S.-L.; Li, L.; Wang, Y.-L.; Dwivedi, K.K.; Zhuk, I.V.; Boulyga, S.F.; Lomonossova, E.M.; Kievitskaja, A.F.; Rakhno, I.L.; Chigrinov, S.E.; Wilson, W.B.

    2001-01-01

    Small samples of 129 I and 237 Np, two long-lived radwaste nuclides, were exposed to spallation neutron fluences from relatively small metal targets of lead and uranium, that were surrounded with a 6 cm thick paraffin moderator, and irradiated with 1.5, 3.7 and 7.4 GeV protons. The (n,γ) transmutation rates were determined for these nuclides. Conventional radiochemical La- and U-sensors and a variety of solid-state nuclear track detectors were irradiated simultaneously with secondary neutrons. Compared with results from calculations with well-known cascade codes (LAHET from Los Alamos and DCM/CEM from Dubna), the observed secondary neutron fluences are larger

  16. Transmutation of {sup 129}I and {sup 237}Np using spallation neutrons produced by 1.5, 3.7 and 7.4 GeV protons

    Energy Technology Data Exchange (ETDEWEB)

    Wan, J.-S.; Schmidt, T.Th.; Langrock, E.-J.; Vater, P.; Brandt, R. E-mail: brandtr@mailer.uni-marburg.de; Adam, J.; Bradnova, V.; Bamblevski, V.P.; Gelovani, L.; Gridnev, T.D.; Kalinnikov, V.G.; Krivopustov, M.I.; Kulakov, B.A.; Sosnin, A.N.; Perelygin, V.P.; Pronskikh, V.S.; Stegailov, V.I.; Tsoupko-Sitnikov, V.M.; Modolo, G.; Odoj, R.; Phlippen, P.-W.; Zamani-Valassiadou, M.; Adloff, J.C.; Debeauvais, M.; Hashemi-Nezhad, S.R.; Guo, S.-L.; Li, L.; Wang, Y.-L.; Dwivedi, K.K.; Zhuk, I.V.; Boulyga, S.F.; Lomonossova, E.M.; Kievitskaja, A.F.; Rakhno, I.L.; Chigrinov, S.E.; Wilson, W.B

    2001-05-11

    Small samples of {sup 129}I and {sup 237}Np, two long-lived radwaste nuclides, were exposed to spallation neutron fluences from relatively small metal targets of lead and uranium, that were surrounded with a 6 cm thick paraffin moderator, and irradiated with 1.5, 3.7 and 7.4 GeV protons. The (n,{gamma}) transmutation rates were determined for these nuclides. Conventional radiochemical La- and U-sensors and a variety of solid-state nuclear track detectors were irradiated simultaneously with secondary neutrons. Compared with results from calculations with well-known cascade codes (LAHET from Los Alamos and DCM/CEM from Dubna), the observed secondary neutron fluences are larger.

  17. Transmutation of 129I and 237Np using spallation neutrons produced by 1.5, 3.7 and 7.4 GeV protons

    Science.gov (United States)

    Wan, J.-S.; Schmidt, Th.; Langrock, E.-J.; Vater, P.; Brandt, R.; Adam, J.; Bradnova, V.; Bamblevski, V. P.; Gelovani, L.; Gridnev, T. D.; Kalinnikov, V. G.; Krivopustov, M. I.; Kulakov, B. A.; Sosnin, A. N.; Perelygin, V. P.; Pronskikh, V. S.; Stegailov, V. I.; Tsoupko-Sitnikov, V. M.; Modolo, G.; Odoj, R.; Phlippen, P.-W.; Zamani-Valassiadou, M.; Adloff, J. C.; Debeauvais, M.; Hashemi-Nezhad, S. R.; Guo, S.-L.; Li, L.; Wang, Y.-L.; Dwivedi, K. K.; Zhuk, I. V.; Boulyga, S. F.; Lomonossova, E. M.; Kievitskaja, A. F.; Rakhno, I. L.; Chigrinov, S. E.; Wilson, W. B.

    2001-05-01

    Small samples of 129I and 237Np, two long-lived radwaste nuclides, were exposed to spallation neutron fluences from relatively small metal targets of lead and uranium, that were surrounded with a 6 cm thick paraffin moderator, and irradiated with 1.5, 3.7 and 7.4 GeV protons. The (n,γ) transmutation rates were determined for these nuclides. Conventional radiochemical La- and U-sensors and a variety of solid-state nuclear track detectors were irradiated simultaneously with secondary neutrons. Compared with results from calculations with well-known cascade codes (LAHET from Los Alamos and DCM/CEM from Dubna), the observed secondary neutron fluences are larger.

  18. Neutron induced fission cross section ratios for 232Th, 235,238U, 237Np and 239Pu from 1 to 400 MeV

    International Nuclear Information System (INIS)

    Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.

    1988-01-01

    Time-of-flight measurements of neutron induced fission cross section ratios for 232 Th, 235,238 U, 237 Np, and 239 Pu, were performed using the WNR high intensity spallation neutron source located at Los Alamos National Laboratory. A multiple-plate gas ionization chamber located at a 20-m flight path was used to simultaneously measure the fission rate for all samples over the energy range from 1 to 400 MeV. Because the measurements were made with nearly identical neutron fluxes, we were able to cancel many systematic uncertainties present in previous measurements. This allows us to resolve discrepancies among different data sets. In addition, these are the first neutron-induced fission cross section values for most of the nuclei at energies above 30 MeV. (author)

  19. Neutron induced fission cross section ratios for 232Th, /sup 235,238/U, 237Np, and 239Pu from 1 to 400 MeV

    International Nuclear Information System (INIS)

    Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.

    1988-01-01

    Time-of-flight measurements of neutron induced fission cross section ratios for 232 Th, /sup 235,238/U, 237 Np, and 239 Pu, were performed using the WNR high intensity spallation neutron source located at Los Alamos National Laboratory. A multiple-plate gas ionization chamber located at a 20-m flight path was used to simultaneously measure the fission rate for all samples over the energy range from 1 to 400 MeV. Because the measurements were made with nearly identical neutron fluxes, we were able to cancel many systematic uncertainties present in previous measurements. This allows us to resolve discrepancies among different data sets. In addition, these are the first neutron-induced fission cross section values for most of the nuclei at energies above 30 MeV. 8 refs., 3 figs

  20. A correlation between isomer shifts of 237Np Moessbauer spectra and coordination numbers of Np atoms in neptunyl(V) compounds

    International Nuclear Information System (INIS)

    Saeki, M.; Nakada, M.; Nakamoto, T.; Yamashita, T.; Masaki, N.M.; Krot, N.N.

    1999-01-01

    Five neptunyl(V) compounds were synthesized and studied by 237 Np Moessbauer spectroscopy. The isomer shifts (δ) of the Moessbauer spectra ranged from -18.6 to -19.1 mm/s for the compounds with Np atoms surrounded by 7 oxygen atoms (coordination number (CN) 7). On the other hand, the larger value of δ was obtained for the compound with CN 8. From the comparison of the present results with those reported on neptunyl(V) and (VI) compounds, it is concluded that there is a correlation between the δ and the CN for neptunyl(V) compounds, and the distribution of δ is narrower for neptunyl(V) compounds than that of neptunyl(VI) compounds. (author)

  1. Evaluation of the 237Np neutron cross sections in the energy range from 10-5 eV to 5 MeV

    International Nuclear Information System (INIS)

    Derrien, H.; Fort, E.

    1979-01-01

    The 237 Np neutron cross-sections have been evaluated in the energy range from thermal to 5 MeV. A set of resonance parameters including a negative level, is recommanded after examination of the available experimental data. This set is used 1) to calculate the cross-sections from the thermal region to 150 ev, and 2) to provide the statistical parameters suitable to the calculations in the unresolved region. At higher energies, the transmission coefficients Te are calculated by the coupled channel optical model code ECIS. They are then used as input in the statistical model code FISINGA. The optical model parameters, including the deformation parameters, are those used by Lagrange for the Pu isotopes, slightly modified to reproduce at 40 KeV the total cross-sections obtained from the pure statistical parameters. The recommendations of Lynn concerning the level density parameters have been used. In this paper we describe the various steps of the evaluation

  2. Absolute and relative cross section measurements of 237Np(n,f and 238U(n,f at the National Physical Laboratory

    Directory of Open Access Journals (Sweden)

    Salvador-Castiñeira Paula

    2017-01-01

    Full Text Available Cross section measurements in the fast energy region are being demanded as one of the key ingredients for modelling Generation-IV nuclear power plants. However, in facilities where there are no time-of-flight possibilities or it is not convenient to use them, using the 235U(n,f cross section as a benchmark would require a careful knowledge of the room scatter in the experimental area. In this paper we present measurements of two threshold reactions, 238U(n,f and 237Np(n,f, that could become a standard between their fission threshold and 2.5 MeV, if the discrepancies shown in the evaluations and in some experimental data can be solved. The preliminary results are in agreement with the present ENDF/B-VII.1 evaluation.

  3. Poor adherence to medication as assessed by the Morisky Medication Adherence Scale-8 and low satisfaction with treatment in 237 psoriasis patients.

    Science.gov (United States)

    Saeki, Hidehisa; Imafuku, Shinichi; Abe, Masatoshi; Shintani, Yoichi; Onozuka, Daisuke; Hagihara, Akihito; Katoh, Norito; Murota, Hiroyuki; Takeuchi, Satoshi; Sugaya, Makoto; Tanioka, Miki; Kaneko, Sakae; Masuda, Koji; Hiragun, Takaaki; Inomata, Naoko; Kitami, Yuki; Tsunemi, Yuichiro; Abe, Shinya; Kobayashi, Miwa; Morisky, Donald E; Furue, Masutaka

    2015-04-01

    Previously we assessed the medication adherence for oral and topical remedies by a translated Japanese version of the Morisky Medication Adherence Scale-8 (MMAS-8) together with socioeconomic backgrounds in 3096 Japanese dermatological patients, and found the medication adherence, especially to topical drugs, was poor in these patients. In order to elucidate the disease-specific sociomedical factors, we further sub-analyzed the medication adherence in 237 psoriasis patients and compared it with that in other dermatological diseases such as atopic dermatitis, urticaria or tinea. This study was conducted among patients registered in monitoring system and 3096 eligible patients were enrolled. Our web-based questionnaire included the following items such as age, sex, annual income, main health-care institution, experience of effectiveness by oral or topical medication, overall satisfaction with treatment, and MMAS-8 for oral or topical medication. Mean adherence score by MMAS-8 was 5.2 for oral and 4.3 for topical medication. More patients with psoriasis used a university hospital and fewer used a private clinic compared with those with the other skin disease patients. Experience of drug effectiveness by oral medication and overall satisfaction with treatment was lower in psoriasis patients than in other patients. In oral medication, significantly better adherence was observed in those of higher age and with higher annual income. The adherence to medication, especially to topical drugs, was poor in 237 psoriasis patients. We speculated that some severe psoriasis patients were not sufficiently treated systemically and were resistant to topical therapy, leading to poor adherence. © 2015 Japanese Dermatological Association.

  4. Capture and Fission rate of 232-Th, 238-U, 237-Np and 239-Pu from spallation neutrons in a huge block of lead.

    CERN Document Server

    Vlachoudis, Vasilis

    2000-01-01

    The study is centered on the research of the incineration possibility of nuclear waste, by the association of a particle accelerator with a multiplying medium of neutrons, in the project "Energy Amplifier" of C. Rubbia. It consists of the experimental determination of the rates of capture and fission of certain elements (232-Th, 238-U, 237-Np and 239-Pu) subjected to a fluence of fast spallation neutrons. These neutrons are produced by the interaction of high kinetic energy protons (several GeV) provided by the CERN-PS accelerator, on a large lead solid volume. The measurement techniques used in this work, are based on the activation of elements in the lead volume and the subsequent gamma spectroscopy of the activated elements, and also by the detection of fission fragment traces. The development, of a Monte Carlo code makes it possible, on one hand, to better understand the relevant processes, and on the other hand, to validate the code, by comparison with measurements, for the design and the construction of...

  5. Criticality Data for Spherical 235U, 239Pu, and 237Np Systems Reflector-Moderated by Low Capturing-Moderator Materials

    International Nuclear Information System (INIS)

    Loaiza, David J.; Stratton, William

    2004-01-01

    The critical dimensions of spherical systems moderated and reflected by low-capturing materials such as D 2 O, BeO, Be, and C were investigated. A parametric study of the critical mass of enriched uranium, plutonium, and neptunium is examined and tabulated. The results obtained expand on the understanding of reflector-moderated critical systems, and they show regions of unstable criticality for 235 U and 239 Pu reflected cores at intermediate densities. This instability is illustrated by calculations of the positive reactivity coefficient of volume expansion. The coefficient is positive, not negative, in the intermediate density region for 235 U and 239 Pu systems. For 237 Np cores reflected by the same moderator, the effect is negligible. The critical dimensions were calculated with the DANTSYS codes using the Hansen-Roach cross-section libraries. This study is both a summary of mostly unpublished calculations and new calculations. Experimental data for these configurations are extremely limited. These are examined in the text when applicable

  6. Accurate 238U(n , 2 n )237U reaction cross-section measurements from 6.5 to 14.8 MeV

    Science.gov (United States)

    Krishichayan, Bhike, M.; Tornow, W.; Tonchev, A. P.; Kawano, T.

    2017-10-01

    The cross section for the 238U(n ,2 n )237U reaction has been measured in the incident neutron energy range from 6.5 to 14.8 MeV in small energy steps using an activation technique. Monoenergetic neutron beams were produced via the 2H(d ,n )3He and 3H(d ,n )4He reactions. 238U targets were activated along with Au and Al monitor foils to determine the incident neutron flux. The activity of the reaction products was measured in TUNL's low-background counting facility using high-resolution γ -ray spectroscopy. The results are compared with previous measurements and latest data evaluations. Statistical-model calculations, based on the Hauser-Feshbach formalism, have been carried out using the CoH3 code and are compared with the experimental results. The present self-consistent and high-quality data are important for stockpile stewardship and nuclear forensic purposes as well as for the design and operation of fast reactors.

  7. Elastic and Raman scattering of 8.5-11.4 MeV photons from 159Tb, 165Ho, and 237Np

    International Nuclear Information System (INIS)

    Bar-Noy, T.; Moreh, R.

    1977-01-01

    Differential cross sections for elastic and inelastic Raman scattering from the deformed heavy nuclei 159 Tb, 165 Ho and 237 Np were measured at five energies between 8.5 and 11.4 MeV. Angular distributions at four angles between 90 0 and 140 0 for both elastic and inelastic scattering at 9.0 and 11.4 MeV were also measured. The monoenergetic photons were obtained from thermal neutron capture in Ni and Cr. All the angular distributions and the elastic and Raman scattering at the higher energies are in good overall agreement with theoretical predictions. The theory is based on a modified simple rotator model of the giant resonance in which the effect of Delbrueck scattering was included. A trend of both the elastic and Raman scattering at lower energies to be stronger than expected are suggested by the data. However, the ratio between the Raman and elastic scattering seem to be in good agreement with theory throughout the whole energy range. This shows that there is no need to introduce a direct nonresonant component to the imaginary part of the elastic scattering amplitude to explain the experimental data. (Auth.)

  8. Determination of neutron resonance parameters of Neptunium 237 between 0 and 500 eV. The covariance matrices of statistical and of systematic origin, relating the resonance parameters, are also given; Determination des parametres des resonances neutroniques du neptunium 237, en dessous de 500eV, et obtention des matrices de covariances statistiques et systematiques entre les parametres de ces resonances

    Energy Technology Data Exchange (ETDEWEB)

    Lepretre, A.; Herault, N. [CEA Saclay, Dept. d' Astrophysique de Physique des Particules, de Physique Nucleaire et de l' Instrumentation Associee, 91- Gif sur Yvette (France); Brusegan, A.; Noguere, G.; Siegler, P. [Institut des Materiaux et des Metrologies - IRMM, Joint Research Centre, Gell (Belgium)

    2002-12-01

    This report is a follow up of the report CEA DAPNIA/SPHN-99-04T of Vincent Gressier. In the frame of a collaboration between the 'Commissariat a l'Energie Atomique (CEA)' and the Institute for Reference Materials and Measurement (IRMM, Geel, Belgique), the resonance parameters of neptunium 237 have been determined in the energy interval between 0 and 500 eV. These parameters have been obtained by using the Refit code in analysing simultaneously three transmission experiments. The covariance matrix of statistical origin is provided. A new method, based on various sensitivity studies is proposed for determining also the covariance matrix of systematic origin, relating the resonance parameters. From an experimental viewpoint, the study indicated that, with a large probability, the background spectrum has structure. A two dimensional profiler for the neutron density has been proved feasible. Such a profiler could, among others, demonstrate the existence of the structured background. (authors)

  9. Study of the excited levels of 233{sup P}a by the 237{sup N}p alpha decay; Estudio de los niveles excitados en el 233{sup P}a por la desintegracion alfa del 237{sup N}p

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez, J; Gaeta, R; Vano, E; Los Arcos, J M

    1978-07-01

    The excited levels in 233{sup P}a following the 237{sup N}p alpha decay have been studied, by performing different experiences to complete available data and supply new information. Thus, two direct alpha spectrum measurement, one alpha-gamma bidimensional coincidence experiment, three gamma-gamma and gamma-X ray coincidences and some other measurements of the gamma spectrum, direct and coincident with alpha-particles have been made. These last experiences have allowed to obviate usual radiochemical separation methods, the 233{sup P}a radioactive descendent interferences being eliminated by means of the coincidence technic. As a result, a primary decay scheme has been elaborated, including 15 new gamma transitions and two new levels, not observed in the most recent works. (Author) 60 refs.

  10. 234 - 237_Uduma_Elementall

    African Journals Online (AJOL)

    pc

    risks from exposure to geological materials associa with mining ... alue both to the mining industry and to the health of the commun cal exploitation ... ent production, ceramics petroleum .... controls can minimize exposures to workers and.

  11. The Effect of Radiation Dose and Chemotherapy on Overall Survival in 237 Patients With Stage III Non-Small-Cell Lung Cancer

    International Nuclear Information System (INIS)

    Wang Li; Correa, Candace R.; Zhao Lujun; Hayman, James; Kalemkerian, Gregory P.; Lyons, Susan; Cease, Kemp; Brenner, Dean; Kong Fengming

    2009-01-01

    Purpose: To study the effects of radiation dose, chemotherapy, and their interaction in patients with unresectable or medically inoperable Stage III non-small-cell lung cancer (NSCLC). Methods and Materials: A total of 237 consecutive Stage III NSCLC patients were evaluated. Median follow-up was 69.0 months. Patients were treated with radiation therapy (RT) alone (n = 106), sequential chemoradiation (n = 69), or concurrent chemoradiation (n = 62). The primary endpoint was overall survival (OS). Radiation dose ranged from 30 to 102.9 Gy (median 60 Gy), corresponding to a bioequivalent dose (BED) of 39 to 124.5 Gy (median 72 Gy). Results: The median OS of the entire cohort was 12.6 months, and 2- and 5-year survival rates were 22.4% and 10.0%, respectively. Multivariable Cox regression model demonstrated that Karnofsky performance status (p = 0.020), weight loss < 5% (p = 0.017), chemotherapy (yes vs. no), sequence of chemoradiation (sequential vs. concurrent; p < 0.001), and BED (p < 0.001) were significant predictors of OS. For patients treated with RT alone, sequential chemoradiation, and concurrent chemoradiation, median survival was 7.4, 14.9, and 15.8 months, and 5-year OS was 3.3%, 7.5%, and 19.4%, respectively (p < 0.001). The effect of higher radiation doses on survival was independent of whether chemotherapy was given. Conclusion: Radiation dose and use of chemotherapy are independent predictors of OS in Stage III NSCLC, and concurrent chemoradiation is associated with the best survival. There is no interaction between RT dose and chemotherapy.

  12. Theoretical analyses of (n,xn) reactions on sup 235 U, sup 238 U, sup 237 Np, and sup 239 Pu for ENDF/B-VI

    Energy Technology Data Exchange (ETDEWEB)

    Young, P.G.; Arthur, E.D.

    1991-01-01

    Theoretical analyses were performed of neutron-induced reactions on {sup 235}U, {sup 238}U, {sup 237}Np, and {sup 239}Pu between 0.01 and 20 MeV in order to calculate neutron emission cross sections and spectra for ENDF/B-VI evaluations. Coupled-channel optical model potentials were obtained for each target nucleus by fitting total, elastic, and inelastic scattering cross section data, as well as low-energy average resonance data. The resulting deformed optical model potentials were used to calculate direct (n,n{prime}) cross sections and transmission coefficients for use in Hauser-Feshbach statistical theory analyses. A fission model with multiple barrier representation, width fluctuation corrections, and preequilibrium corrections were included in the analyses. Direct cross sections for higher-lying vibrational states were calculated using DWBA theory, normalized using B(E{ell}) values determined from (d,d{prime}) and Coulomb excitation data, where available, and from systematics otherwise. Initial fission barrier parameters and transition state density enhancements appropriate to the compound systems involved were obtained from previous analyses, especially fits to charged-particle fission probability data. The parameters for the fission model were adjusted for each target system to obtain optimum agreement with direct (n,f) cross section measurements, taking account of the various multichance fission channels, that is, the different compound systems involved. The results from these analyses were used to calculate most of the neutron (n,n), (n,n{prime}), and (n,xn) cross section data in the ENDF/B/VI evaluations for the above nuclei, and all of the energy-angle correlated spectra. The deformed optical model and fission model parameterizations are described. Comparisons are given between the results of these analyses and the previous ENDF/B-V evaluations as well as with the available experimental data. 14 refs., 3 figs., 1 tab.

  13. Evaluation and improvement of cross section accuracy for most important dosimetry reactions 27Al(n,p), 56Fe(n,p) and 237Np(n,f) including covariance data

    International Nuclear Information System (INIS)

    Zolotarev, K.I.

    2004-02-01

    New evaluations of cross sections and their uncertainties for dosimetry reactions 27 Al(n,p) , 56 Fe(n,p) and 237 Np(n,f) have been carried out in the frame work of IAEA Research Contract No. 11372/RB. Data files prepared for this reactions in the ENDF-6 format may be consider as candidates for the new International Reactor Dosimetry File: IRDF-2002. (author)

  14. Evaluation and improvement of cross section accuracy for most important dosimetry reactions 27Al(n,p), 56Fe(n,p) and 237Np(n,f) including covariance data

    Energy Technology Data Exchange (ETDEWEB)

    Zolotarev, K I [Institute of Physics and Power Engineering, Obninsk (Russian Federation)

    2004-02-01

    New evaluations of cross sections and their uncertainties for dosimetry reactions {sup 27}Al(n,p) , {sup 56}Fe(n,p) and {sup 237}Np(n,f) have been carried out in the frame work of IAEA Research Contract No. 11372/RB. Data files prepared for this reactions in the ENDF-6 format may be consider as candidates for the new International Reactor Dosimetry File: IRDF-2002. (author)

  15. Prevalence, distribution and functional significance of the -237C to T polymorphism in the IL-12Rβ2 promoter in Indian tuberculosis patients.

    Directory of Open Access Journals (Sweden)

    Vikas Kumar Verma

    Full Text Available Cytokine/cytokine receptor gene polymorphisms related to structure/expression could impact immune response. Hence, the -237 polymorphic site in the 5' promoter region of the IL-12Rβ2 (SNP ID: rs11810249 gene associated with the AP-4 transcription motif GAGCTG, was examined. Amplicons encompassing the polymorphism were generated from 46 pulmonary tuberculosis patients, 35 family contacts and 28 miscellaneous volunteers and sequenced. The C allele predominated among patients, (93.4%, 43/46, and in all volunteers and contacts screened, but the T allele was exclusively limited to patients, (6.5%, 3/46. The functional impact of this polymorphism on transcriptional activity was assessed by Luciferase-reporter and electrophoretic mobility shift assays (EMSA. Luciferase-reporter assays showed a significant reduction in transcriptional efficiency with T compared to C allele. The reduction in transcriptional efficiency with the T allele construct (pGIL-12Rb2-T, in U-87MG, THP-1 and Jurkat cell lines, were 53, 37.6, and 49.8% respectively, compared to the C allele construct (pGIL-12Rb2-C. Similarly, densitometric analysis of the EMSA assay showed reduced binding of the AP-4 transcription factor, to T compared to the C nucleotide probe. Reduced mRNA expression in all patients (3/3 harboring the T allele was seen, whereas individuals with the C allele exhibited high mRNA expression (17/25; 68%, p = 0.05. These observations were in agreement with the in vitro assessment of the promoter activity by Luciferase-reporter and EMSA assays. The reduced expression of IL-12Rβ2 transcripts in 8 patients despite having the C allele was attributed to the predominant over expression of the suppressors (IL-4 and GATA-3 and reduced expression of enhancers (IFN-α of IL-12Rβ2 transcripts. The 17 high IL-12Rβ2 mRNA expressers had significantly elevated IFN-α mRNA levels compared to low expressers and volunteers. Notwithstanding the presence of high levels of IL-12R

  16. Measurement of neutron-induced fission cross-sections of Th232, U238, U233 and Np237 relative to U235 from 1 MeV to 200 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Shcherbakov, O.A.; Laptev, A.B.; Petrov, G.A. [Petersburg Nuclear Physics Inst., Gatchina, Leningrad district (Russian Federation); Fomichev, A.V.; Donets, A.Y.; Osetrov, O.I.

    1998-11-01

    The measurements of neutron-induced cross-section ratios for Th232, U238, U233 and Np237 relative to U235 have been carried out in the energy range from 1 MeV up to 200 MeV using the neutron time-of-flight spectrometer GNEIS based on 1 GeV proton synchrocyclotron. Below 20 MeV, the results of present measurements are roughly in agreement with evaluated data though there are some discrepances to be resolved. (author)

  17. 16 CFR 23.7 - Misuse of the words “platinum,” “iridium,” “palladium,” “ruthenium,” “rhodium,” and “osmium.”

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Misuse of the words âplatinum,â âiridium,â... § 23.7 Misuse of the words “platinum,” “iridium,” “palladium,” “ruthenium,” “rhodium,” and “osmium.” (a) It is unfair or deceptive to use the words “platinum,” “iridium,” “palladium,” “ruthenium,” “rhodium...

  18. Measurement of the Neutron Capture Cross Sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm with a Total Absorption Calorimeter at n_TOF

    CERN Multimedia

    Beer, H; Wiescher, M; Cox, J; Rapp, W; Embid, M; Dababneh, S

    2002-01-01

    Accurate and reliable neutron capture cross section data for actinides are necessary for the poper design, safety regulation and precise performance assessment of transmutation devices such as Fast Critical Reactors or Accelerator Driven Systems (ADS). The goal of this proposal is the measurement of the neutron capture cross sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm at n_TOF with an accuracy of 5~\\%. $^{233}$U plays an essential role in the Th fuel cycle, which has been proposed as a safer and cleaner alternative to the U fuel cycle. The capture cross sections of $^{237}$Np,$^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm play a key role in the design and optimization of a strategy for the Nuclear Waste Transmutation. A high accuracy can be achieved at n_TOF in such measurements due to a combination of features unique in the world: high instantaneous neutron fluence and excellent energy resolution of the facility, innovative Data Acquisition System based on flash ADCs and t...

  19. The fission cross sections of 230Th, 232Th, 233U, 234U, 236U, 238U, 237Np, 239Pu and 242Pu relative 235U at 14.74 MeV neutron energy

    International Nuclear Information System (INIS)

    Meadows, J.W.

    1986-12-01

    The measurement of the fission cross section ratios of nine isotopes relative to 235 U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for 235 U are: 230 Th - 0.290 +- 1.9%; 232 Th - 0.191 +- 1.9%; 233 U - 1.132 +- 0.7%; 234 U - 0.998 +- 1.0%; 236 U - 0.791 +- 1.1%; 238 U - 0.587 +- 1.1%; 237 Np - 1.060 +- 1.4%; 239 Pu - 1.152 +- 1.1%; 242 Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs

  20. Determination of neutron resonance parameters of Neptunium 237 between 0 and 500 eV. The covariance matrices of statistical and of systematic origin, relating the resonance parameters, are also given

    International Nuclear Information System (INIS)

    Lepretre, A.; Herault, N.; Brusegan, A.; Noguere, G.; Siegler, P.

    2002-12-01

    This report is a follow up of the report CEA DAPNIA/SPHN-99-04T of Vincent Gressier. In the frame of a collaboration between the 'Commissariat a l'Energie Atomique (CEA)' and the Institute for Reference Materials and Measurement (IRMM, Geel, Belgique), the resonance parameters of neptunium 237 have been determined in the energy interval between 0 and 500 eV. These parameters have been obtained by using the Refit code in analysing simultaneously three transmission experiments. The covariance matrix of statistical origin is provided. A new method, based on various sensitivity studies is proposed for determining also the covariance matrix of systematic origin, relating the resonance parameters. From an experimental viewpoint, the study indicated that, with a large probability, the background spectrum has structure. A two dimensional profiler for the neutron density has been proved feasible. Such a profiler could, among others, demonstrate the existence of the structured background. (authors)

  1. Neutron induced fission cross section ratios for /sup 232/Th, /sup 235,238/U, /sup 237/Np, and /sup 239/Pu from 1 to 400 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Lisowski, P.W.; Ullmann, J.L.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.

    1988-01-01

    Time-of-flight measurements of neutron induced fission cross section ratios for /sup 232/Th, /sup 235,238/U, /sup 237/Np, and /sup 239/Pu, were performed using the WNR high intensity spallation neutron source located at Los Alamos National Laboratory. A multiple-plate gas ionization chamber located at a 20-m flight path was used to simultaneously measure the fission rate for all samples over the energy range from 1 to 400 MeV. Because the measurements were made with nearly identical neutron fluxes, we were able to cancel many systematic uncertainties present in previous measurements. This allows us to resolve discrepancies among different data sets. In addition, these are the first neutron-induced fission cross section values for most of the nuclei at energies above 30 MeV. 8 refs., 3 figs.

  2. Wind-tunnel investigation of longitudinal and lateral-directional stability and control characteristics of a 0.237-scale model of a remotely piloted research vehicle with a thick, high-aspect-ratio supercritical wing

    Science.gov (United States)

    Byrdsong, T. A.; Brooks, C. W., Jr.

    1980-01-01

    A 0.237-scale model of a remotely piloted research vehicle equipped with a thick, high-aspect-ratio supercritical wing was tested in the Langley 8-foot transonic tunnel to provide experimental data for a prediction of the static stability and control characteristics of the research vehicle as well as to provide an estimate of vehicle flight characteristics for a computer simulation program used in the planning and execution of specific flight-research mission. Data were obtained at a Reynolds number of 16.5 x 10 to the 6th power per meter for Mach numbers up to 0.92. The results indicate regions of longitudinal instability; however, an adequate margin of longitudinal stability exists at a selected cruise condition. Satisfactory effectiveness of pitch, roll, and yaw control was also demonstrated.

  3. Investigation of Neutron Spectra and Transmutation of ^{129}I, ^{237}Np and Other Nuclides with 1.5 GeV Protons from the Dubna Nuclotron Using the Electronuclear Setup "Energy plus Transmutation"

    CERN Document Server

    Krivopustov, M I; Balabekyan, A R; Batusov, Yu A; Bielewicz, M; Brandt, R; Chaloun, P; Chultem, D; Dwivedi, K K; Elishev, A F; Fragopoulou, M; Henzl, V; Henzlová, D; Kalinnikov, V G; Kievets, M K; Krása, A; Krizek, F; Kugler, A; Manolopoulou, Metaxia; Mariin, I I; Nourreddine, A; Odoj, R; Pavliouk, A V; Pronskikh, V S; Robotham, H; Siemon, K; Szuta, M; Stegailov, V I; Solnyshkin, A A; Sosnin, A N; Stoulos, S; Tsoupko-Sitnikov, V M; Tumendelger, T; Wojecehowski, A; Wagner, V; Wan, J S; Westmeier, W; Zamani-Valasiadou, M; Kumawat, H; Kumar, V; Zaverioukha, O S; Zhuk, I V

    2004-01-01

    Experiments which are part of the scientific program "Investigations of physical aspects of electronuclear method of energy production and transmutation for radioactive waste of atomic energetics using relativistic beams from the JINR Synchrophasotron/Nuclotron" (project "Energy plus Transmutation") are described. A large lead target surrounded by a four-section uranium blanket with total weight of 206.4 kg natural uranium was irradiated with 1.5 GeV protons from the new cryogenic accelerator Nuclotron. Radiochemical sensors were exposed to the secondary particle fluences inside and on top of the target assembly. Two long-lived radioactive waste of atomic energetics sensors ^{129}I and ^{237}Np (approximately 1 g weight each) and stable nuclides ^{27}Al, ^{59}Co, ^{127}I, ^{139}La, ^{197}Au and ^{209}Bi as well as natural and enriched uranium were used. In addition, various solid state nuclear track detectors and nuclear emulsions were exposed simultaneously. The experimental results confirm the theoretical e...

