Physics of the missing atoms: technetium and promethium
International Nuclear Information System (INIS)
Aspden, H.
1987-01-01
Technetium (Z = 43) and promethium (Z = 61) are by far the least abundant of all atoms below the radioactive elements (Z = 84 onwards). Their scarcity confirms theoretical predictions emerging from a theory of the photon derived from synchronous lattice electrodynamics. This theory has given precise theoretical values for the fine-structure constant and the constant of gravitation G and is now shown in this paper to indicate resonant interactions between the vacuum lattice oscillations and technetium and promethium. In the case of promethium there is strong reason for believing that this atom can assume supergravitational or antigravitational properties, accounting for its scarcity. This paper not only adds support to the earlier theoretical work on the photon and gravitation, but suggests a research route that might lead to new technology based on controlled interactions with gravity fields
10 CFR 30.19 - Self-luminous products containing tritium, krypton-85, or promethium-147.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Self-luminous products containing tritium, krypton-85, or..., krypton-85, or promethium-147. (a) Except for persons who manufacture, process, produce, or initially transfer for sale or distribution self-luminous products containing tritium, krypton-85, or promethium-147...
International Nuclear Information System (INIS)
Seshadri, N.K.; Subramanian, T.K.; Ravi, S.; Mathew, K.M.; Chinnayan, C.
2001-01-01
Beta radiation emanating from promethium-147 and gaseous tritium in close proximity with zinc sulphide phosphor will provide self sustained light sources and are used for, nocturnal illumination of liquid crystal display digital watches and clocks, product advertisements, telephone numbers, exit signs etc. In this paper a procedure for activation of zinc sulphide phosphor with promethium-147 and development of gaseous tritium light sources with respect to thickness of phosphor coating and its effect on light output is described. A typical light source was constructed with promethium-147 activated zinc sulphide to find the overall efficiency of conversion of beta energy to visible light. (author)
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Self-luminous products containing tritium, krypton-85 or... containing tritium, krypton-85 or promethium-147: Requirements for license to manufacture, process, produce... self-luminous products containing tritium, krypton-85, or promethium-147, or to initially transfer such...
Strontium-90 and promethium-147 recovery
International Nuclear Information System (INIS)
Hoisington, J.E.; McDonell, W.R.
1982-01-01
Strontium-90 and promethium-147 are fission product radionuclides with potential for use as heat source materials in high reliability, non-interruptible power supplies. Interest has recently been expressed in their utilization for Department of Defense (DOD) applications. This memorandum summarizes the current inventories, the annual production rates, and the possible recovery of Sr-90 and Pm-147 from nuclear materials production operations at Hanford and Savannah River. Recovery of these isotopes from LWR spend fuel utilizing the Barnwell Nuclear Fuels Plant (BNFP) is also considered. Unit recovery costs at each site are provided
A novel ion selective sensor for promethium determination
International Nuclear Information System (INIS)
Gupta, Vinod K.; Jain, Rajeev; Hamdan, A.J.; Agarwal, Shilpi; Bharti, Arvind K.
2010-01-01
This is a first promethium 145 ion-selective sensor based on the comparative study of two Schiff base ligands (X 1 and X 2 ) as neutral ionophores. Effect of various plasticizers: 2-nitrophenyloctylether (o-NPOE), dibutyl phosphonate (DBP), dioctylphthalate (DOP), tri-(2-ethylhexyl) phosphate (TEHP), dibutyl butylphosphonate (DBBP), chloronaphthalene (CN) and anion excluders: potassium tetrakis (p-chloropheny1) borate (KTpClPB), sodiumtetraphenylborate (NaTPB) and oleic acid (OA) have been studied. The membrane with a composition of ionophore (X 1 /X 2 ):KTpClPB:PVC:o-NPOE (w/w, %) in the ratio of 5:5:30:60 exhibited best performance. The best responsive membrane sensors (8 and 21) exhibited working concentration range of 4.5 x 10 -7 -1.0 x 10 -2 M and 3.5 x 10 -6 -1.0 x 10 -2 M with a detection limits of 3.2 x 10 -7 M and 2.3 x 10 -6 M and Nernstian slopes of 20.0 ± 0.5, 19.5 ± 0.5 mV decade -1 of activity, respectively. The sensor no. 8 works satisfactorily in partially non-aqueous media up to 10% (v/v) content of methanol, ethanol and acetonitrile. Analytical application of the proposed sensor has been demonstrated in determination of promethium (III) ions in spiked water samples.
International Nuclear Information System (INIS)
Atomachi, Tadaaki; Imai, Hiroshi.
1969-01-01
A method of adhering and fixing a luminous powder such as tritium-3 or promethium-147 onto a small semi-conductor element for use in nuclear batteries is disclosed in which a radio isotope such as tritium-3 or promethium-147 is coated onto the surface of a fluorescent material such as ZnS-Cu, CaS, (Ca, Sr)S, (Cd, Zn)S which is then suspended in a silver plating bath. A composite of silver and the luminous powder is electro-deposited onto the semi-conductor element. The deposited layer will not easily separate from the semi-conductor and long life is assured owing to the thickness of the layer. Small dimensions are obtainable without sacrificing capacity. (Owens, K.J.)
International Nuclear Information System (INIS)
Kassai, Z.; Kassai, A.; Bauerova, K.; Koprda, V.; Harangozo, M.; Bendova, P.; Bujnova, A.
2003-01-01
The composition and the permeation properties of the skin are dependent on age. In the animal models for permation studies, age affects the mechanical as well as the permeation properties significantly. The time dependence of permeation of 147 Pm 3+ from aqueous solution was established by the animal skin model and the age dependence of promethium permeation through the skin was examined. The aim was to find the optimum rat skin age model for radionuclide permeation studies and to assess the relative importance of the main permeation pathways: transepidermal and transfollicular permeation. The skin from 5-day-old rats (5DR) was found to represent the optimum animal model to study transepidermal permeation of ions. The skin from 9-day-old rats (9DR) was selected to study transfollicular permeation of ions. Comparison of the permeated amounts of promethium through the skin without hairs (3 DR to 6 DR) and with hairs (7DR to 12DR) showed that the additional permation mode via follicles significantly contributed to the permeation rate and extent. (author)
Directory of Open Access Journals (Sweden)
Jonathan Fitzsimmons
2015-12-01
Full Text Available Background: Radioimmunotherapy utilize a targeting antibody coupled to a therapeutic isotope to target and treat a tumor or disease. In this study we examine the synthesis and cell binding of a polymer scaffold containing a radiotherapeutic isotope and a targeting antibody. Methods: The multistep synthesis of a fluorescent or 149Promethium-labeled Trastuzumab-polyethyleneimine (PEI, Trastuzumab, or PEI is described. In vitro uptake, internalization and/or the binding affinity to the Her2/neu expressing human breast adenocarcinoma SKBr3 cells was investigated with the labeled compounds. Results: Fluorescent-labeled Trastuzumab-PEI was internalized more into cells at 2 and 18 h than fluorescent-labeled Trastuzumab or PEI. The fluorescent-labeled Trastuzumab was concentrated on the cell surface at 2 and 18 h and the labeled PEI had minimal uptake. DOTA-PEI was prepared and contained an average of 16 chelates per PEI; the compound was radio-labeled with 149Promethium and conjugated to Trastuzumab. The purified 149Pm-DOTA-PEI-Trastuzumab had a radiochemical purity of 96.7% and a specific activity of 0.118 TBq/g. The compound demonstrated a dissociation constant for the Her2/neu receptor of 20.30 ± 6.91 nM. Conclusion: The results indicate the DOTA-PEI-Trastuzumab compound has potential as a targeted therapeutic carrier, and future in vivo studies should be performed.
International Nuclear Information System (INIS)
Kassai, Z.; Koprda, V.; Harangozo, M.; Bendova, P.; Bauerova, K.
2001-01-01
In this paper: - the time dependence of permeation of 147 Pm 3+ from aqueous solution through animal skin model was studied; - the age dependence of promethium through the skin was proved; - the optimum biological model of human skin was selected, and - the relative importance of the main diffusion pathways for 147 Pm 3+ the diffusion across the intact skin and the diffusion through the hair channels was assessed. Concluding it can be said, that: -it was proved, that the 5-day-old rats (5DR) represents the optimum animal model to the human skin; - in the case of 8DR to 11DR the dominant route of 147 Pm 3+ penetration is along the follicles; - the permeation resistance of the skin depends on the thickness and mechanical properties of the skin. Comparing amounts of penetrated ions of promethium through the skin without hairs (3DR to 6DR) and through the skin with hairs, it was showed that the additional diffusion along hair's follicles pronounced with animal skin can be important also in case of human skin where hair density is many times lower than in used animal models. (authors)
An experimental study of odd mass promethium isotopes using proton stripping and pickup reactions
International Nuclear Information System (INIS)
Straume, O.
1979-11-01
Odd Pm isotopes have been studied by one proton pick-up and stripping reactions. Spin assignment and spectroscopic factors have been obtained for a number of energy levels. In the stripping reactions, the relative cross-sections have been measured with an unusually high precision by the use of a target of natural neodymium. The spectroscopic strengths have been extracted using standard distorted wave methods. The nuclear structures of these promethium isotopes fall into three categories. The spherical approach seems valid for 143 Pm and 145 Pm and the deformed regime covers 151 Pm and 153 Pm, while 147 Pm and 149 Pm remain as transitional nuclei. (Auth.)
Development of a diagnostic model for inhaled promethium-147 oxide. Animal studies
International Nuclear Information System (INIS)
Shipler, D.B.; Ballou, J.E.; Griffin, B.I.; Nelson, I.C.
1976-01-01
Rats and beagles were exposed by inhalation to an aerosol containing stable Sm 2 O 3 tagged with 145 Sm 2 O 3 and 143 Pm 2 O 3 . The animals were sacrificed at 0, 14 and 30 days post-exposure to compare the kinetics and translocation of 145 Sm and 143 Pm. Quantitative analysis for 145 Sm and 143 Pm in several tissues and excreta indicate that the two rare-earth elements were mobilized and distributed similarly by the rats and dogs. Results indicate that within the error of the measurement technique, samarium acts as a carrier for promethium. The data also indicate that activities measured in faecal samples could be used to predict lung burdens of 147 Pm. At activity levels and sintering temperatures employed in the rat exposures, there was sufficient activity in urine samples to permit its use as an indicator of lung burdens of 147 Pm. At activity levels and sintering temperatures employed in the dog exposures, this was not the case. (author)
Development of a diagnostic model for inhaled promethium-147 oxide: animal studies
International Nuclear Information System (INIS)
Shipler, D.B.; Ballou, J.E.; Griffin, B.I.; Nelson, I.C.
1975-01-01
Rats and beagle dogs were exposed by inhalation to an aerosol containing stable Sm 2 O 3 tagged with 145 Sm 2 O 3 and 143 Pm 2 O 3 . The animals were sacrificed at 0, 14 and 30 days post-exposure to compare the kinetics and translocation of 145 Sm and 143 Pm. Quantitative analysis for 145 Sm and 143 Pm in several tissues and excreta indicate that the two rare earth elements were mobilized and distributed similarly by the rats and dogs. Results indicate that within the error of the measurement technique, samarium acts as a carrier for promethium. The data also indicate that activities measured in fecal samples could be used to predict lung burdens of 147 Pm. At activity levels and sintering temperatures employed in the rat exposures, there was sufficient activity in urine samples to permit its use as an indicator of lung burdens of 147 Pm. At activity levels and sintering temperatures employed in the dog exposures, this was not the case. (auth)
159Ho levels excited by 159 Er EC/β+ decay
International Nuclear Information System (INIS)
Kallinnikov, V.G.; Ibraheem, Y.S.; Vaganov, Yu.A.; Stegailov, V.I.; Sereeter, Zh.; Chaloun, P.
2004-01-01
Full text: The present study of the EC/β + decay of 159 Er to the levels in 159 Ho was completed at the ISOL complex of YASNAPP-2 at JINR, Dubna. Single γ-ray and γ- γ-coincidence spectra were recorded with HPGe-detectors. Conversion electron spectra were measured by using magnetic spectrometer 'mini-orange' with Si(Li) detector. Results of γ-ray and ICE measurements previously reported by Boutet [1] and in our laboratory [2] have been investigated very accurately. It was shown, that a number of week γ-transitions does not belong to the isotope 159 Er. The special attention was given to high-energy part of a γ-spectrum where in ref. [3] 50 γ -transitions were attributed to the decay of 159 Er with E γ ≥1838.5 keV. We shall point out, that some of them were attributed to this nuclide unreasonably, as their energies E γ exceed the energy of β-decay of 159 Er (2768.5 keV). The most of transitions which have been listed in [3] according to our analysis belong to impurities. In addition to the results [1,2] multipolarities of several γ-transitions with E γ >500 keV were determined, that allowed to establish quantum characteristics of separate levels in 159 Ho. The existence of transition with admixture of E0-component indicates that β-vibrational states in daughter nucleus are excited. We observed this E0-component in the γ- transition (939.5 keV) in the case of 159 Er decay to the levels in 159 Ho. As in the case of 161 Er decay, it was not possible for us to find out three-quasiparticle states in 159 Ho, predicted by superfluid model at excitation energies E γ ≥ 1.5 MeV by observation of the fast au- β- transitions. This work was supported by RFBR (grant No. 03-02-17395)
Brewer, John M; Glover, Claiborne V C; Holland, Michael J; Lebioda, Lukasz
2003-05-01
The hypothesis that His159 in yeast enolase moves on a polypeptide loop to protonate the phosphoryl of 2-phosphoglycerate to initiate its conversion to phosphoenolpyruvate was tested by preparing H159N, H159A, and H159F enolases. These have 0.07%-0.25% of the native activity under standard assay conditions and the pH dependence of maximum velocities of H159A and H159N mutants is markedly altered. Activation by Mg2+ is biphasic, with the smaller Mg2+ activation constant closer to that of the "catalytic" Mg2+ binding site of native enolase and the larger in the mM range in which native enolase is inhibited. A third Mg2+ may bind to the phosphoryl, functionally replacing proton donation by His159. N207A enolase lacks an intersubunit interaction that stabilizes the closed loop(s) conformation when 2-phosphoglycerate binds. It has 21% of the native activity, also exhibits biphasic Mg2+ activation, and its reaction with the aldehyde analogue of the substrate is more strongly inhibited than is its normal enzymatic reaction. Polypeptide loop(s) closure may keep a proton from His159 interacting with the substrate phosphoryl oxygen long enough to stabilize a carbanion intermediate.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety. 159.95 Section 159.95... SANITATION DEVICES Design, Construction, and Testing § 159.95 Safety. (a) Each device must— (1) Be free of... explosion or over pressurization as a result of an accumulation of gases; and (3) Meet all other safety...
International Nuclear Information System (INIS)
Kramer, G.H.; Davies, J.M.