  4. Modelling the effect of boundary scavenging on Thorium and Protactinium profiles in the ocean

    International Nuclear Information System (INIS)

    Roy-Barman, M.

    2009-01-01

    The 'boundary scavenging' box model is a cornerstone of our understanding of the particle-reactive radionuclide fluxes between the open ocean and the ocean margins. However, it does not describe the radionuclide profiles in the water column. Here, I present the transport-reaction equations for radionuclides transported vertically by reversible scavenging on settling particles and laterally by horizontal currents between the margin and the open ocean. Analytical solutions of these equations are compared with existing data. In the Pacific Ocean, the model produces 'almost' linear 230 Th profiles (as observed in the data) despite lateral transport. However, omitting lateral transport biases the 230 Th based particle flux estimates by as much as 50%. 231 Pa profiles are well reproduced in the whole water column of the Pacific Margin and from the surface down to 3000 m in the Pacific subtropical gyre. Enhanced bottom scavenging or inflow of 231 Pa-poor equatorial water may account for the model-data discrepancy below 3000 m. The lithogenic 232 Th is modelled using the same transport parameters as 230 Th but a different source function. The main source of the 232 Th scavenged in the open Pacific is advection from the ocean margin, whereas a net flux of 230 Th produced in the open Pacific is advected and scavenged at the margin, illustrating boundary exchange. In the Arctic Ocean, the model reproduces 230 Th measured profiles that the uni-dimensional scavenging model or the scavenging-ventilation model failed to explain. Moreover, if lateral transport is ignored, the 230 Th based particle settling speed may by underestimated by a factor 4 at the Arctic Ocean margin. The very low scavenging rate in the open Arctic Ocean combined with the enhanced scavenging at the margin accounts for the lack of high 231 Pa/ 230 Th ratio in arctic sediments. (authors)

  5. Modelling the effect of boundary scavenging on Thorium and Protactinium profiles in the ocean

    Directory of Open Access Journals (Sweden)

    M. Roy-Barman

    2009-12-01

    Full Text Available The "boundary scavenging" box model is a cornerstone of our understanding of the particle-reactive radionuclide fluxes between the open ocean and the ocean margins. However, it does not describe the radionuclide profiles in the water column. Here, I present the transport-reaction equations for radionuclides transported vertically by reversible scavenging on settling particles and laterally by horizontal currents between the margin and the open ocean. Analytical solutions of these equations are compared with existing data. In the Pacific Ocean, the model produces "almost" linear 230Th profiles (as observed in the data despite lateral transport. However, omitting lateral transport biaises the 230Th based particle flux estimates by as much as 50%. 231Pa profiles are well reproduced in the whole water column of the Pacific Margin and from the surface down to 3000 m in the Pacific subtropical gyre. Enhanced bottom scavenging or inflow of 231Pa-poor equatorial water may account for the model-data discrepancy below 3000 m. The lithogenic 232Th is modelled using the same transport parameters as 230Th but a different source function. The main source of the 232Th scavenged in the open Pacific is advection from the ocean margin, whereas a net flux of 230Th produced in the open Pacific is advected and scavenged at the margin, illustrating boundary exchange. In the Arctic Ocean, the model reproduces 230Th measured profiles that the uni-dimensional scavenging model or the scavenging-ventilation model failed to explain. Moreover, if lateral transport is ignored, the 230Th based particle settling speed may by underestimated by a factor 4 at the Arctic Ocean margin. The very low scavenging rate in the open Arctic Ocean combined with the enhanced scavenging at the margin accounts for the lack of high 231Pa/230Th ratio in arctic sediments.

  6. About the first experiment on investigation of 129I, 237Np, 238Pu and 239Pu transmutation at the nuclotron 2.52 GeV deuteron beam in neutron field generated in U/Pb-assembly 'Energy plus transmutation'

    International Nuclear Information System (INIS)

    Krivopustov, M.I.; Pavliouk, A.V.; Malakhov, A.I.

    2008-01-01

    Preliminary results of the first experiment with energy 2.52 GeV at the electronuclear setup which consists of Pb-target (diameter 8.4 cm, length 45.6 cm) and nat U-blanket (206.4 kg), transmutation samples of 129 I, 237 Np, 238 Pu and 239 Pu (radioecological aspect) are described. Hermetically sealed samples in notable amounts are gathered in atomic reactors and setups of industries which use nuclear materials and nuclear technologies were irradiated in the field of neutrons produced in the Pb-target and propagated in the nat U-blanket. Estimates of transmutations were obtained as a result of measurements of gamma activities of the samples. The information about the space and energy distribution of neutrons in the volume of the lead target and the uranium blanket was obtained with the help of sets of activation threshold detectors (Al, Co, Y, I, Au, Bi and others), solid-state nuclear track detectors, 3 He neutron detectors and nuclear emulsion. Comparison of the experimental data with the results of simulation with the MCNPX program was performed

  7. 237 MORAL AND PSYCHOLOGICAL FILICIDE: EXAMINING THE ...

    African Journals Online (AJOL)

    Fr. Ikenga

    Nigerian campuses of higher learning or the like that engage in sex for .... children and causing various risks to the child safety… ... their babies with them for up to 18months gives room for bonding of mother and child, .... be likely to adversely affect his physical, mental, spiritual, moral or social development or employed as.

  8. 33 CFR 117.237 - Christina River.

    Science.gov (United States)

    2010-07-01

    ... five short blasts, and an audio voice warning stating, “Attention, Attention. Norfolk Southern Railroad... infrared detectors, until green lights are displayed on the swing span. (c) The draw of the Third Street...

  9. TMFunction data: 237 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available HC. J Biol Chem. 2000 Jul 14;275(28):21017-24 mutagenesis ... affinity chromatography 1AJJ ... LDLR_HUMAN (P01130) Helix ... ligand binding site; surface exposed; acidic residue; conserved

  10. 237 MORAL AND PSYCHOLOGICAL FILICIDE: EXAMINING THE ...

    African Journals Online (AJOL)

    Fr. Ikenga

    no good hospital, employment opportunity or social infrastructure and where poverty level is over. 300%, how will you expect a family to reject the gains from anti-social ..... Likewise, every child has the right to maintenance by his parents or guardians in accordance with the extent of their means, and the child has the right, ...

  11. Publications | Page 237 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... the agro-pastoral systems of Tanzania : a gendered analysis (open access) ... This paper deals with the ways in which gender and caste identities marginalise particular groups from access to water in a village in periurban Hyderabad, India.

  12. 48 CFR 237.7301 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... means any public or private post-secondary school, junior college, college, university, or other degree... of study at any level beyond high school. (b) Nonprofit organization means any organization described... good standing in a curriculum designed to lead to the granting of a recognized degree, during the term...

  13. Publications | Page 237 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... we aim to widen the impact of our investment and advance development research. ... from place to place; this is mainly due to social and economic influences. ... with reference to specific technologies: the computer and the cell phone.

  14. 50 CFR 648.237 - Framework provisions.

    Science.gov (United States)

    2010-10-01

    ... Committee composition and process; description and identification of essential fish habitat; description and identification of habitat areas of particular concern; overfishing definition and related thresholds and targets... measures must come from one or more of the following categories: Minimum fish size; maximum fish size; gear...

  15. Human Leukocyte Antigen-A, B, C, DRB1, and DQB1 Allele and Haplotype Frequencies in a Subset of 237 Donors in the South African Bone Marrow Registry

    Directory of Open Access Journals (Sweden)

    Mqondisi Tshabalala

    2018-01-01

    Full Text Available Human leukocyte antigen- (HLA- A, HLA-B, HLA-C, HLA-DRB1, and HLA-DQB1 allele and haplotype frequencies were studied in a subset of 237 volunteer bone marrow donors registered at the South African Bone Marrow Registry (SABMR. Hapl-o-Mat software was used to compute allele and haplotype frequencies from individuals typed at various resolutions, with some alleles in multiple allele code (MAC format. Four hundred and thirty-eight HLA-A, 235 HLA-B, 234 HLA-DRB1, 41 HLA-DQB1, and 29 HLA-C alleles are reported. The most frequent alleles were A∗02:02g (0.096, B∗07:02g (0.082, C∗07:02g (0.180, DQB1∗06:02 (0.157, and DRB1∗15:01 (0.072. The most common haplotype was A∗03:01g~B∗07:02g~C∗07:02g~DQB1∗06:02~DRB1∗15:01 (0.067, which has also been reported in other populations. Deviations from Hardy-Weinberg equilibrium were observed in A, B, and DRB1 loci, with C~DQB1 being the only locus pair in linkage disequilibrium. This study describes allele and haplotype frequencies from a subset of donors registered at SABMR, the only active bone marrow donor registry in Africa. Although the sample size was small, our results form a key resource for future population studies, disease association studies, and donor recruitment strategies.

  16. Modelling of the radioactive daughter elements in soil to assess radiation impact due to contaminated irrigation water by parents of 231Pa, 226Ra, 238U, 237Np and 239Pu

    International Nuclear Information System (INIS)

    Bela Kanyar; Katalin Eged; Tunde Katona; Gerhard Proehl; Ulla Bergstroem; Bengt Hallberg; Shelly Mobbs; Geert Olyslaegers; Theo Zeevaert; Palome Pinedo; Inmaculade Simon

    2004-01-01

    Radioactive wastes may contain both parent and daughter radionuclides. In some cases the transfer parameters of the daughter radio-elements differ significantly from that of the parent ones and therefore the dose contributions in the different pathways might be important to assess separately. The present work has compared 5 different site specific models by a scenario, using contaminated water for drinking and irrigation. Altogether 5 radionuclides from the investigated 10 ones contained radioactive daughter elements. In general, for long term studies in biosphere the steady-state formulations of processes are adequate to assess the contamination, except the infiltration into the deeper soil and sediment layers. According to the results of the modelling and computer simulations, the following daughters are to be assessed separately from their parents with respect to the radiation impact: for parent 231 Pa the daughter 227 Ac, for parent 226 Ra the daughters 222 Rn, 210 Pb and 210 Po and for parent 237 Np the daughter 233 Pa. The dose contributions of the daughters from parents 238 U and 239 Pu are less significant during the considered 100-10000 years. In case of contamination of irrigation water with 1 Bq x m -3 of the parent radionuclide 231 Pa, more than 90% of the external dose from soil exposure comes from the daughter 227 Ac (annually 15 nSv). By a similar contamination with 226 Ra as a parent radionuclide, 60% of the ingestion dose is due to food contamination with the daughters 210 Pb and 210 Po (approximately 150 nSv x a -1 ). (author)

  17. Radioactivity studies. Progress report, January 1-December 31, 1982

    International Nuclear Information System (INIS)

    Cohen, N.

    1983-06-01

    During the last year, the research program in actinide biokinetics in nonhuman primates has been expanded to include preliminary studies of the element neptunium. Recently, Np-237, which is known to be present in high-level nuclear reactor waste, has received increased attention as a potential long-range hazard to man. In addition to the neptunium studies, the metabolism of protactinium-233, the daughter of Np-237, has been investigated. Although characterization of Pa-233 metabolism was originally conducted in order to correct for Pa-233 interference during in vivo and in vitro gamma spectrometry of Np-237, several other considerations indicated that Pa might be of radiological concern itself and should thereby warrant further investigation. Due to the limited amount of data in the literature defining the biokinetics of both neptunium and protactinium, metabolis studies of these nuclides are now being conducted in adult female baboons in a manner similar to that which has been successfully performed at this laboratory for Am-241 and Cm-243,244. Procedures routinely performed include external whole-body counting, excreta collection (separation and measurement), blood sampling, biopsies of liver and bone, and complete tissue and organ analysis after sacrifice

  18. Evaluation of thermal neutron cross-sections and resonance integrals of protactinium, americium, curium, and berkelium isotopes

    International Nuclear Information System (INIS)

    Belanova, T.S.

    1994-12-01

    Data on the thermal neutron fission and capture cross-sections as well as their corresponding resonance integrals are reviewed and analysed. The data are classified according to the form of neutron spectra under investigation. The weighted mean values of the cross-sections and resonance integrals for every type of neutron spectra were adopted as evaluated data. (author). 87 refs, 2 tabs

  19. Correction to: Kürti, László. “Review Article: Documenting Immigrants, Boarding Houses and Ethnographers. Burdosház Amerikából – Balogh Balázs néprajzkutató nyomában ('A Boarding House from America - in the Footsteps of Ethnographer Balázs Balogh'. Directed by Dezső Zsigmond, produced by Dunatáj Alapítvány, Camera: Arthur Bálint, 2015, 50:39 minutes.” Hungarian Cultural Studies. e-Journal of the American Hungarian Educators Association, Volume 9 (2016 DOI: 10.5195/ahea.2016.237

    Directory of Open Access Journals (Sweden)

    László Kürti

    2017-09-01

    Full Text Available Changing the incorrect word “script” to “scrip”. The word “scrip” refers to the method of payment used in companies instead of legal tender. The original article can be found via the DOI: http://doc.doi.org/10.5195/ahea.2016.237

  20. The fission cross sections of /sup 230/Th, /sup 232/Th, /sup 233/U, /sup 234/U, /sup 236/U, /sup 238/U, /sup 237/Np, /sup 239/Pu and /sup 242/Pu relative /sup 235/U at 14. 74 MeV neutron energy

    Energy Technology Data Exchange (ETDEWEB)

    Meadows, J.W.

    1986-12-01

    The measurement of the fission cross section ratios of nine isotopes relative to /sup 235/U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for /sup 235/U are: /sup 230/Th - 0.290 +- 1.9%; /sup 232/Th - 0.191 +- 1.9%; /sup 233/U - 1.132 +- 0.7%; /sup 234/U - 0.998 +- 1.0%; /sup 236/U - 0.791 +- 1.1%; /sup 238/U - 0.587 +- 1.1%; /sup 237/Np - 1.060 +- 1.4%; /sup 239/Pu - 1.152 +- 1.1%; /sup 242/Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs.

  1. 48 CFR 237.102-72 - Contracts for management services.

    Science.gov (United States)

    2010-10-01

    ... development or production of the major system ensures that Federal employees are responsible for determining— (1) Courses of action to be taken in the best interest of the Government; and (2) Best technical performance for the warfighter; and (c) The contract requires that the prime contractor for the contract may...

  2. Vocational Education in Corrections. Information Series No. 237.

    Science.gov (United States)

    Day, Sherman R.; McCane, Mel R.

    Vocational education programs in America's correctional institutions have been financially handicapped, since security demands the greatest portion of resource allocations. Four eras in the development of the correctional system are generally identified: era of punishment and retribution, era of restraint or reform, era of rehabilitation and…

  3. 48 CFR 1852.237-73 - Release of sensitive information.

    Science.gov (United States)

    2010-10-01

    ... technology system for NASA that contains sensitive information, the service provider's contract shall include the clause at 1852.204-76, Security Requirements for Unclassified Information Technology Resources. The Security Requirements clause requires the service provider to implement an Information Technology...

  4. 30 CFR 23.7 - Specific requirements for approval.

    Science.gov (United States)

    2010-07-01

    ... adequate instructions for the installation and connection of telephones and signal devices in order that the safety of these devices and other circuits shall not be diminished by improper installation. MSHA reserves the right to require the attachment of wiring diagrams to the cases of telephones and signal...

  5. 48 CFR 237.104 - Personal services contracts.

    Science.gov (United States)

    2010-10-01

    ... intelligence component or counter-intelligence organization of DoD; or (iii) Directly support the mission of... travel between home or place of business and official duty station. (iii) Coordinate with the civilian... SYSTEM, DEPARTMENT OF DEFENSE SPECIAL CATEGORIES OF CONTRACTING SERVICE CONTRACTING Service Contracts...

  6. 48 CFR 252.237-7016 - Delivery tickets.

    Science.gov (United States)

    2010-10-01

    ...), and (e) to the basic clause: (c) Before the Contractor picks up articles for service under this... of serviced laundry on the delivery ticket. The Contracting Officer will ensure that this weight and... articles for service under this contract, the Contracting Officer will ensure that each bag is weighed and...

  7. 48 CFR 252.237-7017 - Individual laundry.

    Science.gov (United States)

    2010-10-01

    ... clause: Individual Laundry (DEC 1991) (a) The Contractor shall provide laundry service under this... services. (c) Charges for individual laundry will be on a per unit bundle or a piece-rate basis. The... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Individual laundry. 252...

  8. 48 CFR 1552.237-71 - Technical direction.

    Science.gov (United States)

    2010-10-01

    .... (d) Technical direction will be issued in writing or confirmed in writing within five (5) days after... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Technical direction. 1552... Technical direction. As prescribed in 1537.110, insert a clause substantially the same as the following...

  9. 48 CFR 1852.237-72 - Access to Sensitive Information.

    Science.gov (United States)

    2010-10-01

    ... position in another procurement. (2) Safeguard sensitive information coming into its possession from... relating to ethics, conflicts of interest, corruption, and other criminal or civil matters relating to the...

  10. 7 CFR 2.37 - Chief Information Officer.

    Science.gov (United States)

    2010-01-01

    ... acquisition; (iii) Approve the appointment of the program manager for each major information technology... recommendations to Agency Heads for the removal or replacement of information technology project managers, when... regarding information technology matters. (2) Overseeing all information technology and information resource...

  11. Neptunium 237 behaviour in subcellular fractions of rat kidneys

    International Nuclear Information System (INIS)

    Kreslov, V.V.; Maksutova, A.Ya.; Mushkacheva, G.S.

    1978-01-01

    Subcellular distribution of intravenously injected (1 and 0.5 μCi/rat) neptunium nitrate (5- and 6-valent) in kidneys of rat males and females has been investigated. It has been shown that the radionuclide was unevenly distributed within the cell. As early as 24 hours after administration, about 50 per cent of neptunium were concentrated in the mitochondrial fraction. The data are presented on variations in neptunium behaviour within subcellular fractions of rat kidneys depending on the sex of animals, valency and dose of the isotope

  12. All projects related to | Page 237 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Impact of Tobacco Tax Increases in Latin America. Project. Raising taxes ... Region: North and Central America, South America, Argentina, Bolivia, Brazil, Chile, Colombia, Mexico, Peru. Program: Food, Environment, and Health. Total Funding: ...

  13. 48 CFR 652.237-71 - Identification/Building Pass.

    Science.gov (United States)

    2010-10-01

    ..., Information Security Programs Division, Industrial Security Branch (DS/ISP/INB) on its cleared employees..., Information Security Programs Division, Industrial Security Branch (DS/ISP/INB): (i) SF-85P, Questionnaire for... Pass (APR 2004) (a) Contractors working in domestic facilities who already possess a security clearance...

  14. 48 CFR 1252.237-72 - Prohibition on advertising.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Prohibition on advertising... Prohibition on advertising. As prescribed in (TAR) 48 CFR 1213.7101 and 1237.7003, insert the following clause: Prohibition on Advertising (JAN 1996) The contractor or its representatives (including training instructors...

  15. 237 Missionary Historiography: A Factor for the Emergence of ...

    African Journals Online (AJOL)

    User

    2012-01-24

    Jan 24, 2012 ... Nmah, P. E. - Department of Religion and Human Relations, Nnamdi ... It is also the identification of a people with the aspirations and interests of their .... edifices where they congregate for worship, and yet cannot say from their ... robot- like worshippers of the prophet Isaiah's description ( Isaiah 29: 13), or.

  16. 29 CFR 1952.237 - Changes to approved plans.

    Science.gov (United States)

    2010-07-01

    ... 1910.142) in agriculture (except for agricultural temporary labor camps associated with egg, poultry or red meat production, or the post-harvest processing of agricultural or horticultural commodities.) The... Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR...

  17. 48 CFR 1252.237-71 - Certification of data.

    Science.gov (United States)

    2010-10-01

    ... (Public Law 104-106, 41 U.S.C. 425, note) and DOT Memorandum dated July 17, 1996. (a) The offeror...., company profile; qualifications; background statements; brochures) submitted with its offer is current, accurate, and complete as of the date of its offer. (b) The offeror understands that any inaccurate data...

  18. 237 Interrogating Nollywood and its Sources of Funding: The Case ...

    African Journals Online (AJOL)

    The problem of funding continues to haunt start-ups in Africa and there seems to be ... hospitality business where funding, which catalyses the efforts of independent ..... find her testimony too easy, but Emem Isong made the above statement in ...

  19. 49 CFR 237.71 - Determination of bridge load capacities.

    Science.gov (United States)

    2010-10-01

    ... capacity shall be determined. (g) Bridge load capacity may be expressed in terms of numerical values related to a standard system of bridge loads, but shall in any case be stated in terms of weight and...) Bridge load capacity may be expressed in terms of both normal and maximum load conditions. Operation of...

  20. 48 CFR 1552.237-70 - Contract publication review procedures.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contract publication review... journal article to the Project Officer, and one copy to the Contracting Officer. (d) If the Government has... AGENCY CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses...

  1. Radioactivity studies. Progress report, April 30, 1984-June 1, 1985

    International Nuclear Information System (INIS)

    Cohen, N.

    1985-06-01

    This report includes information pertaining to metabolic studies of neptunium and protactinium in the adult baboon. Recent investigations have provided additional data on the uptake, distribution, retention and excretion of Np-237, Np-239 and Pa-233 in baboons following single intravenous and gavage administrations. Data is also presented on the gastrointestinal absorption of isotopes of uranium, neptunium and plutonium in individual baboons after receiving multiple gavage administrations at selected time intervals and nutritional states. The gastrointestinal (GI) absorption (f 1 values) and retention factors have been calculated for each of these nuclides. We have begun metabolic studies on the adult tamarin (Saquinis labiatus). Data are presented in this report on the preliminary results of the metabolism of Np-239 bicarbonate intravenously injected into three females and one male tamarin. These data are discussed in comparison with similar results obtained with our baboons and with other species. 28 refs., 20 figs., 14 tabs

  2. Selective localization of neptunium-237 in the nuclei of mammalian cells. Localisation selective du neptunium-237 au sein des noyaux des cellules de mammiferes

    Energy Technology Data Exchange (ETDEWEB)

    Galle, P.; Boulahdour, H. (Faculte de Medecine, 94 - Creteil (FR)); Metivier, H. (CEA Centre d' Etudes Nucleaires de Fontenay-aux-Roses, 92 (FR). Inst. de Protection et de Surete Nucleaire)

    1992-01-01

    After injection in the rat of soluble neptunium salt, the distribution of this element was studied at the subcellular level by electron microscopy and electron probe microanalysis. Abnormal structures have been observed by electron microscopy in the nuclei of hepatocytes, and the same structures have also been observed in the nuclei of the proximal tubules cells of the kidney. These structures are formed of clusters of very small and dense particles, several nanometers in diameter. The clusters are localized in the central part of the nuclei and they are separate from nucleoli and heterochromatin. Electron probe X-ray analysis of this cluster have shown that they contain neptunium associated with phosphorus. In the cell containing neptunium inclusions, other non specific lesions are also observed (nuclear pycnosis, mitochondrial depletion).

  3. A Study of the 384 KeV Complex Gamma Emission from Plutonium-239

    International Nuclear Information System (INIS)

    Forsyth, R.S.; Ronqvist, N.

    1965-11-01

    Plutonium-239 has been reported to emit a gamma of energy 384 KeV. Subsequent workers, using radiation of this energy as a nondestructive measure of the plutonium content of various materials, found that the peak obtained by sodium iodide scintillation spectrometry showed a pronounced shoulder at about 330 KeV. This shoulder has been attributed to protactinium-233 and to uranium-237. From the width of the peak, however, it is obvious that at least three contributors are present. The present paper describes gamma spectrometric studies of plutonium samples of several isotopic compositions using a sodium iodide detector and a lithium-drifted germanium detector. The 384 KeV peak has been shown to be a complex peak containing 12 gamma components due to plutonium-239 between 300 - 450 KeV, and their relative intensities have been estimated. Anion exchange and solvent extraction experiments have also demonstrated that two further contributions due to uranium-237 are present in plutonium containing significant amounts of plutonium-241

  4. A Study of the 384 KeV Complex Gamma Emission from Plutonium-239

    Energy Technology Data Exchange (ETDEWEB)

    Forsyth, R S; Ronqvist, N

    1965-11-15

    Plutonium-239 has been reported to emit a gamma of energy 384 KeV. Subsequent workers, using radiation of this energy as a nondestructive measure of the plutonium content of various materials, found that the peak obtained by sodium iodide scintillation spectrometry showed a pronounced shoulder at about 330 KeV. This shoulder has been attributed to protactinium-233 and to uranium-237. From the width of the peak, however, it is obvious that at least three contributors are present. The present paper describes gamma spectrometric studies of plutonium samples of several isotopic compositions using a sodium iodide detector and a lithium-drifted germanium detector. The 384 KeV peak has been shown to be a complex peak containing 12 gamma components due to plutonium-239 between 300 - 450 KeV, and their relative intensities have been estimated. Anion exchange and solvent extraction experiments have also demonstrated that two further contributions due to uranium-237 are present in plutonium containing significant amounts of plutonium-241.

  5. 48 CFR 252.237-7023 - Continuation of Essential Contractor Services.

    Science.gov (United States)

    2010-10-01

    ... provide a written plan for continuing the performance of essential contractor services identified in...; and (v) The approach for communicating expectations to contractor employees regarding their roles and... or other designated representative as expeditiously as possible and use its best efforts to cooperate...

  6. Natural Disasters and Adaptive Capacity. OECD Development Centre Working Paper No. 237

    Science.gov (United States)

    Dayton-Johnson, Jeff

    2004-01-01

    Natural disasters (droughts, earthquakes, epidemics, floods, wind storms) damage wellbeing, both in their immediate and long-term aftermath, and because the insecurity of exposure to disasters is in itself harmful to risk-averse people. As such, mitigating and coping with the risk of natural disasters is a pressing issue for economic development.…

  7. Standardized UXO Technology Demonstration Site, Blind Grid Scoring Record No. 237

    National Research Council Canada - National Science Library

    Overbay, Larry, Jr; Robitaille, George; Boutin, Matthew; Fling, Rick; McClung, Christina

    2005-01-01

    ...) utilizing the APG Standardized UXO Technology Demonstration Site Blind Grid. The scoring record was coordinated by Larry Overbay and the Standardized UXO Technology Demonstration Site Scoring Committee...

  8. Yeast Interacting Proteins Database: YGL237C, YOR047C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ene expression; interacts with protein kinase Snf1p, glucose sensors Snf3p and Rgt2p, and TATA-binding prote... expression; interacts with protein kinase Snf1p, glucose sensors Snf3p and Rgt2p, and TATA-binding protein

  9. 48 CFR 237.7204 - Format and clauses for educational service agreements.

    Science.gov (United States)

    2010-10-01

    ... order, official Government order, or other written communication). The (insert type of request, such as, delivery order, official Government order, or other written communication) will contain the number of this... completion. (j) “Curriculum” means a series of courses having a unified purpose and belonging primarily to...

  10. 48 CFR 252.237-7013 - Instruction to offerors (bulk weight).

    Science.gov (United States)

    2010-10-01

    ...) Offers shall be submitted on a unit price per pound of serviced laundry. Unit prices shall include all costs to the Government of providing the service, including pickup and delivery charges. (b) The Contracting Officer will evaluate bids based on the estimated pounds of serviced laundry stated in the...

  11. 48 CFR 252.237-7015 - Loss or damage (weight of articles).

    Science.gov (United States)

    2010-10-01

    ... shall— (1) Be liable for return of the articles furnished for service under this contract; and (2... in servicing the laundry is ____ percent of the weight recorded on delivery tickets when the laundry...

  12. Sexospécificités | Page 237 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The word is out: smoking tobacco through a waterpipe — a narghile or hookah — is as dangerous, or more so than smoking cigarettes. So says the World Health Organization, which issued an advisory in 2005 that made news around the world. It noted that "waterpipe smoking is associated with many of the same risks as ...

  13. Determination of 237Np in environmental and nuclear samples: A review of the analytical method

    International Nuclear Information System (INIS)

    Thakur, P.; Mulholland, G.P.

    2012-01-01

    A number of analytical methods has been developed and used for the determination of neptunium in environmental and nuclear fuel samples using alpha, ICP–MS spectrometry, and other analytical techniques. This review summarizes and discusses development of the radiochemical procedures for separation of neptunium (Np), since the beginning of the nuclear industry, followed by a more detailed discussion on recent trends in the separation of neptunium. This article also highlights the progress in analytical methods and issues associated with the determination of neptunium in environmental samples. - Highlights: ► Determination of Np in environmental and nuclear samples is reviewed. ► Various analytical methods used for the determination of Np are listed. ► Progress and issues associated with the determination of Np are discussed.

  14. 48 CFR 52.237-4 - Payment by Government to Contractor.

    Science.gov (United States)

    2010-10-01

    ... Officer shall retain 10 percent of the estimated payment until final completion and acceptance of the... full, without retaining a percentage. Also, on completion and acceptance of each unit or division for which the price is stated separately, the Contracting Officer may authorize full payment for that unit...

  15. Vapour pressure of D2O - Ice at temperatures below 237 K

    International Nuclear Information System (INIS)

    Heras, J.M.; Asensio, M.C.; Estiu, G.; Viscido, L.

    1984-01-01

    Accurate measurements of heavy water ice vapour pressures between 193 and 253 K have been carried out and an equation based on thermodynamic data has been derived in order to calculate the D 2 O-ice vapour pressures between 173 and 273 K. The agreement between our calculated vapour pressures and the available experimental data including those in this paper, is very good. The comparison between the theoretical calculations of H 2 O-ice and D 2 O-ice vapour pressures confirms the experimental evidence that H 2 O-ice is more volatile than D 2 O-ice at all temperatures in agreement with the vapour isotopic effect theory (VPIE).(author)

  16. Pin cell discontinuity factors in the transient 3-D discrete ordinates code TORT-TD - 237

    International Nuclear Information System (INIS)

    Seubert, A.

    2010-01-01

    This paper describes the application of generalized equivalence theory to the time-dependent 3-D discrete ordinates neutron transport code TORT-TD. The introduction of pin cell discontinuity factors into the discrete ordinates transport equation is described by assuming a linear dependence of the homogenized neutron angular flux within a pin cell which may be discontinuous at the interfaces to adjacent cells. The homogenized flux discontinuity at cell interfaces is expressed by pin cell discontinuity factors which in turn are determined from fuel assembly lattice calculations using HELIOS. Application of TORT-TD to the all rods in state of the PWR MOX/UO 2 Core Transient Benchmark with pin cell homogenized nuclear cross sections demonstrate the potential of pin cell discontinuity factors to reduce pin cell homogenization errors. (authors)

  17. 34 CFR 237.1 - What is the Christa McAuliffe Fellowship Program?

    Science.gov (United States)

    2010-07-01

    ... to reward excellence in teaching by encouraging outstanding teachers to continue their education, to develop innovative programs, to consult with or assist LEAs, private schools, or private school systems...

  18. 48 CFR 52.237-8 - Restriction on Severance Payments to Foreign Nationals.

    Science.gov (United States)

    2010-10-01

    ... ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of... 2003) (a) The Federal Acquisition Regulation (FAR), at 31.205-6(g)(6), limits the cost allowability of...

  19. SU-E-J-237: Image Feature Based DRR and Portal Image Registration

    Energy Technology Data Exchange (ETDEWEB)

    Wang, X; Chang, J [NY Weill Cornell Medical Ctr, NY (United States)

    2014-06-01

    Purpose: Two-dimensional (2D) matching of the kV X-ray and digitally reconstructed radiography (DRR) images is an important setup technique for image-guided radiotherapy (IGRT). In our clinics, mutual information based methods are used for this purpose on commercial linear accelerators, but with often needs for manual corrections. This work proved the feasibility that feature based image transform can be used to register kV and DRR images. Methods: The scale invariant feature transform (SIFT) method was implemented to detect the matching image details (or key points) between the kV and DRR images. These key points represent high image intensity gradients, and thus the scale invariant features. Due to the poor image contrast from our kV image, direct application of the SIFT method yielded many detection errors. To assist the finding of key points, the center coordinates of the kV and DRR images were read from the DICOM header, and the two groups of key points with similar relative positions to their corresponding centers were paired up. Using these points, a rigid transform (with scaling, horizontal and vertical shifts) was estimated. We also artificially introduced vertical and horizontal shifts to test the accuracy of our registration method on anterior-posterior (AP) and lateral pelvic images. Results: The results provided a satisfactory overlay of the transformed kV onto the DRR image. The introduced vs. detected shifts were fit into a linear regression. In the AP image experiments, linear regression analysis showed a slope of 1.15 and 0.98 with an R2 of 0.89 and 0.99 for the horizontal and vertical shifts, respectively. The results are 1.2 and 1.3 with R2 of 0.72 and 0.82 for the lateral image shifts. Conclusion: This work provided an alternative technique for kV to DRR alignment. Further improvements in the estimation accuracy and image contrast tolerance are underway.

  20. 237 Impacts socio-sanitaires et environnementaux de la gestion des ...

    African Journals Online (AJOL)

    SWEET

    pollution des eaux, érosion des berges des mayo et alluvionnement des drains, amènent à suggérer des ... D'après TUCCI [1], les principaux défis de la gestion des inondations sont liés à l'occupation des ... populations aux impacts des inondations de plaine est due, d'après TUCCI [1], au manque de connaissance.

  1. 27 CFR 19.237 - Disapproval of bonds or consents of surety.

    Science.gov (United States)

    2010-04-01

    ..., prohibiting the manufacture, sale, importation, or transportation of spirits, wine, beer, or other... States, if such provision related to internal revenue or customs taxation of spirits, wines, or beer, or...

  2. SU-E-J-237: Real-Time 3D Anatomy Estimation From Undersampled MR Acquisitions

    Energy Technology Data Exchange (ETDEWEB)

    Glitzner, M; Lagendijk, J; Raaymakers, B; Crijns, S [University Medical Center Utrecht, Utrecht (Netherlands); Senneville, B Denis de [University Medical Center Utrecht, Utrecht (Netherlands); Mathematical Institute of Bordeaux, University of Bordeaux, Talence Cedex (France)

    2015-06-15

    Recent developments made MRI guided radiotherapy feasible. Performing simultaneous imaging during fractions can provide information about changing anatomy by means of deformable image registration for either immediate plan adaptations or accurate dose accumulation on the changing anatomy. In 3D MRI, however, acquisition time is considerable and scales with resolution. Furthermore, intra-scan motion degrades image quality.In this work, we investigate the sensitivity of registration quality on imageresolution: potentially, by employing spatial undersampling, the acquisition timeof MR images for the purpose of deformable image registration can be reducedsignificantly.On a volunteer, 3D-MR imaging data was sampled in a navigator-gated manner, acquiring one axial volume (360×260×100mm{sup 3}) per 3s during exhale phase. A T1-weighted FFE sequence was used with an acquired voxel size of (2.5mm{sup 3}) for a duration of 17min. Deformation vector fields were evaluated for 100 imaging cycles with respect to the initial anatomy using deformable image registration based on optical flow. Subsequently, the imaging data was downsampled by a factor of 2, simulating a fourfold acquisition speed. Displacements of the downsampled volumes were then calculated by the same process.In kidneyliver boundaries and the region around stomach/duodenum, prominent organ drifts could be observed in both the original and the downsampled imaging data. An increasing displacement of approximately 2mm was observed for the kidney, while an area around the stomach showed sudden displacements of 4mm. Comparison of the motile points over time showed high reproducibility between the displacements of high-resolution and downsampled volumes: over a 17min acquisition, the componentwise RMS error was not more than 0.38mm.Based on the synthetic experiments, 3D nonrigid image registration shows little sensitivity to image resolution and the displacement information is preserved even when halving the resolution. This can be employed to greatly reduce image acquisition times for interventional applications in real-time. This work was funded by the SoRTS consortium, which includes the industry partners Elekta, Philips and Technolution.

  3. 48 CFR 1352.237-70 - Security processing requirements-high or moderate risk contracts.

    Science.gov (United States)

    2010-10-01

    ... background inquiries pertaining to verification of name, physical description, marital status, present and... undergo security processing by the Department's Office of Security before being eligible to work on the.... citizens must have: (1) Official legal status in the United States; (2) Continuously resided in the United...

  4. 28 CFR 2.37 - Disclosure of information concerning parolees; Statement of policy.

    Science.gov (United States)

    2010-07-01

    ...) pursuant to a request under 18 U.S.C. 4203(e). (c) Information deemed to be “public sector” information may be disclosed to third parties without the consent of the file subject. Public sector information...

  5. 48 CFR 252.237-7000 - Notice of special standards of responsibility.

    Science.gov (United States)

    2010-10-01

    ..., of “Government Auditing Standards.” (1) Qualifications; (2) Independence; and (3) Quality Control. (b) “Government Auditing Standards” is issued by the Comptroller General of the United States and is available for... Contracting Officer evidence that it is licensed by the cognizant licensing authority in the state or other...

  6. P2-37: Processing Affordance Information from Invisible Tool Images

    Directory of Open Access Journals (Sweden)

    Shinho Cho

    2012-10-01

    Full Text Available A recent study showed that viewing manipulable objects such as images of tools induces the neural activation of posterior parietal areas. This neural activation is observed even when visual awareness of the image is visually suppressed. (Fang and He, 2005 Nature Neuroscience 10 1380–1385; Almeida et al, 2010 Psychological Science 21 772–778. However, the specific visuomotor information in tool images that drives the activation of dorsal areas is still unclear. We measured priming effect of invisible tool prime (left or right handed orientation. Observers distinguished the orientation of target tools (appropriate for left vs right handed grip briefly presented following visually suppressed primes (Experiment1. Also we measured the suppression time of tool images whose handle direction was presented in a left- or right-handed orientation. A dynamic noise pattern was presented to one of the observer's eyes at full contrast, while images of tools (left or right handed were simultaneously presented to the left or right visual field of the other eye. The subjects were asked to respond to the appearance of any partial or full part of the test image (Experiment 2. Results showed that (1 observers responded faster in the congruent condition (the same orientation between prime and target and (2 tool images shown in the right visual field took less time to gain dominance against the dynamic noise. These results suggest that even without overt recognition of presented tools, an object's affordance can be registered and processed in the brain. A recent study showed that viewing manipulable objects such as images of tools induces the neural activation of posterior parietal areas. This neural activation is observed even when visual awareness of the image is visually suppressed (Almeida et al., 2010 Psychological Science 21 772–778; Fang and He, 2005 Nature Neuroscience 10 1380–1385. However, the specific visuomotor information in tool images that drives the activation of dorsal areas is still unclear. We measured the priming effect of invisible tool prime (left or right handed orientation. Observers distinguished the orientation of target tools (appropriate for left vs. right handed grip briefly presented following visually suppressed primes (Experiment 1. Also we measured the suppression time of tool images whose handle direction was presented in a left- or right-handed orientation. A dynamic noise pattern was presented to one of the observer's eyes at full contrast, while images of tools (left or right handed were simultaneously presented to the left or right visual field of the other eye. The subjects were asked to respond to the appearance of any partial or full part of the test image (Experiment 2. Results showed that (1 observers responded faster in the congruent condition (the same orientation between prime and target and (2 tool images shown in the right visual field took less time to gain dominance against the dynamic noise. These results suggest that even without overt recognition of presented tools, an object's affordance can be registered and processed in the brain.

  7. 48 CFR 52.237-11 - Accepting and Dispensing of $1 Coin.

    Science.gov (United States)

    2010-10-01

    ... REGULATION (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and... premises owned by the United States or under the control of any agency or instrumentality of the United...

  8. Transmutation experiments ion I-129, La-139 and Np-237 using the Nuclotron accelerator

    Czech Academy of Sciences Publication Activity Database

    Westmeier, W.; Brandt, B. A.; Langrock, E. J.; Odoj, R.; Adam, Jindřich; Bradnova, V.; Golovatyuk, VM.; Krasnov, VA.; Krivopustov, M. I.; Pronskikh, V. S.; Sosnin, A. N.; Tsoupko-Sitnikov, V. M.; Vladimirova, NM.; Hashemi-Nezhad, R. S.; Zamani-Valasiadou, M.

    2005-01-01

    Roč. 93, č. 2 (2005), s. 65-73 ISSN 0033-8230 R&D Projects: GA MŠk(CZ) 1P04LA213 Keywords : transmutation * relativistic proton beam * moderator Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.846, year: 2005

  9. Farmland biodiversity and agriculture management on 237 farms in 13 European and two African regions

    NARCIS (Netherlands)

    Lüscher, G.; Ammari, Y.; Andriets, A.; Angelova, Siyka; Arndorfer, Michaela; Bailey, D.; Balázs, Katalin; Bogers, M.M.B.; Lange, de H.J.; Kats, van R.J.M.

    2016-01-01

    Farmland is a major land cover type in Europe and Africa and provides habitat for numerous species. The severe decline in farmland biodiversity of the last decades has been attributed to changes in farming practices, and organic and low-input farming are assumed to mitigate detrimental effects of

  10. Farmland biodiversity and agricultural management on 237 farms in 13 European and two African regions

    NARCIS (Netherlands)

    Lüscher, G.; Ammari, Y.; Andriets, A.; Angelova, Siyka; Arndorfer, Michaela; Bailey, D.; Balázs, K.; Bogers, M.M.B.; Bunce, R.G.H.; Choisis, Jean Philippe; Dennis, P.; Díaz, M.; Dyman, T.; Eiter, Sebastian; Fjellstad, W.; Fraser, M.; Friedel, Jürgen K.; Garchi, S.; Geijzendorffer, I.R.; Gomiero, Tiziano; González-Bornay, G.; Guteva, Y.; Herzog, F.; Jeanneret, P.; Jongman, R.H.G.

    2016-01-01

    Farmland is a major land cover type in Europe and Africa and provides habitat for numerous species. The severe decline in farmland biodiversity of the last decades has been attributed to changes in farming practices, and organic and low-input farming are assumed to mitigate detrimental effects of

  11. 48 CFR 252.237-7018 - Special definitions of Government property.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Special definitions of... ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT...) Articles delivered to the Contractor to be laundered or dry-cleaned, including any articles which are...

  12. 77 FR 237 - Protection of Stratospheric Ozone: Adjustments to the Allowance System for Controlling HCFC...

    Science.gov (United States)

    2012-01-04

    ... for servicing existing equipment? 2. Can servicing needs be met with virgin and recovered material? 3...-month period thereafter, its calculated level of consumption of the controlled substances in Group I of... calculated level of production of the controlled substances in Group I of Annex C does not exceed, annually...

  13. Oral intake of radionuclides in the population

    International Nuclear Information System (INIS)

    Johansson, L.

    1982-10-01

    Dose factors of some radionuclides have been reviewed with respect to a chronic oral intake by means of the public. The radionuclides taken into account are Pu-239, Np-237, Ra-226, Th-230, Pa-231, Tc-99 and I-129, all of which might be of potential hazard at a long term storage disposal. The parameter that have the major influence on the dose factor, for most of the radionuclides studied, is the uptake from the gut. In order to assess the dose factor it is therefore essential to make a good estimate of the gastrointestinal uptake of the radionuclides under the actual conditions. The 'annual limit of intake' (ALI) given in ICRP 30, is intended to be applicable on a population of workers, and for a single intake. Since the gut uptake in the ICRP-publication are based mainly on uptake values recieved in experimental animals, given single relatively large oral doses of the isotope studied. From a review of current literature, gut absorbtion factors and dose factors, to be used for members of the public at a chronic oral intake, are suggested. Compared with those for workers in ICRP 30, the dose factors increase for plutonium and protactinium, and decrease for neptunium. An attempt to predict possible future changes of the ALI for members of the general public is also made. (Author)

  14. Oral intake of radionuclides in the population

    International Nuclear Information System (INIS)

    Johansson, L.

    1982-11-01

    Dose factors of some radionuclides have been reviewed with respect to a chronic oral intake by members of the public. The radionuclides taken into account are Pu-239, Np-237, Ra-226, Th-230, Pa-231, Tc-99 and I-129, all of which might be of potential hazard at a long term storage disposal. The parameter which has the major influence on the dose factor, for most of the radionuclides studied, is the uptake from the gut. In order to assess the dose factor it is therefore essential to make a good estimate of the gastrointestinal uptake of the radionuclides under the actual conditions. The annual limit of intake (ALI) given in ICRP 30, is intended to be applicable on a population of workers, and for a single intake. Since the gut uptake figures in the ICRP-publication are based mainly on uptake values recieved in experiment animals, given single relatively large oral doses of the isotope studied. From a review of current literature, gut absorbation factors and dose factors, to be used for members of the public at a chronic oral intake, are suggested. Compared with those for workers in ICRP 30, the dose factors increases for plutonium and protactinium, and decreases for neptunium. (Author)

  15. Separation of protactinum, actinium, and other radionuclides from proton irradiated thorium target

    Science.gov (United States)

    Fassbender, Michael E.; Radchenko, Valery

    2018-04-24

    Protactinium, actinium, radium, radiolanthanides and other radionuclide fission products were separated and recovered from a proton-irradiated thorium target. The target was dissolved in concentrated HCl, which formed anionic complexes of protactinium but not with thorium, actinium, radium, or radiolanthanides. Protactinium was separated from soluble thorium by loading a concentrated HCl solution of the target onto a column of strongly basic anion exchanger resin and eluting with concentrated HCl. Actinium, radium and radiolanthanides elute with thorium. The protactinium that is retained on the column, along with other radionuclides, is eluted may subsequently treated to remove radionuclide impurities to afford a fraction of substantially pure protactinium. The eluate with the soluble thorium, actinium, radium and radiolanthanides may be subjected to treatment with citric acid to form anionic thorium, loaded onto a cationic exchanger resin, and eluted. Actinium, radium and radiolanthanides that are retained can be subjected to extraction chromatography to separate the actinium from the radium and from the radio lanthanides.

  16. Integrated plant safety assessment, Systematic Evaluation Program: Dresden Nuclear Power Station, Unit 2 (Docket No. 50-237)

    International Nuclear Information System (INIS)

    1989-10-01

    The US Nuclear Regulatory Commission (NRC) has prepared Supplement 1 to the final Integrated Plant Safety Assessment Report (IPSAR) (NUREG-0823), under the scope of the Systematic Evaluation Program (SEP), for the Commonwealth Edison Company (CECo) Dresden Nuclear Power Station, Unit 2 located in Grundy County, Illinois. The NRC initiated the SEP to provide the framework for reviewing the design of older operating nuclear reactor plants to reconfirm and document their safety. This report documents the review completed by means of the SEP for those issues that required refined engineering evaluations or the continuation of ongoing evaluations subsequent to issuing the final IPSAR for Dresden Unit 2. The review was provided for (1) an assessment of the significance of differences between current technical positions on selected issues and those that existed when Dresden Unit 2 was licensed, (2) a basis for deciding on how these differences should be resolved in an integrated plant review, and (3) a documented evaluation of plant safety. The final IPSAR and this supplement forms part of the bases for considering the conversion of the existing provisional operating license to a full-term operating license. 83 refs., 9 tabs

  17. 17 CFR 230.237 - Exemption for offers and sales to certain Canadian tax-deferred retirement savings accounts.

    Science.gov (United States)

    2010-04-01

    ... laws of Canada, the laws of any province or territory of Canada, and the rules or regulations of any federal, provincial, or territorial regulatory authority, or any self-regulatory authority, of Canada. (2... “Registered Retirement Savings Plan” or “Registered Retirement Income Fund” administered under Canadian law...

  18. Investigation of the soil-to-plant transfer of Np-237, Pu-238, Am-241 and Cm-244

    International Nuclear Information System (INIS)

    Pimpl, M.

    1988-08-01

    Inside a greenhouse for radioecological studies the root uptake of Np, Pu, Am, and Cm from 5 different soils into 19 crop plants have been measured. The soils have been artificially contaminated with the 4 nuclides in range from 1-20 Bq/g dry soil. Within 7 vegetation periods about 380 transfer measurements have been performed. The obtained results show that the soil-to-plant transfer is mainly influenced by the following parameters: physical and chemical properties of the different radionuclides, plant species and variety, soil type, time of soil utilization and soil management. The transfer factors measured are compared with those data which are proposed for the calculation of the long term radiation burden of the population by ingestion of contaminated food inside the Federal Republic of Germany. The experiments have been performed from the beginning of 1983 to the end of 1986. The results summarized within this report have already been published in annual reports or as contributions to scientific meetings. (orig.) [de

  19. Cusculium (Plin. XVI 22, coscus (Chiron 237 and coccolubis (Colum. III 2.19: Mediterranean substrate and Latin form

    Directory of Open Access Journals (Sweden)

    Benjamín García-Hernández

    2014-12-01

    Full Text Available Cusculium, a hapax used by Pliny in its accusative form, has a Pre-Roman base (cuscu- that is found throughout western Mediterranean countries; the same root appears in coscus, referring to certain types of worm. Given its Latin ending, the word could be used to designate both the tree (cusculius «kermes oak» and its acorns (cusculium. Coccolubis is a compound adjective, the first element of which is the diminutive of coccum («grain of kermes», which carries the same Mediterranean root as the previous word. Given its use as an epithet for a type of vine, its second element may be seen to contain the base of the noun uua. Its original form may have therefore been coccoluuis («of red grape». The Navarran term cuzculubita («oak apple», however, suggests that a Pre-Roman compound may have existed.

  20. Neutron-induced transmutation reactions in Np-237, Pu-238, and Pu-239 at the massive natural uranium spallation target

    Czech Academy of Sciences Publication Activity Database

    Závorka, L.; Adam, Jindřich; Baldin, A. A.; Čaloun, Pavel; Chilap, V. V.; Furman, W.; Kadykov, M. G.; Khushvaktov, J.; Pronskikh, V. S.; Solnyshkin, A. A.; Sotnikov, V.; Stegailov, V. I.; Suchopár, Martin; Tsoupko-Sitnikov, V. M.; Tyutyunnikov, S. I.; Voronko, V.; Vrzalová, Jitka

    2015-01-01

    Roč. 349, APR (2015), s. 31-38 ISSN 0168-583X R&D Projects: GA MŠk LG14004 Institutional support: RVO:61389005 Keywords : ADS * spent nuclear fuel * transmutation reaction * spallation neutrons Subject RIV: BG - Nuclear , Atomic and Molecular Physics, Colliders Impact factor: 1.389, year: 2015

  1. Measurements of periods, relative abundances and absolute yields of delayed neutrons from fast neutron induced fission of {sup 237}Np

    Energy Technology Data Exchange (ETDEWEB)

    Piksaikine, V. [Institute of Physics and Power Engineering, Obninsk (Russian Federation)

    1997-03-01

    The experimental method for measurements of the delayed neutron yields and period is presented. The preliminary results of the total yield, relative abundances and periods are shown comparing with the previously reported values. (J.P.N.)

  2. Study of an automatic dosing of neptunium in the industrial process of separation neptunium 237-plutonium 238

    International Nuclear Information System (INIS)

    Ros, Pierre

    1973-01-01

    The objective is to study and to adapt a method of automatic dosing of neptunium to the industrial process of separation and purification of plutonium 238, while taking the information quality and economic aspects into account. After a recall of some generalities on the production of plutonium 238, and the process of separation plutonium-neptunium, the author addresses the dosing of neptunium. The adopted measurement technique is spectrophotometry (of neptunium, of neptunium peroxide) which is the most flexible and economic to adapt to automatic control. The author proposes a project of chemical automatic machine, and discusses the complex (stoichiometry, form) and some aspects of neptunium dosing (redox reactions, process control) [fr

  3. Challenges to Persian Gulf Security: How Should the United States Respond? (Strategic Forum, Number 237, November 2008)

    National Research Council Canada - National Science Library

    Yaphe, Judith S

    2008-01-01

    .... Iran's quest for regional preeminence, driven by the impulses of exceptionalism and self-sufficiency that are deeply engrained in the country's political psyche, will not slacken any time soon...

  4. 48 CFR 652.237-73 - Statement of Qualifications for Preference as a U.S. Person.

    Science.gov (United States)

    2010-10-01

    ... price of an offer. U.S. person means a company, partnership, or joint venture that the Government... or financial resources of another organization or individual, including parent companies... headquarters staff. The named location must be a United States jurisdiction in which the prospective offeror...

  5. Global determination of alpha emitters (241Am, 237Np, 239Pu, 232Th) in biological media (urine and feces)

    International Nuclear Information System (INIS)

    Bataller, Georges; Vasson, Olivier de; Bazin, Roger; Bonnard, Danielle; Morello, Marcel.

    1979-01-01

    A technique is described in this paper which permits the determination of the gross alpha activity emitted by a mixture of specially radiotoxic elements in urine and feces. After reduction and adjustment of the solution at pH 5,0, the radionuclides are adsorbed on glass marbles. The elution is made in acid medium (HCl 6N). Under these conditions the chemical yields are very satisfying: 96+-6% for urine and 68+-9% for feces. In case of significant results at the end of the manipulation, the radioactive source quality is sufficient to allow the identification of the contaminating radionuclide(s) by alpha spectrometry [fr

  6. 49 CFR Appendix A to Part 237 - Supplemental Statement of Agency Policy on the Safety of Railroad Bridges

    Science.gov (United States)

    2010-10-01

    ... incorporate recognized principles of structural design and analysis to provide for the safe and economic... railroad bridge rating reference system. The most common standard bridge rating reference system... systems may be used where convenient, provided their effects can be defined in terms of shear, bending and...

  7. Moessfit [Hyperfine Interactions, ISSN 0304-3843, Dec 2016, v. 237(1), p. 1-10

    Energy Technology Data Exchange (ETDEWEB)

    Kamusella, Sirko, E-mail: sirko.kamusella@tu-dresden.de; Klauss, Hans-Henning [TU Dresden, Institute of Solid State Physics (Germany)

    2016-12-15

    A free data analysis program for Mössbauer spectroscopy was developed to solve commonly faced problems such as simultaneous fitting of multiple data sets, Maximum Entropy Method and a proper error estimation. The program is written in C++ using the Qt application framework and the Gnu Scientific Library. Moessfit makes use of multithreading to reasonably apply the multi core CPU capacities of modern PC. The whole fit is specified in a text input file issued to simplify work flow for the user and provide a simple start in the Mössbauer data analysis for beginners. However, the possibility to define arbitrary parameter dependencies and distributions as well as relaxation spectra makes Moessfit interesting for advanced user as well.

  8. Moessfit [Hyperfine Interactions, ISSN 0304-3843, Dec 2016, v. 237(1), p. 1-10

    International Nuclear Information System (INIS)

    Kamusella, Sirko; Klauss, Hans-Henning

    2016-01-01

    A free data analysis program for Mössbauer spectroscopy was developed to solve commonly faced problems such as simultaneous fitting of multiple data sets, Maximum Entropy Method and a proper error estimation. The program is written in C++ using the Qt application framework and the Gnu Scientific Library. Moessfit makes use of multithreading to reasonably apply the multi core CPU capacities of modern PC. The whole fit is specified in a text input file issued to simplify work flow for the user and provide a simple start in the Mössbauer data analysis for beginners. However, the possibility to define arbitrary parameter dependencies and distributions as well as relaxation spectra makes Moessfit interesting for advanced user as well.

  9. Crystal and molecular structures of thorium and uranium tetrakis(hexafluoroacetonylpyrazolide) complexes

    International Nuclear Information System (INIS)

    Volz, K.; Zalkin, A.; Templeton, D.H.

    1976-01-01

    Triclinic crystals of thorium(IV) and uranium(IV) tetrakis(hexafluoroacetonylpyrazolide) are isostructural, with space group P1 and Z = 2. At 23 0 C for Th(C 6 H 3 ON 2 F 6 ) 4 α = 11.282 (5) A, b = 16.245 (7) A, c = 10.836 (5) A, α = 90.14 (5) 0 , β = 108.75 (5) 0 , and γ = 107.07 (5) 0 . For the uranium compound a = 11.302 (5) A, b = 16.377 (8) A, c = 11.000 (5) A, α = 87.85 (5) 0 , β = 111.02 (5) 0 , and γ = 109.95 (5) 0 . X-ray diffraction data were measured with a scintillation counter, theta-2theta scans, and Mo Kα radiation. For thorium the conventional R value is 0.026 for 2966 unique data with I greater than sigma(I), and for uranium it is 0.027 for 4125 unique data with I greater than sigma(I). The full-matrix least-squares refinement of the 598 parameters of each structure included anisotropic thermal parameters for the 61 nonhydrogen atoms and isotropic ones for the 12 hydrogen atoms. The actinide ion is at the center of an irregular polyhedron of four oxygen and four nitrogen atoms. The average Th-O, Th-N, U-O, and U-N distances are 2.291 (4), 2.637 (5), 2.237 (3), and 2.574 (5) A. The molecules are packed in a manner which resembles cubic closest packing but which is more nearly analogous to the body-centered tetragonal structure of protactinium metal

  10. Prospection for natural 231Pa in India

    International Nuclear Information System (INIS)

    Anupama, P.; Gantayet, L.M.; Verma, R.; Parthasarathy, R.; Anil Kumar, S.; Dingankar, M.V.; Ghosh, S.K.; Patra, R.N.

    2001-08-01

    Protactinium-231 ( 231 Pa) occurs in nature as a member of the decay chain of naturally occuring 235 U of the 4n+ 3 radioactive series. The expected protactinium concentration in the Jaduguda ore body (with uranium concentration of 0.03-0.06 %) is around 0.2 parts per billion (ppb) and that in monazite ore (uranium concentration 0.3%) is 0.9 ppb. The process at uranium ore processing plant at Jaduguda was studied. 231 Pa content in samples from the process streams of the plant was determined. The gamma ray spectrometry method was chosen and standardised in our laboratory to detect and measure 231 Pa in parts per billion levels in these samples. A concentrated source of protactinium could not be found among the assessed streams of Jaduguda uranium plant. The Monazite processing plant at IRE, Aluva was then studied. From the known chemistry of protactinium, the possible distribution of the 231 Pa was guessed at. Accordingly, the process streams of IRE process plant were selected to prospect for 231 Pa and determine the fractionation of protactinium. For analysis of 231 Pa, the thorium bearing samples were chemically treated to remove the thorium daughter products, which interfere in gamma spectrometry. This report describes the planning for prospecting, sample selection, the standardisation of the analysis procedure for determination of 231 Pa content, and the analysis results. The 231 Pa content in various streams of Indian Rare Earths plant was found in the range 0.2 -6.5 ppb. Some of the streams did not carry any protactinium. The fractionation of 231 Pa in the various streams of the plant and the selection of source for recovery of protactinium are discussed in detail. (author)

  11. Quality of life of women submitted to myocardial revascularization surgery in a public hospital - doi:10.5020/18061230.2010.p237

    Directory of Open Access Journals (Sweden)

    Rafaela Melo de Oliveira

    2012-01-01

    Full Text Available Objective: To analyze the sociodemografic profile, risck factors and the quality of life of women submitted to myocardial revascularization surgery. Methods: We conducted a qualitative study by applying a questionnaire on lifestyle and risk factors and an interview with four guiding questions to 15 revascularized inpatients of cardiology units of a referral public hospital and who had no manifestations of depression prior to surgery. Results: The patients profile showed that 9 (60% were Caucasian, 8 (54% had incomplete primary education, 4(27% were housewives, 9 (60% lived in urban area, 10 (67% were married, all had a family income lower than three minimum wages and 4(27% had only two kids. From the content analysis of the interviews, the following categories aroused: religiosity, disruption with everyday life, family and quality of life. Conclusion: We found out that the knowledge about the psychosocial structure of each patient helps in the treatment of the individual submitted to myocardial revascularization. By identifying the lifestyle and risk factors, women promote self-knowledge, which can avoid habits that lead to cardiovascular diseases. We suggest the development of strategies for prevention and health promotion involving the patients and their families so that there is an extension of hospital care at home and a better adaptation to the new condition.

  12. SU-F-T-237: The Imaging and Radiation Oncology Core (IROC) Cooperatives Activities Supporting the NCI’s National Clinical Trial Network

    Energy Technology Data Exchange (ETDEWEB)

    Followill, D [UT MD Anderson Cancer Center, Houston, TX (United States); Galvin, J [Thomas Jefferson University Hospital, Newtown, PA (United States); Michalski, J [Washington University in St. Louis, St. Louis, MO (United States); Rosen, M [University of Pennsylvania Medical Center, Philadelphia, PA (United States); FitzGerald, T [University of Massachusetts Medical School, Lincoln, RI (United States); Knopp, M [The Ohio State University, Columbus, OH (United States)

    2016-06-15

    Purpose: The Imaging and Radiation Oncology Core (IROC) Cooperative has been active for the past two years supporting the National Clinical Trial Network and the details of that support are reported. Methods: There are six QA centers (Houston, Ohio, Philadelphia-RT, Philadelphia-DI, Rhode Island, St. Louis) providing an integrated RT and DI quality control program in support of the NCI’s clinical trials. The QA Center’s efforts are focused on assuring high quality data for clinical trials designed to improve the clinical outcomes for cancer patients worldwide. This program is administered through five core services: site qualification, trial design support, credentialing, data management, and case review. Results: IROC currently provides core support for 172 NCTN trials with RT, DI and RT/DI components. Many of these trials were legacy trial from the previous cooperative group program. IROC monitors nearly 1800 RT photon and 20 proton institutions. Over 28,000 beams outputs were monitored with 8% of the sites requiring repeat audits due to beam out of criteria. As part of credentialing, 950 QA phantoms have been irradiated, 515 imaging modalities evaluated and almost 4000 credentialing letters have been issued. In just year 2, 5290 RT and 4934 DI patient datasets were received (many using TRIAD) by IROC QA Centers to be prepared for review. During the past 2 years, a total of 6300 RT cases and 19,000 DI image sets were reviewed by IROC technical staff. To date, IROC has published 36 manuscripts. Conclusion: The QA services provided by IROC are numerous and are continually being evaluated for effectiveness, harmonized across all NCTN Groups and administered in an efficient and timely manner to enhance accurate and per protocol trial data submission. These efforts increase each NCTN Group’s ability to derive meaningful outcomes from their clinical trials. This work was supported by DHHS NIH grant 5U24CA180803.

  13. Investigation of the formation of residual nuclei from the radiactive .sup.237 Np and .sup.241 Am targets in the reaction with 660-MeV protons

    Czech Academy of Sciences Publication Activity Database

    Adam, Jindřich; Balabekyan, A. R.; Brandt, R.; Dzhelepov, V. P.; Gustov, S. A.; Kalinnikov, V. G.; Krivopustov, M. I.; Mirokhin, I. V.; Mrázek, Jaromír; Odoj, R.

    2002-01-01

    Roč. 65, č. 5 (2002), s. 797-809 ISSN 0044-0027 R&D Projects: GA AV ČR KSK1048102 Keywords : protons * spallation * target activation * radionuclides Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  14. Safety Evaluation Report related to the full-term operating license for Dresden Nuclear Power Station, Unit 2 ( Docket No. 50-237)

    International Nuclear Information System (INIS)

    1990-10-01

    The Safety Evaluation Report for the full-term operating license application filed by Commonwealth Edison Company for the Dresden Nuclear Power Station, Unit 2, has been prepared by the Office of Nuclear Regulation of the US Nuclear Regulatory Commission. The facility is located in Grundy County, Illinois. Subject to favorable resolution of the items discussed in this report, the staff concludes that the facility can continue to be operated without endangering the health and safety of the public. 72 refs

  15. Evaluation of the excitation function of the 238U(n,2n)237U reaction for neutron energies from threshold to 19 MeV

    International Nuclear Information System (INIS)

    Kornilov, N.V.; Vinogradov, V.N.; Gay, E.V.; Rabotnov, N.S.; Salnikov, O.A.; Raics, P.; Daroczy, S.; Nagy, S.; Csikai, J.

    1983-01-01

    Experimental results for the 238 U(n,2n) reaction were collected from the literature and evaluated. The normalisation of the measured cross sections was carried out using recent values for the cross sections of standard monitor reactions as well as new nuclear decay data. The evaluated excitation function was then obtained by the Pade-approximation. (Auth.)

  16. Exercise-induced TBC1D1 Ser237 phosphorylation and 14-3-3 protein binding capacity in human skeletal muscle

    DEFF Research Database (Denmark)

    Frøsig, Christian; Pehmøller, Christian; Birk, Jesper Bratz

    2010-01-01

    muscle (EDL) from whole-body a1 or a2 AMPK knock-out and wild-type mice were stimulated to contract in vitro. In wild-type and a1 knock-out mice, contractions resulted in a similar ~100% increase (Pknock-out mice were characterized by reduced...

  17. Integrated-plant-safety assessment Systematic Evaluation Program. Dresden Nuclear Power Station, Unit 2, Commonwealth Edison Company, Docket No. 50-237

    International Nuclear Information System (INIS)

    1982-10-01

    The Systematic Evaluation Program was initiated in February 1977 by the US Nuclear Regulatory Commission to review the designs of older operating nuclear reactor plants to reconfirm and document their safety. The review provides: (1) an assessment of how these plants compare with current licensing safety requirements relating to selected issues; (2) a basis for deciding on how these differences should be resolved in an integrated plant review; and (3) a documented evaluation of plant safety. This report documents the review of Dresden Nuclear Generating Station, Unit 2 owned and operated by the Commonwealth Edison Company and located in Grundy County, Illinois. Dresden Unit 2 is one of ten plants reviewed under Phase II of this program, which indicates how 137 topics selected for review under Phase I of the program were addressed. Equipment and procedural changes have been identified as a result of the review. It is expected that this report will be one of the bases in considering the issuance of a full-term operating license in place of the existing provisional operating license

  18. Monte Carlo simulation of γ and fission transfer-induced probabilities using extended -matrix theory: Application to the 237U∗ system

    Directory of Open Access Journals (Sweden)

    Bouland Olivier

    2017-01-01

    Full Text Available This paper deals with simultaneous neutron-induced average partial cross sections and surrogate-like probability simulations over several excitation and de-excitation channels of the compound nucleus. Present calculations, based on one-dimensional fission barrier extended -matrix theory using Monte Carlo samplings of both first and second well resonance parameters, avoid the surrogate-reaction method historically taken for surrogate data analyses that proved to be very poor in terms of extrapolated neutron-induced capture cross sections. Present theoretical approach is portrayed and subsequent results can be compared for the first time with experimental γ-decay probabilities; thanks to brand new simultaneous 238U(3He,4Heγ and 238U(3He,4He f surrogate measurements. Future integration of our strategy in standard neutron cross section data evaluation remains tied to the developments made in terms of direct reaction population probability calculations.