1981-04-01
A method has been developed for separating low-level activities of the beta-emitting isotopes strontium-90, yttrium-90, promethium-147 and cerium-144 from urine and aqueous solutions. They are subsequently estimated by planchet or liquid scintillation counting. The radionuclides are separated from each other and from interfering elements by solvent extraction with HDEHP (di-2-ethylhexyl phosphoric acid) in n-heptane. It is possible to separate the elements with a minimum of cross-contamination by selecting appropriate pH's and solvent concentrations. Percentage recoveries for the radionuclides are: 90 Sr, 100 +- 12; 90 Y, 65 +- 4; 147 Pm, 90 +- 8; 144 Ce, 87 +- 11. The limits of detection are: 90 Sr, 0.6 pCi; 90 Y, 0.7 pCi; 147 Pm, 1.0 pCi; 144 Ce, 0.8 pCi. (author)
33 CFR 159.307 - Untreated sewage.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Untreated sewage. 159.307 Section 159.307 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED... Operations § 159.307 Untreated sewage. No person shall discharge any untreated sewage from a cruise vessel...
33 CFR 159.69 - Motor ratings.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Motor ratings. 159.69 Section 159.69 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION MARINE SANITATION DEVICES Design, Construction, and Testing § 159.69 Motor ratings. Motors must be rated...
36 CFR 406.152-406.159 - [Reserved
2010-07-01
... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false [Reserved] 406.152-406.159 Section 406.152-406.159 Parks, Forests, and Public Property AMERICAN BATTLE MONUMENTS COMMISSION... BATTLE MONUMENTS COMMISSION §§ 406.152-406.159 [Reserved] ...
45 CFR 2490.152-2490.159 - [Reserved
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false [Reserved] 2490.152-2490.159 Section 2490.152-2490.159 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL... CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION §§ 2490.152-2490.159 [Reserved] ...
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Vents. 159.61 Section 159.61 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION MARINE... to minimize clogging by either the contents of the tank or climatic conditions such as snow or ice. ...
28 CFR 39.152-39.159 - [Reserved
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false [Reserved] 39.152-39.159 Section 39.152-39.159 Judicial Administration DEPARTMENT OF JUSTICE ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF JUSTICE §§ 39.152-39.159 [Reserved] ...
49 CFR 28.152-28.159 - [Reserved
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false [Reserved] 28.152-28.159 Section 28.152-28.159 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION §§ 28.152-28.159 [Reserved] ...
19 CFR 159.3 - Rounding of fractions.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Rounding of fractions. 159.3 Section 159.3 Customs... (CONTINUED) LIQUIDATION OF DUTIES General Provisions § 159.3 Rounding of fractions. (a) Value. In the... cents or more, the lower fractions shall be dropped, and if it is necessary to take up as whole dollars...
Molecular Cloud Structures and Massive Star Formation in N159
Nayak, O.; Meixner, M.; Fukui, Y.; Tachihara, K.; Onishi, T.; Saigo, K.; Tokuda, K.; Harada, R.
2018-02-01
The N159 star-forming region is one of the most massive giant molecular clouds (GMCs) in the Large Magellanic Cloud (LMC). We show the 12CO, 13CO, CS molecular gas lines observed with ALMA in N159 west (N159W) and N159 east (N159E). We relate the structure of the gas clumps to the properties of 24 massive young stellar objects (YSOs) that include 10 newly identified YSOs based on our search. We use dendrogram analysis to identify properties of the molecular clumps, such as flux, mass, linewidth, size, and virial parameter. We relate the YSO properties to the molecular gas properties. We find that the CS gas clumps have a steeper size–linewidth relation than the 12CO or 13CO gas clumps. This larger slope could potentially occur if the CS gas is tracing shocks. The virial parameters of the 13CO gas clumps in N159W and N159E are low (<1). The threshold for massive star formation in N159W is 501 M ⊙ pc‑2, and the threshold for massive star formation in N159E is 794 M ⊙ pc‑2. We find that 13CO is more photodissociated in N159E than N159W. The most massive YSO in N159E has cleared out a molecular gas hole in its vicinity. All the massive YSO candidates in N159E have a more evolved spectral energy distribution type in comparison to the YSO candidates in N159W. These differences lead us to conclude that the giant molecular cloud complex in N159E is more evolved than the giant molecular cloud complex in N159W.
9 CFR 381.159 - Poultry rolls.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Poultry rolls. 381.159 Section 381.159... ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION POULTRY PRODUCTS INSPECTION REGULATIONS Definitions and Standards of Identity or Composition § 381...
49 CFR 173.159 - Batteries, wet.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Batteries, wet. 173.159 Section 173.159... Batteries, wet. (a) Electric storage batteries, containing electrolyte acid or alkaline corrosive battery fluid (wet batteries), may not be packed with other materials except as provided in paragraphs (g) and...
33 CFR 159.75 - Overcurrent protection.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Overcurrent protection. 159.75...) POLLUTION MARINE SANITATION DEVICES Design, Construction, and Testing § 159.75 Overcurrent protection. Overcurrent protection must be provided within the unit to protect subcomponents of the device if the...
19 CFR 159.38 - Rates for estimated duties.
2010-04-01
... TREASURY (CONTINUED) LIQUIDATION OF DUTIES Conversion of Foreign Currency § 159.38 Rates for estimated duties. For purposes of calculating estimated duties, the port director shall use the rate or rates... 19 Customs Duties 2 2010-04-01 2010-04-01 false Rates for estimated duties. 159.38 Section 159.38...
33 CFR 159.85 - Sewage removal.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Sewage removal. 159.85 Section...) POLLUTION MARINE SANITATION DEVICES Design, Construction, and Testing § 159.85 Sewage removal. The device must be designed for efficient removal of nearly all of the liquid and solids in the sewage retention...
19 CFR 159.31 - Rates to be used.
2010-04-01
... (CONTINUED) LIQUIDATION OF DUTIES Conversion of Foreign Currency § 159.31 Rates to be used. Except as otherwise specified in this subpart, no rate or rates of exchange shall be used to convert foreign currency... 19 Customs Duties 2 2010-04-01 2010-04-01 false Rates to be used. 159.31 Section 159.31 Customs...
Levels in 159Ho as populated from decay of 159Er
International Nuclear Information System (INIS)
Boutet, J.
1977-06-01
The level scheme of the odd proton nucleus 159 Ho has been investigated using Ge(Li) and Si(Li) detectors. Results of γ-ray singles, conversion electron spectra and coincidence experiments are reported. Assignments are made for several energy levels
33 CFR 159.317 - Sampling and reporting.
2010-07-01
... Section 159.317 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED... Operations § 159.317 Sampling and reporting. (a) The owner, operator, master or other person in charge of a... protocols, including chain of custody; (2) Laboratory analytical information including methods used...
33 CFR 159.121 - Sewage processing test.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Sewage processing test. 159.121...) POLLUTION MARINE SANITATION DEVICES Design, Construction, and Testing § 159.121 Sewage processing test. (a) The device must process human sewage in the manner for which it is designed when tested in accordance...
29 CFR 1910.159 - Automatic sprinkler systems.
2010-07-01
... supply is out of service, except for systems of 20 or fewer sprinklers. (5) Hose connections for fire fighting use. The employer may attach hose connections for fire fighting use to wet pipe sprinkler systems... 29 Labor 5 2010-07-01 2010-07-01 false Automatic sprinkler systems. 1910.159 Section 1910.159...
12 CFR 410.152-410.159 - [Reserved
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false [Reserved] 410.152-410.159 Section 410.152-410.159 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES §§ 410...
29 CFR 4.159 - General minimum wage.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true General minimum wage. 4.159 Section 4.159 Labor Office of... General minimum wage. The Act, in section 2(b)(1), provides generally that no contractor or subcontractor... a contract less than the minimum wage specified under section 6(a)(1) of the Fair Labor Standards...
40 CFR 159.188 - Failure of performance information.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Failure of performance information. 159.188 Section 159.188 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... submitted concerning substantiation of any incident of a pest having developed resistance to any pesticide...
33 CFR 159.315 - Sewage and graywater discharge record book.
2010-07-01
... record book. 159.315 Section 159.315 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... by Cruise Vessel Operations § 159.315 Sewage and graywater discharge record book. (a) While operating... and Graywater Discharge Record Book with the vessel's name and official number listed on the front...
42 CFR 423.159 - Electronic prescription drug program.
2010-10-01
... 42 Public Health 3 2010-10-01 2010-10-01 false Electronic prescription drug program. 423.159 Section 423.159 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICARE PROGRAM VOLUNTARY MEDICARE PRESCRIPTION DRUG BENEFIT Cost Control and Quality...
40 CFR 159.195 - Reporting of other information.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Reporting of other information. 159.195 Section 159.195 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE... reported to the Agency. (4) Use of a pesticide promotes or creates secondary pest infestations. (5) Any...
Study of the decay scheme of 159Tm
International Nuclear Information System (INIS)
Aguer, Pierre; Bastin, Genevieve; Chin Fan Liang; Libert, Jean; Paris, Pierre; Peghaire, Alain
1975-01-01
The energy levels of 159 Er have been investigated from the decay of 159 Tm (T(1/2)=9mn). Samples were obtained by (p,xn) reaction and on-line separation through Isocele facility. A level scheme is proposed with 24 levels between 0 and 1.3MeV [fr
Fusion of 6Li with 159Tb at near-barrier energies
International Nuclear Information System (INIS)
Pradhan, M. K.; Mukherjee, A.; Basu, P.; Goswami, A.; Kshetri, R.; Roy, Subinit; Chowdhury, P. Roy; Sarkar, M. Saha; Palit, R.; Parkar, V. V.; Santra, S.; Ray, M.
2011-01-01
Complete and incomplete fusion cross sections for 6 Li + 159 Tb have been measured at energies around the Coulomb barrier by the γ-ray method. The measurements show that the complete fusion cross sections at above-barrier energies are suppressed by ∼34% compared to coupled-channel calculations. A comparison of the complete fusion cross sections at above-barrier energies with the existing data for 11,10 B + 159 Tb and 7 Li + 159 Tb shows that the extent of suppression is correlated with the α separation energies of the projectiles. It has been argued that the Dy isotopes produced in the reaction 6 Li + 159 Tb at below-barrier energies are primarily due to the d transfer to unbound states of 159 Tb, while both transfer and incomplete fusion processes contribute at above-barrier energies.
29 CFR 1915.159 - Personal fall arrest systems (PFAS).
2010-07-01
... 29 Labor 7 2010-07-01 2010-07-01 false Personal fall arrest systems (PFAS). 1915.159 Section 1915... Protective Equipment (PPE) § 1915.159 Personal fall arrest systems (PFAS). The criteria of this section apply to PFAS and their use. Effective January 1, 1998, body belts and non-locking snaphooks are not...
33 CFR 159.309 - Limitations on discharge of treated sewage or graywater.
2010-07-01
... treated sewage or graywater. 159.309 Section 159.309 Navigation and Navigable Waters COAST GUARD... Certain Alaskan Waters by Cruise Vessel Operations § 159.309 Limitations on discharge of treated sewage or graywater. (a) No person shall discharge treated sewage or graywater from a cruise vessel into the...
International Nuclear Information System (INIS)
Angelini, P.; Adair, H.L.
1976-07-01
The promethium metal used in the determination of the melting point and phase transformation temperatures was prepared by reduction of promethium oxide with thorium metal at 1600 0 C and distilling the promethium metal into a quartz dome. The melting point and phase transformation temperatures of promethium metal were found to be 1042 +- 5 0 C and 890 +- 5 0 C, respectively. The ratio for the heat of the high-temperature transformation to the heat of fusion was determined to be 0.415
19 CFR 159.33 - Proclaimed rate.
2010-04-01
... currency involved, such proclaimed rate shall be used unless it varies by 5 percent or more from the... (CONTINUED) LIQUIDATION OF DUTIES Conversion of Foreign Currency § 159.33 Proclaimed rate. If a rate of...
7 CFR 1717.159 - Applications for RUS approvals of mergers.
2010-01-01
... 7 Agriculture 11 2010-01-01 2010-01-01 false Applications for RUS approvals of mergers. 1717.159... ELECTRIC LOANS Mergers and Consolidations of Electric Borrowers § 1717.159 Applications for RUS approvals of mergers. If a proposed merger requires RUS approval according to RUS regulations and/or the loan...
49 CFR 173.159a - Exceptions for non-spillable batteries.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Exceptions for non-spillable batteries. 173.159a... Class 1 and Class 7 § 173.159a Exceptions for non-spillable batteries. (a) Exceptions for hazardous...-spillable batteries offered for transportation or transported in accordance with this section are subject to...
46 CFR 159.005-7 - Preapproval review: Coast Guard action.
2010-10-01
... Section 159.005-7 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT... may be conducted. (2) If the Commandant determines from the application for approval that the... under § 159.005-13 can be taken. (c) An item of equipment or material that does not meet all of the...
Fusion cross sections measurement for 6Li + 159Tb
International Nuclear Information System (INIS)
Pradhan, M.K.; Mukherjee, A.; Kshetri, R.; Roy, Subinit; Basu, P.; Goswami, A.; Saha Sarkar, M.; Ray, M.; Parkar, V.; Santra, S.; Kailas, S.; Palit, R.
2009-01-01
In order to investigate the effect of projectile breakup threshold energy on fusion in mass region around A∼170, we have carried out a systematic investigation of the fusion (both CF and ICF) cross sections for the systems 11 B, 10 B + 159 Tb and 7 Li + 159 Tb at energies near and close to the barrier where 11 B was considered to be a strongly bound nucleus. The nucleus 10 B has a α-separation energy of 4.5 MeV. The measurements show that the extent of suppression of CF cross sections is correlated with the α-separation energies of the projectiles. As a further continuation of this work, we have recently carried out fusion excitation function measurement for the system 6 Li + 159 Tb (Coulomb barrier 27 MeV) at energies near and close to the barrier
The H159A mutant of yeast enolase 1 has significant activity.
Brewer, J M; Holland, M J; Lebioda, L
2000-10-05
The function of His159 in the enolase mechanism is disputed. Recently, Vinarov and Nowak (Biochemistry (1999) 38, 12138-12149) prepared the H159A mutant of yeast enolase 1 and expressed this in Escherichia coli. They reported minimal (ca. 0.01% of the native value) activity, though the protein appeared to be correctly folded, according to its CD spectrum, tryptophan fluorescence, and binding of metal ion and substrate. We prepared H159A enolase using a multicopy plasmid and expressed the enzyme in yeast. Our preparations of H159A enolase have 0.2-0.4% of the native activity under standard assay conditions and are further activated by Mg(2+) concentrations above 1 mM to 1-1.5% of the native activity. Native enolase 1 (and enolase 2) are inhibited by such Mg(2+) concentrations. It is possible that His159 is necessary for correct folding of the enzyme and that expression in E. coli leads to largely misfolded protein. Copyright 2000 Academic Press.