  19. Protocolo Nacional para la Evaluacion de Disturbios en Suelos Forestales; Volumen II: Metodos complementarios, estad&#237stica y recoleccion de datos

    Science.gov (United States)

    Deborah S. Page-Dumroese; Ann M. Abbott; Thomas M. Rice

    2013-01-01

    Este documento-El Volumen II: Métodos complementarios, estadística y recolección de datos- define las bases, los métodos estadísticos y de almacenamiento de datos de un Protocolo Nacional para la Evaluación de Disturbios en Suelos Forestales. Esta guía técnica proporciona las bases de un método consistente, con definiciones comunes, para generar datos de alta calidad,...

  20. Multibeam collection for TN237: Multibeam data collected aboard Thomas G. Thompson from 2009-07-11 to 2009-07-28, Apia, Samoa to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  1. 237. Malformación hamartomatosa de la aurícula izquierda como causa infrecuente de ataque isquémico transitorio de repetición

    Directory of Open Access Journals (Sweden)

    O. Leal

    2012-04-01

    Conclusiones: Ante la presencia de AIT, en primer lugar debemos considerar el origen cardioembólico, excluidos éstos, la patología tumoral aunque infrecuente debe tenerse en cuenta, y su tratamiento generalmente es quirúrgico.

  2. Study of fission mechanism with the reactions 230Th, 231Pa, 235U, 237Np(n,f) and 252Cf(fs)

    International Nuclear Information System (INIS)

    Benfoughal, T.

    1983-01-01

    In this work, the different stages of the nuclear fission process have been investigated. The analysis of fission cross-section and fission fragment angular distribution measurements are made using the hypothesis of asymmetrically deformed states. From the correlation between fissioning nucleus excitation energy and fragment total kinetic energy measurement for several fissioning systems, it is shown that the nuclear viscosity is relatively strong during the saddle-point to scission-point transition. The study of the spontaneous fission of 252 Cf shows that the fragment mass and kinetic energy distributions are mainly determinated by the nucleon shell effects and pairing correlations [fr

  3. Study on the adsorption of 233Pa in glass

    International Nuclear Information System (INIS)

    Natsumi, R.R.; Saiki, M.; Lima, F.W. de.

    1982-08-01

    It is intended to examine the adsorption of protactinium on glass in relation to pH, presence of complexing agents concentration and type of electrolytes. The study was made by using carrier-free 233 Pa solution and Pyrex glass tube was selected as adsorbent glass material surface. The adsorption curve of protactinium on glass surface as a function of the pH of the tracer solution showed the existence of two pronounced adsorption regions. It was found that this adsorption can be reduced by using electrolytes or complexing agents. Desorption of protactinium previously adsorbed on the Pyrex glass tube was also studied. Hidrochloric, oxalic and hydrofluoric acid solutions were used for the desorption experiments. (Author) [pt

  4. An extraction method of uranium 233 from the thorium irradiates in a reactor core

    International Nuclear Information System (INIS)

    Chesne, A.; Regnaut, P.

    1955-01-01

    Description of the conditions of separation of the thorium, of the uranium 233 and of the protactinium 233 in hydrochloric solution by absorption then selective elution on anion exchange resin. A precipitation of the thorium by the oxalic acid permits the recuperation of the hydrochloric acid which is recycled, the main, raw material consumed being the oxalic acid. (authors) [fr

  5. Molten salt reactors: chemistry

    International Nuclear Information System (INIS)

    1983-01-01

    This work is a critical analysis of the 1000 MW MSBR project. Behavior of rare gases in the primary coolant circuit, their extraction from helium. Coating of graphite by molybdenum, chemistry of protactinium and niobium produced in the molten salt, continuous reprocessing of the fuel salt and use of stainless steel instead of hastelloy are reviewed [fr

  6. Feasibility studies of thermonuclear neutron capture synthesis of SHE

    International Nuclear Information System (INIS)

    Meldner, H.W.

    1978-01-01

    A variety of thermonuclear neutron sources and neutron capture targets were investigated for their potential of allowing signigicant production of heavy, perhaps superheavy, isotopes. The neutron sources considered range from inertial confinement microexplosives to (underground) macroexplosives. Optimal capture targets appear to be composites containing uranium and protactinium. 1 figure

  7. REGENERATION OF FISSION-PRODUCT-CONTAINING MAGNESIUM-THORIUM ALLOYS

    Science.gov (United States)

    Chiotti, P.

    1964-02-01

    A process of regenerating a magnesium-thorium alloy contaminated with fission products, protactinium, and uranium is presented. A molten mixture of KCl--LiCl-MgCl/sub 2/ is added to the molten alloy whereby the alkali, alkaline parth, and rare earth fission products (including yttrium) and some of the thorium and uranium are chlorinated and

  8. First results studying the transmutation of 129I, 237Np, 238Pu, and 239Pu in the irradiation of an extended natU/Pb-assembly with 2.52 GeV deuterons

    Czech Academy of Sciences Publication Activity Database

    Krivopustov, M. I.; Pavljuk, A. V.; Kovalenko, A.D.; Mariin, I.I.; Elishev, A.F.; Adam, Jindřich; Kovalík, Alojz; Batusov, Yu, A.; Kalinnikov, V. G.; Brudanin, V. B.; Čaloun, Pavel; Tsoupko-Sitnikov, V. M.; Solnyshkin, A. A.; Stegailov, V. I.; Gerbish, Sh.; Svoboda, Ondřej; Dubnická, Z.; Kala, M.; Kloc, M.; Krása, Antonín; Kugler, Andrej; Majerle, Mitja; Wagner, Vladimír; Brandt, R.; Westmeier, W.; Robotham, H.; Siemon, K.; Bielewicz, M.; Kilim, S.; Szuta, M.; Strugalska-Gola, E.; Wojeciechowski, A.; Hashemi-Nezhad, R. S.; Manolopoulou, M.; Fragopolou, M.; Stoulos, S.; Zamani-Valasiadou, M.; Jokic, S.; Katovsky, K.; Schastny, O.; Zhuk, I. V.; Potapenko, A.S.; Safronova, A.A.; Lukashevich, Zh.A.; Voronko, V.A.; Sotnikov, V.V.; Sidorenko, V.V.; Ensinger, W.; Severin, H.D.; Batsev, S.; Kostov, L.; Protokhristov, Kh.; Stoyanov, Ch,.; Yordanov, O.; Zhivkov, P.K.; Kumar, A.V.; Sharma, M.; Khilmanovich, A.M.; Marcinkevich, B.A.; Korneev, S.V.; Damdinsuren, Ts.; Togoo, Ts.; Kumawat, H.

    2009-01-01

    Roč. 279, č. 2 (2009), s. 567-584 ISSN 0236-5731 R&D Projects: GA AV ČR IAA100480803; GA MŠk LC07050 Institutional research plan: CEZ:AV0Z10480505 Keywords : MCNPX. * GeV Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.631, year: 2009

  9. ADS-HE: Evaluated Nuclear Data Library up to 1 GeV for 202Hg, 208Pb, 209Bi, 232Th, 235U, 238U, 237Np, 239Pu, 242Am and 245Cm

    International Nuclear Information System (INIS)

    Lopez Aldama, Daniel

    2013-12-01

    Accelerator Driven Systems (ADS) are being developed for power generation and the transmutation of actinide and fission product waste, and well-defined cross-section libraries suitable for their transport calculations are required. Transport of high energy neutrons and protons near the target assembly requires an extension of the library for incident energies up to 1 GeV. An ADS-HE library for incident neutrons on selected target elements has been developed to meet this request, and assist benchmarking studies linked to ADS experiments and design concepts. New evaluations of high-energy data from 20 MeV up to 1 GeV have been carried out by S.G. Yavshits and O.T. Grudzevich (see INDC(NDS)-0615). The ADS- HE library has been prepared from these high-energy evaluations combined with evaluations below 20 MeV selected from the ENDF/B-VII.1, the JEFF-3.1.2 and the JENDL-4u2 libraries. The ADS-HE library was processed in suitable forms for Monte Carlo transport codes used in the analysis of ADS. ADS-HE is freely available from the IAEA Nuclear Data Section, and is readily accessible on the web site: http://www-nds.iaea.org/ads/adshe.html. (author)

  10. Leopoldo Lugones. El ángel de la sombra, estudio preliminar de María Teresa Gramuglio : Buenos Aires, Editorial Losada, 1994, 237 páginas

    OpenAIRE

    Dalmaroni, Miguel Ángel

    1996-01-01

    Fechado en octubre de 1994 y distribuido durante el año pasado, el libro del que nos ocupamos aquí puede considerarse un acontecimiento de cierta importancia en la bibliografía lugoniana: se trata de la primera reedición de la única novela que escribiera el autor de La guerra gaucha. Con El ángel de la sombra, publicado por primera y única vez en 1926 bajo el sello editorial de Manuel Gleizer, Lugones conoció su más rotundo fracaso de lectores y de crítica. Luego, aquel llamado de atención de...

  11. Procedures for determination of 239,240Pu, 241Am, 237Np, 234,238U, 228,230,232Th, 99Tc and 210Pb-210Po in environmental material

    International Nuclear Information System (INIS)

    Kolstad, A. K.; Lind, B.; QingJiang Chen; Aarkrog, A.; Nielsen, S.P.; Dahlgaard, H.; Yixuan Yu

    2001-12-01

    Since 1987, the Department of Nuclear Safety Research, Risoe National Laboratory has developed procedures for analysis of low-level amounts of radioactivity in large samples of 200 liters seawater, 10 gram sediment, soil and other environmental materials. These analytical procedures provide high chemical yields, good resolution and excellent decontamination factors for large environmental samples analysed by alpha spectrometry and mass spectrometry (ICPMS). The procedures have been checked through practical analysis work and are used in Norway, the Netherlands, Germany, Spain, France and Denmark. (au)

  12. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT228-237 during 2011 (NODC Accession 0101727)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  13. An extraction method of uranium 233 from the thorium irradiates in a reactor core; Une methode d'extraction de l'uranium-233 a partir du thorium irradie dans une pile

    Energy Technology Data Exchange (ETDEWEB)

    Chesne, A; Regnaut, P [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1955-07-01

    Description of the conditions of separation of the thorium, of the uranium 233 and of the protactinium 233 in hydrochloric solution by absorption then selective elution on anion exchange resin. A precipitation of the thorium by the oxalic acid permits the recuperation of the hydrochloric acid which is recycled, the main, raw material consumed being the oxalic acid. (authors) [French] Description des conditions de separation du thorium, de l'uranium 233 et du protactinium 233 en solution chlorhydrique par absorption puis elution selective sur resine echangeuse d'anions. Une precipitation du thoriun par l'acide oxalique permet la recuperation de l'acide chlorhydrique qui est recycle, la principale matiere premiere consommee etant l'acide oxalique. (auteurs)

  14. Sorption studies of radioelements on geological materials

    International Nuclear Information System (INIS)

    Berry, John A.; Yui, Mikazu; Kitamura, Akira

    2007-11-01

    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)

  15. Determination of thorium in native gold by radiochemical neutron activation analysis

    International Nuclear Information System (INIS)

    Liu, Y.; Kraehenbuehl, U.

    1995-01-01

    Thorium concentrations in 11 native gold samples from different sources, e.g. placer gold, vein and lode gold were determined. Thorium was determined by radiochemical separation and measurement of protactinium from irradiated native gold samples. The chemical yield of the separation procedures is 90%. Other elements were measured by gamma-ray spectroscopy. The radiochemical separation procedures described in this work make accurate determination of Th concentrations in native gold at picogram concentrations possible. (orig.)

  16. The actinides

    International Nuclear Information System (INIS)

    Bagnall, K.W.

    1987-01-01

    This chapter of coordination compound chemistry is devoted to the actinides and starts with a general survey. Most of the chapter relates to thorium and uranium but protactinium, neptunium and plutonium are included. There are sections on nitrogen, phosphorus, sulfur, selenium, tellurium and halogen ligands of the metals in their +3, +4, +5 and +6 oxidation states and of the transplutonium elements in their +2, +3, +4, and +5 oxidation states. (UK)

  17. Gas-Phase Energetics of Actinide Oxides: An Assessment of Neutral and Cationic Monoxides and Dioxides from Thorium to Curium

    Science.gov (United States)

    Marçalo, Joaquim; Gibson, John K.

    2009-09-01

    An assessment of the gas-phase energetics of neutral and singly and doubly charged cationic actinide monoxides and dioxides of thorium, protactinium, uranium, neptunium, plutonium, americium, and curium is presented. A consistent set of metal-oxygen bond dissociation enthalpies, ionization energies, and enthalpies of formation, including new or revised values, is proposed, mainly based on recent experimental data and on correlations with the electronic energetics of the atoms or cations and with condensed-phase thermochemistry.

  18. The f electron collapse revisited

    International Nuclear Information System (INIS)

    Bennett, B.I.

    1987-03-01

    A reexamination of the collapse of 4f and 5f electrons in the lanthanide and actinide series is presented. The calculations show the well-known collapse of the f electron density at the thresholds of these series along with an f 2 collapse between thorium and protactinium. The collapse is sensitive to the choice of model for the exchange-correlation potential and the behavior of the potential at large radius

  19. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 112 ... Query: 237 RIELHGVNFKYDSAELTDSAKRILDETAENLILFPEKRDIEVAGHTSTEGT...NEYNMRLSI 296 ... RIELHGVNFKYDSAELTDSAKRILDETAENLILFPEKRDIEVAGHTSTEGTNEYNMRLSI Sbjct: 1 ... RIELHGVNFKYDSAELTDSAKRILDETAENLILFPEKRDIEVAGHTSTEGTNEYNMRLSI 60 ...

  20. ORF Alignment: NC_000854 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 237 ... Query: 64 ... LLVVVTFPGLKSDVELIACSGDRVIEIYNPGVDPHEAQLDPRAARMVAEAD...IVVTGGHTP 123 ... LLVVVTFPGLKSDVELIACSGDRVIEIYNPGVDPHEAQLDPRAARMVAEADIVVTGGHTP Sbjct: 1 ... LLVVVTFPGLKSDVELIACSGDRVIEIYNPGVDPHE

  1. ORF Alignment: NC_006348 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 98 ... Query: 237 IVAAARDYVLAHRSRPVGVPELCEQLHVSRRTLQYCFQDVLGMAPATYLRALRLNGVRRD 296 ... IVAAARDYVLAHRSRP...VGVPELCEQLHVSRRTLQYCFQDVLGMAPATYLRALRLNGVRRD Sbjct: 1 ... IVAAARDYVLAHRSRPVGVPELCEQLHVSRRTLQYCFQDVLGMAPATYLRALRLNGVRRD 60 ...

  2. Comment on Spracklandus Hoser, 2009 (Reptilia, Serpentes, ELAPIDAE): request for confirmation of availability of the generic name and for the nomenclatural validation of the journal in which it was published (Case 3601; BZN 70:234–237; 71:30–38; 133-135,181-182 ,252-253)

    Science.gov (United States)

    Rhodin, Anders G.J.; Kaiser, Hinrich; van Dijk, Peter Paul; Wüster, Wolfgang; O’Shea, Mark; Archer, Michael; Auliya, Mark; Boitani, Luigi; Bour, Roger; Clausnitzer, Viola; Contreras-MacBeath, Topiltzin; Crother, Brian I.; Daza, Juan M.; Driscoll, Carlos A.; Flores-Villela, Oscar; Frazier, Jack; Fritz, Uwe; Gardner, Alfred L.; Gascon, Claude; Georges, Arthur; Glaw, Frank; Grazziotin, Felipe G.; Groves, Colin P.; Haszprunar, Gerhard; Havaš, Peter; Hero, Jean-Marc; Hoffmann, Michael; Hoogmoed, Marinus S.; Horne, Brian D.; Iverson, John B.; Jäch, Manfred; Jenkins, Christopher L.; Jenkins, Richard K.B.; Kiester, A. Ross; Keogh, J. Scott; Lacher, Thomas E.; Lovich, Jeffrey E.; Luiselli, Luca; Mahler, D. Luke; Mallon, David P.; Mast, Roderic; McDiarmid, Roy W.; Measey, John; Mittermeier, Russell A.; Molur, Sanjay; Mosbrugger, Volker; Murphy, Robert W.; Naish, Darren; Niekisch, Manfred; Ota, Hidetoshi; Parham, James F.; Parr, Michael J.; Pilcher, Nicolas J.; Pine, Ronald H.; Rylands, Anthony B.; Sanderson, James G.; Savage, Jay M.; Schleip, Wulf; Scrocchi, Gustavo J.; Shaffer, H. Bradley; Smith, Eric N.; Sprackland, Robert; Stuart, Simon N.; Vetter, Holger; Vitt, Laurie J.; Waller, Tomás; Webb, Grahame; Wilson, Edward O.; Zaher, Hussam; Thomson, Scott

    2015-01-01

    In Case 3601 Raymond Hoser has asked the Commission to validate for the purposes of nomenclature the name Spracklandus Hoser, 2009, and ‘the journal in which it was published,’ issue 7 of the Australasian Journal of Herpetology (AJH). We note that the entire run of AJH has been written, edited, and published solely by Hoser. Although his requests to the Commission were presented as narrow and, in his words, ‘routine matters,’ we are convinced that they represent an important tipping-point with broad implications of major concern for zoological taxonomy and nomenclature as a whole and, by extension, the greater scientific community. Since Hoser’s actions and works have failed to follow scientific best practices (e.g. Turtle Taxonomy Working Group, 2007, 2014; Kaiser et al., 2013; Kaiser, 2014) and both the Commission’s general Recommendations and Code of Ethics in Appendix A, the global herpetological community has widely rejected his taxonomic decisions and resultant nomenclature. This has unfortunately caused a confusing dual nomenclature to develop in the herpetological community, with most boycotting or ignoring Hoser’s 700+ new names coined in the AJH, while he and a few personal followers actively promote their usage. We believe that suppression of the name Spracklandus, and all issues of AJH, is the only effective way to bring this contentious and confusing issue to resolution. The plenary power available under Article 81.1 of the Code exist specifically to allow the Commission to make rulings in individual cases that disturb stability and cause confusion, whether the works are Code-compliant or not. We maintain that it is in the interest of nomenclatural stability, not only for herpetology, but for all of zoological taxonomy, that the plenary power be invoked to declare the works in AJH unavailable, regardless of any narrow interpretation of their technical Code-compliance. We present our arguments for rejection of the validity of AJH in the following commentary. In view of the wide-reaching implications of this case for all of zoology, and reflecting the deep and broad-based community concern over these issues, our contributing authors include 70 global scientific leaders and accomplished amateurs from a wide variety of zoological disciplines.

  3. Safety assessment of poloxamers 101, 105, 108, 122, 123, 124, 181, 182, 183, 184, 185, 188, 212, 215, 217, 231, 234, 235, 237, 238, 282, 284, 288, 331, 333, 334, 335, 338, 401, 402, 403, and 407, poloxamer 105 benzoate, and poloxamer 182 dibenzoate as used in cosmetics.

    Science.gov (United States)

    Singh-Joy, Subhashni D; McLain, Valerie C

    2008-01-01

    Poloxamers are polyoxyethlyene, polyoxypropylene block polymers. The impurities of commercial grade Poloxamer 188, as an example, include low-molecular-weight substances (aldehydes and both formic and acetic acids), as well as 1,4-dioxane and residual ethylene oxide and propylene oxide. Most Poloxamers function in cosmetics as surfactants, emulsifying agents, cleansing agents, and/or solubilizing agents, and are used in 141 cosmetic products at concentrations from 0.005% to 20%. Poloxamers injected intravenously in animals are rapidly excreted in the urine, with some accumulation in lung, liver, brain, and kidney tissue. In humans, the plasma concentration of Poloxamer 188 (given intravenously) reached a maximum at 1 h, then reached a steady state. Poloxamers generally were ineffective in wound healing, but were effective in reducing postsurgical adhesions in several test systems. Poloxamers can cause hypercholesterolemia and hypertriglyceridemia in animals, but overall, they are relatively nontoxic to animals, with LD(50) values reported from 5 to 34.6 g/kg. Short-term intravenous doses up to 4 g/kg of Poloxamer 108 produced no change in body weights, but did result in diffuse hepatocellular vacuolization, renal tubular dilation in kidneys, and dose-dependent vacuolization of epithelial cells in the proximal convoluted tubules. A short-term inhalation toxicity study of Poloxamer 101 at 97 mg/m(3) identified slight alveolitis after 2 weeks of exposure, which subsided in the 2-week postexposure observation period. A short-term dermal toxicity study of Poloxamer 184 in rabbits at doses up to 1000 mg/kg produced slight erythema and slight intradermal inflammatory response on histological examination, but no dose-dependent body weight, hematology, blood chemistry, or organ weight changes. A 6-month feeding study in rats and dogs of Poloxamer 188 at exposures up to 5% in the diet produced no adverse effects. Likewise, Poloxamer 331 (tested up to 0.5 g/kg day(-1)), Poloxamer 235 (tested up to 1.0 g/kg day(-1)), and Poloxamer 338 (at 0.2 or 1.0 g/kg day(-1)) produced no adverse effects in dogs. Poloxamer 338 (at 5.0 g/kg day(-1)) produced slight transient diarrhea in dogs. Poloxamer 188 at levels up to 7.5% in diet given to rats in a 2-year feeding study produced diarrhea at 5% and 7.5% levels, a small decrease in growth at the 7.5% level, but no change in survival. Doses up to 0.5 mg/kg day(-1) for 2 years using rats produced yellow discoloration of the serum, high serum alkaline phosphatase activity, and elevated serum glutamicpyruvic transaminase and glutamic-oxalacetic transaminase activities. Poloxamers are minimal ocular irritants, but are not dermal irritants or sensitizers in animals. Data on reproductive and developmental toxicity of Poloxamers were not found. An Ames test did not identify any mutagenic activity of Poloxamer 407, with or without metabolic activation. Several studies have suggested anticarcinogenic effects of Poloxamers. Poloxamers appear to increase the sensitivity to anticancer drugs of multidrug-resistant cancer cells. In clinical testing, Poloxamer 188 increased the hydration of feces when used in combination with a bulk laxative treatment. Compared to controls, one study of angioplasty patients receiving Poloxamer 188 found a reduced myocardial infarct size and a reduced incidence of reinfarction, with no evidence of toxicity, but two other studies found no effect. Poloxamer 188 given to patients suffering from sickle cell disease had decreased pain and decreased hospitilization, compared to controls. Clinical tests of dermal irritation and sensitization were uniformly negative. The Cosmetic Ingredient Review (CIR) Expert Panel stressed that the cosmetic industry should continue to use the necessary purification procedures to keep the levels below established limits for ethylene oxide, propylene oxide, and 1,4-dioxane. The Panel did note the absence of reproductive and developmental toxicity data, but, based on molecular weight and solubility, there should be little skin penetration and any penetration of the skin should be slow. Also, the available data demonstrate that Poloxamers that are introduced into the body via routes other than dermal exposure have a rapid clearance from the body, suggesting that there would be no risk of reproductive and/or developmental toxicity. Overall, the available data do not suggest any concern about carcinogenesis. Although there are gaps in knowledge about product use, the overall information available on the types of products in which these ingredients are used, and at what concentration, indicates a pattern of use. Based on these safety test data and the information that the manufacturing process can be controlled to limit unwanted impurities, the Panel concluded that these Poloxamers are safe as used.

  4. STANDARD ATOMIC WEIGHT VALUES FOR THE MONONUCLIDIC ELEMENTS - 2001

    International Nuclear Information System (INIS)

    HOLDEN, N.E.

    2001-01-01

    Atomic Mass Evaluations have had a major impact on the values of the atomic weights for the twenty mononuclidic elements plus two elements, Thorium and Protactinium, which have no stable nuclides but a characteristic terrestrial isotopic composition. This paper reviews the history of the atomic weight values of these elements in the years, since the reference mass standard changed from 16 O to 12 C. There is a problem for Thorium, which is considered to have an abundance value of 100%, but is not treated as such in the Standard Atomic Weights' Table. Recommendations for handling the Standard Atomic Weight values for 2001 are presented

  5. The speciation of dissolved elements in aquatic solution. Radium and actinides

    International Nuclear Information System (INIS)

    Haesaenen, E.

    1994-01-01

    In the publication, the chemistry and speciation of radium, thorium, protactinium, uranium, neptunium, lutonium, americium and curium in ground-water environment is reviewed. Special attention is given to the transuranium elements, which have a central role in the repository of nuclear wastes. The most important methods used in the speciation of these elements is presented. The laser-induced methods, developed in the 1980's, are especially discussed. These have made it possible, e.g., to speciate the transuranium elements in their very low, actual repository ground-water concentrations (10-100 ng/l). (54 refs., 10 figs., 3 tabs.)

  6. Adjustment of a direct method for the determination of man body burden in Pu-239 on by X-ray detection of U-235

    International Nuclear Information System (INIS)

    Boulay, P.

    1968-04-01

    The use of Pu-239 on a larger scale sets a problem about the contamination measurement by aerosol at lung level. A method of direct measurement of Pu-239 lung burden is possible, thanks to the use of a large area window proportional counter. A counter of such pattern, has been especially carried out for this purpose. The adjustment of the apparatus allows an adequate sensibility to detect a contamination at the maximum permissible body burden level. Besides, a method for individual 'internal calibration', with a plutonium mock: the protactinium-233, is reported. (author) [fr

  7. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.

    1985-01-01

    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  8. Preparation of uranium-230 as a new uranium tracer

    International Nuclear Information System (INIS)

    Hashimoto, T.; Kido, K.; Sotobayashi, T.

    1977-01-01

    A uranium isotope, 230 U(T=20.8 d), was produced from the 231 Pa(γ,n) 230 Pa→viaβ - decay 230 U process with a bremsstrahlung irradiation on a protactinium target. After standing for about one month to obtain a maximal growth of 230 U, the uranium was chemically purified, applying an ion-exchange method. The purity of the 230 U obtained was examined with alpha spectrometry and an intrinsic alpha peak due to 230 U as a new uranium tracer in an alpha spectrometric analysis of uranium isotopes is described. (author)

  9. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  10. MOX-fuel inherent proliferation-protection due to {sup 231}Pa admixture

    Energy Technology Data Exchange (ETDEWEB)

    Kryuchkov, E.F.; Glebov, V.B.; Apse, V.A.; Shmelev, A.N. [Moscow Engineering Physics Institute (State University), Moscow (Russian Federation)

    2003-07-01

    The proliferation protection levels of MOX-fuel containing small additions of protactinium are evaluated for equilibrium closed and open cycles of a light-water reactor (LWR).Analysis of the ways to the proliferation protection of MOX-fuel by small {sup 231}Pa addition and comparison of this way with another options for giving MOX-fuel the proliferation self-protection property enable us to make the 3 following conclusions: -1) Unique nature of protactinium as a small addition to MOX-fuel is determined by the following properties: - Protactinium is available in the nature (uranium ore) as a long-lived mono-isotope {sup 231}Pa, - under neutron irradiation, {sup 231}Pa is converted into {sup 232}U, which is a long-term source of high energy gamma-radiation and practically non-separable from main fuel mass, - essentially, {sup 231}Pa is a high-quality burnable neutron absorber. -2) From the proliferation self-protection point of view, nuclear fuel cycle closure with fuel recycle is a preferable option because, under this condition, introduction of protactinium into MOX-fuel allows to create the inherent radiation barrier which is in action during full cycle of fuel management at the level corresponding to the accepted today criterion of the Spent Fuel Standard (SFS). In particular, the considered example of multiple MOX-fuel recycle with small addition of {sup 231}Pa (0.2% HM) at each cycle demonstrates a possibility to reach the proliferation protection level of fresh MOX-fuel corresponding to once irradiated fuel with the same cooling time. In this case, the lethal dose (at 30 cm distance from fuel assembly) is received within the minute range. -3) Introduction of {sup 231}Pa into MOX-fuel composition in amount of 0.5% HM allows to prolong action of the SFS from 100 to 200 years. If {sup 231}Pa content is increased up to 5% HM, then MOX-fuel conserves the proliferation self-protection property in respect to short-term unauthorized actions for 200-year period of its

  11. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    Energy Technology Data Exchange (ETDEWEB)

    NA

    2004-11-22

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.

  12. Adjustment of a direct method for the determination of man body burden in Pu-239 on by X-ray detection of U-235; Mise au point d'une methode directe de determination de la charge corporelle en plutonium 239 chez l'homme par detection X de l'uranium 235

    Energy Technology Data Exchange (ETDEWEB)

    Boulay, P [Commissariat a l' Energie Atomique, Bruyeres-le-Chatel (France). Centre d' Etudes

    1968-04-01

    The use of Pu-239 on a larger scale sets a problem about the contamination measurement by aerosol at lung level. A method of direct measurement of Pu-239 lung burden is possible, thanks to the use of a large area window proportional counter. A counter of such pattern, has been especially carried out for this purpose. The adjustment of the apparatus allows an adequate sensibility to detect a contamination at the maximum permissible body burden level. Besides, a method for individual 'internal calibration', with a plutonium mock: the protactinium-233, is reported. (author) [French] L'utilisation a une echelle de plus en plus large du plutonium-239 pose un probleme de la mesure de la contamination par aerosol au niveau du poumon. Une methode de mesure directe de la charge pulmonaire en plutonium-239 est possible grace a l'utilisation d'un compteur proportionnel a fenetre de grande surface. Un compteur de ce type a specialement ete realise dans ce but. La mise au point de l'appareillage permet une sensibilite suffisante pour deceler une contamination au niveau de la Q.M.A (quantite maximale admissible). D'autre part, une methode 'd'etalonnage interne' de l'individu a l'aide d'un simulateur de plutonium, le protactinium-233, est decrite. (auteur)

  13. Radionuclide interactions with marine sediments

    International Nuclear Information System (INIS)

    Higgo, J.J.W.

    1987-09-01

    A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)

  14. The Influenced of Salting Out Agent of Phosphat Ion and Ferrosulfamic in Extraction of Thorium and Uranium

    International Nuclear Information System (INIS)

    Busron Masduki; Didiek Herhady, R.

    2002-01-01

    It was carried out thorium-uranium extraction using one stage mixer settler to investigate the influenced of salting out agent of nitric acid and nitric aluminium. The result of this experiment showed the salting out of agent for nitric aluminium of 0.5 M much more significantly increase the distribution coefficient of uranium, but not for the thorium. The distribution coefficient of thorium much more significantly increased after nitric aluminium addition ≥1.0 M. There was not any meaningly differences the waste volume between nitric acid and nitric aluminium in its utilization. Reductor agent of ion Fe 2+ for chromi and decontaminate agent for protactinium in feed extraction, did not any influences of thorium and uranium distribution coefficient. (author)

  15. Large-scale shell model calculations for the N=126 isotones Po-Pu

    International Nuclear Information System (INIS)

    Caurier, E.; Rejmund, M.; Grawe, H.

    2003-04-01

    Large-scale shell model calculations were performed in the full Z=82-126 proton model space π(Oh 9/2 , 1f 7/2 , Oi 13/2 , 2p 3/2 , 1f 5/2 , 2p 1/2 ) employing the code NATHAN. The modified Kuo-Herling interaction was used, no truncation was applied up to protactinium (Z=91) and seniority truncation beyond. The results are compared to experimental data including binding energies, level schemes and electromagnetic transition rates. An overall excellent agreement is obtained for states that can be described in this model space. Limitations of the approach with respect to excitations across the Z=82 and N=126 shells and deficiencies of the interaction are discussed. (orig.)

  16. Method for converting UF5 to UF4 in a molten fluoride salt

    International Nuclear Information System (INIS)

    Bennett, M.R.; Bamberge, C.E.; Kelmers, A.D.

    1980-01-01

    The subject relates to fuel preparation for molten salt breeder reactors, and more particularly to the reconstitution of spent molten fuel salt after fission product removal. During the course of reactor operation, fission products including rare earths and bred-in protactinium build up in the fuel salt and adversely affect the nuclear properties of the fuel. In order to more efficiently operate the reactor, the level of neutron poison fission products must be kept at a minimum. This is accomplished by continuously removing spent fuel from the primary circuit, processing it to remove fission products, and returning the reprocessed molten salt to the primary circuit. It is desirable for safety and economy that the fuel processing plant be a component of the reactor itself and that the salt be kept in the molten state throughout the processing system. (auth)

  17. Definition of breeding gain for molten salt reactors - 147

    International Nuclear Information System (INIS)

    Nagy, K.; Kloosterman, J.L.; Lathouwers, D.; Van der Hagen, T.H.J.J.

    2010-01-01

    The graphite-moderated Molten Salt Reactor (MSR) is a potential breeder reactor using the thorium fuel cycle. The MSR has unique properties due to the possibility of making changes to the salt composition during operation. Most important is the extraction of protactinium, which separates the fissile uranium production into two volumes: the reactor core and the external stockpile. The paper focuses on the definition of breeding gain in such a system. The prospects of using breeding gain expressions defined for solid fuel reactors are investigated and new definitions are given which incorporate the processes occurring in the reactor core and the external stockpile. The difference of the growth rate of the mass of fissile material and breeding gain is pointed out. The new definitions are applied to an optimization study of the graphite-salt lattice of a breeder MSR. (authors)

  18. Properties of Group Five and Group Seven transactinium elements

    Energy Technology Data Exchange (ETDEWEB)

    Wilk, Philip A. [Univ. of California, Berkeley, CA (United States)

    2001-05-01

    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 ±19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was

  19. North Atlantic ocean circulation and abrupt climate change during the last glaciation.

    Science.gov (United States)

    Henry, L G; McManus, J F; Curry, W B; Roberts, N L; Piotrowski, A M; Keigwin, L D

    2016-07-29

    The most recent ice age was characterized by rapid and hemispherically asynchronous climate oscillations, whose origin remains unresolved. Variations in oceanic meridional heat transport may contribute to these repeated climate changes, which were most pronounced during marine isotope stage 3, the glacial interval 25 thousand to 60 thousand years ago. We examined climate and ocean circulation proxies throughout this interval at high resolution in a deep North Atlantic sediment core, combining the kinematic tracer protactinium/thorium (Pa/Th) with the deep water-mass tracer, epibenthic δ(13)C. These indicators suggest reduced Atlantic overturning circulation during every cool northern stadial, with the greatest reductions during episodic Hudson Strait iceberg discharges, while sharp northern warming followed reinvigorated overturning. These results provide direct evidence for the ocean's persistent, central role in abrupt glacial climate change. Copyright © 2016, American Association for the Advancement of Science.

  20. The chemistry of the actinide elements. Volume I

    International Nuclear Information System (INIS)

    Katz, J.J.; Seaborg, G.T.; Morss, L.R.

    1986-01-01

    The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements

  1. Near-field solubility studies

    International Nuclear Information System (INIS)

    Thomason, H.P.; Williams, S.J.

    1992-02-01

    Experimental determinations of the solubilities of americium, plutonium, neptunium, protactinium, thorium, radium, lead, tin, palladium and zirconium are reported. These elements have radioactive isotopes of concern in assessments of radioactive waste disposal. All measurements were made under the highly alkaline conditions typical of the near field of a radioactive waste repository which uses cementitious materials for many of the immobilisation matrices, the backfill and the engineered structures. Low redox potentials, typical of those resulting from the corrosion of iron and steel, were simulated for those elements having more than one accessible oxidation state. The dissolved concentrations of the elements were defined using ultrafiltration. In addition, the corrosion of iron and stainless steel was shown to generate low redox potentials in solution and the solubility of iron(II) at high pH was measured and found to be sufficient for it to act as a redox buffer with respect to neptunium and plutonium. (author)

  2. Variation of 231Pa, 230Th and 231Paex/230Thex in surface sediments of the Sabah-Sarawak coastal waters

    International Nuclear Information System (INIS)

    Zal U'yun Wan Mahmood; Zaharudin Ahmad; Abdul Kadir Ishak; Norfaizal Mohamed; Che Abd Rahim Mohamed

    2011-01-01

    Protactinium and thorium activities were measured in eight surface sediment taken in 2004 to determine effectiveness scavenging of 231 Pa at Sabah-Sarawak coastal waters. The result found that activity ratios of 231 Pa ex / 230 Th ex were ranged from 0.07 to 0.13 at all sampling stations. The high 231 Pa ex / 230 Th ex activity ratio than the production ratio of 0.093 in seawater at station SR 01, SR 02, SR 04, SB 02 and SB 05, revealed that 231 Pa is effectively removed from the water column into the sediment in comparison with 230 Th at those stations. Low percentage of 230 Th ex (90-95%) in comparison with 231 Pa ex at all stations can be attributed to less efficiently scavenged of 230 Th onto particles prior deposited at the marine sediment bed. (author)

  3. Production of 231Pa and 232U by irradiation of 230Th/232Th mixtures

    International Nuclear Information System (INIS)

    Kluge, E.; Lieser, K.H.

    1981-01-01

    The production of 231 Pa and of 232 U by irradiating a 230 Th/ 232 Th mixture (containing 12 mol per cent 230 Th) in form of ThO 2 at a thermal neutron flux of 6.9 x 10 13 cm -2 s -1 for 4 months was investigated. Pa, U and Th were separated and the chemical yields were determined. 2.6% of the 230 Th were transformed into 231 Pa and 0.13% into 232 U. These values are higher than those calculated for a thermal flux, but lower than those calculated for a flux ratio epithermal to thermal = 0.03. 231 Pa and 232 U were isolated in form of a protactinium solution and of U 3 O 8 with 94.9 and 89.1% chemical yields, respectively. Foreign activities were not detected. Thorium was recuperated and isolated as ThO 2 , with a chemical yield of 93.6%. (orig.)

  4. Uranium-series disequilibrium data for tooth fragments from the fossil hominid site at Ternifine, Algeria

    International Nuclear Information System (INIS)

    Szabo, B.J.

    1982-01-01

    Uranium-series dating ussumes that fossil bones rapidly takes up uranium, although no thorium or protactinium, soon after burial, and that the bone neither gains nor loses uranium and 230 Th, and 231 Pa. The report analyses elephant molar-tooth fragments for uranium series dating. Three samples were heated for eight hours, the concentrations were determined on a solid-source mass spectrometer, and the 234 U/ 238 U, 230 Th/ 234 U and 231 Pa/ 235 U activivy ratios were determined by alpha spectrometric analyses using chemical and instrumental procedures. There is no firm radiometric age estimate of the prehistoric site of Ternifine, Algeria but is believe to be between 200 000 and 1 100 000 years

  5. Calculation of a TBP extraction column

    International Nuclear Information System (INIS)

    Lima Soares, M.L. de.

    1973-01-01

    Problems involving the number of stages in an extraction column and the equipment needed in most aqueous methods of reprocessing of nuclear fuels were studied. A solution for the separation of uranium from fission products in a feed solution that contains these components plus nitric acid, thorium and protactinium is obtained. The program has peculiarities such as treatment of tracer components; acceptance of decontamination and recuperation factors better than the set values for the solution; occurrence of niaxima concentrations; change of key component; criterion for ending of section; corrections for interaction; input data not including concentration estimates of the raffinate and organic extract; set of limitations for the concentrations based on input data to help convergence

  6. An aerial radiological survey of the Central Savannah River Site, Aiken, South Carolina

    International Nuclear Information System (INIS)

    Feimster, E.L.

    1991-09-01

    An aerial radiological survey was conducted over a 194-square- kilometer (75-square-mile) area encompassing the central portion of the Savannah River Site (SRS). The survey was flown during February 10--27, 1987. These radiological measurements were used as baseline data for the central area and for determining the extent of man-made radionuclide distribution. Previous SRS surveys included small portions of the area; the 1987 survey was covered during the site- wide survey conducted in 1979. Man-made radionuclides (including cobalt-60, cesium-137, protactinium-234m, and elevated levels of uranium-238 progeny) that were detected during the survey were typical of those produced by the reactor operations and material processing activities being conducted in the area. The natural terrestrial radiation levels were consistent with those measured during prior surveys of other SRS areas. 1 refs., 4 figs

  7. Properties of Group Five and Group Seven transactinium elements

    International Nuclear Information System (INIS)

    Wilk, Philip A.

    2001-01-01

    The detection and positive identification of the short-lived, low cross section isotopes used in the chemical studies of the heaviest elements are usually accomplished by measuring their alpha-decay, thus the nuclear properties of the heaviest elements must be examined simultaneously with their chemical properties. The isotopes 224 Pa and 266,267 Bh have been studied extensively as an integral part of the investigation of the heaviest members of the groups five and seven of the periodic table. The half-life of 224 Pa was determined to be 855 plus/minus19 ms by measuring its alpha-decay using our rotating wheel, solid state detector system at the Lawrence Berkeley National Laboratory 88-Inch Cyclotron. Protactinium was produced by bombardment of a bismuth target. New neutron rich isotopes, 267 Bh and 266 Bh, were produced in bombardments of a 249 Bk target and their decay was observed using the rotating wheel system. The 266 Bh that was produced decays with a half-life of approximately 1 s by emission of alpha particles with an average energy of 9.25 plus/minus 0.03 MeV. 267 Bh was observed to decay with a 17 s half-life by emission of alpha-particles with an average energy of 8.83 plus/minus 0.03 MeV. The chemical behavior of hafnium, Ha (element 105) was investigated using the fast on-line continuous liquid extraction and detection system SISAK-LISSY. Hafnium was not observed in this experiment following transport and extraction. Protactinium was used as on-line test of the apparatus to determine the experimental efficiency of the entire system. Unfortunately, the amount of protactinium observed after the extraction, compared to the amount produced, was extremely small, only 2.5%. The extraction of the protactinium isotope indicated the efficiency of the apparatus was too low to observe the extraction of hafnium. The chemical behavior of oxychloride compounds of bohrium was investigated by isothermal gas adsorption chromatography in a quartz column at 180, 150

  8. Dating methods based on the radioactive disequilibrium (1961); Methodes de chronologie par le desequilibre radioactif (1961)

    Energy Technology Data Exchange (ETDEWEB)

    Coquema, C; Coulomb, R; Goldsztein, M; Schiltz, J C [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1961-07-01

    The existence in the uranium families of two long-life descendants: ionium (half-life 80000 years) and protactinium (half-life 32000 years), together with the differences in geochemical behaviour of the various natural radio-elements, particularly thorium, make it possible to envisage several models of geological time-scales covering-periods from 0 to 500000 years The theory of two of the most important models i s developed and methods are described for making radiochemical measurements on the various nuclides which are essential for resolving these models (U{sup 238}, Th{sup 234}, Th{sup 230}, Ra{sup 226}, Pa{sup 231}, Th{sup 232}, Th{sup 228}, Po{sup 210}) An example of dating is given in the case of a secondary mineralisation on a weathered portion of a deposit in the Limouzat (Forez). Samples of autunite and chalcolite taken at different levels of the mine were calculated to be between 30000 and 240000 years old. (authors) [French] L'existence dans les familles de l'uranium de deux descendants a vie longue: ionium (periode 80000 ans) et protactinium (periode 32000 ans), ainsi que les differences tie comportement geochimique des divers radioelements naturels, en particulier du thorium, permettent d'envisager plusieurs modeles d'echelles geochronologiques couvrant un domaine allant de 0 a 500000 ans. Nous developpons la theorie de deux de ces modeles les plus importants, et decrivons les methodes de dosage radiochimiques des divers nucleides dont la connaissance est necessaire a la resolution des modeles ({sup 238}U, {sup 234}Th, {sup 230}Th, {sup 226}Ra, {sup 231}Pa, {sup 232}Th, {sup 228}Th, {sup 210}Po). On donne un exemple de chronologie d'une mineralisation secondaire sur la partie alteree du gisement du Liznouzat (Forez). Des echantillons d'autunite et de chalcolite pris a differents niveaux de la mine ont pu etre dates de 30000 a 240000 ans. (auteurs)

  9. Dissolved Concentration Limits of Radioactive Elements

    International Nuclear Information System (INIS)

    Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady

    2003-01-01

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been

  10. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    International Nuclear Information System (INIS)

    P. Bernot

    2005-01-01

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO 2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231 Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise

  11. Radiochemical separation of {sup 231}Pa from siliceous cake prior to its determination by gamma ray spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Dalvi, Aditi A. [Bhabha Atomic Research Centre, Mumbai (India). Analytical Chemistry Div.; Homi Bhabha National Institute, Mumbai (India); Verma, Rakesh

    2017-07-01

    A simple and fast radiochemical method for the separation of protactinium ({sup 231}Pa) from siliceous cake for its determination by gamma ray spectrometry is described. The method involves (a) a novel approach, the fusion of the siliceous cake with sodium peroxide, (b) the dissolution of the fused mass in nitric acid and (c) the co-precipitation of {sup 231}Pa with manganese dioxide formed in-situ by the addition of solid manganous sulfate and potassium permanganate to the solution. The fusion, effected in a single step, is simpler and highly effective in comparison to methods reported hitherto in literature. The radiochemical yield of {sup 231}Pa, determined using 311.9 keV gamma ray of {sup 233}Pa radiotracer is quantitative (∝90%). The decontamination factors calculated using gamma ray spectrometry and energy dispersive X-ray fluorescence measurements show that the separation from the interfering radionuclides is high whereas separation from major and minor elements is good. Separation by ion-exchange method in hydrochloric acid, hydrofluoric acid and oxalic acid media have comparatively much lower yields. The concentration of {sup 231}Pa in the siliceous cake measured using interference-free 283.6 keV gamma ray was found to be (6.4 ± 0.33) μg kg{sup -1}. The measured concentration of {sup 231}Pa was well above the limit of quantitation whereas the coefficient of variation was ∝5%. The improvement in the limit of detection was due to the reduction in spectral background. Systematic evaluation of various uncertainty parameters showed that the major contributors to the combined uncertainty were efficiency of the high purity germanium detector and the counting statistics. The present sample decomposition and separation methods are robust, simple to perform and can be effectively used for the determination and hence source prospecting of protactinium.

  12. Dissolved Concentration Limits of Radioactive Elements

    Energy Technology Data Exchange (ETDEWEB)

    Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady

    2003-06-20

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been

  13. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    Energy Technology Data Exchange (ETDEWEB)

    P. Bernot

    2005-07-13

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or

  14. ORF Alignment: NC_006274 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available kinase ... [Bacillus cereus ATCC 14579] ... Length = 81 ... Query: 237 MRKKLKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANT...PEKMDKYLT 296 ... MRK+LKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANT...PEKMDKYLT Sbjct: 1 ... MRKRLKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANTPEKMDKYLT 60 ...

  15. ORF Alignment: NC_004722 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available kinase ... [Bacillus cereus ATCC 14579] ... Length = 81 ... Query: 237 MRKRLKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANT...PEKMDKYLT 296 ... MRKRLKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANT...PEKMDKYLT Sbjct: 1 ... MRKRLKESIEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANTPEKMDKYLT 60 ...

  16. Method for Determination of Neptunium in Large-Sized Urine Samples Using Manganese Dioxide Coprecipitation and 242Pu as Yield Tracer

    DEFF Research Database (Denmark)

    Qiao, Jixin; Hou, Xiaolin; Roos, Per

    2013-01-01

    A novel method for bioassay of large volumes of human urine samples using manganese dioxide coprecipitation for preconcentration was developed for rapid determination of 237Np. 242Pu was utilized as a nonisotopic tracer to monitor the chemical yield of 237Np. A sequential injection extraction chr...... and rapid analysis of neptunium contamination level for emergency preparedness....

  17. Quantum helimagnetism of the frustrated spin-1/2 chain LiCuVO.sub.4./sub..

    Czech Academy of Sciences Publication Activity Database

    Enderle, M.; Mukherjee, C.; Fak, B.; Kremer, R. K.; Broto, J.-M.; Rosner, H.; Drechsler, S.-L.; Richter, J.; Málek, Jiří; Prokofiev, A.; Assmus, W.; Pujol, S.; Raggazzoni, J.-L.; Rakato, H.; Rheinstädter, M.; Ronnow, H.M.

    2005-01-01

    Roč. 70, č. 2 (2005), s. 237-243 ISSN 0295-5075 Institutional research plan: CEZ:AV0Z10100520 Keywords : inelastic neutron scattering * magnetic quantum helix Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.237, year: 2005

  18. New records of Ascaridia platyceri (Nematoda) in parrots (Psittaciformes)

    Czech Academy of Sciences Publication Activity Database

    Kajerová, V.; Baruš, Vlastimil; Literák, I.

    2004-01-01

    Roč. 49, č. 7 (2004), s. 237-241 ISSN 0375-8427 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6093917 Keywords : ascarids * morphology * Nematoda Subject RIV: EG - Zoology Impact factor: 0.790, year: 2004 http://www.vri.cz/docs/vetmed/49-7-237.pdf

  19. The accumulation of plutonium by the European lobster (Homarus gammarus L.)

    International Nuclear Information System (INIS)

    Swift, D.J.

    1992-01-01

    For 237 Pu accumulation from seawater, the whole body concentration factors (CFs) for juvenile lobsters at 18 o C did not exceed 250 over the 49 days of the study. Most 237 Pu was accumulated by the gills and exoskeleton. Since homarid lobsters eat their exuviae after ecdysis, the whole body 237 Pu content of recently moulted lobsters was also a function of the amount of 237 Pu ingested with the exuviae. Consequently, organ/tissue content and CF values for individual lobsters reflected both the time since their last moult and their exposure time to 237 Pu. These factors precluded the calculation of mean whole body CF values or the accurate estimate of a mean steady state (C ss ) CF value. Juvenile lobsters retained significantly more 237 Pu from labelled food at 7-10 o C than at 18 o C. At 7 o C, the biological half time for assimilated 237 Pu was about 28 days, at 10 o C about 15 days and at 18 o C about 8 days. Very little 237 Pu was transported from the gut to the internal tissues (about 1%); most was retained in the hepatopancreas. (author)

  20. The study of prompt and delayed muon induced fission III. The ratios of prompt to delayed fission yields

    NARCIS (Netherlands)

    Rösel, Ch.; Hänscheid, H.; Hartfiel, J.; Mutius, von R.; Achard van Enschut, d' J.F.M.; David, P; Janszen, H.; Johansson, T.; Konijn, J.; Krogulski, T.; Laat, de C.T.A.M.; Paganetti, H.; Petitjean, C.; Polikanov, S.M.; Reist, H.W.; Risse, F.; Schaller, L.A.; Schrieder, W.; Sinha, A.K.; Taal, A.; Theobald, J.P.; Tibell, G.; Trautmann, N.

    1993-01-01

    The ratios of prompt to delayed fission yields for the isotopes U-233, U-234, U-235, U-236, U-238, Np-237, Pu-242, and Pu-244 and the fission probabilities relative to each other have been investigated experimentally. Using the value of the total fission probability for Np-237 the absolute

  1. Determination of neptunium in soil by ICP-MS

    International Nuclear Information System (INIS)

    Ayranov, M.; Kraehenbuehl, U.

    2005-01-01

    A fast and simple method for the determination of 237 Np in soil is presented. The borate fusion decreases the sample pre-treatment time and a TEVA extraction chromatography separates neptunium from uranium and the interfering matrix components. A comparison of the sensitivities of alpha spectrometry and sector field ICP-MS for determination of 237 Np is presented. (orig.)

  2. Gastrointestinal absorption and retention of plutonium-238 in neonatal rats and swine

    International Nuclear Information System (INIS)

    Sullivan, M.F.

    1978-01-01

    Neonatal rats gavaged with 237 Pu or 238 Pu retained a substantial quantity in gut mucosa for a week but absorbed only 2.9% of the 237 Pu. After 140 days the amount retained fell to half that initially deposited. Newborn swine also retained large amounts in the gut and absorbed about 40% of the dose

  3. Dicty_cDB: Contig-U12507-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 129S1/SvImJ Mus musculus STS genomi... 58 0.001 1 ( BV434071 ) S237P6227RB12.T0 PortugueseWaterDog Canis fam...ilia... 58 0.001 1 ( BV424860 ) S237P6196FC6.T0 PortugueseWaterDog Canis familiar

  4. Dicty_cDB: Contig-U03903-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A sequence from clone DKEYP-86F8 in l... 52 0.023 1 ( BV433213 ) S237P6285FG10.T0 Portuguese...6 1 ( BV438906 ) S237P6374FA9.T0 PortugueseWaterDog Canis familiar... 44 5.6 1 ( AM456273 ) Vitis vinifera c

  5. EFFECT OF HYDROPHOBIC ORGANIC POLLUTANTS BIOAVAILABILITY ON ECOTOXICITY OF HISTORICALLY CONTAMINATED SOILS

    Czech Academy of Sciences Publication Activity Database

    Čvančarová, Monika; Innemanová, P.; Cajthaml, Tomáš

    2012-01-01

    Roč. 11, č. 3 (2012), s. 237-237 ISSN 1843-3707. [Environmental Microbiology and Biotechnology. 10.04.2012-12.04.2012, Bologna] R&D Projects: GA TA ČR TA01020804 Institutional research plan: CEZ:AV0Z50200510 Keywords : Supercritical fluid extraction Subject RIV: EE - Microbiology, Virology

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 237 of 237 ... Vol 59 (2015), The IFAA Sunday Forum: Youth Dialogue on the TRC - Reflections and Possibilities, Abstract. CA Lester. Vol 58 (2015), The IMF's advice on fiscal policy, Abstract. A Schimmelpfennig. Vol 67, No 1 (2017), The national health insurance and traditional healing in South Africa, Abstract.

  7. The accumulation of plutonium by the European lobster (Homarus gammarus L. )

    Energy Technology Data Exchange (ETDEWEB)

    Swift, D J [Ministry of Agriculture, Fisheries and Food, Lowestoft (United Kingdom). Directorate of Fisheries Research

    1992-01-01

    For {sup 237}Pu accumulation from seawater, the whole body concentration factors (CFs) for juvenile lobsters at 18{sup o}C did not exceed 250 over the 49 days of the study. Most {sup 237}Pu was accumulated by the gills and exoskeleton. Since homarid lobsters eat their exuviae after ecdysis, the whole body {sup 237}Pu content of recently moulted lobsters was also a function of the amount of {sup 237}Pu ingested with the exuviae. Consequently, organ/tissue content and CF values for individual lobsters reflected both the time since their last moult and their exposure time to {sup 237}Pu. These factors precluded the calculation of mean whole body CF values or the accurate estimate of a mean steady state (C{sub ss}) CF value. Juvenile lobsters retained significantly more {sup 237}Pu from labelled food at 7-10{sup o}C than at 18{sup o}C. At 7{sup o}C, the biological half time for assimilated {sup 237}Pu was about 28 days, at 10{sup o}C about 15 days and at 18{sup o}C about 8 days. Very little {sup 237}Pu was transported from the gut to the internal tissues (about 1%); most was retained in the hepatopancreas. (author).

  8. Structural analysis within the Rožná and Olší uranium deposits (Strážek Moldanubicum) for the estimation of deformation and stress conditions of underground gas storage

    Czech Academy of Sciences Publication Activity Database

    Ptáček, Jiří; Melichar, R.; Hájek, Antonín; Koníček, Petr; Souček, Kamil; Staš, Lubomír; Kříž, P.; Lazárek, J.

    2013-01-01

    Roč. 10, č. 2 (2013), s. 237-246 ISSN 1214-9705 Institutional support: RVO:68145535 Keywords : structural analysis * deformation * stress * underground gas storage Subject RIV: DH - Mining, incl. Coal Mining Impact factor: 0.667, year: 2013 http://www.irsm.cas.cz/materialy/acta_content/2013_02/acta_170_13_Ptacek_237-246.pdf

  9. 78 FR 73109 - Radio Broadcasting Services; Benjamin and Cisco, TX; De Beque, CO; Port Lions, AK; Rule and...

    Science.gov (United States)

    2013-12-05

    ... Broadcasting Services; Benjamin and Cisco, TX; De Beque, CO; Port Lions, AK; Rule and Shamrock, TX AGENCY... 237C3 at Benjamin, Texas; Channel 261C3 at Cisco, Texas; Channel 288C2 at Rule, Texas; and Channel 225C2..., Channel 237C3; by removing Cisco, Channel 261C3; by removing Channel 288C2 at Rule; and by removing...

  10. Dicty_cDB: Contig-U04716-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( BV429027 ) S237P6215FG6.T0 PortugueseWaterDog Canis familiar... 38 6e-04 2 ( CE020668 ) tigr-gss-dog-1700...AFT ... 48 0.034 2 ( CE733596 ) tigr-gss-dog-17000315432205 Dog Library Canis lup... 38 0.034 2 ( BV431612 ) S237P656RA1.T0 Portugues...library Mus ... 38 0.13 2 ( BV431707 ) S237P6458FA8.T0 PortugueseWaterDog Canis familiar... 38 0.13 2 ( BV25... ( BV437326 ) S237P6229FG2.T0 PortugueseWaterDog Canis familiar... 38 0.13 2 ( CE358139 ) tigr-gss-dog-17000... Canis lup... 38 0.14 2 ( BV432826 ) S237P6430RB9.T0 PortugueseWaterDog Canis familiar... 36 0.14 2 ( CE4742

  11. Capability to Recover Plutonium-238 in H-Canyon/HB-Line - 13248

    Energy Technology Data Exchange (ETDEWEB)

    Fuller, Kenneth S. Jr.; Smith, Robert H. Jr.; Goergen, Charles R. [Savannah River Nuclear Solutions, LLC, Savannah River Site, Aiken, SC 29802 (United States)

    2013-07-01

    Plutonium-238 is used in Radioisotope Thermoelectric Generators (RTGs) to generate electrical power and in Radioisotope Heater Units (RHUs) to produce heat for electronics and environmental control for deep space missions. The domestic supply of Pu-238 consists of scrap material from previous mission production or material purchased from Russia. Currently, the United States has no significant production scale operational capability to produce and separate new Pu-238 from irradiated neptunium-237 targets. The Department of Energy - Nuclear Energy is currently evaluating and developing plans to reconstitute the United States capability to produce Pu-238 from irradiated Np-237 targets. The Savannah River Site had previously produced and/or processed all the Pu-238 utilized in Radioisotope Thermoelectric Generators (RTGs) for deep space missions up to and including the majority of the plutonium for the Cassini Mission. The previous full production cycle capabilities included: Np- 237 target fabrication, target irradiation, target dissolution and Np-237 and Pu-238 separation and purification, conversion of Np-237 and Pu-238 to oxide, scrap recovery, and Pu-238 encapsulation. The capability and equipment still exist and could be revitalized or put back into service to recover and purify Pu-238/Np-237 or broken General Purpose Heat Source (GPHS) pellets utilizing existing process equipment in HB-Line Scrap Recovery, and H-Canyon Frame Waste Recovery processes. The conversion of Np-237 and Pu-238 to oxide can be performed in the existing HB-Line Phase-2 and Phase- 3 Processes. Dissolution of irradiated Np-237 target material, and separation and purification of Np-237 and Pu-238 product streams would be possible at production rates of ∼2 kg/month of Pu-238 if the existing H-Canyon Frames Process spare equipment were re-installed. Previously, the primary H-Canyon Frames equipment was removed to be replaced: however, the replacement project was stopped. The spare equipment

  12. Holdup Measures on an SRNL Mossbauer Spectroscopy Instrument

    Energy Technology Data Exchange (ETDEWEB)

    Dewberry, R.; Brown, T.; Salaymeh, S.

    2010-05-05

    Gamma-ray holdup measurements of a Mossbauer spectroscopy instrument are described and modeled. In the qualitative acquisitions obtained in a low background area of Savannah River National Laboratory, only Am-241 and Np-237 activity were observed. The Am-241 was known to be the instrumental activation source, while the Np-237 is clearly observed as a source of contamination internal to the instrument. The two sources of activity are modeled separately in two acquisition configurations using two separate modeling tools. The results agree well, demonstrating a content of (1980 {+-} 150) {mu}Ci Am-241 and (110 {+-} 50) {mu}Ci of Np-237.

  13. Mutual emergency assistance for radiation accidents

    International Nuclear Information System (INIS)

    1983-03-01

    A revised document on ''Mutual Emergency Assistance for Radiation Accidents'' jointly prepared by the Agency with the participation of the World Health Organization (WHO), the Food and Agricultural Organization of the United Nations (FAO), the International Labour Organisation (ILO) and the Office of the United Nations Disaster Relief Co-ordinator (UNDRO) was issued in 1980 as TECDOC-237. The present document lists the additional information received after publication of the 1980 edition and is issued as a Supplement to TECDOC-237 (1980 Edition). Some useful information contained in TECDOC-237 such as the IAEA arrangement and the WHO Collaborating Centres for Radiation Emergency Assistance are reprinted for ready reference

  14. Comparison of fission and capture cross sections of minor actinides

    International Nuclear Information System (INIS)

    Nakagawa, Tsuneo; Iwamoto, Osamu

    2003-01-01

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals. (author)

  15. Attenuation of Foot-and-Mouth Disease Virus by Engineered Viral Polymerase Fidelity.

    Science.gov (United States)

    Rai, Devendra K; Diaz-San Segundo, Fayna; Campagnola, Grace; Keith, Anna; Schafer, Elizabeth A; Kloc, Anna; de Los Santos, Teresa; Peersen, Olve; Rieder, Elizabeth

    2017-08-01

    Foot-and-mouth disease virus (FMDV) RNA-dependent RNA polymerase (RdRp) (3D pol ) catalyzes viral RNA synthesis. Its characteristic low fidelity and absence of proofreading activity allow FMDV to rapidly mutate and adapt to dynamic environments. In this study, we used the structure of FMDV 3D pol in combination with previously reported results from similar picornaviral polymerases to design point mutations that would alter replication fidelity. In particular, we targeted Trp237 within conserved polymerase motif A because of the low reversion potential inherent in the single UGG codon. Using biochemical and genetic tools, we show that the replacement of tryptophan 237 with phenylalanine imparts higher fidelity, but replacements with isoleucine and leucine resulted in lower-fidelity phenotypes. Viruses containing these W237 substitutions show in vitro growth kinetics and plaque morphologies similar to those of the wild-type (WT) A 24 Cruzeiro strain in BHK cells, and both high- and low-fidelity variants retained fitness during coinfection with the wild-type virus. The higher-fidelity W237F (W237F HF ) mutant virus was more resistant to the mutagenic nucleoside analogs ribavirin and 5-fluorouracil than the WT virus, whereas the lower-fidelity W237I (W237I LF ) and W237L LF mutant viruses exhibited lower ribavirin resistance. Interestingly, the variant viruses showed heterogeneous and slightly delayed growth kinetics in primary porcine kidney cells, and they were significantly attenuated in mouse infection experiments. These data demonstrate, for a single virus, that either increased or decreased RdRp fidelity attenuates virus growth in animals, which is a desirable feature for the development of safer and genetically more stable vaccine candidates. IMPORTANCE Foot-and-mouth disease (FMD) is the most devastating disease affecting livestock worldwide. Here, using structural and biochemical analyses, we have identified FMDV 3D pol mutations that affect polymerase

  16. Schattenboxen

    Directory of Open Access Journals (Sweden)

    Johannes Berchtold

    2011-01-01

    Full Text Available Rezensiertes Werk: Turan Kayaoğlu, Legal Imperialism. Sovereignty and Extraterritoriality in Japan, the Ottoman Empire, and China, New York: Cambridge University Press 2010, VIII, 237 p., ISBN 978-0-521-76591-6

  17. E3 Testing of Directed Energy Systems: A Challenging Future

    National Research Council Canada - National Science Library

    Brown, Lyndell R

    2009-01-01

    .... Compatibility testing and susceptibility to electromagnetic radiation is required. Standards, such as MIL-STD-464 and MIL-STD-237D, are being revised to include HPM levels and frequencies for E3 tests...

  18. risk factors and sero-prevalence of hepatitis b surface antigen

    African Journals Online (AJOL)

    2014-02-01

    Feb 1, 2014 ... Medicine, University of Ilorin, PMB 1515, Ilorin, Kwara State, Nigeria ... Results: High prevalence rate 10.9% was recorded. All the ... school graduate, tertiary school graduate and illiterate respectively with 36.8%, 23.7%,.

  19. 76 FR 27563 - Margin and Capital Requirements for Covered Swap Entities

    Science.gov (United States)

    2011-05-11

    ... Comptroller of the Currency 12 CFR Part 45 Board of Governors of the Federal Reserve System 12 CFR Part 237... Housing Finance Agency 12 CFR Part 1221 Margin and Capital Requirements for Covered Swap Entities...; [[Page 27564

  20. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... Feelings Expert Answers Q&A Movies & More for Teens Teens site Sitio para adolescentes Body Mind Sexual Health ... 237 milliliters) of urine in your bladder, your brain tells you it's time to find a bathroom. ...

  1. Transformation of arsenic-rich copper smelter flue dust in contrasting soils: A 2-year field experiment

    Czech Academy of Sciences Publication Activity Database

    Jarošíková, A.; Ettler, V.; Mihaljevič, M.; Penížek, V.; Matoušek, Tomáš; Culka, A.; Drahota, P.