33 CFR 159.131 - Safety: Incinerating device.
2010-07-01
... (CONTINUED) POLLUTION MARINE SANITATION DEVICES Design, Construction, and Testing § 159.131 Safety.... Unitized incineration devices must completely burn to a dry, inert ash, a simultaneous defecation and...
46 CFR 159.005-11 - Approval inspection or test report: Contents.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Approval inspection or test report: Contents. 159.005-11 Section 159.005-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT... representation is also punishable as a crime under 18 U.S.C. 1001. ...
46 CFR 159.007-11 - Production inspections and tests: Yearly report.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Production inspections and tests: Yearly report. 159.007-11 Section 159.007-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL APPROVAL OF EQUIPMENT AND MATERIALS Production...
46 CFR 159.010-7 - Recognized independent laboratory: Memorandum of Understanding.
2010-10-01
... independent laboratory and the Coast Guard; (7) An agreement to conduct comparison testing with other... for conducting comparison tests with other recognized laboratories. (d) Copies of MOUs signed by the... Understanding. 159.010-7 Section 159.010-7 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED...
78 FR 13396 - 90th Meeting: RTCA Special Committee 159, Global Positioning Systems (GPS)
2013-02-27
... 159, Global Positioning Systems (GPS) AGENCY: Federal Aviation Administration (FAA), U.S. Department... 159, Global Positioning Systems (GPS) SUMMARY: The FAA is issuing this notice to advise the public of the eighty-ninth meeting of the RTCA Special Committee 159, Global Positioning Systems (GPS). DATES...
78 FR 57672 - 91st Meeting: RTCA Special Committee 159, Global Positioning Systems (GPS)
2013-09-19
... 159, Global Positioning Systems (GPS) AGENCY: Federal Aviation Administration (FAA), U.S. Department... 159, Global Positioning Systems (GPS). SUMMARY: The FAA is issuing this notice to advise the public of the ninety-first meeting of the RTCA Special Committee 159, Global Positioning Systems (GPS) DATES...
DC-159a Shows Inhibitory Activity against DNA Gyrases of Mycobacterium leprae.
Yamaguchi, Tomoyuki; Yokoyama, Kazumasa; Nakajima, Chie; Suzuki, Yasuhiko
2016-09-01
Fluoroquinolones are a class of antibacterial agents used for leprosy treatment. Some new fluoroquinolones have been attracting interest due to their remarkable potency that is reportedly better than that of ofloxacin, the fluoroquinolone currently recommended for treatment of leprosy. For example, DC-159a, a recently developed 8-methoxy fluoroquinolone, has been found to be highly potent against various bacterial species. Nonetheless, the efficacy of DC-159a against Mycobacterium leprae is yet to be examined. To gather data that can support highly effective fluoroquinolones as candidates for new remedies for leprosy treatment, we conducted in vitro assays to assess and compare the inhibitory activities of DC-159a and two fluoroquinolones that are already known to be more effective against M. leprae than ofloxacin. The fluoroquinolone-inhibited DNA supercoiling assay using recombinant DNA gyrases of wild type and ofloxacin-resistant M. leprae revealed that inhibitory activities of DC-159a and sitafloxacin were at most 9.8- and 11.9-fold higher than moxifloxacin. Also the fluoroquinolone-mediated cleavage assay showed that potencies of those drugs were at most 13.5- and 9.8-fold higher than moxifloxacin. In addition, these two drugs retained their inhibitory activities even against DNA gyrases of ofloxacin-resistant M. leprae. The results indicated that DC-159a and sitafloxacin are more effective against wild type and mutant M. leprae DNA gyrases than moxifloxacin, suggesting that these antibacterial drugs can be good candidates that may supersede current fluoroquinolone remedies. DC-159a in particular is very promising because it is classified in a subgroup of fluoroquinolones that is known to be less likely to cause adverse effects. Our results implied that DC-159a is well worth further investigation to ascertain its in vivo effectiveness and clinical safety for humans.
checkCIF/PLATON report Datablock: zufz159
Indian Academy of Sciences (India)
THIS REPORT IS FOR GUIDANCE ONLY. IF USED AS PART OF A REVIEW PROCEDURE. FOR PUBLICATION, IT SHOULD NOT REPLACE THE EXPERTISE OF AN EXPERIENCED. CRYSTALLOGRAPHIC REFEREE. No syntax errors found. CIF dictionary Interpreting this report. Datablock: zufz159. Bond precision:.
46 CFR 159.007-5 - Production inspections and tests: Application for acceptance.
2010-10-01
... acceptance. 159.007-5 Section 159.007-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL APPROVAL OF EQUIPMENT AND MATERIALS...) Is accepted by the Commandant for approval inspections and tests of the equipment or material under...
46 CFR 159.007-3 - Production inspections and tests: Independent laboratory's procedures.
2010-10-01
...'s procedures. 159.007-3 Section 159.007-3 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL APPROVAL OF EQUIPMENT AND... meets the inspection and test procedures of the laboratory; and (3) Are accepted by the Commandant under...
Process for producing a self luminescent material
Energy Technology Data Exchange (ETDEWEB)
Abe, E
1962-01-28
A self luminescent material is produced by a process comprising applying a hydroxide or fluoride of promethium-147 suspended in a medium of paraffinic acid to the surface of a fluorescent body. Promethium-147 decays with a half-life of 2.6 years and emits beta-rays but not alpha- and gamma-rays so that it is suitable for manufacturing self luminescent materials. A chloride of promethium-147 cannot be employed because its structure is destroyed by acids. Although fluorides and hydroxides of promethium-147 are difficult to mix with the fluorescent body material, they become mixable when paraffinic acids containing from 12 to 20 carbon atoms, (for example, steric acid, palmitic acid and margaric acid) are used as a medium. In embodiments, the self luminescent materials are prepared by either neutralization of a promethium-147 chloride solution having a specific radioactivity of 1.2 c/cc. with an ammonium hydroxide solution to form gelatinous hydroxide, or the reaction of a promethium-147 chloride solution with H/sub 2/SiF/sub 6/ by heating at 80/sup 0/C to form a fluoride of promethium-147. The products have a specific radioactivity of 8 to 12 mc/g. These products are suspended in vehicles of polystyrene and methacrylic resin to produce the self luminescent coating materials. Tests show that the initical brightness is comparatively high, the decreasing rate of brightness is small, no blackening effects by alpha-rays occur and costs are low. The brightness of the coating containing promethium-147 is 82-85 after 5 days, 100-105 after 100 days and 82-92 after 180 days. With respect to the coating containing radium the values are 31-70 after 5 days, 28-49 after 100 days and 19-31 after 180 days.
Chloroplast Preproteins Bind to the Dimer Interface of the Toc159 Receptor during Import1[OPEN
Chen, Lih-Jen; Yeh, Yi-Hung; Hsiao, Chwan-Deng
2017-01-01
Most chloroplast proteins are synthesized in the cytosol as higher molecular weight preproteins and imported via the translocons in the outer (TOC) and inner (TIC) envelope membranes of chloroplasts. Toc159 functions as a primary receptor and directly binds preproteins through its dimeric GTPase domain. As a first step toward a molecular understanding of how Toc159 mediates preprotein import, we mapped the preprotein-binding regions on the Toc159 GTPase domain (Toc159G) of pea (Pisum sativum) using cleavage by bound preproteins conjugated with the artificial protease FeBABE and cysteine-cysteine cross-linking. Our results show that residues at the dimer interface and the switch II region of Toc159G are in close proximity to preproteins. The mature portion of preproteins was observed preferentially at the dimer interface, whereas the transit peptide was found at both regions equally. Chloroplasts from transgenic plants expressing engineered Toc159 with a cysteine placed at the dimer interface showed increased cross-linking to bound preproteins. Our data suggest that, during preprotein import, the Toc159G dimer disengages and the dimer interface contacts translocating preproteins, which is consistent with a model in which conformational changes induced by dimer-monomer conversion in Toc159 play a direct role in facilitating preprotein import. PMID:28250068
Li, Bo; Dobruchowska, Justyna M.; Hoogenkamp, Michel A.; Gerwig, Gerrit J.
2012-01-01
The structure of an extracellular polysaccharide EPS159 produced from sucrose by Streptococcus mutans UA159 was investigated through the main oligosaccharides obtained from partial acid hydrolysis, monosaccharide/methylation analysis, and 1D/2D H-1 NMR spectroscopy. The results showed that EPS159
Directory of Open Access Journals (Sweden)
Yu Wang
Full Text Available In Arabidopsis and rice, miR159-regulated GAMYB-like family transcription factors function in flower development and gibberellin (GA signaling in cereal aleurone cells. In this study, the involvement of miR159 in the regulation of its putative target TaGAMYB and its relationship to wheat development were investigated. First, we demonstrated that cleavage of TaGAMYB1 and TaGAMYB2 was directed by miR159 using 5'-RACE and a transient expression system. Second, we overexpressed TamiR159, TaGAMYB1 and mTaGAMYB1 (impaired in the miR159 binding site in transgenic rice, revealing that the accumulation in rice of mature miR159 derived from the precursor of wheat resulted in delayed heading time and male sterility. In addition, the number of tillers and primary branches in rice overexpressing mTaGAMYB1 increased relative to the wild type. Our previous study reported that TamiR159 was downregulated after two hours of heat stress treatment in wheat (Triticum aestivum L.. Most notably, the TamiR159 overexpression rice lines were more sensitive to heat stress relative to the wild type, indicating that the downregulation of TamiR159 in wheat after heat stress might participate in a heat stress-related signaling pathway, in turn contributing to heat stress tolerance.
19 CFR 159.36 - Multiple certified rates.
2010-04-01
... multiple rates have been certified for a foreign currency, the rate to be used for Customs purposes shall... TREASURY (CONTINUED) LIQUIDATION OF DUTIES Conversion of Foreign Currency § 159.36 Multiple certified rates... rates of exchange (e.g., official and free) for a foreign currency: (a) Rates to be published. When the...
19 CFR 159.35 - Certified daily rate.
2010-04-01
... TREASURY (CONTINUED) LIQUIDATION OF DUTIES Conversion of Foreign Currency § 159.35 Certified daily rate. The daily buying rate of foreign currency which is determined by the Federal Reserve Bank of New York and certified to the Secretary of the Treasury in accordance with 31 U.S.C. 5151(e) shall be used for...
76 FR 67019 - Eighty-Seventh: RTCA Special Committee 159: Global Positioning System (GPS)
2011-10-28
... Committee 159: Global Positioning System (GPS) AGENCY: Federal Aviation Administration (FAA), U.S... System (GPS). SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 159: Global Positioning System (GPS) 87th meeting. DATES: The meeting will be held November 14-18...
46 CFR 159.005-15 - Approval of equipment or material: Suspensions, withdrawals, and terminations.
2010-10-01
..., withdrawals, and terminations. 159.005-15 Section 159.005-15 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL APPROVAL OF..., withdrawals, and terminations. (a) The Commandant suspends an approval issued under this subchapter in...
MASSIVE STAR FORMATION IN THE LMC. I. N159 AND N160 COMPLEXES
Energy Technology Data Exchange (ETDEWEB)
Gordon, Michael S.; Jones, Terry J.; Gehrz, Robert D. [Minnesota Institute for Astrophysics, School of Physics and Astronomy 116 Church St SE, University of Minnesota, Minneapolis, MN 55455 (United States); Helton, L. Andrew [USRA–SOFIA Science Center, NASA Ames Research Center, Moffett Field, CA 94035 (United States)
2017-01-10
We present images and spectral energy distributions (SEDs) of massive young stellar objects (YSOs) in three star-forming H ii regions of the Large Magellanic Cloud: N159A, N159 Papillon, and N160. We use photometry from SOFIA/FORCAST at 25.3–37.1 μ m to constrain model fits to the SEDs and determine luminosities, ages, and dust content of the embedded YSOs and their local environments. By placing these sources on mid-infrared color–magnitude and color–color diagrams, we analyze their dust properties and consider their evolutionary status. Since each object in the FORCAST images has an obvious bright near-infrared counterpart in Spitzer Space Telescope images, we do not find any evidence for new, very cool, previously undiscovered Class 0 YSOs. Additionally, based on its mid-infrared colors and model parameters, N159A is younger than N160 and the Papillon. The nature of the first extragalactic protostars in N159, P1, and P2, is also discussed.
Modifications at the A-domain of the chloroplast import receptor Toc159.
Agne, Birgit; Kessler, Felix
2010-11-01
Two families of GTPases, the Toc34 and Toc159 GTPase families, take on the task of preprotein recognition at the translocon at the outer membrane of chloroplasts (TOC translocon). The major Toc159 family members have highly acidic N-terminal domains (A-domains) that are non-essential and so far have escaped functional characterization. But recently, interest in the role of the A-domain has strongly increased. The new data of three independent studies provide evidence that the Toc159 A-domain I) participates in preprotein selectivity, II) has typical features of intrinsically unfolded proteins and III) is highly phosphorylated and possibly released from the rest of the protein by a proteolytic event. This hints to a complex regulation of A-domain function that is important for the maintenance of the preprotein selectivity at the TOC translocons.
40 CFR 159.156 - How information must be submitted.
2010-07-01
... to the Office of Pesticide Programs' Document Processing Desk at the appropriate address as set forth... registration number, date of transmittal to EPA, the type of study or incident being reported under §§ 159.165...
27 CFR 24.159 - Release of collateral security.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Release of collateral... § 24.159 Release of collateral security. Collateral security pledged and deposited will be released only in accordance with the provisions of 31 CFR part 225. The collateral security will not be released...
75 FR 2581 - Eighty-First Meeting: RTCA Special Committee 159: Global Positioning System (GPS)
2010-01-15
... Committee 159: Global Positioning System (GPS) AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of RTCA Special Committee 159 meeting: Global Positioning System (GPS). SUMMARY: The FAA is... System (GPS). DATES: The meeting will be held February 2-5, 2010, from 9 a.m. to 4:30 p.m. (unless stated...
76 FR 27744 - Eighty-Fifth Meeting: RTCA Special Committee 159: Global Positioning System (GPS)
2011-05-12
... Committee 159: Global Positioning System (GPS) AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of RTCA Special Committee 159 meeting: Global Positioning System (GPS). SUMMARY: The FAA is... System (GPS). DATES: The meeting will be held May 26, 2011, from 9 a.m. to 11:45 a.m. ADDRESSES: The...
76 FR 33022 - Eighty-Sixth Meeting: RTCA Special Committee 159: Global Positioning System (GPS)
2011-06-07
... Committee 159: Global Positioning System (GPS) AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of RTCA Special Committee 159 meeting: Global Positioning System (GPS). SUMMARY: The FAA is... System (GPS). DATES: The meeting will be held June 13-17, 2011, from 9 a.m. to 4:30 p.m. ADDRESSES: The...