    2018-01-01

    Roč. 237, JUN (2018), s. 83-92 ISSN 0269-7491 Institutional support: RVO:68081715 Keywords : arsenic * smelter dust * soil Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Analytical chemistry Impact factor: 5.099, year: 2016

  2. Preparation of graphite derivatives by selective reduction of graphite oxide and isocyanate functionalization

    Czech Academy of Sciences Publication Activity Database

    Kumar, A. R. S. S.; Piana, Francesco; Mičušík, M.; Pionteck, J.; Banerjee, S.; Voit, B.

    2016-01-01

    Roč. 182, 1 October (2016), s. 237-245 ISSN 0254-0584 Institutional support: RVO:61389013 Keywords : graphite oxide * surface modification * conductive nanoparticles Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.084, year: 2016

  3. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... from the kidneys. When you have about a cup (237 milliliters) of urine in your bladder, your ... into a bathroom and pee into a plastic cup. Your doctor will give you special wipes to ...

  4. Latein als Sprache der mittelalterlichen Schriften über Wettervorhersage

    Czech Academy of Sciences Publication Activity Database

    Kocánová, Barbora

    -, č. 71 (2013), s. 237-248 ISSN 1376-7453 R&D Projects: GA MŠk(CZ) LD13043 Institutional support: RVO:67985955 Keywords : medieval weather forecasting * medieval Latin * medieval manuscripts Subject RIV: AI - Linguistics

  5. [The importance of the internal picture of the disease for the rehabilitative prognosis in paranoid schizophrenia].

    Science.gov (United States)

    Pkhidenko, S V

    1993-07-01

    Clinico-catamnestic analysis of internal picture of disease was carried out in 237 patients with paranoid schizophrenia. High ratio of anosognosia (52%) was found. As many as 11% of patients aimed at overcoming morbid symptoms.

  6. 78 FR 73565 - Agency Information Collection Activities: Proposed Collection, Comments Requested, New Collection...

    Science.gov (United States)

    2013-12-06

    ..., homicide offenses, human trafficking, kidnapping/abduction, larceny/theft offenses, motor vehicle theft...; Public Law110-457, Title II, Section 237(a), (b), December 23, 2008, the William Wilberforce Trafficking...

  7. Other Concerns & Conditions

    Science.gov (United States)

    ... anxiety, behavioral and mood disorders, substance abuse, or delinquency as teenagers. Parents of children with ADHD report ... United States, 2004–2006. National Center for Health Statistics . Vital Health Statistics, 10 (237), 1-15. Strine, ...

  8. 77 FR 72197 - Pears Grown in Oregon and Washington; Assessment Rate Decrease for Processed Pears

    Science.gov (United States)

    2012-12-05

    ... Agricultural Statistics Service, the total farm-gate value of summer/fall processed pears grown in Oregon and... introductory text and paragraph (a) are revised to read as follows: Sec. 927.237 Processed pear assessment rate...

  9. Fejtová, Olga/Ledvinka, Václav/Pešek, Jiří u.a.: Evropská velkoměsta mezi koncem války světové a války studené 1945–1989.

    Czech Academy of Sciences Publication Activity Database

    Nosková, Jana

    2014-01-01

    Roč. 54, - (2014), 233-237 ISSN 0523-8587 Institutional support: RVO:68378076 Keywords : European cities * Cold War * 1945–1989 * urban history * urban anthropology Subject RIV: AC - Archeology, Anthropology, Ethnology

  10. Sooaspekt ja selle keeleline ülekanne : Emil Tode Piiririik / Riita-Ilona Märka

    Index Scriptorium Estoniae

    Märka, Riita-Ilona

    2003-01-01

    "Piiririigi" tõlge inglise keelde: Õnnepalu, Tõnu. Border state : [novel] / translated from the Estonian by Madli Puhvel. Evanston [USA] : Northwestern University Press, 2000. Autorist lk. 234 (inglise k.) ja lk. 237 (vene k.)

  11. Pattern of Histopathological Diagnosis of Breast lesions in Gombe ...

    African Journals Online (AJOL)

    neoplastic proliferative and benign neoplastic disorders, while 118 (40.5%) were malignant neoplasms. Fibroadenoma was the commonest benign breast lesion with 69 (23.7%) cases. Of all the malignancies, invasive ductal carcinoma was the most ...

  12. evaluation of total annual costs of heat exchanger networks using

    African Journals Online (AJOL)

    user

    after solving the first problem using RPA based heat integration gave a minimum total annual cost (TAC) of $237, ... mathematical programming and non-RPA based Hint software. ... The concept of pinch analysis evolved over the years.

  13. Urinary Tract Infections (For Kids)

    Medline Plus

    Full Text Available ... Infections Diseases & Conditions Pregnancy & Baby Nutrition & Fitness Emotions & Behavior School & Family Life First Aid & Safety Doctors & Hospitals ... 237 milliliters) of urine in your bladder, your brain tells you it's time to find a bathroom. ...

  14. Fuelling Economic Growth The Role of Public–Private Sector ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Types of parts manufactured by domestic firms in the automotive sector. 237. 8.8. The first ... Tanzania Engineering and Manufacturing Design Organization. TIRDO. Tanzania ...... Table 2.3 Distribution of firms according to sector of production ...

  15. 77 FR 14558 - Announcement of Funding Awards for the Public and Indian Housing Resident Opportunity and Self...

    Science.gov (United States)

    2012-03-12

    ... Wide Resident Council of 555 Wabasha Street Saint Paul......... MN 55102 702,000 the City of St. Paul.... Cherry Court Resident c/o Kenneth Milwaukee WI 53212 237,619 Organization. Barbeau, Contract...

  16. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... will automatically play next. Up next What is PTSD? (Whiteboard Video) - Duration: 3:38. Veterans Health Administration ... Health Administration 216 views 2:37 Veterans and PTSD: Challenging the Misconceptions - Duration: 2:14. Veterans Health ...

  17. germplasm collection of highland palms of afikpo in eastern nigeria

    African Journals Online (AJOL)

    DR. AMIN

    1Plant Breeding Division, Nigerian Institute For Oil Palm Research (NIFOR) P.M.B 1030 .... computed following standard statistical methods (Steel .... The production of NIFOR elite ... Malaysia Palm Oil Board, Kualar Lumpur, pp 171 – 237.

  18. 1417-IJBCS-Article-Tsopmbeng Gaston

    African Journals Online (AJOL)

    pc

    Evaluation of culture media for growth and sporulation of Phytophthora colocasiae Racib., causal ... Corresponding author, E-mail: grnoumbo@yahoo.fr, Tel: +237 99 66 50 42. ABSTRACT ..... Technology and Commerce (vol. 5),. Govil JN ...

  19. dispersion characteristics of settleable and dissolvable pollutants in ...

    African Journals Online (AJOL)

    The implication of this in waste stabilization pond design was also discussed. KEYWORDS: Dispersion, settleable pollutants, waste stabilization ponds. INTRODUCTION. A waste ...... and Soil Pollution 52, 237-245. Agunwamba, J. C., 1991.

  20. Trematodes of fishes of the Indo-west Pacific: told and untold richness

    Czech Academy of Sciences Publication Activity Database

    Cribb, T.H.; Bray, R. A.; Diaz, P.E.; Huston, D.C.; Kudlai, Olena; Martin, S.B.; Yong, R.Q.-Y.; Cutmore, S.C.

    2016-01-01

    Roč. 93, č. 3 (2016), s. 237-247 ISSN 0165-5752 Institutional support: RVO:60077344 Keywords : Great Barrier reef * French Polynesia * Cardicola forsteri Subject RIV: EH - Ecology, Behaviour Impact factor: 1.181, year: 2016

  1. Trad. Daniele Vitale, Arquitectos portugueses. Identidade, nacionalidade, modernidade

    OpenAIRE

    Marnoto, Rita

    2010-01-01

    (2010. Trad.). Daniele Vitale, Arquitectos portugueses. Identidade, nacionalidade, modernidade, JA Jornal Arquitectos. Publicação Trimestral da Ordem dos Arquitectos Portugal, 237, 93-101. ISSN 0870 1504 Trad. Daniele Vitale

  2. 48 CFR 1213.7101 - Solicitation provision and contract clause.

    Science.gov (United States)

    2010-10-01

    ... Data, in all solicitations and requests for quotations, and the clause at (TAR) 48 CFR 1252.237-72, Prohibition on Advertising, in solicitations, requests for quotations, and all contracts (e.g., purchase...

  3. Serosurveillance of Scrub Typhus in Small Mammals Collected from Military Training Sites near the DMZ, Northern Gyeonggi-do, Korea, and Analysis of the Relative Abundance of Chiggers from Mammals Examined

    Science.gov (United States)

    2010-09-01

    Korean J Paras/to/. Vol. 48, No. 3: 237-243, September 2010 DOl: JO.J3471kjp.2010.48.J.237 Serosurveillance of Scrub Typhus in Small Mammals...65th Medical BrigadeAJSAMEDDAC-Korea, Unit# 15281, APO AP 96205-5281, USA Abstract: Comprehensive quarterly serosurveillance on scrub typhus in small...rarely observed (prevalence < 1 0%). In contrast to previous surveys, higher chigger indices of the primary scrub typhus vectors, L. pallidum (165.4

  4. Profiling N-Type Dopants in Silicon

    Czech Academy of Sciences Publication Activity Database

    Hovorka, Miloš; Mika, Filip; Mikulík, P.; Frank, Luděk

    2010-01-01

    Roč. 51, č. 2 (2010), s. 237-242 ISSN 1345-9678 R&D Projects: GA ČR GP102/09/P543; GA AV ČR IAA100650803 Institutional research plan: CEZ:AV0Z20650511 Keywords : silicon * dopant contrast * photoemission electron microscopy * scanning electron microscopy Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.779, year: 2010 http://www.jim.or.jp/journal/e/51/02/237.html

  5. Situation Desperate: U.S. Army Engineer Disaster Relief Operations, Origins to 1950

    Science.gov (United States)

    2011-01-01

    the Sabine River sub- office, for example, relayed the following sad report to headquarters: “I regret to report the loss of all property in my...doctor with typhoid vaccine ; the cows and horses and dogs of every description wandering up and down the levees; the fur- niture, every kind of...215 Sabine River, 59 Sacramento Engineer District, 237, 238 Sacramento River, 186, 237 St. Francis River, 85, 87 St. Joe River, 217 St. Louis Engineer

  6. Analysis of trace neptunium in the vicinity of underground nuclear tests at the Nevada National Security Site.

    Science.gov (United States)

    Zhao, P; Tinnacher, R M; Zavarin, M; Kersting, A B

    2014-11-01

    A high sensitivity analytical method for (237)Np analysis was developed and applied to groundwater samples from the Nevada National Security Site (NNSS) using short-lived (239)Np as a yield tracer and HR magnetic sector ICP-MS. The (237)Np concentrations in the vicinity of the Almendro, Cambric, Dalhart, Cheshire, and Chancellor underground nuclear test locations range from nuclear tests at very low but measureable concentrations. Copyright © 2014 The Authors. Published by Elsevier Ltd.. All rights reserved.

  7. Dicty_cDB: Contig-U01557-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ling_GS-29-01-01-1... 30 5.1 3 ( BV439796 ) S237P619FE6.T0 PortugueseWaterDog Canis familiari... 36 5.1 2 ( ...enom... 42 8.1 1 ( BV424741 ) S237P6453FF6.T0 PortugueseWaterDog Canis familiar... 42 8.1 1 ( BV402984 ) S22

  8. Modeling of 830 nm FSO Link Attenuation in Fog or Wind Turbulence

    Czech Academy of Sciences Publication Activity Database

    Pešek, J.; Fišer, Ondřej; Svoboda, Jaroslav; Schejbal, V.

    2010-01-01

    Roč. 19, č. 2 (2010), s. 237-241 ISSN 1210-2512 R&D Projects: GA ČR GA102/08/0851; GA MŠk OC09027 Institutional research plan: CEZ:AV0Z30420517 Keywords : Free space optics propagation * fog attenuation, * wind turbulence attenuation * turbulent energy Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.503, year: 2010 http://www.radioeng.cz/fulltexts/2010/10_02_237_241.pdf

  9. Value of MR-angiography in brain infarction

    International Nuclear Information System (INIS)

    Pirronello, Veronica; Capizzano, Aristides A.; Chouela, Carolina L.; Ternak, Alejandro; Ramirez, Susana; Mazzuco, Juan C.

    2004-01-01

    A retrospective study has been performed in a series of 237 patients, with brain and neck MR and MR angiography techniques. 108/237 (45.5%) patients presented either hemorrhage or lacunar and non lacunar ischemic stroke, 67 of which showed restricted diffusion. Diffusion and perfusion techniques can significantly contribute to study acute stroke. In our series MR angiography showed a 4% sensitivity to detect small arteries pathology. (author)

  10. Dollar Summary of Prime Contract Awards by State, Place, and Contractor, FY84, Part 4, (Allenville, Missouri-Wyoming, Pennsylvania).

    Science.gov (United States)

    1984-01-01

    CLOSED CIRCUIT TV CORP 26 26INGERSOLL-RAND COMPANY INC 67 67INSTITUTE FOR ADVANCED STUDY 75 75 INTERNATIONAL BUSINESS MCHS 28 28M L ENERGIA INC 30...I 28 PRINCETON E 0 & 0 PARC 28 IBM CORP 25 25 M L ENERGIA INC 107 107 SAN LUIS CAMERA 41 41...SANDERS ASSOCIATES INC 848 848 SATELLITE SERVICES INC 237 237 SCHICKEL H GEN CONTR INC 132 132 SHERLOT HOME RENOVATION CORP 317 317 TRACY TROMBLEY CONT

  11. Modeling of lung cancer risk due to radon exhalation of granite stone in dwelling houses

    Directory of Open Access Journals (Sweden)

    Akbar Abbasi

    2017-01-01

    Conclusions: The estimated numbers of lung cancer deaths attributable to indoor radon due to granite stones in 2013 were 145 (3.33% and 103 (2.37% for poor and normal ventilation systems, respectively. According to our estimations, the values of 3.33% and 2.37% of lung cancer deaths in 2013 are attributed to radon exhalation of granite stones with poor and normal ventilation systems, respectively.

  12. Analysis of burnup of Angra 2 PWR nuclear with addition of thorium dioxide fuel using ORIGEN-ARP

    Energy Technology Data Exchange (ETDEWEB)

    Goncalves, Isadora C.; Wichrowski, Caio C.; Oliveira, Claudio L. de; Vellozo, Sergio O.; Baptista, Camila O., E-mail: isadora.goncalves@ime.eb.br, E-mail: wichrowski@ime.eb.br, E-mail: d7luiz@yahoo.com.br, E-mail: vellozo@ime.eb.br, E-mail: camila.oliv.baptista@gmail.com [Instituto Militar de Engenharia (IME), Rio de Janeiro, RJ (Brazil). Secao de Engenharia Nuclear

    2017-11-01

    It is known that isotope {sup 232}thorium is a fertile nuclide with the ability to convert into {sup 233}uranium, a potentially fissile isotope, after absorbing a neutron. As there is a large stock of available thorium in the world, this element shows great promise in mitigate the world energy crisis, more particularly in the problem of uranium scarcity, besides being an alternative nuclear fuel for those currently used in reactors, and yet presenting advantages as an option for the non-proliferation movement, among others. In this study, the analysis of the remaining nuclides of burnup was carried out for the core configuration of a PWR (pressurized water reactor) reactor, specifically the Angra 2 reactor, using only uranium dioxide, its current configuration, and in different configurations including a mixed oxide of uranium and thorium in three concentrations, allowing a preliminary assessment of the feasibility of the modification of the fuel, the resulting production of {sup 233}uranium, the emergence of {sup 231}protactinium (an isotope that only occurs as a fission product of {sup 232}Th) resulting from burning. The study was carried out using data obtained from FSAR (Final Safety Analysis Report) of Angra 2, using the SCALE 6.1, a modeling and simulation nuclear code, especially its ORIGEN-ARP module, which analyzes the depletion of isotopes presents in a reactor. (author)

  13. Growth rates of iron-manganese concretions in the Pacific and Indian oceans

    International Nuclear Information System (INIS)

    Kuznetsov, Yu.V.; Pospelov, Yu.N.

    1978-01-01

    Radiochemical analysis has been used for studying the distribution of 231 Pa, 230 Th, 232 Th, 226 Ra, 234 U, and 238 U isotopes in nineteen iron-manganese concretions. The study has shown a considerable violation of the equilibrium between uranium and daughter isotopes, viz, protactinium-231 and thorium-230. A sharp decrease of the ratios between the 231 Pain concretions made it possible to find the growth rates of 10 concretions from pelagic regions of the Pacific and Indian oceans. The obtained data deviate in narrow limits and amount to (3-6)mm/10 6 years when evaluation is made according to 230 Th decay and (4-7)mm/10 6 years when 231 Pa is used. The presence of Ra excess (as compared with mother isotopes 230 Th) in inner layers of the concretions points to the fact that the growth rates determined by the radium method are raised too high due to radium migration from the surface layers into the depth of the concretion. It is shown that accumulation of 231 Pa and 230 Th in concretions accounts for a small part (less than 25%) of their production from uranium dissolved in the sea water

  14. A brief history of the Delayed'' discovery of nuclear fission

    Energy Technology Data Exchange (ETDEWEB)

    Holden, N.E.

    1989-08-01

    This year marks the Fiftieth Anniversary of the discovery of Nuclear Fission. In the early 1930's, the neutron was discovered, followed by the discovery of artificial radioactivity and then the use of the neutron to produce artificial radioactivity. The first experiments resulting in the fission of uranium took place in 1934. A paper which speculated on fission as an explanation was almost immediately published, yet no one took it seriously not even the author herself. Why did it take an additional five years before anyone realized what had occurred This is an abnormally long time in a period when discoveries, particularly in nuclear physics, seemed to be almost a daily occurrence. The events which led up to the discovery are recounted, with an attempt made to put them into their historical perspective. The role played by Mendeleev's Periodic Table, the role of the natural radioactive decay chain of uranium, the discovery of protactinium, the apparent discovery of masurium (technetium) and a speculation on the reason why Irene Curie may have missed the discovery of nuclear fission will all be discussed. 43 refs.

  15. An aerial radiological survey of the Paducah Gaseous Diffusion Plant and surrounding area, Paducah, Kentucky

    International Nuclear Information System (INIS)

    1992-11-01

    An aerial radiological survey of the Paducah Gaseous Diffusion Plant (PGDP) and surrounding area in Paducah, Kentucky, was conducted during May 15--25, 1990. The purpose of the survey was to measure and document the terrestrial radiological environment at the PGDP and surrounding area for use in effective environmental management and emergency response planning. The aerial survey was flown at an altitude of 61 meters (200 feet) along a series of parallel lines 107 meters (350 feet) apart. The survey encompassed an area of 62 square kilometers (24 square miles), bordered on the north by the Ohio River. The results of the aerial survey are reported as inferred exposure rates at 1 meter above ground level in the form of a gamma radiation contour map. Typical background exposure rates were found to vary from 5 to 12 microroentgens per hour (μR/h). Protactinium-234m, a radioisotope indicative of uranium-238, was detected at several facilities at the PGDR. In support of the aerial survey, ground-based exposure rate and soil sample measurements were obtained at several sites within the survey perimeter. The results of the aerial and ground-based measurements were found to agree within ±15%

  16. An aerial radiological survey of the Portsmouth Gaseous Diffusion Plant and surrounding area

    International Nuclear Information System (INIS)

    Sampoll-Ramirez, G.

    1994-09-01

    An aerial radiological survey was conducted from August 10-16, 1993, over a 78-square-kilometer (30-square-mile) area of the Portsmouth Gaseous Diffusion Plant and surrounding area located near Portsmouth, Ohio. The survey was performed at a nominal altitude of 46 meters (150 feet) with a line spacing of 76 meters (250 feet). A contour map of the terrestrial gamma exposure rate extrapolated to 1 meter above ground level was prepared and overlaid on a set of United States Geological Survey topographic maps of the area and an aerial photograph of the plant. The terrestrial gamma exposure rates varied from about 7 to 14 microroentgens per hour at 1 meter above the ground. Protactinium-234m was observed at six sites within the boundaries of the plant. At a seventh site, only uranium-235 was observed. No other man-made, gamma ray-emitting radioactive material was present in a detectable quantity, either on or off the plant property. Soil sample and pressurized ion chamber measurements were obtained at four locations within the survey boundaries to support the aerial data. The results of the aerial and ground-based measurements were found to agree within ± 7.5%

  17. An aerial radiological survey of the Babcock and Wilcox Nuclear Facilities and surrounding area, Lynchburg, Virginia

    International Nuclear Information System (INIS)

    Guss, P.P.

    1993-04-01

    An aerial radiological survey was conducted from July 18 through July 25, 1988, over a 41-square-kilometer (16-square-mile) area surrounding the Babcock and Wilcox nuclear facilities located near Lynchburg, Virginia. The survey was conducted at a nominal altitude of 61 meters (200 feet) with line spacings of 91 meters (300 feet). A contour map of the terrestrial gamma exposure rate extrapolated to 1 meter above ground level (AGL) was prepared and overlaid on an aerial photograph. The terrestrial exposure rates varied from 8 to 12 microroentgens per hour (μR/h). A search of the data for man-made radiation sources revealed the presence of three areas of high count rates in the survey area. Spectra accumulated over the main plant showed the presence of cobalt-60 ( 60 Co) and cesium-137 ( 137 Cs). A second area near the main plant indicated the presence of uranium-235 ( 235 U). Protactinium-234m ( 234m Pa) and 60 Co Were detected over a building to the east of the main plant. Soil samples and pressurized ion chamber measurements were obtained at four locations within the survey boundaries in support of the aerial data

  18. Electronic structure of the actinides and their dioxides. Application to the defect formation energy and krypton solubility in uranium dioxide; Etude de la structure electronique des actinides et de leurs dioxydes. Application aux defauts ponctuels et aux gaz de fission dans le dioxyde d`uranium

    Energy Technology Data Exchange (ETDEWEB)

    Petit, T. [CEA Centre d`Etudes Nucleaires de Grenoble, 38 (France)]|[CEA Centre d`Etudes de Grenoble, 38 (France). Dept. de Thermohydraulique et de Physique

    1996-09-28

    Uranium dioxide is the standard nuclear fuel used in French h power plants. During irradiation, fission products such as krypton and xenon are created inside fuel pellets. So, gas release could become, at very high burnup, a limiting factor in the reactor exploitation. To study this subject, we have realised calculations using the Density Functional Theory (DFT) into the Local Density Approximation (LDA) and the Atomic Sphere Approximation (ASA). First, we have validated our approach by calculating cohesive properties of thorium, protactinium and uranium metals. The good agreement between our results and experimental values implies that 5f electrons are itinerant. Calculated lattice parameter, cohesive energy and bulk modulus for uranium and thorium dioxides are in very good agreement with experiment. We show that binding between uranium and oxygen atoms is not completely ionic but partially covalent. The question of the electrical conductivity still remains an open problem. We have been able to calculate punctual defect formation energies in uranium dioxide. Accordingly to experimental observations, we find that it is easier to create a defect in the oxygen sublattice than in the uranium sublattice. Finally, we have been able to predict a probable site of krypton atoms in nuclear fuel: the Schottky trio. Experiences of Extended X-ray Absorption Fine structure Spectroscopy (EXAFS) and X-ray Photoelectron Spectroscopy (XPS) on uranium dioxide doped by ionic implantation will help us in the comprehension of the studied phenomena and the interpretation of our calculations. (author). 256 refs.

  19. Fuel processing for molten-salt reactors

    International Nuclear Information System (INIS)

    Hightower, J.R. Jr.

    1976-01-01

    Research devoted to development of processes for the isolation of protactinium and for the removal of fission products from molten-salt breeder reactors is reported. During this report period, engineering development progressed on continuous fluorinators for uranium removal, the metal transfer process for rare-earth removal, the fuel reconstitution step, and molten salt--bismuth contactors to be used in reductive extraction processes. The metal transfer experiment MTE-3B was started. In this experiment all parts of the metal transfer process for rare-earth removal are demonstrated using salt flow rates which are about 1 percent of those required to process the fuel salt in a 1000-MW(e) MSBR. During this report period the salt and bismuth phases were transferred to the experimental vessels, and two runs with agitator speeds of 5 rps were made to measure the rate of transfer of neodymium from the fluoride salt to the Bi--Li stripper solution. The uranium removed from the fuel salt by fluorination must be returned to the processed salt in the fuel reconstitution step before the fuel salt is returned to the reactor. An engineering experiment to demonstrate the fuel reconstitution step is being installed. In this experiment gold-lined equipment will be used to avoid introducing products of corrosion by UF 6 and UF 5 . Alternative methods for providing the gold lining include electroplating and mechanical fabrication

  20. A brief history of the ''Delayed'' discovery of nuclear fission

    International Nuclear Information System (INIS)

    Holden, N.E.

    1989-08-01

    This year marks the Fiftieth Anniversary of the discovery of Nuclear Fission. In the early 1930's, the neutron was discovered, followed by the discovery of artificial radioactivity and then the use of the neutron to produce artificial radioactivity. The first experiments resulting in the fission of uranium took place in 1934. A paper which speculated on fission as an explanation was almost immediately published, yet no one took it seriously not even the author herself. Why did it take an additional five years before anyone realized what had occurred? This is an abnormally long time in a period when discoveries, particularly in nuclear physics, seemed to be almost a daily occurrence. The events which led up to the discovery are recounted, with an attempt made to put them into their historical perspective. The role played by Mendeleev's Periodic Table, the role of the natural radioactive decay chain of uranium, the discovery of protactinium, the apparent discovery of masurium (technetium) and a speculation on the reason why Irene Curie may have missed the discovery of nuclear fission will all be discussed. 43 refs

  1. Global ocean conveyor lowers extinction risk in the deep sea

    Science.gov (United States)

    Henry, Lea-Anne; Frank, Norbert; Hebbeln, Dierk; Wienberg, Claudia; Robinson, Laura; van de Flierdt, Tina; Dahl, Mikael; Douarin, Mélanie; Morrison, Cheryl L.; López Correa, Matthias; Rogers, Alex D.; Ruckelshausen, Mario; Roberts, J. Murray

    2014-06-01

    General paradigms of species extinction risk are urgently needed as global habitat loss and rapid climate change threaten Earth with what could be its sixth mass extinction. Using the stony coral Lophelia pertusa as a model organism with the potential for wide larval dispersal, we investigated how the global ocean conveyor drove an unprecedented post-glacial range expansion in Earth's largest biome, the deep sea. We compiled a unique ocean-scale dataset of published radiocarbon and uranium-series dates of fossil corals, the sedimentary protactinium-thorium record of Atlantic meridional overturning circulation (AMOC) strength, authigenic neodymium and lead isotopic ratios of circulation pathways, and coral biogeography, and integrated new Bayesian estimates of historic gene flow. Our compilation shows how the export of Southern Ocean and Mediterranean waters after the Younger Dryas 11.6 kyr ago simultaneously triggered two dispersal events in the western and eastern Atlantic respectively. Each pathway injected larvae from refugia into ocean currents powered by a re-invigorated AMOC that led to the fastest postglacial range expansion ever recorded, covering 7500 km in under 400 years. In addition to its role in modulating global climate, our study illuminates how the ocean conveyor creates broad geographic ranges that lower extinction risk in the deep sea.

  2. Review of experience gained in fabricating nuclear grade uranium and thorium compounds and their analytical quality control at the Instituto de Energia Atomica, Sao Paulo, Brazil

    International Nuclear Information System (INIS)

    Abrao, A.; Franca, J.M. Jr.; Ikuta, A.; Pueschel, C.R.; Federgruen, L.; Lordello, A.R.; Tomida, E.K.; Moraes, S.; Brito, J. de; Gomes, R.P.; Araujo, J.A.; Floh, B.; Matsuda, H.T.

    1977-01-01

    This paper summarizes the main activities dealing with the fabrication of nuclear grade uranium and thorium compounds at the Instituto de Energia Atomica, Sao Paulo. Identification of problems and their resolutions, the experience gained in plant operation, the performance characteristics of an ion-exchange facility and a solvent extraction unit (a demonstration plant based on pulsed columns for purification of uranium and production of ammonium diuranate) are described. A moving-bed facility for UF 4 preparation and its operation is discussed. A pilot plant for uranium and thorium oxide microsphere preparation based on internal gelation for HTGR fuel type is also described. A solvent extraction pilot plant for thorium purification based on a compound extraction-scrubbing column and a mixer-settler battery and the involved technology for thorium purification are commented. The main products, namely ammonium diuranate, uranyl amonium tricarbonate, uranium trioxide, uranium tetrafluoride, thorium nitrate and thorium oxalate and their quality are commented. The development of necessary analytical procedures for the quality control of the mentioned nuclear grade products is summarized. A great majority of such procedures was particularly suitable for analyzing traces impurities. Designed for installation are the units for denitration of uranyl nitrate solutions and pilot plants for elemental fluorine and UF 6 . The installation of a laboratory-scale plant designed for reprocessing irradiated uranium and an experimental unit for the recovery of protactinium from irradiated thorium is in progress

  3. Use of tetracycline as complexing agent in radiochemical separations

    International Nuclear Information System (INIS)

    Saiki, M.; Nastasi, M.J.C.; Lima, F.W.

    1981-01-01

    The use of the antibiotic agent tetracycline (TC) for analytical purposes in solvent extraction procedures is presented. Individual extraction curves for the lanthanides, zinc, scandium, uranium, thorium, neptunium and protactinium were obtained. Separation of those elements from one another, and of uranium from selenium, bromine, antimony, barium, tantalum and tungsten was carried out. In all cases benzyl alcohol was the diluent used to dissolve tetracycline hydrochloride. Sodium chloride was used as supporting electrolyte for the lanthanide separations and sodium perchlorate for the other elements mentioned. Stability or formation constants for the lanthanide complexes as well as for thorium complex with tetracycline were determined by using the methods of average number of ligands, the limiting value (for thorium), the two parameters and the weighted least squares. For the lanthanides, the stability constants of the complexes Ln(TC) 3 go from 9.35+-0.22 for lanthanum up to 10.84+-0.11 for lutetium. For the Th(TC) 4 complex the formation constant is equal to 24.6+-0.3. Radioisotopes of the respective elements were used as tracers for the determinations. (author)

  4. Neutron activation determination of rhenium in mineral raw materials of complex composition

    International Nuclear Information System (INIS)

    Shiryaeva, M.B.; Lyubimova, L.N.; Salmin, Yu.P.; Ryumina, K.N.; Tatarkin, M.A.

    1984-01-01

    The method of neutron-activation rhenium determination in mineral raw material of complex composition is developed, according to which easily hydrolized elements: scandium, iron, lanthanum, ytterbium, protactinium, hafnium and partially ruthenium and osmium are isolated in the form of hydroxides after smelting of a sample, which has been previously irradiated in nuclear reactor (thermal neutron flux 1.2x10 13 n/cm 2 xs for 22 hr) with sodium peroxide and leaching of the melt by water. To separate Re from other interfering elements extraction of perrhenate-ion by methylethylketone from alkali solution is used. Interfering effect of gold is eliminated by its extraction with TBP 30% solution in toluence or benzene from 1 M HNO 3 . Activity of rhenium preparations, singled out from samples of comparison, is measured, using multichannel γ-spectrometer with Ge(Li)-coaxial detector of high resolution (approximately 2.0-2.2 keV over the line 122 keV 5+ Co). Relative standard deviation in Re content range 5x10 -7 -5x10 -2 % does not exceed 0.3

  5. Soil nuclide distribution coefficients and their statistical distributions

    International Nuclear Information System (INIS)

    Sheppard, M.I.; Beals, D.I.; Thibault, D.H.; O'Connor, P.

    1984-12-01

    Environmental assessments of the disposal of nuclear fuel waste in plutonic rock formations require analysis of the migration of nuclides from the disposal vault to the biosphere. Analyses of nuclide migration via groundwater through the disposal vault, the buffer and backfill, the plutonic rock, and the consolidated and unconsolidated overburden use models requiring distribution coefficients (Ksub(d)) to describe the interaction of the nuclides with the geological and man-made materials. This report presents element-specific soil distribution coefficients and their statistical distributions, based on a detailed survey of the literature. Radioactive elements considered were actinium, americium, bismuth, calcium, carbon, cerium, cesium, iodine, lead, molybdenum, neptunium, nickel, niobium, palladium, plutonium, polonium, protactinium, radium, samarium, selenium, silver, strontium, technetium, terbium, thorium, tin, uranium and zirconium. Stable elements considered were antimony, boron, cadmium, tellurium and zinc. Where sufficient data were available, distribution coefficients and their distributions are given for sand, silt, clay and organic soils. Our values are recommended for use in assessments for the Canadian Nuclear Fuel Waste Management Program

  6. Criteria for achieving actinide reduction goals

    International Nuclear Information System (INIS)

    Liljenzin, J.O.

    1996-01-01

    In order to discuss various criteria for achieving actinide reduction goals, the goals for actinide reduction must be defined themselves. In this context the term actinides is interpreted to mean plutonium and the so called ''minor actinides'' neptunium, americium and curium, but also protactinium. Some possible goals and the reasons behind these will be presented. On the basis of the suggested goals it is possible to analyze various types of devices for production of nuclear energy from uranium or thorium, such as thermal or fast reactors and accelerator driven system, with their associated fuel cycles with regard to their ability to reach the actinide reduction goals. The relation between necessary single cycle burn-up values, fuel cycle processing losses and losses to waste will be defined and discussed. Finally, an attempt is made to arrange the possible systems on order of performance with regard to their potential to reduce the actinide inventory and the actinide losses to wastes. (author). 3 refs, 3 figs, 2 tabs

  7. An aerial radiological survey of the Portsmouth Gaseous Diffusion Plant and surrounding area, Portsmouth, Ohio

    International Nuclear Information System (INIS)

    1992-09-01

    An aerial radiological survey was conducted from July 11--20, 1990, over an 83-square-kilometer (32-square-mile) area surrounding the Portsmouth Gaseous Diffusion Plant located near Portsmouth, Ohio. The survey was conducted at a nominal altitude of 91 meters (300 feet) with line spacings of 122 meters (400 feet). A contour map of the terrestrial gamma exposure rate extrapolated to 1 meter above ground level (AGL) was prepared and overlaid on an aerial photograph and a set of United States Geological Survey (USGS) topographic maps of the area. The terrestrial exposure rates varied from about 7 to 14 microroentgens per hour (μR/h) at 1 meter above the ground. Analysis of the data for man-made sources and for the uranium decay product, protactinium-234m ( 234m Pa), showed five sites within the boundaries of the Portsmouth Gaseous Diffusion Plant with elevated readings. Spectra obtained in the vicinity of the buildings at the Portsmouth Gaseous Diffusion Plant showed the presence of 234m Pa, a uranium-238 ( 238 U) decay product. In addition, spectral analysis of the data obtained over the processing plant facility showed gamma activity indicative of uranium-235 ( 234 U). No other man-made gamma ray emitting radioactive material was detected, either on or off the Portsmouth Gaseous Diffusion Plant property. Soil samples and pressurized ion chamber measurements were obtained at five different locations within the survey boundlaries to support the aerial data

  8. An aerial radiological survey of the Savannah River Site and surrounding area, Aiken, South Carolina, October--November 1991

    International Nuclear Information System (INIS)

    Vojtech, R.J.

    1993-12-01

    An aerial radiological survey was conducted during the period of October 14 to November 23, 1991, over an area surrounding the United States Department of Energy's Savannah River Site (SRS). The area is situated 15 kilometers south of Aiken, South Carolina. The purpose of the survey was to measure and document the gamma ray environment of the SRS and surrounding areas. Contour maps showing gamma radiation exposure rates at 1 meter above ground level were constructed from the aerial data and overlaid on a United States Geological Survey map of the area. The exposure rates measured within the survey region are generally uniform and typical of natural background. The reported exposure rate values include an estimated cosmic ray contribution. Enhanced exposure rates not attributable to natural background were measured over several areas within the survey region. The manmade radionuclides detected in these areas, cesium-137, cobalt-60, and protactinium-234m, were produced by the reactor operations and material processing conducted at the SRS. The radiation levels produced by these nuclides are consistent with those levels measured during previous SRS aerial surveys. Radionuclide assays of soil samples and pressurized ion chamber measurements were obtained at four locations within the survey boundaries

  9. Dosimetry of the gastrointestinal tract

    International Nuclear Information System (INIS)

    Sullivan, M.F.; Cross, F.T.; Dagle, G.E.

    1987-01-01

    In order to obtain information on radiation doses to the intestine, doses were determined in dogs for beta-emitters ( 106 Ru- 106 Rh, 147 Pm and 91 Y) that might be delivered to critical cells in the bowel in the event of an accident. Thermoluminescent dosimeters were implanted beneath the large-bowel mucose of dogs. Results were related to toxicity in the dogs and extrapolated to toxicity observed in other experiments with suckling, weanling and adult rats similarly treated. With that information the depth of the critical cells in both dogs and rats could be calculated. Studies with isotopes of thorium, uranium, protactinium, neptunium, plutonium, americium, curium and einsteinium showed that substantial amounts of these alpha-emitting actinides were retained in the intestines of neonatal rats, guinea pigs, dogs and swine after gavage. Despite high doses retained by mucosal cells on the villous tips, (some epithelial cells in the ileum received 100 Gy/day) gross injury was seldom observed at necropsy. 26 refs.; 4 figs.; 3 tabs

  10. The raw material and waste activity balance in the projected nuclear power of Russia

    International Nuclear Information System (INIS)

    Adamov, E.O.; Ganev, I.Kh.; Lopatkin, A.V.; Muratov, V.G.; Orlov, V.V.

    1997-01-01

    Under discussion is the management of long-lived high-level wastes in the nuclear energy sector of Russia, the development of which on a large scale in the next century is motivated by the need for arresting the increasing consumption of fossil fuels. The prerequisites for the nuclear power growth consists in the design of naturally safe reactors and development of a transmutational nuclear fuel cycle (NFC) technology. The choice of operations in such a cycle and of their quantitative characteristics, is aimed at minimizing the wastes to approach the radiation balance with the natural uranium extracted and put to use. The paper discusses the way the approximation to the balance between the raw material and waste activity is influenced by introduction of the transmutational NFC (in case 2), inclusion of transmutation reactors into the energy mix (case 1), partial disposal of actinide wastes into outer space, and by recycling of protactinium (case 3). It is shown that such a balance can be sustained for a considerable time in cases 2 and 3 or throughout the operation stage of the future nuclear power (case 1). (orig.)

  11. Parametric analyses of single-zone thorium-fueled molten salt reactor fuel cycle options

    International Nuclear Information System (INIS)

    Powers, J.J.; Worrall, A.; Gehin, J.C.; Harrison, T.J.; Sunny, E.E.

    2013-01-01

    Analyses of fuel cycle options based on thorium-fueled Molten Salt Reactors (MSRs) have been performed in support of fuel cycle screening and evaluation activities for the United States Department of Energy. The MSR options considered are based on thermal spectrum MSRs with 3 different separations levels: full recycling, limited recycling, and 'once-through' operation without active separations. A single-fluid, single-zone 2250 MWth (1000 MWe) MSR concept consisting of a fuel-bearing molten salt with graphite moderator and reflectors was used as the basis for this study. Radiation transport and isotopic depletion calculations were performed using SCALE 6.1 with ENDF/B-VII nuclear data. New methodology developed at Oak Ridge National Laboratory (ORNL) enables MSR analysis using SCALE, modeling material feed and removal by taking user-specified parameters and performing multiple SCALE/TRITON simulations to determine the resulting equilibrium operating conditions. Parametric analyses examined the sensitivity of the performance of a thorium MSR to variations in the separations efficiency for protactinium and fission products. Results indicate that self-sustained operation is possible with full or limited recycling but once-through operation would require an external neutron source. (authors)

  12. Electronic structure of the actinides and their dioxides. Application to the defect formation energy and krypton solubility in uranium dioxide

    International Nuclear Information System (INIS)

    Petit, T.; CEA Centre d'Etudes de Grenoble, 38

    1996-01-01

    Uranium dioxide is the standard nuclear fuel used in French h power plants. During irradiation, fission products such as krypton and xenon are created inside fuel pellets. So, gas release could become, at very high burnup, a limiting factor in the reactor exploitation. To study this subject, we have realised calculations using the Density Functional Theory (DFT) into the Local Density Approximation (LDA) and the Atomic Sphere Approximation (ASA). First, we have validated our approach by calculating cohesive properties of thorium, protactinium and uranium metals. The good agreement between our results and experimental values implies that 5f electrons are itinerant. Calculated lattice parameter, cohesive energy and bulk modulus for uranium and thorium dioxides are in very good agreement with experiment. We show that binding between uranium and oxygen atoms is not completely ionic but partially covalent. The question of the electrical conductivity still remains an open problem. We have been able to calculate punctual defect formation energies in uranium dioxide. Accordingly to experimental observations, we find that it is easier to create a defect in the oxygen sublattice than in the uranium sublattice. Finally, we have been able to predict a probable site of krypton atoms in nuclear fuel: the Schottky trio. Experiences of Extended X-ray Absorption Fine structure Spectroscopy (EXAFS) and X-ray Photoelectron Spectroscopy (XPS) on uranium dioxide doped by ionic implantation will help us in the comprehension of the studied phenomena and the interpretation of our calculations. (author)

  13. Analysis of burnup of Angra 2 PWR nuclear with addition of thorium dioxide fuel using ORIGEN-ARP

    International Nuclear Information System (INIS)

    Goncalves, Isadora C.; Wichrowski, Caio C.; Oliveira, Claudio L. de; Vellozo, Sergio O.; Baptista, Camila O.

    2017-01-01

    It is known that isotope "2"3"2thorium is a fertile nuclide with the ability to convert into "2"3"3uranium, a potentially fissile isotope, after absorbing a neutron. As there is a large stock of available thorium in the world, this element shows great promise in mitigate the world energy crisis, more particularly in the problem of uranium scarcity, besides being an alternative nuclear fuel for those currently used in reactors, and yet presenting advantages as an option for the non-proliferation movement, among others. In this study, the analysis of the remaining nuclides of burnup was carried out for the core configuration of a PWR (pressurized water reactor) reactor, specifically the Angra 2 reactor, using only uranium dioxide, its current configuration, and in different configurations including a mixed oxide of uranium and thorium in three concentrations, allowing a preliminary assessment of the feasibility of the modification of the fuel, the resulting production of "2"3"3uranium, the emergence of "2"3"1protactinium (an isotope that only occurs as a fission product of "2"3"2Th) resulting from burning. The study was carried out using data obtained from FSAR (Final Safety Analysis Report) of Angra 2, using the SCALE 6.1, a modeling and simulation nuclear code, especially its ORIGEN-ARP module, which analyzes the depletion of isotopes presents in a reactor. (author)

  14. New equations to calculate temperature correction factors for PO2 in human blood.

    Science.gov (United States)

    Inaba, H; Ohwada, T; Sato, J; Mizuguchi, T; Hirasawa, H

    1986-01-01

    Effects of hemoglobin concentration (Hb), pH, and body temperature (T) on the relationships between delta log PO2/delta T and PO2 were studied by means of a mathematical model using a Newton-Raphson iteration method. The functions between delta log PO2/delta T and PO2 were affected by the above three factors. New equations considering the effects of Hb, pH, and T were proposed by modifying the equation reported by Severinghaus: delta log PO2/delta T = (L +(U-L)/(A(vPO237)B + 1))(10(-2) where U = 3.15-0.45(7.4-pH37) L = 0.68-0.09(7.4-pH37) A = 5.86(exp10(0.074(T)-0.294(7.4-pH37)-11))((Hb)0.913) B = 6.33(exp10(-0.0051(T)))((Hb)-0.113) + 0.24(7.4-pH37) and vPO237 is virtual PO237 which may exist when PO237 is corrected to standard conditions (pH = 7.4, BE = 0) by the following equations: vPO237 = PO237(exp10(fB(7.4-pH37)-0.0013(BE))) fB = (PO237/26.6)0.08-1.52 where fB is the Bohr factor. The above equations provided values of delta log PO2/delta T which fit closely to those obtained by the complex iteration method with maximum differences of less than 1.3 X 10(-3) at T = 27, indicating that maximum % errors for PO2 at T (PO2T) are less than 3.0% at T = 27 and that our equations can be applied over a wide range of Hb, pH37 and T.

  15. Neptunium Transport Behavior in the Vicinity of Underground Nuclear Tests at the Nevada Test Site

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, P; Tinnacher, R M; Zavarin, M; Williams, R W; Kersting, A B

    2010-12-03

    We used short lived {sup 239}Np as a yield tracer and state of the art magnetic sector ICP-MS to measure ultra low levels of {sup 237}Np in a number of 'hot wells' at the Nevada National Security Site (NNSS), formerly known as the Nevada Test Site (NTS). The results indicate that {sup 237}Np concentrations at the Almendro, Cambric, Dalhart, Cheshire and Chancellor sites, are in the range of 3 x 10{sup -5} to 7 x 10{sup -2} pCi/L and well below the MCL for alpha emitting radionuclides (15 pCi/L) (EPA, 2009). Thus, while Np transport is believed to occur at the NNSS, activities are expected to be well below the regulatory limits for alpha-emitting radionuclides. We also compared {sup 237}Np concentration data to other radionuclides, including tritium, {sup 14}C, {sup 36}Cl, {sup 99}Tc, {sup 129}I, and plutonium, to evaluate the relative {sup 237}Np transport behavior. Based on isotope ratios relative to published unclassified Radiologic Source Terms (Bowen et al., 1999) and taking into consideration radionuclide distribution between melt glass, rubble and groundwater (IAEA, 1998), {sup 237}Np appears to be substantially less mobile than tritium and other non-sorbing radionuclides, as expected. However, this analysis also suggests that {sup 237}Np mobility is surprisingly similar to that of plutonium. The similar transport behavior of Np and Pu can be explained by one of two possibilities: (1) Np(IV) and Pu(IV) oxidation states dominate under mildly reducing NNSS groundwater conditions resulting in similar transport behavior or (2) apparent Np transport is the result of transport of its parent {sup 241}Pu and {sup 241}Am isotopes and subsequent decay to {sup 237}Np. Finally, measured {sup 237}Np concentrations were compared to recent Hydrologic Source Term (HST) models. The 237Np data collected from three wells in Frenchman Flat (RNM-1, RNM-2S, and UE-5n) are in good agreement with recent HST transport model predictions (Carle et al., 2005). The agreement

  16. Update neutron nuclear data evaluation for 236,238Np

    International Nuclear Information System (INIS)

    Chen, Guochang; Wang, Jimin; Yu, Baosheng; Cao, Wentian; Tang, Guo-you

    2015-01-01

    The nuclear data with high accuracy for actinides play an important role in nuclear technology applications, including reactor design and operation, fuel cycle, estimation of the amount of minor actinides (MAs) in high burnup reactors and to research to transmute the MAs to short half-lived nuclides or stable ones. The nuclides of 236 Np are generated via the α-decay of 240 Am or 237 Np(n, 2n) and 237 Np(d, t) reactions. And the nuclides of 238 Np are generated via the α-decay of 242 Am or 237 Np(n, γ) and 237 Np(d, p) reactions. In the present work, according to the systematic trend of the total cross section and elastic cross section etc. of different Np isotopes, and based on the neutron optical model parameters (OMP) of 237 Np, a new set of neutron optical model parameters were obtained for 236,238 Np. Based on the new set OMP and the systematic trend of the cross sections of different Np isotopes, a full set of 236,238 Np neutron nuclear data has been updated and improved by theoretical calculation. The present result has significant improvements over the data in CENDL-3.1

  17. Excited levels of Pa-233; Niveles excitados del Pa-233

    Energy Technology Data Exchange (ETDEWEB)

    Vara Cuadrado, J M

    1969-07-01

    A study of Pa-233 excited levels from the alpha decay of Np-237 and from beta decay of Th-233 has been performed. The alpha decay spectrum was measured with a semiconductor spectrometer of 18 keV effective resolution (FWHM). Over 13 new lines were identified. The gamma ray spectra of Np-237 and Th-233 were obtained with a Ge-Li detector low and medium range energy lines, and with Si-Li detector for the low energy region. A continuous purification method of Np-237 from its comparatively short-lived daughter Pa-233 was applied. A high number of new lines were identified in both spectra. The gamma-gamma coincidence spectra were obtained with INa(T{sub 1}) detectors. (Author) 54 refs.

  18. Excited levels of Pa-233

    International Nuclear Information System (INIS)

    Vara Cuadrado, J. M.

    1969-01-01

    A study of Pa-233 excited levels from the alpha decay of Np-237 and from beta decay of Th-233 has been performed. The alpha decay spectrum was measured with a semiconductor spectrometer of 18 keV effective resolution (FWHM). Over 13 new lines were identified. The gamma ray spectra of Np-237 and Th-233 were obtained with a Ge-Li detector low and medium range energy lines, and with Si-Li detector for the low energy region. A continuous purification method of Np-237 from its comparatively short-lived daughter Pa-233 was applied. A high number of new lines were identified in both spectra. The gamma-gamma coincidence spectra were obtained with INa(T 1 ) detectors. (Author) 54 refs

  19. Aspects of 238Pu production in the experimental fast reactor JOYO

    International Nuclear Information System (INIS)

    Osaka, Masahiko; Koyama, Shin-ichi; Tanaka, Kenya; Itoh, Masahiko; Saito, Masaki

    2005-01-01

    Experimental determination of 238 Pu in 237 Np samples irradiated in the experimental fast reactor JOYO was done as part of the demonstration of 238 Pu production from 237 Np in fast reactors within the framework of the protected Pu production project, which aims at reinforcement of proliferation resistance of Pu by increasing the 238 Pu isotopic ratio. 238 Pu production amount in the irradiated 237 Np samples was determined by a radioanalytical technique. Aspects of 238 Pu production were examined on the basis of the present radioanalysis. The 238 Pu production amount depends on the neutron spectrum which can range from that of a typical fast reactor to a nearly epi-thermal spectrum. It is concluded that the fast reactor has not only high potential for use in protected Pu production, but also as an incinerator for excess Pu

  20. Uranium age determination - Separation and analysis of 230Th and 231Pa

    International Nuclear Information System (INIS)

    Morgenstern, A.; Apostolidis, C.; Mayer, K.; Wallenius, M.

    2002-01-01

    uranium must be of high chemical recovery and must afford large decontamination factors. In general, the age obtained from parent/daughter ratios refers to the last separation of the parent nuclide from its daughters, i.e. the last purification of the material. The accuracy of the obtained age therefore depends on the quality of the purification process and assumes that the material subsequently has not been contaminated. Obviously the availability of two analytical methods relying on both, independent parent/daughter pairs will therefore significantly increase the confidence in the experimental results. In this work we demonstrate analytical methods for the age determination of uranium samples using the parent/daughter relations 234 U/ 230 Th and 235 U/ 231 Pa. Thorium is separated from bulk uranium using extraction chromatography and subsequently quantified using □-spectrometry, thermal ionisation mass spectrometry (TIMS) and inductively coupled mass spectrometry (ICP-MS). Protactinium is separated by highly selective sorption of protactinium to silica gel followed by □-spectrometric quantification. The methods were tested and validated using uranium reference materials of different uranium enrichment and of known ages. The experimental results obtained with both methods were found to agree with the assumed ages of the reference materials within the combined uncertainty of the measurement. The analysis exploiting the parent/daughter pair 235 U/ 231 Pa exhibits a slightly larger combined uncertainty and bias than the thorium method but is found valuable in validating the experimental results by means of a second, independent analysis. (author)

  1. The Properties of Trilaurylmethylammonium Nitrate as an Extractant for Trivalent Actinides. RCN Report

    International Nuclear Information System (INIS)

    Ooyen, J. van

    1970-03-01

    The concept of the group of the actinide elements as a f-type transition series within the periodic system was first launched by G.T. Seaborg in 1944]. In this transition series the filling up of the 5 f electron shell would cause a close similarity with the lanthanide series. This proved to be a very fruitful hypothesis in the prediction of the properties of the new elements americium and curium that soon were discovered. The new hypothesis necessitated a shift of the accepted ideas concerning the place of the elements thorium, protactinium and uranium in the periodic table. In fact, the chemistry of these elements had never been considered to be so closely parallel to that of the lanthanides. On the contrary, the trend in the stability of the oxidation states had been interpreted to indicate that these elements would belong to group IVA, VA and VIA respectively. It is undeniable that there are marked differences in oxidation states between the lanthanide elements and the first six elements of the actinide series. However, physical and chemical investigations both of the newly discovered elements and the elements actinium to uranium disclosed many resemblances with the lanthanides that had not been noticed before in this group. The actinide elements - and more in particular the transuranium elements - have been the subject of a number of monographs covering the discovery, the synthesis, the systematics, the chemistry, and (or) the nuclear properties of these elements. It is for this reason that the scope of the following sections in this chapter will be limited to a summary of the chemistry in sofar as it is relevant to the investigations described in the following chapters, viz., the properties of the elements in aqueous systems and more in particular in those systems containing nitrate ions

  2. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Moody, K.J.

    1983-07-01

    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined

  3. The geology and geochemistry of some epigenetic uranium deposits near the Swakop River, South West Africa

    International Nuclear Information System (INIS)

    Hambleton-Jones, B.B.

    1983-10-01

    This study comprises a geological and geochemical investigation of the uranium deposits in the region near the Swakop River which extends from the Langer Heinrich Mountain in the east to the end of the Tumas River in the west. The general geology of the basement rocks in the Langer Heinrich region only is discussed. The general geology of the younger duricrust formations is discussed. Analytical methods were developed for the separation of thorium, protactinium and uranium from geological materials using various chromatographic procedures. Alpha spectrometry, neutron activation analysis and delayed neutron counting were the main techniques used. The occurrence of uranium in the region of study follows a unique geochemical cycle, and the geochemistry at each stage in the cycle was examined. The first stage in the uranium-geochemical cycle was the basement rocks. The second stage in the geochemical cycle of uranium was the subsurface water. The third stage in the geochemical cycle of uranium concerns its occurrence in the duricrust deposits. Isotopic disequilibrium measurements showed that uranium is still migrating, and that the age of the carnotite precipitation is 30 000 years, based on the open-system model of uranium migration. In the final stage of the geochemical cycle, the geochemistry of uranium in seawater and the diatomaceous muds is discussed. A classification system for the uranium deposits near the Swakop River, based on genetic relationships, is proposed and described in terms of the geochemical cycle of uranium, the mode of transport and mode of deposition. The relationships between the duricrust uranium deposits and the other uranium deposits of South Africa are compared

  4. Spent Nuclear Fuel Reprocessing Flowsheet. A Report by the WPFC Expert Group on Chemical Partitioning of the NEA Nuclear Science Committee

    International Nuclear Information System (INIS)

    Na, Chan; Yamagishi, Isao; Choi, Yong-Joon; Glatz, Jean-Paul; Hyland, Bronwyn; Uhlir, Jan; Baron, Pascal; Warin, Dominique; De Angelis, Giorgio; Luce, Alfredo; INOUE, Tadashi; Morita, Yasuji; Minato, Kazuo; Lee, Han Soo; Ignatiev, Victor V.; Kormilitsyn, Mikhail V.; Caravaca, Concepcion; Lewin, Robert G.; Taylor, Robin J.; Collins, Emory D.; Laidler, James J.

    2012-06-01

    Under the auspices of the NEA Nuclear Science Committee (NSC), the Working Party on Scientific Issues of the Fuel Cycle (WPFC) has been established to co-ordinate scientific activities regarding various existing and advanced nuclear fuel cycles, including advanced reactor systems, associated chemistry and flowsheets, development and performance of fuel and materials, and accelerators and spallation targets. The WPFC has different expert groups to cover a wide range of scientific fields in the nuclear fuel cycle. The Expert Group on Chemical Partitioning was created in 2001 to (1) perform a thorough technical assessment of separations processes in application to a broad set of partitioning and transmutation (P and T) operating scenarios and (2) identify important research, development and demonstration necessary to bring preferred technologies to a deployable stage and (3) recommend collaborative international efforts to further technological development. This report aims to collect spent nuclear fuel reprocessing flowsheet of various processes developed by member states: aqueous, pyro and fluoride volatility. Contents: 1 - Hydrometallurgy process: Standard PUREX, Extended PUREX, UREX+3, Grind/Leach; 2 - Pyrometallurgy process: pyro-process (CRIEPI - Japan), 4-group partitioning process, pyro-process (KAERI - Korea), Direct electrochemical processing of metallic fuel, PyroGreen (reduce radiotoxicity to the level of low and intermediate level waste - LILW); 3 - Fluoride volatility process: Fluoride volatility process, Uranium and protactinium removal from fuel salt compositions by fluorine bubbling, Flowsheet studies on non-aqueous reprocessing of LWR/FBR spent nuclear fuel; Appendix A: Flowsheet studies of RIAR (Russian Federation), List of contributors, Members of the expert group

  5. Fuel processing for molten-salt reactors

    International Nuclear Information System (INIS)

    Hightower, J.R. Jr.

    1975-01-01

    Progress is reported on the development of processes for the isolation of protactinium and for the removal of fission products from molten-salt breeder reactors. The metal transfer experiment MTE-3 (for removing rare earths from MSRE fuel salt) was completed and the equipment used in that experiment was examined. The examination showed that no serious corrosion had occurred on the internal surfaces of the vessels, but that serious air oxidation occurred on the external surfaces of the vessels. Analyses of the bismuth phases indicated that the surfaces in contact with the salts were enriched in thorium and iron. Mass transfer coefficients in the mechanically agitated nondispersing contactors were measured in the Salt/Bismuth Flow-through Facility. The measured mass transfer coefficients are about 30 to 40 percent of those predicted by the preferred literature correlation, but were not as low as those seen in some of the runs in MTE-3. Additional studies using water--mercury systems to simulate molten salt-bismuth systems indicated that the model used to interpret results from previous measurements in the water--mercury system has significant deficiencies. Autoresistance heating studies were continued to develop a means of internal heat generation for frozen-wall fluorinators. Equipment was built to test a design of a side arm for the heating electrode. Results of experiments with this equipment indicate that for proper operation the wall temperature must be held much lower than that for which the equipment was designed. Studies with an electrical analog of the equipment indicate that no regions of abnormally high current density exist in the side arm. (JGB)

  6. Concept and experimental studies on fuel and target for minor actinides and fission products transmutation

    Energy Technology Data Exchange (ETDEWEB)

    Prunier, C; Guerin, Y [CEA Centre d` Etudes de Cadarache, 13 - Saint-Paul-lez-Durance (France). Dept. d` Etudes des Combustibles; Salvatores, M [CEA Centre d` Etudes de Cadarache, 13 - Saint-Paul-lez-Durance (France). Direction des Reacteurs Nucleaires; Zaetta, A [CEA Centre d` Etudes de Cadarache, 13 - Saint-Paul-lez-Durance (France). Dept. d` Etudes des Reacteurs

    1994-12-31

    High activity long-lived radionuclides in nuclear wastes, namely minor actinides (americium and neptunium) are in large amount generated by current nuclear reactive. The destruction of these radionuclides is a part of the French SPIN (Partitioning and Burning) program consistent with the determination to send a minimum amount of harmful products for final storage. Transmutation concepts are defined for neptunium and americium taking into account fuel cycle strategies. Neptunium destruction does not pose any major problems. It`s a by-product of uranium consumption, as plutonium and in despite of a slight gamma activity due to the protactinium 233 it`s quite easy to handle. Diluting neptunium in the mixed oxide fuels (MOX) should not be an obstacle for fabrication, in-pile behaviour and reprocessing either. Consequently we make the proposal of homogeneous mode of neptunium in MOX which should be soon explored in the experimental OSIRIS reactor and in the Phenix and Superphenix reactors. The analysis is more complex for the multi isotope americium. Its destruction is difficult because of gamma radioactivity which complicates fabrication. Experiments in Phenix and calculation showed that Phenix reactor offers a good potential for americium incineration, but similar data do not exist for PWR. It will remain a well known difficulty for fabrication and reprocessing. In this case we have to put a real new face to the fabrication flow-sheet of americium compounds and we propose to develop the heterogeneous mode. Targets choice are defined in term of: -safety, considering fuel reaction with cladding and water sodium, -transmutation rate, limited by target behaviour, in FR`s (Phenix), PWR`s (OSIRIS) and HFR (Petten), -reprocessing, checking the solubility of such targets by Purex process. So, at the beginning of our program the account has been on improving fuel and targets properties related to safety and fuel cycle. (authors). 4 figs.

  7. An aerial radiological survey of the Oak Ridge Reservation and surrounding area, Oak Ridge, Tennessee

    International Nuclear Information System (INIS)

    Maurer, R.J.

    1989-09-01

    An aerial radiological survey of the Oak Ridge Reservation (ORR) and surrounding area in Oak Ridge, Tennessee, was conducted from September 12--29, 1989. The purpose of the survey was to measure and document the site's terrestrial radiological environment for use in effective environmental management and emergency response planning. The aerial survey was flown at an altitude of 91 meters (300 feet) along a series of parallel lines 152 meters (500 feet) apart. The survey encompassed an area of 440 square kilometers (170 square miles) as defined by the Tennessee Valley Authority Map S-16A of the entire Oak Ridge Reservation and adjacent area. The results of the aerial survey are reported as inferred exposure rates at 1 meter above ground level (AGL) in the form of a radiation contour map. Typical background exposure rates were found to vary from 5 to 14 microroentgens per hour (μR/h). The man-made radionuclides, cobalt-60, cesium-137, and protactinium-234m (a radioisotope indicative of depleted uranium), were detected at several facilities on the site. In support of the aerial survey, ground-based exposure rate and soil sample measurements were obtained at several locations within the survey boundary. In addition to the large scale aerial survey, two special flyovers were requested by the Department of Energy. The first request was to conduct a survey of a 1-mile x 2-mile area in south Knoxville, Tennessee. The area had been used previously to store contaminated scrap metals from operations at the Oak Ridge site. The second request was to fly several passes over a 5-mile length of railroad tracks leading from the Oak Ridge Y-12 Plant, north through the city of Oak Ridge. The railroad tracks had been previously used in the transport of cesium-137

  8. Radiological aspects in a monazite based rare earth production facility

    International Nuclear Information System (INIS)

    Harikumar, M.; Sujata, R.; Chinnaesakki, S.; Tripathi, R.M.; Puranik, V.D.; Nair, N.N.G.

    2011-01-01

    One of the largest reserves of monazite in the world is present in the Indian subcontinent. Monazite ore has around 8-9% thorium oxide and nearly 60% Rare earth oxides. Selective acid extraction is used to separate the composite rare earths. The main radiological hazard arises from the presence of thorium and its daughter products. Monitoring of the radiation field and air activity in the rare earths plant is done routinely to reduce the radiation exposure to plant personnel. The separation of uranium and rare earths from Thorium concentrate separated from Monazite is being done as a part of the THRUST (Thorium Retrieval, Recovery of Uranium and Re-storage of Thorium) project from 2004 at Indian Rare Earths Limited, Udyogamandal. The radiological aspect for this extraction of uranium and rare earths was studied. The general radiation field in the rare earth production plant was 0.3-5.0 μGyh -1 and the average short lived air activity was 46 ± 7 mWL. The long lived air activity arising from 232 Th is very insignificant radiologically. The occupational radiation exposure for the rare earths separation plant is only 6 % of the total dose and the estimated average individual dose is 1.6 mSv per year. Studies were also done to estimate the residual radioactivity in the separated rare earth compounds using gamma spectrometry and the results showed significant presence of 227 Ac arising due to the protactinium fraction in the thorium concentrate. This activity is not detectable in a freshly separated rare earth compound but can buildup with time. (author)

  9. An aerial radiological survey of the Nevada Test Site

    International Nuclear Information System (INIS)

    Hendricks, T.J.; Riedhauser, S.R.

    1999-01-01

    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the US Department of Energy's Nevada Test Site including three neighboring areas during August and September 1994. The survey team measured the terrestrial gamma radiation at the Nevada Test Site to determine the levels of natural and man-made radiation. This survey included the areas covered by previous surveys conducted from 1962 through 1993. The results of the aerial survey showed a terrestrial background exposure rate that varied from less than 6 microroentgens per hour (mR/h) to 50 mR/h plus a cosmic-ray contribution that varied from 4.5 mR/h at an elevation of 900 meters (3,000 feet) to 8.5 mR/h at 2,400 meters (8,000 feet). In addition to the principal gamma-emitting, naturally occurring isotopes (potassium-40, thallium-208, bismuth-214, and actinium-228), the man-made radioactive isotopes found in this survey were cobalt-60, cesium-137, europium-152, protactinium-234m an indicator of depleted uranium, and americium-241, which are due to human actions in the survey area. Individual, site-wide plots of gross terrestrial exposure rate, man-made exposure rate, and americium-241 activity (approximating the distribution of all transuranic material) are presented. In addition, expanded plots of individual areas exhibiting these man-made contaminations are given. A comparison is made between the data from this survey and previous aerial radiological surveys of the Nevada Test Site. Some previous ground-based measurements are discussed and related to the aerial data. In regions away from man-made activity, the exposure rates inferred from the gamma-ray measurements collected during this survey agreed very well with the exposure rates inferred from previous aerial surveys

  10. Removal of 230Th and 231Pa at ocean margins

    International Nuclear Information System (INIS)

    Anderson, R.F.; Bacon, M.P.; Brewer, P.G.