77 FR 12106 - 88th Meeting: RTCA Special Committee 159, Global Positioning System (GPS)
2012-02-28
... 159, Global Positioning System (GPS) AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Notice of RTCA Special Committee 159, Global Positioning System (GPS). SUMMARY: The..., Global Positioning System (GPS). DATES: The meeting will be held March 13-16, 2012, from 9 a.m.-4:30 p.m...
MicroRNA159 can act as a switch or tuning microRNA independently of its abundance in Arabidopsis.
Directory of Open Access Journals (Sweden)
Maria M Alonso-Peral
Full Text Available The efficacy of gene silencing by plant microRNAs (miRNAs is generally assumed to be predominantly determined by their abundance. In Arabidopsis the highly abundant miRNA, miR159, acts as a molecular "switch" in vegetative tissues completely silencing the expression of two GAMYB-like genes, MYB33 and MYB65. Here, we show that miR159 has a diminished silencing efficacy in the seed. Using reporter gene constructs, we determined that MIR159 and MYB33 are co-transcribed in the aleurone and embryo of germinating seeds. However in contrast to vegetative tissues, MYB33 is not completely silenced. Instead, miR159 appears to shape the spatio-temporal expression pattern of MYB33 during seed germination. Transcript profiling in a time course during seed germination in wild-type and a mir159 mutant in which miR159 is almost absent, revealed that transcript levels of the GAMYB-like genes were similar between these two genotypes during germination, but much higher in the mir159 mutant once germination had completed. This attenuation in the silencing of the GAMYB-like genes was not explained by a decrease in mature miR159 levels, which remained constant at all time points during seed germination. We propose that miR159 acts as a tuner of GAMYB-like levels in Arabidopsis germinating seeds and that the activity of this miRNA is attenuated in the seed compared to vegetative tissues. This implies that the efficacy of miRNA-mediated silencing is not solely determined by miRNA abundance and target transcript levels, but is being determined through additional mechanisms.
Zheng, Jie; Zhang, Mengxue; Zhang, Liying; Ding, Xiaodi; Li, Wentong; Lu, Shijun
2018-05-08
HSPC159 is a novel human galectin-related protein and has been shown to involved in the carcinogenesis. Little is known about HSPC159 expression and function in breast cancer. Here we showed that HSPC159 was aberrantly expressed in both breast cancer cell lines and tumor tissues and that its expression was associated with poor prognosis of breast cancer patients. Using gain- and loss-of-function methods we found that HSPC159 enhanced breast cancer cells proliferation and metastasis in vitro and in vivo. Mechanistically, HSPC159 was found to induce epithelial-mesenchymal transition (EMT) and F-actin polymerization process of breast cancer cells. Moreover, HSPC159 promoted proliferation, migration and invasion through activating PI3K/Akt signaling pathway in breast cancer. In conclusion, our findings demonstrated that HSPC159 contributed to breast cancer progression via PI3K/Akt pathway and might serve as a potential therapeutic target for the treatment of breast cancer. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.
SPITZER VIEW OF YOUNG MASSIVE STARS IN THE LARGE MAGELLANIC CLOUD H II COMPLEXES. II. N 159
International Nuclear Information System (INIS)
Chen, C.-H. Rosie; Indebetouw, Remy; Chu, You-Hua; Gruendl, Robert A.; Seale, Jonathan P.; Testor, Gerard; Heitsch, Fabian; Meixner, Margaret; Sewilo, Marta
2010-01-01
The H II complex N 159 in the Large Magellanic Cloud is used to study massive star formation in different environments, as it contains three giant molecular clouds (GMCs) that have similar sizes and masses but exhibit different intensities of star formation. We identify candidate massive young stellar objects (YSOs) using infrared photometry, and model their spectral energy distributions to constrain mass and evolutionary state. Good fits are obtained for less evolved Type I, I/II, and II sources. Our analysis suggests that there are massive embedded YSOs in N 159B, a maser source, and several ultracompact H II regions. Massive O-type YSOs are found in GMCs N 159-E and N 159-W, which are associated with ionized gas, i.e., where massive stars formed a few Myr ago. The third GMC, N 159-S, has neither O-type YSOs nor evidence of previous massive star formation. This correlation between current and antecedent formation of massive stars suggests that energy feedback is relevant. We present evidence that N 159-W is forming YSOs spontaneously, while collapse in N 159-E may be triggered. Finally, we compare star formation rates determined from YSO counts with those from integrated Hα and 24 μm luminosities and expected from gas surface densities. Detailed dissection of extragalactic GMCs like the one presented here is key to revealing the physics underlying commonly used star formation scaling laws.
40 CFR 159.179 - Metabolites, degradates, contaminants, and impurities.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Metabolites, degradates, contaminants.../Benefit Information § 159.179 Metabolites, degradates, contaminants, and impurities. (a) Metabolites and... degradation of less than 10 percent in a 30-day period. (b) Contaminants and impurities. The presence in any...
2010-10-01
... and tests: Coast Guard action. 159.007-7 Section 159.007-7 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL APPROVAL....007-7 Application for acceptance for production inspections and tests: Coast Guard action. (a) From...
Neutron resonance spins of 159Tb from experiments with polarized neutrons and polarized nuclei
International Nuclear Information System (INIS)
Alfimenkov, V.P.; Ivanenko, A.I.; Lason', L.; Mareev, Yu.D.; Ovchinnikov, O.N.; Pikel'ner, L.B.; Sharapov, Eh.I.
1976-01-01
Spins of 27 neutron resonances of 159 Tb with energies up to 114 eV have been measured using polarized neutrons and nuclei beams in the modernized time-of-flight spectrometer of the IBR-30 pulse reator. The direct measurements of the terbium resonances spins performed using polarized neutrons reaffirm the conclusion that there are no unstationary effects in the behaviour of 159 Tb neutron resonances in the energy range
Inhaled /sup 147/Pm and/or total-body gamma radiation: Early mortality and morbidity in rats
Energy Technology Data Exchange (ETDEWEB)
Filipy, R.E.; Lauhala, K.E.; McGee, D.R.; Cannon, W.C.; Buschbom, R.L.; Decker, J.R.; Kuffel, E.G.; Park, J.F.; Ragan, H.A.; Yaniv, S.S.; Scott, B.R.
1989-05-01
Rats were given doses of /sup 60/Co gamma radiation and/or lung burdens of /sup 147/Pm (in fused aluminosilicate particles) within lethal ranges in an experiment to determine and compare morbidity and mortality responses for the radiation insults within 1 year after exposure. Radiation-induced morbidity was assessed by measuring changes in body weights, hematologic parameters, and pulmonary-function parameters. Acute mortality and morbidity from inhaled promethium were caused primarily by radiation pneumonitis and pulmonary fibrosis that occurred more than 53 days after exposure. Acute mortality and morbidity from total-body gamma irradiation occurred within 30 days of exposure and resulted from the bone-marrow radiation syndrome. Gamma radiation caused transient morbidity, reflected by immediately depressed blood cell levels and by reduced body weight gain in animals that survived the acute gamma radiation syndrome. Inhaled promethium caused a loss of body weight and diminished pulmonary function, but its only effect on blood cell levels was lymphocytopenia. Combined gamma irradiation and promethium lung burdens were synergistic, in that animals receiving both radiation insults had higher morbidity and mortality rates than would be predicted based on the effect of either kind of radiation alone. Promethium lung burdens enhanced the effect of gamma radiation in rats within the first 30 days of exposure, and gamma radiation enhanced the later effect of promethium lung burdens. 70 refs., 68 figs., 21 tabs.
Cloning and characterization of pre-miR159a and pre-miR1123 from ...
African Journals Online (AJOL)
Although many miRNA genes are conserved across the plant species, the same gene family varies significantly in size and genomic organization in different species. ... Sequence identity matrix suggests 43-82% variation in precursor of Tae AL pre-miR159a (Tae Agra local pre-miR159a) across the species. On the other ...
In vitro and in vivo studies of gadolinium-159 liposomes in cancer treatment
International Nuclear Information System (INIS)
Soares, Daniel Cristian Ferreira
2011-01-01
In Brazil, estimates of new cancer cases, valid for the years 2010 and 2011 show that the disease will be responsible for the deaths of about 500,000 people. As an alternative therapy the radiotherapy technique, widely used in treating various types of tumors, act indiscriminate tumoral and healthy cells. Seeking to minimize these effects, nano structured carriers containing radioisotopes, such as liposomes, have been studied with the aim of improving the specificity of action of ionizing radiation, delivering and retaining adequate amounts of radioactive material in tumor cells, leading them to death. In this context, the present study, we prepared liposomes stealth pH-sensitive metal complex containing the radioactive 159 Gd-DTPA-BMA ( 159 Gd-SpHL) aiming to study in vitro and in vivo its effects in cancer treatment. The vesicles showed encapsulation rate of about 20%, average diameter of 100 nm and low release kinetics of radioactivity in biological media. The formulation was characterized through physic-chemical and morphological studies and the results revealed a low polydispersity index and negative Zeta potential. We studied in vitro and in vivo its action against the cells of Ehrlich tumor models and RT2 (rat glioma). The results of in vitro studies showed that the complex has significant radioactive cytotoxicity against the cells of two of the three models studied and that, being encapsulated in liposomes, the cytotoxicity was greatly enhanced. Additionally, we investigated the involvement of caspase-3 protein in Ehrlich and RT2 cell death. The results suggest that the main mechanism involved in the cytotoxic action of radioactive complex is related to apoptosis. The results of in vivo studies showed that liposomes containing 159 Gd-DTPA-BMA accumulated significantly in Ehrlich solid tumor in mice. Aiming to improve this uptake, we prepared pH-sensitive liposomes coated with folate containing the same radioactive complex ( 159 Gd-FTSpHL). The results
14 CFR 61.159 - Aeronautical experience: Airplane category rating.
2010-01-01
... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Aeronautical experience: Airplane category... Transport Pilots § 61.159 Aeronautical experience: Airplane category rating. (a) Except as provided in... certificate with an airplane category and class rating must have at least 1,500 hours of total time as a pilot...
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Man tests for gases and vapors; supplied-air respirators; general performance requirements. 84.159 Section 84.159 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL OF RESPIRATORY PROTECTIVE DEVICES...
Preparation of 147Pm ceramic source core
International Nuclear Information System (INIS)
Mielcarski, M.
1989-01-01
Preparation of ceramic pellets containing fixed promethium-147 is described. Incorporation rate of 147 Pm into the ceramic material was determined. The leachability and vaporization of promethium from the obtained ceramics was investigated. The ceramic pellets prepared by the described procedure, mounted in special holders, can be applied as point sources in beta backscatter thickness gauges. (author)
46 CFR 159.005-5 - Preapproval review: Contents of application.
2010-10-01
... under paragraph (a)(2) of this section contains confidential commercial information that could cause... considered privileged and confidential under exemption (b)(4) of the Freedom of Information Act (5 U.S.C. 552... Section 159.005-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT...
46 CFR 159.010-5 - Independent laboratory: Application for acceptance.
2010-10-01
... organization or in a company or corporation that controls the organization. [CGD 93-055, 61 FR 13928, Mar. 28....010-5 Section 159.010-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT... organization or the chief officer's representative, that an official representative of the Coast Guard is...
46 CFR 159.010-11 - Changes in the laboratory's qualifications.
2010-10-01
... Section 159.010-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT... Commandant in writing of each change within 30 days after the change has occurred. (b) If any change in the... laboratory shall notify the Commandant in writing within 30 days after the change occurs. The Commandant may...
Combined therapy of the Walker-256 carcinosarcoma with X-rays and ICRF-159
International Nuclear Information System (INIS)
Schaphaus, A.
1974-01-01
The radiosensitivity of the Walker-256 carcinosarcoma of the rat under the influence of the tumour-inhibiting bisdioxopiperazine ICRF-159 was studied in collectives of 11-16 animals with tumours. In the combined radio- and chemotherapy, the animals received a daily i.p. injection of 30 mg/kg K.G. of the bisdioxopiperazine ICRF-159 in 1.0 ml NaCl solution containing carboxyl methyl cellulose. The tumour inhibition was determined by multidimensional measurements of the increase in tumour size with the aid of a slide gange. The combined therapy had a better inhibiting effect on tumour growth than radiotherapy alone. (orig./AK) [de
78 FR 54168 - Special Local Regulation, Cumberland River, Mile 157.0 to 159.0; Ashland City, TN
2013-09-03
... Local Regulation, Cumberland River, Mile 157.0 to 159.0; Ashland City, TN AGENCY: Coast Guard, DHS... Special local regulation; Cumberland River, Miles 157.0 to 159.0, Ashland City, TN. (a) Location. The... regulation for the waters of the Cumberland River beginning at mile marker 157.0 and ending at mile marker...
Characterization of a TK6-Bcl-xL gly-159-ala Human Lymphoblast Clone
Energy Technology Data Exchange (ETDEWEB)
Chyall, L.: Gauny, S.; Kronenberg, A.
2006-01-01
TK6 cells are a well-characterized human B-lymphoblast cell line derived from WIL-2 cells. A derivative of the TK6 cell line that was stably transfected to express a mutated form of the anti-apoptotic protein Bcl-xL (TK6-Bcl-xL gly-159- ala clone #38) is compared with the parent cell line. Four parameters were evaluated for each cell line: growth under normal conditions, plating efficiency, and frequency of spontaneous mutation to 6‑thioguanine resistance (hypoxanthine phosphoribosyl transferase locus) or trifluorothymidine resistance (thymidine kinase locus). We conclude that the mutated Bcl-xL protein did not affect growth under normal conditions, plating efficiency or spontaneous mutation frequencies at the thymidine kinase (TK) locus. Results at the hypoxanthine phosphoribosyl transferase (HPRT) locus were inconclusive. A mutant fraction for TK6‑Bcl-xL gly-159-ala clone #38 cells exposed to 150cGy of 160kVp x-rays was also calculated. Exposure to x-irradiation increased the mutant fraction of TK6‑Bcl-xL gly-159-ala clone #38 cells.
Why 159°?: a story about the dropping of the Hiroshima atom bomb
Prunty, Sean L.
2015-04-01
This paper presents an analysis of the evasive manoeuvre undertaken by the pilot of the Enola Gay aircraft following the dropping of the first uranium bomb. The pilot was instructed to make a 159° turn following the bomb’s release in order to acquire the greatest distance from the point at which the bomb explodes. Accordingly, the objective here is to investigate why the angle should be exactly 159°. The optimum flight-path to maximize the distance from the detonation point is analysed by considering the escape or exit angle taken by the aircraft following a turning-manoeuvre that points it directly away from the detonation site. A range of escape angles are predicted based on the requirement to exit the turning radius prior to detonation. By using information that appeared in a historical account of the event regarding the manoeuvre undertaken by the pilot following the release of the bomb, an estimate is made of the escape angle. Despite the fact that the result shows reasonable agreement with the value of 159°, some uncertainty is expressed as to the close coincidence obtained. In addition, the location of the aircraft and the time of arrival of the shock wave following detonation are also briefly discussed.
46 CFR 159.010-19 - Termination of acceptance or recognition: Procedure.
2010-10-01
... termination is under consideration. The laboratory may submit written comments to the Commandant within 21... of the laboratory and may direct the holder of the certificate of approval to cease claiming that the....010-19 Section 159.010-19 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT...
Clinical analysis on 159 cases of mechanical ocular trauma
Zi-Yao Liu; Ya-Zhi Fan; Yu-Ping Zheng; Jian-Ming Wang
2013-01-01
AIM: To provide the basis of security guidance and decreasing the incidence through a general investigation of the mechanical ocular trauma among all the common causes, occasions where getting hurt as well as the characteristics of the high-risk group, and by further analysis and monitoring of the clinical cases and follow-up visit, study the related key factors of influencing the prognosis statistically. METHODS: The data of the 159 cases with mechanical ocular trauma were recorded.RESULTS: ...
2011-10-20
... DEPARTMENT OF LABOR Employee Benefits Security Administration 159th Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of Meeting Pursuant to the authority... 159th open meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans (also known as...
Silica nanoparticles containing 159-Gadolinium as potential system for cancer treatment
International Nuclear Information System (INIS)
Oliveira, Andre Felipe de; Ferreira, Tiago Hilario; Sousa, Edesia Martins Barros de; Lacerda, Marco Aurelio
2013-01-01
Ordered silica nanoparticles are compounds highly organized which have very interesting textural characteristics, such as high thermal stability, well defined pore size, narrow size distribution and high area surface. Among the various types of nano materials ordered, the SBA-16 have a meso structure that can be considered very interesting due to the fact of the arrangement of mesoporous (tri dimensional as a cage) and spherical morphology, which make it in a promising material for a range of bioapplications such as incorporation of drugs and radioisotopes. In this study Gadodiamide® (Omniscan-General Electric Healthcare Company), a frequently non-ionic gadolinium complex contrasting used in MRI's was incorporated in the silica matrix SBA-16 as a carrier. From this gadolinium it is possible to obtain the isotope 159 Gd by neutron irradiation, wherein the isotope 158 Gd captures a neutron and becomes 159 Gd [ 15 '8Gd(n,c) 1 '5 9 Gd]. The 159 Gd is a beta (endpoint energy of 970.6 keV) and gamma (main energy: 363.54 keV) emitter with a half-life of 18.59 hours. These characteristics are similar to that of other isotopes already used in nuclear medicine such as 90 Y. In this work, the 158 Gd incorporated in the Gd-silica was activated by the neutron flux generated by the cyclotron located in the Centro de Desenvolvimento da Tecnologia Nuclear (CDTN) during the production of the 18 FDG. Atomic emission spectroscopy (ICP-AES) and infrared spectroscopy (FTIR) were used to confirm the presence of the gadolinium complex in the silica matrix. The antitumor activity of the complex after the irradiation was evaluated through cytotoxicity assay with T98 cell lines derived from a human glioblastoma multiform tumor. (author)
49 CFR 1.59a - Redelegations by the Assistant Secretary for Administration.
2010-10-01
... DELEGATION OF POWERS AND DUTIES Delegations § 1.59a Redelegations by the Assistant Secretary for...-delegate and authorize successive re-delegations. (b) The Assistant Secretary for Administration has... employees under the Federal Wage System, except as delegated to the Commandant of the Coast Guard at § 1.46...
47 CFR 25.159 - Limits on pending applications and unbuilt satellite systems.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Limits on pending applications and unbuilt... § 25.159 Limits on pending applications and unbuilt satellite systems. (a) Applicants with a total of... band, or a combination of pending GSO-like applications and licensed-but-unbuilt GSO-like space...
DEFF Research Database (Denmark)
Juknaite, Lina; Sugamata, Yutaro; Tokiwa, Kazuya
2013-01-01
IKM-159 was developed and identified as a member of a new class of heterotricyclic glutamate analogs that act as AMPA receptor-selective antagonists. However, it was not known which enantiomer of IKM-159 was responsible for its pharmacological activities. Here, we report in vivo and in vitro neur...
CD14-159C/T polymorphism in the development of delayed skin hypersensitivity to tuberculin.
Directory of Open Access Journals (Sweden)
Magdalena Druszczynska
Full Text Available The skin tuberculin test (TST, an example of a delayed-type hypersensitivity (DTH reaction, is based on measuring the extent of skin induration to mycobacterial tuberculin (PPD. Little is known about the genetic basis of TST reactivity, widely used for diagnosing TB infection. The study investigated the relationship of the single base change polymorphic variants in CD14 gene (CD14(-159C/T with the development of DTH to PPD in BCG-vaccinated Polish Caucasian individuals. We found persistent lack of TST reactivity in about 40% of healthy subjects despite receiving more than one dose of BCG. The TST size was negatively correlated with the number of BCG inoculations. The distribution of C/T genotype was significantly more frequent among TST-negative compared with TST-positive individuals. The concentration of serum sCD14 was positively associated with mCD14 expression, but not with the TST status or CD14(-159C/T polymorphism. A significant increase in mCD14 expression and serum sCD14 levels was found in TB group. We hypothesize that CD14(-159C/T polymorphic variants might be one of genetic components in the response to attenuated M. bovis BCG bacilli.
Energy Technology Data Exchange (ETDEWEB)
Baker, D.; Constable, W.; Elkon, D.; Rinehart, L.
1981-11-15
Courses of irradiation consisting of 6000 rad in ten equal fractions over 12 days delivered to KHT sarcomas in mice controlled 55% of the local tumors but 83% of the mice died from metastases. Three strategies to reduce the risk of metastatic spread were tested. The fractionation scheme was changed to deliver the same total dose using a large initial fraction followed by seven equal portions with the same overall time. ICRF-159 was used with the intention of partially synchronizing the tumor growth fraction in a radiosensitive state of the growth cycle and of promoting normalization of the tumor vasculature. Levamisole was used to stimulate the immune system. The combination of ICRF-159 with the eight-fraction radiation course proved to be effective for both increasing local control and decreasing the incidence of metastases. The addition of levamisole did not improve the results obtained with a combination of ICRF-159 and irradiation.
Directory of Open Access Journals (Sweden)
Eun Ky Kim
2014-12-01
Full Text Available Mutation in HNF1B, the hepatocyte nuclear factor-1β (HNF-1β gene, results in maturity-onset diabetes of the young (MODY 5, which is characterized by gradual impairment of insulin secretion. However, the functional role of HNF-1β in insulin secretion and glucose metabolism is not fully understood. We identified a family with early-onset diabetes that fulfilled the criteria of MODY. Sanger sequencing revealed that a heterozygous P159L (CCT to CTT in codon 159 in the DNA-binding domain mutation in HNF1B was segregated according to the affected status. To investigate the functional consequences of this HNF1B mutation, we generated a P159L HNF1B construct. The wild-type and mutant HNF1B constructs were transfected into COS-7 cells in the presence of the promoter sequence of human glucose transporter type 2 (GLUT2. The luciferase reporter assay revealed that P159L HNF1B had decreased transcriptional activity compared to wild-type (p < 0.05. Electrophoretic mobility shift assay showed reduced DNA binding activity of P159L HNF1B. In the MIN6 pancreatic β-cell line, overexpression of the P159L mutant was significantly associated with decreased mRNA levels of GLUT2 compared to wild-type (p < 0.05. However, INS expression was not different between the wild-type and mutant HNF1B constructs. These findings suggests that the impaired insulin secretion in this family with the P159L HNF1B mutation may be related to altered GLUT2 expression in β-cells rather than decreased insulin gene expression. In conclusion, we have identified a Korean family with an HNF1B mutation and characterized its effect on the pathogenesis of diabetes.
Job burnout in 159 anesthesiology trainees
Directory of Open Access Journals (Sweden)
Yesim Cokay Abut
2012-01-01
Full Text Available Background: Anesthesiology may be stressful and most anesthesiologists develop mechanisms for coping. However, inexperienced trainee anesthesiologists seem to be vulnerable. We studied stress perception and job burnout in trainee anesthesiologists. Methods: Responses to perceived stress scale (PSS and Maslach Burnout Inventory (MBI were evaluated in 159 trainee anesthesiologists. Results: In our results, when perceived stress was increased, emotional exhaustion and depersonalization increased but personal accomplishment decreased, as expected. Perceived stress was very high in the early years of training. There was a negative correlation between age and emotional exhaustion and depersonalization, but positive correlation with personal accomplishment. Female anesthesiologists had higher personal accomplishment, but lower depersonalization points than male anesthesiologists in our study. There was no statistical association between marital status, PSS, and MBI; ≥2 children group had a significant high personal accomplishment but low depersonalization and emotional exhaustion scores. Line regression analysis showed a statistically significant relationship between PSS and emotional exhaustion and between age and depersonalization. Conclusions: Social factors such as gender and number of children affect the work life of our trainees.
Oleanolic acid and ursolic acid inhibit peptidoglycan biosynthesis in Streptococcus mutans UA159
Directory of Open Access Journals (Sweden)
Soon-Nang Park
2015-06-01
Full Text Available In this study, we revealed that OA and UA significantly inhibited the expression of most genes related to peptidoglycan biosynthesis in S. mutans UA159. To the best of our knowledge, this is the first report to introduce the antimicrobial mechanism of OA and UA against S. mutans.
SPECTROSCOPIC STUDY OF THE N159/N160 COMPLEX IN THE LARGE MAGELLANIC CLOUD
International Nuclear Information System (INIS)
Farina, Cecilia; Bosch, Guillermo L.; Morrell, Nidia I.; Barba, Rodolfo H.; Walborn, Nolan R.
2009-01-01
We present a spectroscopic study of the N159/N160 massive star-forming region south of 30 Doradus in the Large Magellanic Cloud, classifying a total of 189 stars in the field of the complex. Most of them belong to O and early B spectral classes; we have also found some uncommon and very interesting spectra, including members of the Onfp class, a Be P Cygni star, and some possible multiple systems. Using spectral types as broad indicators of evolutionary stages, we considered the evolutionary status of the region as a whole. We infer that massive stars at different evolutionary stages are present throughout the region, favoring the idea of a common time for the origin of recent star formation in the N159/N160 complex as a whole, while sequential star formation at different rates is probably present in several subregions.
46 CFR 159.010-17 - Termination of acceptance or recognition of an independent laboratory.
2010-10-01
... (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL APPROVAL OF EQUIPMENT AND... comply with § 159.010-11; (g) Contracts or transfers the performance or supervision of required..., or in the opinion of the Commandant is unable to, carry out its responsibilities under an MOU...
Directory of Open Access Journals (Sweden)
Atiyeh Ghajarieh
2017-11-01
Full Text Available Dyes are a main source of pollutants in textile plant effluents. Due to their molecular structure, they are usually toxic, carcinogenous, and persistent in the environment. The aim of the present work was to explore the removal of basic blue159 (BB159 using magnetic sodium alginate hydrogel beads. Magnetic sodium alginate hydrogel beads were initially synthesized accoriodng to Rocher method using CaCl2 as a crosslink agent. Fourier transform infrared spectroscopy (FTIR was then employed to examine the functional groups on the surface of the magnetic sodium alginate hydrogel beads. In a third stage, the magnetic properties of the beads were measured using a vibrating sample magnetometer (VSM and the magnetic parameters were calculated. Subsequently, the effects of such parameters as adsorbent dosage, pH, initial concentration of dye, and contact time were evaluated on the BB159 removal efficiency of the adsorbent used. Finally, the Langmuir, Freundlich, Temkin, and B.E.T models were exploited to study the adsorption isotherm of BB159 onto the magnetic sodium alginate hydrogel beads. It was found that the magnetic sodium alginate beads possess both –COO and –OH groups that play important roles in the adsorption of the positively charged BB159 dye. A saturation magnetization equal to 21/8(emu/g was obtained for the sodium alginate beads/nano Fe3O4. Results also revealed that the highest dye removal from aqueous solutions was achieved at pH=11 in 120 minutes for 9 grams of the adsorbent. The study indicated that BB159 removal using the magnetic sodium alginate hydrogel beads as the adsorbent obeys the Langmuir model. Moreover, it was shown that the efficiency of the process for BB159 removal from aqueous solutions was satisfactory (85%.
Energy Technology Data Exchange (ETDEWEB)
Baker, D.; Constable, W.; Elkon, D.; Rinehart, L.
1981-11-15
Courses of irradiation consisting of 6000 rad in ten equal fractions over 12 days delivered to KHT sarcomas in mice controlled 55% of the local tumors but 83% of the mice died from metastases. Three strategies to reduce the risk of metastatic spread were tested. The fractionation scheme was changed to deliver the same total dose using a large initial fraction followed by seven equal portions with the same overall time. ICRF-159 was used with the intention of partially synchronizing the tumor growth fraction in a radiosensitive state of the growth cycle and of promoting normalization of the tumor vasculature. Levamisole was used to stimulate the immune system. The combination of ICRF-159 with the eight-fraction radiation course proved to be effective for both increasing local control and decreasing the incidence of metastases. The addition of levamisole did not improve the results obtained with a combination of ICRF-159 and irradiation.
Soft X-ray excess in the cluster of galaxies Sérsic 159-03
de Plaa, J.; Kaastra, J.S.; Méndez, R.M.; Tamura, T.; Bleeker, J.A.M.; Peterson, J.; Paerels, F.B.S.; Bonamente, M.; Lieu, R.
2004-01-01
We present the results from a new 120 ks XMM-Newton observation of Sérsic 159-03. A previous XMM-Newton observation of this cluster shows the presence of a soft X-ray excess in the outer parts of the cluster, which is possibly connected to the interaction between the cluster and the gas from the
Clinical analysis on 159 cases of mechanical ocular trauma
Directory of Open Access Journals (Sweden)
Zi-Yao Liu
2013-08-01
Full Text Available AIM: To provide the basis of security guidance and decreasing the incidence through a general investigation of the mechanical ocular trauma among all the common causes, occasions where getting hurt as well as the characteristics of the high-risk group, and by further analysis and monitoring of the clinical cases and follow-up visit, study the related key factors of influencing the prognosis statistically. METHODS: The data of the 159 cases with mechanical ocular trauma were recorded.RESULTS: We obtained the 159 subjects' ages, genders as well as mechanical ocular trauma characteristic data, such as ocular distributions, the seasons of the injuries occurring, the causes and the occasions of the injuries, the high-risks group and so on. The factors affecting the visual prognosis,univariate analysis showed that the difference between urban and rural areas was a related influencing factor while the consulting hours and the ages of the patients were irrelevant. In the multivariate Logistic regression model of complications that affected the visual prognosis, there were four main factors leading to poor eyesight: endophthalmitis, retinal detachment, luxation or subluxation of the lens, prolapse of vitreous. In the multivariate Logistic regression model of the visual prognosis of mechanical eye injury, there were three factors of concern that corresponded to poor eyesight: the ages less than 10, zonation Ⅲ, grade of injury more than 3. CONCLUSION: The epidemiologic features of the mechanical ocular trauma in our hospital correspond to the reports from other areas. Appropriate medical care can improve the visual prognosis. Factors such as zonation Ⅲ, ages less than 10, grade of injury more than 3, endophthalmitis with the eye injury, prolapse of vitreous, luxation or subluxation of the lens and so on, indicate poor visual prognosis.