    1983-01-01

    Uranium, thorium and protactinium isotopes were measured in particulate matter collected by sediment traps deployed in the Panama Basin and by in-situ filtration of large volumes of seawater in the Panama and Guatemala Basins. Concentrations of dissolved Th and Pa isotopes were determined by extraction onto MnO 2 adsorbers placed in line behind the filters in the in-situ pumping systems. Concentrations of dissolved 230 Th and 231 Pa in the Panama and Guatemala Basins are lower than in the open ocean, whereas dissolved 230 Th/ 231 Pa ratios are equal to, or slightly greater than, ratios in the open ocean. Particulate 230 Th/ 231 Pa ratios in the sediment trap samples ranged from 4 to 8, in contrast to ratios of 30 or more at the open ocean sites previously studied. Particles collected by filtration in the Panama Basin and nearest to the continental margin in the Guatemala Basin contained 230 Th/ 231 Pa ratios similar to the ratios in the sediment trap samples. The ratios increased with distance away from the continent. Suspended particles near the margin show no preference for adsorption of Th or Pa and therefore must be chemically different from particles in the open ocean, which show a strong preference for adsorption of Th. Ocean margins, as typified by the Panama and Guatemala Basins, are preferential sinks for 231 Pa relative to 230 Th. Furthermore, the margins are sinks for 230 Th and, to a greater extent, 231 Pa transported by horizontal mixing from the open ocean. (orig.)

  11. Exploring the Presence of microDNAs in Prostate Cancer Cell Lines, Tissue, and Sera of Prostate Cancer Patients and its Possible Application as Biomarker

    Science.gov (United States)

    2016-04-01

    ES2 OVCAR8 LnCap PC-3 C4-2 Cell Count 1.8X108 1x108 1.1X108 1.24X108 1.1X108 Episomal DNA (ug) 21.3 23.7 26 15.6 20.4 Starting DNA (ug) 21.3 23.7...kidney, liver, lung, skeletal muscle, spleen, sperm , testis and thymus) (5). EccDNA sequences were then enriched by multiple displacement amplification...including sperm . MicroDNAs arise preferentially from areas with high gene density, GC content, and exon density from promoters with activating chro

  12. Child Pornography. An Exploratory Study

    Science.gov (United States)

    1990-01-01

    The Sexual Exploitation of Children. New York: St Martins Press, 1986. Fields, Howa’-4 "Supreme Court, 6-3, Sans Possossiron of Child Porn ...Court, 6-3, Bans Possession of Child Porn ," Publishers Weekly 237, no.18 (May 4, 1990) 10. 27 See: O’Brien, 65-78; Seth L. Goldstein, "Investigating...15, (1973). 3 New York v. Ferber, 458 U.S. 757, (1982). 4 Howard Fields, "Supreme Court, 6-3, Bans Possession of Child Porn ,’" Publishers Weekly 237

  13. Non-conventional measurement techniques for the determination of some long-lived radionuclides produced in nuclear fuel

    International Nuclear Information System (INIS)

    Rosenberg, R.J.

    1992-04-01

    The results of a literature survey on non-radiometric analytical techniques for the determination of long-lived radionuclides are described. The methods which have been considered are accelerator mass spectrometry, inductively coupled plasma mass spectrometry, thermal ionization mass spectrometry, resonance ionization spectrometry, resonance ionization mass spectrometry and neutron activation analysis. Neutron activation analysis has been commonly used for the determination of 129 I and 237 Np in environmental samples. Inductively coupled mass spectrometry seems likely to become the method of choice for the determination of 99 Tc, 237 Np and Pu-isotopes. The methods are discussed and the chemical separation methods described. (orig.)

  14. Source-driven noise analysis measurements with neptunium metal reflected by high enriched uranium

    International Nuclear Information System (INIS)

    Valentine, Timothy E.; Mattingly, John K.

    2003-01-01

    Subcritical noise analysis measurements have been performed with neptunium ( 237 Np) sphere reflected by highly enriched uranium. These measurements were performed at the Los Alamos Critical Experiment Facility in December 2002 to provide an estimate of the subcriticality of 237 Np reflected by various amounts of high-enriched uranium. This paper provides a description of the measurements and presents some preliminary results of the analysis of the measurements. The measured and calculated spectral ratios differ by 15% whereas the 'interpreted' and calculated k eff values differ by approximately 1%. (author)

  15. Construction of a Recyclable Genetic Marker and Serial Gene Deletions in the Human Pathogenic Mucorales Mucor circinelloides.

    Science.gov (United States)

    Garcia, Alexis; Adedoyin, Gloria; Heitman, Joseph; Lee, Soo Chan

    2017-07-05

    Mucor circinelloides is a human pathogen, biofuel producer, and model system that belongs to a basal fungal lineage; however, the genetics of this fungus are limited. In contrast to ascomycetes and basidiomycetes, basal fungal lineages have been understudied. This may be caused by a lack of attention given to these fungi, as well as limited tools for genetic analysis. Nonetheless, the importance of these fungi as pathogens and model systems has increased. M. circinelloides is one of a few genetically tractable organisms in the basal fungi, but it is far from a robust genetic system when compared to model fungi in the subkingdom Dikarya. One problem is the organism is resistant to drugs utilized to select for dominant markers in other fungal transformation systems. Thus, we developed a blaster recyclable marker system by using the pyrG gene (encoding an orotidine-5'-phosphate decarboxylase, ortholog of URA3 in Saccharomyces cerevisiae ). A 237-bp fragment downstream of the pyrG gene was tandemly incorporated into the upstream region of the gene, resulting in construction of a pyrG-dpl237 marker. To test the functionality of the pyrG-dpl237 marker, we disrupted the carRP gene that is involved in carotenoid synthesis in pyrG - mutant background. The resulting carRP :: pyrG-dpl237 mutants exhibit a white colony phenotype due to lack of carotene, whereas wild type displays yellowish colonies. The pyrG marker was then successfully excised, generating carRP-dpl237 on 5-FOA medium. The mutants became auxotrophic and required uridine for growth. We then disrupted the calcineurin B regulatory subunit cnbR gene in the carRP :: dpl237 strain, generating mutants with the alleles carRP :: dpl237 and cnbR :: pyrG These results demonstrate that the recyclable marker system is fully functional, and therefore the pyrG-dpl237 marker can be used for sequential gene deletions in M. circinelloides . Copyright © 2017 Garcia et al.

  16. Contribution to the experimental study of transuranian element (Pu, Am, Cm) transfers between the various phases (particles, water, organisms) of the sedimentary system

    International Nuclear Information System (INIS)

    Grillo, M.C.

    1982-06-01

    The methodology of this work is first given. Transfer kinetics of 237 Pu, 241 Am and 242 Cm between seawater and macrofauna of loose substrates are studied. The effect of temperature and salinity over the transfers of 237 Pu, 241 Am and 242 Cm between water and bivalve mollusk Tapes decussatus is then studied. This work deals also with transfer kinetics of these elements between carnivorous organisms of the loose substrates and their preys. A preliminary study of 241 Am transfers between two phases, particles and interstitial water is finally presented: role of benthic burrowing organisms [fr

  17. Construction of a Recyclable Genetic Marker and Serial Gene Deletions in the Human Pathogenic Mucorales Mucor circinelloides

    Directory of Open Access Journals (Sweden)

    Alexis Garcia

    2017-07-01

    Full Text Available Mucor circinelloides is a human pathogen, biofuel producer, and model system that belongs to a basal fungal lineage; however, the genetics of this fungus are limited. In contrast to ascomycetes and basidiomycetes, basal fungal lineages have been understudied. This may be caused by a lack of attention given to these fungi, as well as limited tools for genetic analysis. Nonetheless, the importance of these fungi as pathogens and model systems has increased. M. circinelloides is one of a few genetically tractable organisms in the basal fungi, but it is far from a robust genetic system when compared to model fungi in the subkingdom Dikarya. One problem is the organism is resistant to drugs utilized to select for dominant markers in other fungal transformation systems. Thus, we developed a blaster recyclable marker system by using the pyrG gene (encoding an orotidine-5′-phosphate decarboxylase, ortholog of URA3 in Saccharomyces cerevisiae. A 237-bp fragment downstream of the pyrG gene was tandemly incorporated into the upstream region of the gene, resulting in construction of a pyrG-dpl237 marker. To test the functionality of the pyrG-dpl237 marker, we disrupted the carRP gene that is involved in carotenoid synthesis in pyrG− mutant background. The resulting carRP::pyrG-dpl237 mutants exhibit a white colony phenotype due to lack of carotene, whereas wild type displays yellowish colonies. The pyrG marker was then successfully excised, generating carRP-dpl237 on 5-FOA medium. The mutants became auxotrophic and required uridine for growth. We then disrupted the calcineurin B regulatory subunit cnbR gene in the carRP::dpl237 strain, generating mutants with the alleles carRP::dpl237 and cnbR::pyrG. These results demonstrate that the recyclable marker system is fully functional, and therefore the pyrG-dpl237 marker can be used for sequential gene deletions in M. circinelloides.

  18. Biology of neptunium

    International Nuclear Information System (INIS)

    Wirth, R.E.

    1985-11-01

    This work contains detailed information about fractional absorption of neptunium through gastrointestinal tract in vivo as well as about organ and subcellular distribution in rats. Biochemical investigations have shown, that neptunium is bound to the iron transport protein transferrin in the blood serum. A long-term experiment resulted in osteosarkomincidences of 11% (0.2 mp Np-237/kg) and 36% (1 mg Np-237/kg); simultaneous the whole-body retention was measured during the natural lifespan of the animals of 2.5 years. (orig.) [de

  19. {open_quotes}Transmutation efficiency calculation in the blanket on melted salts with central neptunium target{close_quotes}

    Energy Technology Data Exchange (ETDEWEB)

    Kolesov, V.F.; Shtarev, S.K.; Khoruzhiy, V.K. [Russia Federal Nuclear Center, Arzamas (Russian Federation)] [and others

    1995-10-01

    In the limits of ABC project version of two-sectional reactor system in the form of combination of subcritical blanket on melted salts and multiplying target from threshold fissile material {sup 237}Np is considered. This research is the development of the VNIIEF`s earlier work`s (Russia) investigating of usage possibilities in ABC project the conception of multisectional blankets with single-sided neutron coupling between sections. With the help of Monte-Carlo program the calculations results of system mentioned are given. The possibility of accelerator`s considerable power reduction at the account of thorium target substitution with neptunium-237 multiplying target is shown.

  20. Transport of neptunium through Yucca Mountain tuffs

    International Nuclear Information System (INIS)

    Triay, I.R.; Robinson, B.A.; Mitchell, A.J.; Overly, C.M.; Lopez, R.M.

    1993-01-01

    Neptunium has a high solubility in groundwaters from Yucca Mountain [1]. Uranium in nuclear reactors produces 237 Np which has a half-life of 2.1 4 x 10 6 years. Consequently, the transport of 237 Np through tuffs is of major importance in assessing the performance of a high-level nuclear waste repository at Yucca Mountain. The objective of this work is to determine the amount of Np retardation that is provided by the minerals in Yucca Mountain tuffs as a function of groundwater chemistry

  1. The discovery of plutonium reorganized the periodic table and aided the discovery of new elements

    International Nuclear Information System (INIS)

    Clark, David L.

    2009-01-01

    The modern Periodic Table derives principally from the work of the great Russian scientist Dimitri Mendeleev, who in 1869 enunciated a 'periodic law' that the properties of the elements are a periodic function of their atomic weights, and arranged the 65 known elements in a 'periodic table'. Fundamentally, every column in the main body of the Periodic Table is a grouping of elements that display similar chemical and physical behavior. Similar properties are therefore exhibited by elements with widely different mass. Chemical periodicity is central to the study of chemistry, and no other generalization comes close to its ability to systematize and rationalize known chemical facts. With the development of atomic theory, and an understanding of the electronic structure of atoms, chemical periodicity and the periodic table now find their natural explanation in the electronic structure of atoms. Moving from left to right along any row, the elements are arranged sequentially according to nuclear charge (the atomic number). Electrons counter balance that nuclear charge, hence each successive element has one more electron in its configuration. The electron configuration, or distribution of electrons among atomic orbitals, may be determined by application of the Pauli principle (paired spin in the same orbital) and the aufbau principle (which outlines the order of filling of electrons into shells of orbitals - s, p, d, f, etc.) such that in a given atom, no two electrons may have all four quantum numbers identical. In 1939, only three elements were known to be heavier than actinium: thorium, protactinium, and uranium. All three exhibited variable oxidation states and a complex chemistry. Thorium, protactinium and uranium were assumed to be d-transition metals and were placed in the Periodic Table under hafnium, tantalum, and tungsten, respectively. By 1940, McMillan and Abelson bombarded uranium atoms with slow neutrons and successfully identified atoms of element 93, which

  2. Early career burnout among Dutch nurses : A process captured in a Rasch model

    NARCIS (Netherlands)

    de Vos, Jan Alexander; Brouwers, Andre; Schoot, Tineke; Pat-El, Ron; Verboon, Peter; Näring, Gerard

    2016-01-01

    This study investigates burnout among Dutch nursing graduates as a process by testing a sequential-developmental model. A sample of 237 respondents was recruited from a population of Dutch early career nurses. Burnout was measured with the Dutch version of the Maslach Burnout Inventory Human

  3. Early career burnout among Dutch nurses: A process captured in a Rasch model

    NARCIS (Netherlands)

    Vos, J.A. de; Brouwers, A.; Schoot, T.; Pat-El, R.; Verboon, P.; Näring, G.W.B.

    2016-01-01

    This study investigates burnout among Dutch nursing graduates as a process by testing a sequential-developmental model. A sample of 237 respondents was recruited from a population of Dutch early career nurses. Burnout was measured with the Dutch version of the Maslach Burnout Inventory Human

  4. El expresionismo de Gutiérrez Girardot

    Directory of Open Access Journals (Sweden)

    Guillermo Linero Montes

    2006-05-01

    Full Text Available Entre la ilustración y el expresionismo. Figuras de la literatura alemana. Rafael Gutiérrez Girardot. Fondo de Cultura Económica. Colombia, colección Tierra Firme, Bogotá, 2004, 237 págs.

  5. The occurrence of PPV in cherry trees in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Navrátil, M.; Šafářová, D.; Fanigliulo, A.; Comes, S.; Petrzik, Karel; Karešová, R.

    2004-01-01

    Roč. 657, - (2004), 237-244 ISSN 0567-7572 R&D Projects: GA MZe(CZ) NAZV QD1407 Institutional research plan: CEZ:AV0Z5051902 Keywords : Plum pox virus * Prunus avium * sweet cherry cultivars * ELISA * RT-PCR Subject RIV: EE - Microbiology, Virology

  6. Socio-Demographic and Maternal Factors in Anaemia in Pregnancy ...

    African Journals Online (AJOL)

    Low educational attainment [Adjusted Odds Ratio (AOR)=2.13], being single or divorced [AOR=2.02], high parity [AOR=2.06], late booking [AOR=2.71] and short intervals between pregnancies [AOR=2.37] were significant predictors of anaemia in pregnancy. The high prevalence of anaemia in pregnancy related to low ...

  7. Conceptions of Pupils of the Primary on the Topic of an Electric Circuit in Three Countries (Canada, France and Morocco)

    Science.gov (United States)

    Métioui, Abdeljalil; MacWillie, Mireille Baulu; Trudel, Louis

    2016-01-01

    Qualitative research conducted with 237 pupils from Canada, France, and Morocco, between 10 and 12 years of age, on the setting and functioning of simple electric circuits, demonstrates that similar explanatory systems of the students. For this, we had given them a paper and pencil questionnaire of a sixty minutes duration. The first question was…

  8. Proton emission from laser-generated plasmas at different intensities

    Czech Academy of Sciences Publication Activity Database

    Torrisi, L.; Cutroneo, M.; Cavallaro, S.; Giuffrida, L.; Margarone, Daniele

    2012-01-01

    Roč. 57, č. 2 (2012), s. 237-240 ISSN 0029-5922. [International Conference on Research and Applications of Plasmas (PLASMA). Warsaw, 12.09.2011-16.09.2011] Institutional support: RVO:68378271 Keywords : laser-generated plasma * hydrogenated targets * proton acceleration Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.507, year: 2012

  9. 75 FR 54524 - Defense Federal Acquisition Regulation Supplement; Guidance on Personal Services (DFARS Case 2009...

    Science.gov (United States)

    2010-09-08

    ... parts 211 and 237 are being amended to (1) require that statements of work or performance work statements clearly distinguish between Government employees and contractor employees and (2) ensure that... Department, including several checklists currently used. This interim rule adopts best practices and...

  10. A Descriptive Study of Individual and Cross-Cultural Differences in Statistics Anxiety

    Science.gov (United States)

    Baloglu, Mustafa; Deniz, M. Engin; Kesici, Sahin

    2011-01-01

    The present study investigated individual and cross-cultural differences in statistics anxiety among 223 Turkish and 237 American college students. A 2 x 2 between-subjects factorial multivariate analysis of covariance (MANCOVA) was performed on the six dependent variables which are the six subscales of the Statistical Anxiety Rating Scale.…

  11. Short Note Birds feeding in association with bat-eared foxes on ...

    African Journals Online (AJOL)

    Short Note Birds feeding in association with bat-eared foxes on Benfontein Game Farm, South Africa. Ute Stenkewitz, Jan F Kamler. Abstract. No Abstract. Ostrich 2008, 79(2): 235–237. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  12. Actinide neutron induced cross-sections; analysis of the OSMOSE LWR-UO{sub 2} experiment in MINERVE

    Energy Technology Data Exchange (ETDEWEB)

    Bernard, D.; Litaize, O.; Santamarina, A.; Antony, M.; Hudelot, J. P. [Commissariat a l' Energie Atomique, Cadarache, DEN/DER, 13108 Saint-Paul-Lez-Durance (France)

    2006-07-01

    This paper describes the interpretation of the first phase of the OSMOSE experimental program. The OSMOSE experiment began in 2005 in the MINERVE French facility and will continue until 2008. It consists in reactivity worth measurements of separated actinides by an oscillation technique. First results are obtained in a standard LWR neutron spectrum (UO{sub 2} lattice). The present study focuses on the following isotopes: {sup 234,236}U, {sup 237}Np, {sup 239,242}Pu. The comparison between APOLLO2 accurate deterministic calculations and experiments shows the reliability of the latest JEFF-3.1 European nuclear data library for all oscillated isotopes, except {sup 237}Np. The obtained (C/E-1){+-}({delta}E/E) values are the following: {sup 234}U: -5%{+-}2% {sup 237}Np: -11%{+-}2% {sup 239}Pu: +1%{+-}2% {sup 242}Pu: +2%{+-}2% An energetic decomposition of the reactivity worth is carried out using Standard Perturbation Theory that underlines the underestimation of the {sup 237}Np(n, {gamma}) thermal and resonant capture cross-section. (authors)

  13. Characterization of a Synechocystis double mutant lacking the photosystem II assembly factors YCF48 and Sll0933

    Czech Academy of Sciences Publication Activity Database

    Rengstl, B.; Knoppová, Jana; Komenda, Josef; Nickelsen, J.

    2013-01-01

    Roč. 237, č. 2 (2013), s. 471-480 ISSN 0032-0935 R&D Projects: GA ČR GBP501/12/G055; GA MŠk(CZ) ED2.1.00/03.0110 Institutional support: RVO:61388971 Keywords : Complex assembly * Cyanobacteria * Photosynthesis Subject RIV: EE - Microbiology, Virology Impact factor: 3.376, year: 2013

  14. Nové poznatky ke stavebnímu vývoji kostela sv. Jana Křtitele v Kurdějově

    Czech Academy of Sciences Publication Activity Database

    Bláha, Jiří; Dohnalová, P.

    2013-01-01

    Roč. 20, č. 1 (2013), s. 237-256 ISSN 1212-1487 R&D Projects: GA MK(CZ) DF11P01OVV002 Keywords : fortified church * timber roof * dendrochronology Subject RIV: AL - Art, Architecture, Cultural Heritage www.pruzkumypamatek.cz

  15. 48 CFR 1237.7003 - Solicitation provisions and contact clause.

    Science.gov (United States)

    2010-10-01

    ... and the clause at (TAR) 48 CFR 1252.237-72, Prohibition on Advertising, in solicitations and contracts for training services when the content and/or presentation of the course is controlled by DOT. (b... descriptive information (i.e., dated material such as resumes, company and/or personnel qualifications) to...

  16. Download this PDF file

    African Journals Online (AJOL)

    ÿþU s e r

    while nine patients (23.7%) had pin tract infection in the control group. There was a significantly lower ... duration of five days is expected to be incapable of preventing pin-tract .... Shapiro JM, Bond EL, Garman JK. 13. Hannan M; Juste RN; ...

  17. Electrotunable wetting and micro- and nanofluidics: general discussion

    Czech Academy of Sciences Publication Activity Database

    Bazant, M.; Bennewitz, R.; Bocquet, L.; Kratochvílová, Irena

    2017-01-01

    Roč. 199, Jul (2017), s. 195-237 ISSN 1359-6640 Institutional support: RVO:68378271 Keywords : ionic liquids * wall turbulence * double-layer * water * surfaces * interface * scale * electrolyt * capacitance * relaxation Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 3.588, year: 2016

  18. Assessing the Relationship between Family Mealtime Communication and Adolescent Emotional Well-Being Using the Experience Sampling Method

    Science.gov (United States)

    Offer, Shira

    2013-01-01

    While most prior research has focused on the frequency of family meals the issue of which elements of family mealtime are most salient for adolescents' well-being has remained overlooked. The current study used the experience sampling method, a unique form of time diary, and survey data drawn from the 500 Family Study (N = 237 adolescents with…

  19. Family history of systemic lupus erythematosus and risk of autoimmune disease

    DEFF Research Database (Denmark)

    Ulff-Møller, Constance Jensina; Simonsen, Jacob; Kyvik, Kirsten Ohm

    2017-01-01

    Objective.: To provide population-based estimates of relative risk of SLE and other autoimmune diseases (ADs) in relatives of SLE patients. Methods.: A cohort of 5 237 319 Danish residents identified through the Civil Registration System was coupled to their relatives through the parental link...

  20. 77 FR 112 - Effluent Limitations Guidelines and Standards for the Construction and Development Point Source...

    Science.gov (United States)

    2012-01-03

    ..., developing and general contracting. Heavy and civil 237 engineering construction, including land subdivision..., Engineering and Analysis Division, Office of Water (4303T), Environmental Protection Agency, 1200 Pennsylvania... Treatment Chemicals, Disposal and Toxicity Concerns F. Cold Weather Considerations G. Small Sites That Are...

  1. Application of SBRA Method in Mechanics of Continental Plates

    Czech Academy of Sciences Publication Activity Database

    Frydýšek, K.; Wandrol, I.; Kalenda, Pavel

    2012-01-01

    Roč. 6, č. 4 (2012), s. 230-237 ISSN 1998-4448 Institutional support: RVO:67985891 Keywords : mathematical modeling * probability * lithosphere plates Subject RIV: JL - Materials Fatigue, Friction Mechanics http://www.naun.org/main/NAUN/mechanics/16-581.pdf

  2. Smoothing identification of systems with small non-linearities

    Czech Academy of Sciences Publication Activity Database

    Kozánek, Jan; Piranda, J.

    2003-01-01

    Roč. 38, č. 1 (2003), s. 71-84 ISSN 0025-6455 R&D Projects: GA ČR GA101/00/1471 Institutional research plan: CEZ:AV0Z2076919 Keywords : identification * small non-linearities * smoothing methods Subject RIV: BI - Acoustics Impact factor: 0.237, year: 2003

  3. The Home Smoking Environment: Influence on Behaviors and Attitudes in a Racially Diverse Adolescent Population

    Science.gov (United States)

    Muilenburg, Jessica Legge; Latham, Teaniese; Annang, Lucy; Johnson, William D.; Burdell, Alexandra C.; West, Sabra J.; Clayton, Dixie L.

    2009-01-01

    Although studies indicate that public policy can influence the decrease in smoking behaviors, these policies have not necessarily transferred to home environments at the same rate. The authors surveyed 4,296 students in a southern urban area. African American students were 76.3% of the respondents and Caucasians accounted for 23.7%. African…

  4. Entheseal changes: Do they reflect socioeconomic status in the Early Medieval Central European population? (Mikulčice - Klášteřisko, Great Moravian Empire, 9th - 10th century)

    Czech Academy of Sciences Publication Activity Database

    Havelková, P.; Hladík, Marek; Velemínský, P.

    2013-01-01

    Roč. 23, č. 2 (2013), s. 237-251 ISSN 1047-482X Institutional research plan: CEZ:AV0Z80010507 Institutional support: RVO:68081758 Keywords : Early Middle Ages * enthesopathies * factor analysis * grave goods * musculoskeletal stress markers * social status Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 1.070, year: 2013

  5. Fatigue property and fatigue cracks of ultra-fine grained copper processed by equal-channel angular pressing

    Czech Academy of Sciences Publication Activity Database

    Wang, Q.; Du, Z.; Liu, X.; Kunz, Ludvík

    2011-01-01

    Roč. 2011, č. 682 (2011), s. 231-237 ISSN 1013-9826 Institutional research plan: CEZ:AV0Z20410507 Keywords : ultrafine-grained copper * equal channel angular pressing * fatigue * fatigue cracks Subject RIV: JL - Materials Fatigue, Friction Mechanics

  6. Waste Dump Closure and Cost Estimates at AngloGold Ashanti ...

    African Journals Online (AJOL)

    Michael

    2017-12-02

    Dec 2, 2017 ... 2University of Mines and Technology, P.O. Box 237, Tarkwa, Ghana ... The mine has closure plans for the waste dumps and the closure activity ... incur additional cost, it was advised that the mine should execute the closure and reclamation plan without delay. .... Progressively rehabilitate the project area.

  7. Fungal diversity notes 253-366: taxonomic and phylogenetic contributions to fungal taxa

    Czech Academy of Sciences Publication Activity Database

    Li, G.J.; Hyde, K.D.; Zhao, R. L.; Hongsanan, S.; Abdel-Aziz, F.A.; Abdel-Wahab, M. A.; Alvarado, P.; Alves-Silva, G.; Ammirati, J.F.; Ariyawansa, H.A.; Baghela, A.; Bahkali, A. H.; Beug, M.; Bhat, D.J.; Bojantchev, D.; Boonpratuang, T.; Bulgakov, T.S.; Camporesi, E.; Boro, M.C.; Ceska, O.; Chakraborty, D.; Chen, J.J.; Chethana, K.W.T.; Chomnunti, P.; Consiglio, G.; Cui, B.K.; Dai, D. Q.; Dai, Y.C.; Daranagama, D. A.; Das, K.; Vlasák, Josef

    2016-01-01

    Roč. 78, č. 1 (2016), s. 1-237 ISSN 1560-2745 Institutional support: RVO:60077344 Keywords : lichenized ascomycota ostropales * ribosomal dna-sequences * strictly anaerobic fungus * sp-nov russulaceae * molecular phylogeny * Basidiomycota Subject RIV: EF - Botanics Impact factor: 13.465, year: 2016

  8. Unemployment Impairs Mental Health: Meta-Analyses

    Science.gov (United States)

    Paul, Karsten I.; Moser, Klaus

    2009-01-01

    The effect of unemployment on mental health was examined with meta-analytic methods across 237 cross-sectional and 87 longitudinal studies. The average overall effect size was d = 0.51 with unemployed persons showing more distress than employed persons. A significant difference was found for several indicator variables of mental health (mixed…

  9. Cytotoxic Effect of Crude Aqueous Extract of Pistia Stratiotes Leaves ...

    African Journals Online (AJOL)

    1.19 mmol/L, 18.57 mmol/L and 27.27±2.37 mmol/L) between urea concentration of group 1, 2 and 3 before and after the administration of the extract. Serum creatinine concentration was found to be 108.51±3.21 mmol/L in controls, before the ...

  10. A clinical comparison of disposable airway devices | Strydom ...

    African Journals Online (AJOL)

    Cuff pressures were significantly higher in the Ambu™ and LMA Unique™ (p = 0.001). Maximum airway pressure attainable after 5 minutes was significantly higher in the Ambu™ (p = 0.036). Airway trauma as graded by visible blood on the device was low, and similar between groups (p = 0.237). Secretions were negligible ...

  11. Pattern of Maxillofacial Surgical Conditions in North Central Nigeria ...

    African Journals Online (AJOL)

    2018-02-07

    com on Wednesday, February 7, 2018, IP: 197.89.67.237] ... Table 2: Profile of orofacial surgical conditions seen and treated over 5 years during outreach programmes in ..... The North Central zone of the country, with a population of 20.2 ...

  12. Biological Art of Producing Useful Chemicals

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 21; Issue 3. Metabolic Engineering: Biological Art of Producing Useful Chemicals. Ram Kulkarni. General Article Volume 21 Issue 3 March 2016 pp 233-237. Fulltext. Click here to view fulltext PDF. Permanent link:

  13. Preservice Science Teachers' Science Teaching Orientations and Beliefs about Science

    Science.gov (United States)

    Kind, Vanessa

    2016-01-01

    This paper offers clarification of science teacher orientations as a potential component of pedagogical content knowledge. Science teaching orientations and beliefs about science held by 237 preservice science teachers were gathered via content-specific vignettes and questionnaire, respectively, prior to participation in a UK-based teacher…

  14. Příprava duto-vlákenných membrán pro separaci plynů inverzí fází: vliv smykové rychlosti na separační vlastnosti

    Czech Academy of Sciences Publication Activity Database

    Válek, R.; Malý, D.; Peter, Jakub; Ullsperger, J.

    2018-01-01

    Roč. 112, č. 4 (2018), s. 237-241 ISSN 0009-2770 Institutional support: RVO:61389013 Keywords : gas membrane separation * polymer membrane * hollow fibre Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science Impact factor: 0.387, year: 2016 http://www.chemicke-listy.cz/ojs3/index.php/chemicke-listy/article/view/3067

  15. Trace element chemistry and textures of low-temperature pyrites associated with shallow fossil subsurface geothermal discharge in the Eger Graben, northwestern Bohemia

    Czech Academy of Sciences Publication Activity Database

    Zachariáš, J.; Adamovič, Jiří; Langrová, Anna

    2006-01-01

    Roč. 37, 29 (2006), s. 237-239 ISSN 0032-6267 R&D Projects: GA AV ČR IAA3013302 Institutional research plan: CEZ:AV0Z30130516 Keywords : pyrite * geothermal fluids * Eger Graben Subject RIV: DB - Geology ; Mineralogy

  16. Parenting Stress and Child Behavior Problems: A Transactional Relationship across Time

    Science.gov (United States)

    Neece, Cameron L.; Green, Shulamite A.; Baker, Bruce L.

    2012-01-01

    Parenting stress and child behavior problems have been posited to have a transactional effect on each other across development. However, few studies have tested this model empirically. The authors investigated the relationship between parenting stress and child behavior problems from ages 3 to 9 years old among 237 children, 144 of whom were…

  17. 77 FR 38769 - 97th Annual Meeting of the National Conference on Weights and Measures

    Science.gov (United States)

    2012-06-29

    ... Handbook 130, ``Uniform Laws and Regulations in the area of Legal Metrology and Engine Fuel Quality'' and.... Polyethylene Sheeting--Test Procedure--Footnote to Step 3.) Item 232-2, Method of Sale Regulation--Section 2.19... consumers as part of the oil change service. (See also Item 237-4, Handbook 130 Uniform Engine Fuels and...

  18. Streptokinase increases the sensitivity of colon cancer cells to chemotherapy by gemcitabine and cis-platine in vitro

    Czech Academy of Sciences Publication Activity Database

    Bobek, V.; Pintérová, D.; Kološtová, K.; Boubelík, Michael; Douglas, J.; Teyssler, P.; Pavlásek, J.; Kovařík, J.

    2006-01-01

    Roč. 237, č. 1 (2006), s. 95-101 ISSN 0304-3835 Institutional research plan: CEZ:AV0Z50520514 Keywords : chemotherapy * radiation * colon cancer Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.277, year: 2006

  19. Critical comparison of radiometric and mass spectrometric methods for the determination of radionuclides in environmental, biological and nuclear waste samples

    DEFF Research Database (Denmark)

    Hou, Xiaolin; Roos, Per

    2008-01-01

    application in the environmental and biological researches, these radionuclides include H-3, C-14, Cl-36, Ca-41 Ni-59,Ni-63, Sr-89,Sr-90, Tc-99, I-129, Cs-135,Cs-137, Pb-210, Ra-226,Ra-228, Np-237, Am-241, and isotopes of thorium, uranium and plutonium. The application of on-line methods (flow injection...

  20. The Conference on the Dynamics of Molecular Collisions Held at Snowbird, Utah on 14-19 July 1985.

    Science.gov (United States)

    1985-07-01

    Berkeley Lab. (701) 237-8906 Berkeley, CA 94720 S(415) 486-6 4 47 Dr. F. Borondo Dept. de Quimica Fisica y Quimica CuanticA Dr. Frank Budenholzer...F. Martin and M. Yaez. Departamento de Quimica Fisica y Quimica Cudntica Facultad de Ciencias. C-XIV. Universidad Aut6noma de Madrid. Cantoblanco