10-GHz 1.59-μm quantum dash passively mode-locked two-section lasers
DEFF Research Database (Denmark)
Dontabactouny, Madhoussoudhana; Rosenberg, C.; Semenova, Elizaveta
2010-01-01
This paper reports the fabrication and the characterisation of a 10 GHz two-section passively mode-locked quantum dash laser emitting at 1.59 μm. The potential of the device's mode-locking is investigated through an analytical model taking into account both the material parameters and the laser...
Alpha-production channels in 6Li+159Tb at energies around the Coulomb barrier
International Nuclear Information System (INIS)
Pradhan, M.K.; Mukherjee, A.; Roy, S.; Basu, P.; Goswami, A.; Saha Sarkar, M.; Kshetri, R.; Roy Chowdhury, R.; Ray, M.; Santra, S.; Kailas, S.; Parkar, V.V.; Palit, R.
2010-01-01
In order to investigate what are the dominant processes that might contribute to the inclusive α-particle channels, very recently measurements have been performed by the characteristic γ-ray method for the system 6 Li+ 159 Tb at energies below and above the Coulomb barrier (V B = 26.9 MeV)
Energy Technology Data Exchange (ETDEWEB)
Gautam, Manjeet Singh [Thapar University, School of Physics and Materials Science, Patiala (India); Indus Degree College, Department of Physics, Kinana, Jind, Haryana (India); Grover, Neha; Sharma, Manoj K. [Thapar University, School of Physics and Materials Science, Patiala (India)
2017-01-15
The complete fusion (CF) and incomplete fusion (ICF) cross-sections are estimated for {sup 6,} {sup 7}Li + {sup 159}Tb reactions using the energy-dependent Woods-Saxon potential model (EDWSP model) and dynamical cluster-decay model (DCM). The CF data of the {sup 6}Li + {sup 159}Tb({sup 7}Li + {sup 159}Tb) reaction at above barrier energies is suppressed with reference to expectations of the EDWSP model by 25% (20%) which is smaller than the reported data by ∝ 9% (6%). This suppression is correlated with the projectile breakup effect. The projectiles {sup 6,7}Li are loosely bound systems, which may break up into charged fragments prior to reaching the fusion barrier and subsequently one of the fragment is captured by the target leading to the suppression of fusion data at above barrier energies. The sum of CF and ICF, which is termed as total fusion cross-section (TF), removes the discrepancies between theoretical predictions and the above barrier complete fusion data and hence is adequately explained via the EDWSP model over a wide range of energy spread across the Coulomb barrier. In addition to fusion, the decay mechanism of {sup 6}Li + {sup 159}Tb reaction is studied within the framework of the dynamical cluster-decay model (DCM). The breakup of the projectile ({sup 6}Li) in the entrance channel indicates the presence of ICF, which is investigated further using the collective clusterization approach of DCM. The present theoretical analysis suggests that a larger barrier modification is needed to address the fusion data of chosen reactions in the below barrier energy region. (orig.)
Raman spectra of Pm2O3, PmF3, PmCl3, PmBr3 and PmI3
International Nuclear Information System (INIS)
Wilmarth, W.R.; Peterson, J.R.
1988-01-01
Raman spectral data are presented for the sesquioxide and the trihalides (F, Cl, Br and I) of promethium. The Raman spectra of these lanthanide compounds are reported for the first time and are compared with those of the homologous lanthanide compounds. Tentative symmetry assignments have been made for the observed Raman-active bands based on factor group analysis of their respective crystal structures and comparisons with the assigned Raman spectra of other lanthanide compounds. The characteristic band patterns of the Raman phonon spectra have been found to be very useful in determining the crystal structure of the respective promethium compounds. (author)
International Nuclear Information System (INIS)
Kopyrin, A.A.; Murashov, V.D.; Shvedov, V.P.
1980-01-01
The effect of DTPA, cerium and europium nitrates concentration in the range from 10 -1 -10 -6 M on extraction and separation of americium (3), cerium (3), prometium and europium 0.2 M with the solution of tri-n-octylamine nitrate in n-xylol of concentrated lithium nitrate solutions, is investigated. The method of Box-Wilson is used to determine the optimum conditions of separation of the above elements. The maximum values of separation factors are obtained for the following pairs: cerium(3)-americium(3) - 100, americium (3)-europium - 12, promethium-americium(3) - 35, cerium(3)-promethium - 30, cerium(3)-europium - 890 [ru
Die verwysing van hupèr eléous in Romeine 15:9
Directory of Open Access Journals (Sweden)
E. Engelbrecht
1986-01-01
Full Text Available The reference of hupèr eléous in Romans 15:9 The question of how hupèr eléous is to be understood in Romans 15:9 is answered with two presuppositions in mind. The letter to the Romans is understood as a paranetic reminder which culminates in 15:7-13. Furthermore it is argued that the context of this passage is the letter itself rather than a Pauline theology. The microstructure of the term is investigated to determine the resiprocal interrelationship between the term and its immediate neighbourhood. These results are used to control the presuppositions relating to the macro-context. The term hupèr eléous functions within the idea that Christ's acceptance of the congregation is coordinated by God's truthfulness towards Israel and his mercy towards the gentiles. This mercy of God is a new and surprising act of God, but since this mercy of God is Christ's acceptance of the gentiles, it is related to God's truthfulness to Israel which was manifested in Christ's confirmation of the promises given to the patriarchs. This has implications for the interrelationship between the church and the Jews.
Functional effects of the DCM mutant Gly159Asp troponin C in skinned muscle fibres
DEFF Research Database (Denmark)
Preston, Laura C; Lipscomb, Simon; Robinson, Paul
2006-01-01
We recently reported a dilated cardiomyopathy (DCM) causing mutation in a novel disease gene, TNNC1, which encodes cardiac troponin C (TnC). We have determined how this mutation, Gly159Asp, affects contractile regulation when incorporated into muscle fibres. Endogenous troponin in rabbit skinned...
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Activities of self-regulatory... COMMODITY EXCHANGE ACT Miscellaneous § 1.59 Activities of self-regulatory organization employees, governing...) Self-regulatory organization means “self-regulatory organization,” as defined in Commission regulation...
Xue, Tao; Liu, Zhenhua; Dai, Xuehuan; Xiang, Fengning
2017-09-01
Organ growth is a fundamental developmental process basing on cell proliferation and differentiation. The growth of the plant root is sustained by the activity of the root meristem, a process controlled in part by various transcription factors. Here, the miR159 has been identified as a post transcriptional repressor of root growth, on the basis that the mir159ab double mutant developed a larger meristem than did the wild type, and that it formed longer roots. In the mutant, the abundance of MYB33, MYB65 and MYB101 transcript was substantially increased. When MYB33, MYB65 and MYB101 were replaced by the miR159-resistant forms mMYB33, mMYB65 and mMYB101 respectively, the root meristem was similarly enlarged and the growth of the primary root enhanced. MYB65 activity promoted cell division in the root meristem by accelerating the cell cycle. The data suggest that miR159 acts as a key repressor of the primary root's growth, acting through its repression of MYB65 and consequent blocking of the cell cycle. Copyright © 2017 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Barry J. Connell
2012-01-01
Full Text Available Background. Lipoic acid (LA, which has significant antioxidant properties, may also function as a potent neuroprotectant. The synthetic compounds INV-155, INV-157, INV-159, and INV-161 are physiochemical combinations of lipoic acid and captopril. We sought to determine if these compounds have neuroprotective potential following middle cerebral artery occlusion (MCAO in rats. Methods. Male Sprague-Dawley rats were injected intravenously with captopril (1–50 mg/kg 30 minutes prior to MCAO. Blood pressure, heart rate, baroreceptor reflex sensitivity, and infarct size were measured. In addition, dose response effect on infarct size and cardiovascular parameters was determined using INV-155, INV-157, INV-159, and INV-161 and compared to captopril and LA. Results. Pretreatment with captopril and LA at all doses tested was neuroprotective. The compounds INV-159 (0.5–10 mg/kg and INV-161 (1–10 mg/kg produced a significant,dose-dependent decrease in infarct size. In contrast, INV-155 and INV-157 had no effect on infarct size. Conclusions. Combined pretreatment with captopril potentiated the neuroprotective benefit observed following LA alone. Both INV-159 and INV-161 were also neuroprotective. These results suggest that patients taking combinations of captopril and LA, either as combination therapy or in the form of INV-159 or INV-161, may also benefit from significant protection against cerebral infarction.
International Nuclear Information System (INIS)
Kawase, Y.; Okano, K.; Aoki, K.
1987-01-01
By using a high-temperature thermal ion source coupled to a He-jet system, neutron-rich isotopes of rare-earth elements such as cerium, praseodymium, neodymium and promethium produced by the thermal-neutron fission of /sup 235/U were ionized and successfully separated. The temperature dependence of the ionization efficiency has been measured and found to be explained qualitatively by the vapour pressure of the relevant elements. The characteristic temperature dependence of the ionization efficiency has been utilized for Z-identification of several isobars of rare-earth elements. The heaviest isotopes of neodymium and promethium, /sup 155/Nd and /sup 156/Pm, have recently been identified
Study of the 14N + 159Tb reaction between 6 and 22 MeV/u
International Nuclear Information System (INIS)
Balster, G.J.
1987-01-01
The main topic of this thesis is the study of the dynamics of asymmetric nucleus-nucleus collisions from low to intermediate energies by concentrating on one specific reaction, 14 N+ 159 Tb. The main experimental techniques involved are inclusive measurements and measurements of coincidences between particles and KX-rays. Additional experiments that were performed to support this study are also discussed. Results from measurements of target KX-ray production cross sections for heavy ion beams at energies above the Coulomb barrier are presented. It is shown that these cross sections can be accurately calculated and hence that the measurement of target KX-rays can serve as a convenient way of normalizing the particle-KX-ray coincidence data. Results from inclusive measurements of 92 MeV 14 N induced reactions on different targets are employed to investigate the reaction systematics at low energies. The systematic study of the 14 N+ 159 Tb reaction between 6 and 22 MeV/u via inclusive measurements and the measurement of particle-KX-ray coincidences is then presented. (Auth.)
Incomplete fusion reactions in 16O+159Tb system: Spin distribution measurements
Directory of Open Access Journals (Sweden)
Sharma Vijay R.
2015-01-01
Full Text Available In order to explore the reaction modes on the basis of their entry state spin population, an experiment has been done by employing particle-γ coincidence technique carried out at the Inter University Accelerator Centre, New Delhi. The preliminary analysis conclusively demonstrates, spin distribution for some reaction products populated via complete and/or incomplete fusion of 16O with 159Tb system found to be distinctly different. Further, the existence of incomplete fusion at low bombarding energies indicates the possibility to populate high spin states.
Importance of $1n$-stripping process in the $^{6}$Li+$^{159}$Tb reaction
Pradhan, M. K.; Mukherjee, A.; Roy, Subinit; Basu, P.; Goswami, A.; Kshetri, R.; Palit, R.; Parkar, V. V.; Ray, M.; Sarkar, M. Saha; Santra, S.
2013-01-01
The inclusive cross sections of the $\\alpha$-particles produced in the reaction $^{6}$Li+$^{159}$Tb have been measured at energies around the Coulomb barrier. The measured cross sections are found to be orders of magnitude larger than the calculated cross sections of $^{6}$Li breaking into $\\alpha$ and $d$ fragments, thus indicating contributions from other processes. The experimental cross sections of $1n$-stripping and $1n$-pickup processes have been determined from an entirely different me...
International Nuclear Information System (INIS)
Ali, R.; Singh, D.; Pachouri, Dipti; Afzal Ansari, M.; Rashid, M.H.
2007-01-01
The recoil range distribution (RRD) of several residues have been measured for the system 20 Ne + 159 Tb at 165 MeV beam energy by collecting the recoiling residues in the Al-catcher foils of varying thickness
Kim, Hye Ryun; Lee, Ae Ran; Kim, Jae-Ho
2017-06-01
Herein, nuruks derived from non-glutinous and glutinous rice inoculated with Aspergillus oryzae N159-1 (having high alpha-amylase and beta-glucosidase activities) were used to produce Korean alcoholic beverages. The resultant beverages had enhanced fruity (ethyl caproate and isoamyl alcohol) and rose (2-phenethyl acetate and phenethyl alcohol) flavors and high taste scores.
Kim, Hye Ryun; Lee, Ae Ran; Kim, Jae-Ho
2017-01-01
Herein, nuruks derived from non-glutinous and glutinous rice inoculated with Aspergillus oryzae N159-1 (having high alpha-amylase and beta-glucosidase activities) were used to produce Korean alcoholic beverages. The resultant beverages had enhanced fruity (ethyl caproate and isoamyl alcohol) and rose (2-phenethyl acetate and phenethyl alcohol) flavors and high taste scores.
Defense Language Inst., Washington, DC.
The 19 lessons in these two volumes are intended for the advanced phase of a 159-lesson intensive audiolingual basic Russian course developed recently by the Defense Language Institute to train native speakers of English to a Level 3 second language proficiency. These third and fifth volumes contain such features as (1) texts on the Russian Civil…
Study of Quasielastic scattering for 7Li+159Tb at around- barrier energies
Directory of Open Access Journals (Sweden)
Mukherjee A.
2017-01-01
Full Text Available Quasielastic scattering cross sections for the reaction 7Li+159Tb have been measured at large backangles, at energies around the Coulomb barrier. The quasielastic barrier distribution has been extracted from the measured quasielastic scattering excitation function, including and excluding α particle contribution. The peak of the quasielastic barrier distribution including α particle contribution shows a shift towards higher energy compared to the peak of the distribution without α particles. The quasielastic barrier distribution when compared to the calculated fusion barrier distribution, appears to show reasonable agreement for the system.
Measured thermal and fast neutron fluence rates for ATF-1 holders during ATR cycle 158B/159A
Energy Technology Data Exchange (ETDEWEB)
Smith, Larry Don [Idaho National Lab. (INL), Idaho Falls, ID (United States); Miller, David Torbet [Idaho National Lab. (INL), Idaho Falls, ID (United States); Walker, Billy Justin [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2016-11-01
This report contains the thermal (2200 m/s) and fast (E>1MeV) neutron fluence rate data for the ATF-1 holders located in core for ATR Cycle 158B/159A which were measured by the Radiation Measurements Laboratory (RML).
Directory of Open Access Journals (Sweden)
Arnaldo Amado Ferreira Neto
2011-01-01
Full Text Available OBJETIVO: Análise dos resultados de 159 pacientes com instabilidade anterior do ombro submetidos ao tratamento artroscópico de janeiro de 2001 a dezembro de 2005. MÉTODOS: Estudo retrospectivo de prontuários com dados completos. RESULTADOS: Em 108 pacientes notou-se a lesão de Bankart e em 62 pacientes a lesão do tipo SLAP estava presente. Utilizou-se em média 2,7 âncoras. Apresentaram complicações 42 casos; 14 tinham dor aos esforços, 12 tinham algum grau de diminuição da rotação externa, 16 apresentaram recidiva. Os pacientes que evoluíram com complicações utilizaram em média 2,5 âncoras, enquanto naqueles sem complicações a média foi de 2,8 (pOBJECTIVE: To analyze the results of 159 patients with anterior instability of the shoulder submitted to arthroscopic treatment from January 2001 to December 2005. METHODS: Retrospective study of complete patient records. RESULTS: In 108 patients the Bankart lesion was found, while in 62 patients, SLAP type lesions were found. An average of 2.7 anchors was used. 42 cases presented complications; 14 had pain on effort, 12 had some degree of reduction of external rotation, and 16 had recorrence. The patients who developed complications used an average of 2.5 anchors, while those without complications used an average of 2.8 anchors (p<0.05. Of the 35 patients with anterior glenoid bone lesion, 8 had recorrence, while of the 124 patients without fractures, 8 had recorrence (p<0.05. Of the 113 patients with first-time traumatic dislocations, 12 developed limitation of external rotation, while in 46 atraumatic cases none developed limitation (p<0.05. Of the patients with SLAP lesion, 11 developed pain, while in the cases without this lesion, only 3 presented pain (p<0.05. CONCLUSION: There were more recurrences (deveria ser plural e recurrences, nao recurrence in cases of anterior glenoid bone lesion. Post-operative pain was more frequent when the lesion type was SLAP. Limitation of
International Nuclear Information System (INIS)
Saigo, Kazuya; Harada, Ryohei; Kawamura, Akiko; Onishi, Toshikazu; Tokuda, Kazuki; Morioka, Yuuki; Nayak, Omnarayani; Meixner, Margaret; Sewiło, Marta; Indebetouw, Remy; Torii, Kazufumi; Ohama, Akio; Hattori, Yusuke; Yamamoto, Hiroaki; Tachihara, Kengo; Minamidani, Tetsuhiro; Inoue, Tsuyoshi; Madden, Suzanne; Lebouteiller, Vianney; Galametz, Maud
2017-01-01
We present the ALMA Band 3 and Band 6 results of 12 CO(2-1), 13 CO(2-1), H30 α recombination line, free–free emission around 98 GHz, and the dust thermal emission around 230 GHz toward the N159 East Giant Molecular Cloud (N159E) in the Large Magellanic Cloud (LMC). LMC is the nearest active high-mass star-forming face-on galaxy at a distance of 50 kpc and is the best target for studing high-mass star formation. ALMA observations show that N159E is the complex of filamentary clouds with the width and length of ∼1 pc and several parsecs. The total molecular mass is 0.92 × 10 5 M ⊙ from the 13 CO(2-1) intensity. N159E harbors the well-known Papillon Nebula, a compact high-excitation H ii region. We found that a YSO associated with the Papillon Nebula has the mass of 35 M ⊙ and is located at the intersection of three filamentary clouds. It indicates that the formation of the high-mass YSO was induced by the collision of filamentary clouds. Fukui et al. reported a similar kinematic structure toward two YSOs in the N159 West region, which are the other YSOs that have the mass of ≳35 M ⊙ . This suggests that the collision of filamentary clouds is a primary mechanism of high-mass star formation. We found a small molecular hole around the YSO in Papillon Nebula with a sub-parsec scale. It is filled by free–free and H30 α emission. The temperature of the molecular gas around the hole reaches ∼80 K. It indicates that this YSO has just started the distruction of parental molecular cloud.
Energy Technology Data Exchange (ETDEWEB)
Saigo, Kazuya; Harada, Ryohei; Kawamura, Akiko [Chile Observatory, National Astronomical Observatory of Japan, National Institutes of Natural Science, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Onishi, Toshikazu; Tokuda, Kazuki; Morioka, Yuuki [Department of Physical Science, Graduate School of Science, Osaka Prefecture University, 1-1 Gakuen-cho, Naka-ku, Sakai, Osaka 599-8531 (Japan); Nayak, Omnarayani; Meixner, Margaret [The Johns Hopkins University, Department of Physics and Astronomy, 366 Bloomberg Center, 3400 N. Charles Street, Baltimore, MD 21218 (United States); Sewiło, Marta [NASA Goddard Space Flight Center, 8800 Greenbelt Road, Greenbelt, MD 20771 (United States); Indebetouw, Remy [Department of Astronomy, University of Virginia, P.O. Box 400325, Charlottesville, VA 22904 (United States); Torii, Kazufumi; Ohama, Akio; Hattori, Yusuke; Yamamoto, Hiroaki; Tachihara, Kengo [Department of Physics, Nagoya University, Chikusa-ku, Nagoya 464-8602 (Japan); Minamidani, Tetsuhiro [Nobeyama Radio Observatory, 462-2 Nobeyama Minamimaki-mura, Minamisaku-gun, Nagano 384-1305 (Japan); Inoue, Tsuyoshi [Division of Theoretical Astronomy, National Astronomical Observatory (Japan); Madden, Suzanne; Lebouteiller, Vianney [Laboratoire AIM, CEA, Universite Paris VII, IRFU/Service d’Astrophysique, Bat. 709, F-91191 Gif-sur-Yvette (France); Galametz, Maud [Institute of Astronomy, University of Cambridge, Madingley Road, Cambridge CB3 0HA (United Kingdom); and others
2017-01-20
We present the ALMA Band 3 and Band 6 results of {sup 12}CO(2-1), {sup 13}CO(2-1), H30 α recombination line, free–free emission around 98 GHz, and the dust thermal emission around 230 GHz toward the N159 East Giant Molecular Cloud (N159E) in the Large Magellanic Cloud (LMC). LMC is the nearest active high-mass star-forming face-on galaxy at a distance of 50 kpc and is the best target for studing high-mass star formation. ALMA observations show that N159E is the complex of filamentary clouds with the width and length of ∼1 pc and several parsecs. The total molecular mass is 0.92 × 10{sup 5} M {sub ⊙} from the {sup 13}CO(2-1) intensity. N159E harbors the well-known Papillon Nebula, a compact high-excitation H ii region. We found that a YSO associated with the Papillon Nebula has the mass of 35 M {sub ⊙} and is located at the intersection of three filamentary clouds. It indicates that the formation of the high-mass YSO was induced by the collision of filamentary clouds. Fukui et al. reported a similar kinematic structure toward two YSOs in the N159 West region, which are the other YSOs that have the mass of ≳35 M {sub ⊙}. This suggests that the collision of filamentary clouds is a primary mechanism of high-mass star formation. We found a small molecular hole around the YSO in Papillon Nebula with a sub-parsec scale. It is filled by free–free and H30 α emission. The temperature of the molecular gas around the hole reaches ∼80 K. It indicates that this YSO has just started the distruction of parental molecular cloud.
E1-E2 interference in /sup 159/Tb(γ,n) and /sup 209/Bi(γ,n) reactions
International Nuclear Information System (INIS)
Birenbaum, Y.; Berant, Z.; Kahane, S.; Moreh, R.; Wolf, A.
1986-01-01
Angular distributions of fast neutrons from the (γ,n) reactions on /sup 159/Tb and /sup 209/Bi were measured. Gamma sources in the 7--11.4 MeV range were obtained from (n,γ) reactions using thermal neu- trons. Pronounced asymmetries around 90 0 were observed for the angular distributions of photoneu- trons leading to the ground and a few excited states, in both the spherical /sup 209/Bi and the deformed /sup 159/Tb nuclei. These asymmetries indicate strong and similar E1-E2 interference effects in the two nuclei. The direct-semidirect model was modified to be used for target nuclei with one proton outside an even-even core. From a detailed comparison of the data with calculations using the modified direct-semidirect model, the contributions of different partial waves are estimated. Contributions of the compound nucleus process are included, and are shown to affect to some extent the calculated angular distribution's energy dependence
Probing the limit of nuclear existence: Proton emission from 159Re
International Nuclear Information System (INIS)
Joss, D.T.; Darby, I.G.; Page, R.D.; Uusitalo, J.; Eeckhaudt, S.; Grahn, T.; Greenlees, P.T.; Jones, P.M.; Julin, R.; Juutinen, S.; Ketelhut, S.; Leino, M.; Leppaenen, A.-P.; Nyman, M.; Pakarinen, J.; Rahkila, P.; Saren, J.; Scholey, C.; Steer, A.; Cannon, A.J.; Stevenson, P.D.; Al-Khalili, J.S.; Ertuerk, S.; Venhart, M.; Gall, B.; Hadinia, B.; Simpson, J.
2006-01-01
The observation of the new nuclide 159 75 Re 84 provides important insights into the evolution of single-particle structure and the mass surface in heavy nuclei beyond the proton drip line. This nuclide, 26 neutrons away from the nearest stable rhenium isotope, was synthesised in the reaction 106 Cd( 58 Ni, p4n) and identified via its proton radioactivity using the ritu gas-filled separator and the great focal-plane spectrometer. Comparisons of the measured proton energy (E p =1805+/-20 keV) and decay half-life (t 1/2 =21+/-4 μs) with values calculated using the WKB method indicate that the proton is emitted from an h 11/2 state. The implications of these results for future experimental investigations into even more proton unbound nuclei using in-flight separation techniques are considered
Migowa, A N; Gatinu, B; Nduati, R W
2010-04-01
To determine adherence to oral rehydration solution (ORS) among in-patients aged 1-59 months suffering from gastroenteritis and having some dehydration (SD) or no dehydration (ND) in two rural hospitals in Kenya. Children aged 1-59 months suffering from acute gastroenteritis with (SD) or (ND) were enrolled into the study, examined and medical records reviewed. On the second and third day of follow up, children were re-examined to ascertain hydration status and care-takers interviewed. Ninety-nine children were enrolled. Forty-five (75%) of the 60 children with SD received a correct prescription for ORS but only 12 (20%) received the correct amount. Among the 39 children with ND, 23 (59%) received a correct prescription for ORS, however only 16 (41%) received the correct amount. On the 3rd day, 9 (15%) of the 60 children with SD at baseline and 2 (5%) of the 39 with ND were classified as having SD. Four in five children with SD and 6 in 10 children with ND fail to receive the correct amounts of ORS.
VizieR Online Data Catalog: NIR polarimetric study in the LMC N159/N160 field (Kim+, 2017)
Kim, J.; Jeong, W.-S.; Pyo, J.; Pak, S.; Park, W.-K.; Kwon, J.; Tamura, M.
2018-04-01
Simultaneous JHKs polarimetric observations of the N159/N160 c were performed on 2007 February 3 and 5. We used the near-infrared camera SIRIUS (Nagayama et al. 2003SPIE.4841..459N) and the polarimeter SIRPOL (Kandori et al. 2006SPIE.6269E..51K) of the Infrared Survey Facility (IRSF) 1.4 m telescope at the South African Astronomical Observatory in Sutherland, South Africa. The camera has a field of view of 7.7"x7.7" and a pixel scale of 0.45"/pixel. One set of observations for a target field consisted of 20 s exposures at 10 dithered positions for four wave-plate angles (0°, 45°, 22.5°, and 67.5°) in the J, H, and Ks bands, and the whole sequence is repeated 10 and 9 times for the N159 and N160 fields centered at (α, δ)2000=(5h39m37.1s, -69°43'45.1") and (5h40m05.6s, -69°36'25.8"), respectively. (2 data files).
Genomewide Identification of Essential Genes and Fitness Determinants of Streptococcus mutans UA159
Zeng, Lin; Culp, David J.
2018-01-01
ABSTRACT Transposon mutagenesis coupled with next-generation DNA sequencing (Tn-seq) is a powerful tool for discovering regions of the genome that are required for the survival of bacteria in different environments. We adapted this technique to the dental caries pathogen Streptococcus mutans UA159 and identified 11% of the genome as essential, with many genes encoding products required for replication, translation, lipid metabolism, and cell wall biogenesis. Comparison of the essential genome of S. mutans UA159 with those of selected other streptococci for which such information is available revealed several metabolic pathways and genes that are required in S. mutans, but not in some Streptococcus spp. We further identified genes that are essential for sustained growth in rich or defined medium, as well as for persistence in vivo in a rodent model of oral infection. Collectively, our results provide a novel and comprehensive view of the genes required for essential processes of S. mutans, many of which could represent potential targets for therapeutics. IMPORTANCE Tooth decay (dental caries) is a common cause of pain, impaired quality of life, and tooth loss in children and adults. It begins because of a compositional change in the microorganisms that colonize the tooth surface driven by repeated and sustained carbohydrate intake. Although several bacterial species are associated with tooth decay, Streptococcus mutans is the most common cause. Therefore, it is important to identify biological processes that contribute to the survival of S. mutans in the human mouth, with the aim of disrupting the processes with antimicrobial agents. We successfully applied Tn-seq to S. mutans, discovering genes that are required for survival, growth, and persistence, both in laboratory environments and in a mouse model of tooth decay. This work highlights new avenues for the control of an important human pathogen. PMID:29435491
International Nuclear Information System (INIS)
Im, Dong-Won; Kim, Tae-O; Jung, Ha Yun; Oh, Ji Eun; Lee, Se Jin; Heo, Yong-Seok
2011-01-01
The RNA polymerase domain of primase from S. mutans strain UA159 was cloned, overexpressed, purified and crystallized. X-ray diffraction data were collected to a resolution of 1.60 Å. Primase is the enzyme that synthesizes RNA primers on single-stranded DNA during normal DNA replication. In this study, the catalytic core domain of primase from Streptococcus mutans UA159 was overexpressed in Escherichia coli, purified and crystallized. Diffraction data were collected to 1.60 Å resolution using a synchrotron-radiation source. The crystal belonged to space group P4 1 or P4 3 , with unit-cell parameters a = b = 52.63, c = 110.31 Å. The asymmetric unit is likely to contain one molecule, with a corresponding V M of 1.77 Å 3 Da −1 and a solvent content of 30.7%
Somyong, Suthasinee; Poopear, Supannee; Sunner, Supreet Kaur; Wanlayaporn, Kitti; Jomchai, Nukoon; Yoocha, Thippawan; Ukoskit, Kittipat; Tangphatsornruang, Sithichoke; Tragoonrung, Somvong
2016-06-01
Oil palm (Elaeis guineesis Jacq.) is the most productive oil-bearing crop, yielding more oil per area than any other oil-bearing crops. However, there are still efforts to improve oil palm yield, in order to serve consumer and manufacturer demand. Oil palm produces female and male inflorescences in an alternating cycle. So, high sex ratio (SR), the ratio of female inflorescences to the total inflorescences, is a favorable trait in term of increasing yields in oil palm. This study aims to understand the genetic control for SR related traits, such as fresh fruit bunch yield (FFB), by characterizing genes at FFB quantitative trait loci (QTLs) on linkage 10 (chromosome 6) and linkage 15 (chromosome 10). Published oil palm sequences at the FFB QTLs were used to develop gene-based and simple sequence repeat (SSR) markers. We used the multiple QTL analysis model (MQM) to characterize the relationship of new markers with the SR traits in the oil palm population. The RNA expression of the most linked QTL genes was also evaluated in various tissues of oil palm. We identified EgACCO1 (encoding aminocyclopropane carboxylate (ACC) oxidase) at chromosome 10 and EgmiR159a (microRNA 159a) at chromosome 6 to be the most linked QTL genes or determinants for FFB yield and/or female inflorescence number with a phenotype variance explained (PVE) from 10.4 to 15 % and suggest that these play the important roles in sex determination and differentiation in oil palm. The strongest expression of EgACCO1 and the predicted precursor of EgmiR159a was found in ovaries and, to a lesser extent, fruit development. In addition, highly normalized expression of EgmiR159a was found in female flowers. In summary, the QTL analysis and the RNA expression reveal that EgACCO1 and EgmiR159a are the potential genetic factors involved in female flower determination and hence would affect yield in oil palm. However, to clarify how these genetic factors regulate female flower determination, more investigation
International Nuclear Information System (INIS)
Kim, Tae-O; Im, Dong-Won; Jung, Ha Yun; Kwon, Seong Jung; Heo, Yong-Seok
2012-01-01
Enoyl-acyl carrier protein reductase (FabK) from S. mutans strain UA159 was cloned, overexpressed, purified and crystallized. X-ray diffraction data were collected to a resolution of 2.40 Å. A triclosan-resistant flavoprotein termed FabK is the sole enoyl-acyl carrier protein reductase in Streptococcus pneumoniae and Streptococcus mutans. In this study, FabK from S. mutans strain UA159 was overexpressed in Escherichia coli, purified and crystallized. Diffraction data were collected to 2.40 Å resolution using a synchrotron-radiation source. The crystal belonged to space group P6 2 , with unit-cell parameters a = b = 105.79, c = 44.15 Å. The asymmetric unit contained one molecule, with a corresponding V M of 2.05 Å 3 Da −1 and a solvent content of 39.9%
Public health implications of radioluminous materials
International Nuclear Information System (INIS)
Moghissi, A.A.; Carter, M.W.
1975-07-01
The safety, efficacy, and relative merits of radium, tritium, and promethium in radioluminous materials, particularly as used in the dial paint of timepieces and instruments, were evaluated. The reduced use of radium in recent years is reflected in estimates of the population dose for 1973--3600 person-rem from 24 million tritium watches versus 2500 person-rem from 8.4 million radium clocks. Had radium still been used in watches, the dose could have been significantly higher. No reliable data are available on the activity of promethium used for this purpose. Assuming a minimum dose of 6100 person-rem from all these radionuclides, an average of 0.03 mrem/year is estimated for the U.S. population. Because of the unavoidable radiation hazard, it is recommended that radium no longer be used in radioluminous materials. Furthermore, the 'frivolous' use of other radionuclides for this purpose should be discouraged
The 4-fold fission in 40Ar + 209Bi, 197Au and 159Tb reactions at 25MeV/u
International Nuclear Information System (INIS)
Dai, G.X.; Wu, H.Y.; He, Z.Y.; Luo, Q.Z.; Duan, L.M.; Zhang, B.G.; Qi, Y.J.; Li, Z.Y.; Jin, G.M.; Wen, W.X.
1995-01-01
The paper presents the 4-fold fission or fragmentation of hot nuclei produced in 25MeV/u 40 Ar+ 209 Bi, 197 Au and 159 Tb reactions. The events with 4 massive fragments emitted with angles larger than 36 were detected by 8 PPACs with area of 25x20cm 2 . The TKE, distributions of mass and velocity for the four fragments have been obtained. ((orig.))
(Vapour+liquid) equilibria of {xCH3Cl+(1-x)HCl} at temperatures (159.01 and 182.33) K
International Nuclear Information System (INIS)
Senra, A.M.P.; Fonseca, I.M.A.; Lobo, L.Q.
2005-01-01
VLE for (CH 3 Cl+HCl) has been experimentally determined at temperatures (159.01 and 182.33) K, using a static; method. The data were used to calculate the molar excess Gibbs energy at the two temperatures. The excess molar enthalpy estimated from the G m E values for the equimolar mixture is relatively large and negative: H m E =-(1011+/-318) J.mol -1 . The results have been compared with estimates from the chemical theory of solutions
International Nuclear Information System (INIS)
Hernandez Torres, Jorge; Maldonado, Monica Alexandra Arias; Chomilier, Jacques
2007-01-01
The evolutionary origin of some nuclear encoded proteins that translocate proteins across the chloroplast envelope remains unknown. Therefore, sequences of GTPase proteins constituting the Arabidopsis thaliana translocon at the outer membrane of chloroplast (atToc) complexes were analyzed by means of HCA. In particular, atToc159 and related proteins (atToc132, atToc120, and atToc90) do not have proven homologues of prokaryotic or eukaryotic ancestry. We established that the three domains commonly referred to as A, G, and M originate from the GTPase G domain, tandemly repeated, and probably evolving toward an unstructured conformation in the case of the A domain. It resulted from this study a putative common ancestor for these proteins and a new domain definition, in particular the splitting of A into three domains (A1, A2, and A3), has been proposed. The family of Toc159, previously containing A. thaliana and Pisum sativum, has been extended to Medicago truncatula and Populus trichocarpa and it has been revised for Oryza sativa. They have also been compared to GTPase subunits involved in the cpSRP system. A distant homology has been revealed among Toc and cpSRP GTP-hydrolyzing proteins of A. thaliana, and repetitions of a GTPase domain were also found in cpSRP protein receptors, by means of HCA analysis
International Nuclear Information System (INIS)
Byrski, T.; Beck, F.A.; Sharpey-Schafer, J.F.
1987-01-01
High-spin states of 159,160 Yb have been studied using the escape-suppressed array TESSA 2. Extensions of yrast and lateral bands have been found up to I ∼40. Experimental data suggest strong correlations between maximum alignment configurations of the valence nucleons and related collective states. Theoretical analysis fully supports the idea of prolate-collective vs. oblate-non-collective correlations. Band termination interpretation is discussed
Chaman, Reza; Alami, Ali; Emamian, Mohammad Hassan; Naieni, Kourosh Holakouie; Mirmohammadkhani, Majid; Ahmadnezhad, Elham; Entezarmahdi, Rasool; Shati, Mohsen; Shariati, Mohammad
2012-12-01
The aim of the study was to evaluate potential risk factors of children mortality between 1-59 months of age. This nested case-control study was conducted among children born from June 1999 to March 2009 in rural areas of Shahroud, located in the central region of Iran using health care visit reports and follow-up data available in household health records. MORTALITY WAS SIGNIFICANTLY ASSOCIATED WITH BREASTFEEDING DURATION (OR: 0.87, 95% CI: 0.81-0.93), total health care visits (OR: 0.90, 95% CI: 0.83-0.98) and low birth weight (LBW) (OR: 7.38, 95% CI: 1.37-39.67). In our study, a longer breastfeeding period and more frequent health care visits were two important protective factors, while LBW was an important risk factor for 1-59 month child mortality. It seems, that complex and multiple factors may be involved in mortality of under 5-year-old children, so combined efforts would be necessary to improve child health indicators.
Directory of Open Access Journals (Sweden)
Bisyuk Yu.A.
2015-05-01
Full Text Available Introduction. The refractory asthma refers to the phenotype, which is characterized by severe persistent course with frequent exacerbations and resistance to corticosteroid therapy. This phenotype of asthma can be related to C159T polymorphism of CD14 receptor gene Material and methods. There were studied the C159T polymorphism of CD14 gene in 331 patients with bronchial asthma. The control group consisted of 285 healthy individuals of Crimea. The C159T gene polymorphism of CD14 was detected by allele-specific polymerase chain reaction with electrophoretic detection. The distribution of genotypes was checked according to the law of the Hardy-Weinberg equilibrium by using Fisher's exact test and χ2. There was used logistic regression to determine the difference in the frequency of genotypes and alleles. Results and discussion. In our study have been identified 291 patients with corticosteroid-sensitive and 40 with refractory asthma. The genotype distribution of control (CC – 34%, CT – 51%, CT – 15% and patients with corticosteroid-sensitive asthma (CC – 29%, CT – 53%, CT – 18% were in accordance with the law of Hardy- Weinberg equilibrium and did not significantly differ (χ2 = 2.204, P = 0.332. There were no significant differences when comparing the allele and genotype frequencies by using risk allele T and C model. In the control group the frequency distribution of genotypes CC – 34%, CT – 51%, TT – 15% did not differ significantly (χ2 = 3.540, P = 0.170 from refractory asthma (CC – 52%, CT – 35%, CT – 13%. The risk analysis for the T allele showed that the frequency of CT+TT genotype in patients with refractory asthma (49% was significantly lower (OR = 0.467, CI = [0.240-0.910], χ2 = 5.17, p = 0.023 compere to control (66 %. In turn, the difference of allelic frequencies for the control and patients with persistent asthma did not differ significantly (p = 0.076. The content of antiendotoxin antibody of class A in
State of the art of cardiac pacemaker technology
International Nuclear Information System (INIS)
Lambeck, R.
1978-01-01
The development of cardiac pacemakers from fixed-frequency to demand pacemakers is reviewed. The latter is described in more detail with regard to its energy sources and its design. The use of radioactive energy sources is illustrated by the example of 238 Pu and 147 promethium and a comparison of the two radiation sources. (AJ) 891 AJ [de
Nuclear structure from radioactive decay
International Nuclear Information System (INIS)
Wood, J.L.
1991-01-01
This report discusses nuclear structure from radioactive decay of the following: Neutron-Deficient Iridium Isotopes; Neutron-Deficient Platinum Isotopes; Neutron-Deficient Gold Isotopes; Neutron-Deficient Mercury Isotopes; Neutron-Deficient Thallium Isotopes; Neutron-Deficient Lead Isotopes; Neutron-Deficient Samarium Isotopes; Neutron-Deficient Promethium Isotopes; Neutron-Deficient Neodymium Isotopes; and Neutron-Deficient Praseodymium Isotopes. Also discussed are Nuclear Systematics and Models
10 CFR 32.55 - Same: Quality assurance; prohibition of transfer.
2010-01-01
...; prohibition of transfer. (a) Each person licensed under § 32.53 shall visually inspect each device and shall... promethium-147. (b) Each person licensed under § 32.53 shall take a random sample of the size required by the... subject each unit in the sample to the following tests: (1) Each device shall be immersed in 30 inches of...
Insights into the 1.59-Mbp largest plasmid of Azospirillum brasilense CBG497.
Acosta-Cruz, Erika; Wisniewski-Dyé, Florence; Rouy, Zoé; Barbe, Valérie; Valdés, María; Mavingui, Patrick
2012-09-01
The plant growth-promoting proteobacterium Azospirillum brasilense enhances growth of many economically important crops, such as wheat, maize, and rice. The sequencing and annotation of the 1.59-Mbp replicon of A. brasilense CBG497, a strain isolated from a maize rhizosphere grown on an alkaline soil in the northeast of Mexico, revealed a GC content of 68.7 % and the presence of 1,430 potential protein-encoding genes, 1,147 of them classified into clusters of orthologous groups categories, and 16 tRNA genes representing 11 tRNA species. The presence of sixty-two genes representatives of the minimal gene set and chromid core genes suggests its importance in bacterial survival. The phaAB → G operon, reported as involved in the bacterial adaptation to alkaline pH in the presence of K(+), was also found on this replicon and detected in several Azospirillum strains. Phylogenetic analysis suggests that it was laterally acquired. We were not able to show its inference on the adaptation to basic pH, giving a hint about the presence of an alternative system for adaptation to alkaline pH.
Kinetics of promethium-147 in a simulated pond
International Nuclear Information System (INIS)
Shang Zhaorong
1995-03-01
The dynamic behaviour of 147 Pm in a simulated aquatic ecosystem which consists of water, soil and aquatic lives. The results are as follows: The accumulation of 147 Pm in the ecosystem can be expressed by an exponential function; the aquatic plants have the highest capacity of concentration of 147 Pm, they can be used as bio-monitors and cleaning agents of contamination of 147 Pm in water; the absorption of 147 Pm by cardio is few, and the most of it accumulates in bone; 147 Pm in soil has little penetrability, and about 80% of it accumulates within 1 cm of top soil. (10 refs., 1 fig., 5 tabs.)
Energy Technology Data Exchange (ETDEWEB)
Fradin, J; Hayoun, C [Commissariat a l' Energie Atomique, 91 - Saclay (France). Centre d' Etudes Nucleaires
1969-07-01
This installation has been designed and built for producing sealed sources of fission elements: caesium 137, strontium 90, promethium 147, ruthenium 106 and cerium 144 in particular. The installation consists of sealed and protected cells, each being assigned to a particular production. The safety and the operational reliability of the equipment are the principal considerations which have governed this work. The report describes the installation and, in particular, the apparatus used as well as the various control devices. In conclusion, a review as presented of six years operation. (authors) [French] Cette installation a ete concue et realisee pour effectuer des fabrications de sources scellees d'elements de fission: caesium 137 - strontium 90 - promethium 147 - ruthenium 106 - cerium 144 en particulier. L'installation est composee de cellules etanches et protegees, chacune d'elles etant affectee a une fabrication particuliere. La securite et la surete de fonctionnement de l'ensemble sont parmi les elements principaux qui ont guide l'etude. Le rapport decrit l'installation et plus particulierement l'appareillage utilise ainsi que les divers controles et commandes. Le bilan de fonctionnement apres 6 ans d'exploitation sert de conclusion. (auteurs)
Energy Technology Data Exchange (ETDEWEB)
Fradin, J.; Hayoun, C. [Commissariat a l' Energie Atomique, 91 - Saclay (France). Centre d' Etudes Nucleaires
1969-07-01
This installation has been designed and built for producing sealed sources of fission elements: caesium 137, strontium 90, promethium 147, ruthenium 106 and cerium 144 in particular. The installation consists of sealed and protected cells, each being assigned to a particular production. The safety and the operational reliability of the equipment are the principal considerations which have governed this work. The report describes the installation and, in particular, the apparatus used as well as the various control devices. In conclusion, a review as presented of six years operation. (authors) [French] Cette installation a ete concue et realisee pour effectuer des fabrications de sources scellees d'elements de fission: caesium 137 - strontium 90 - promethium 147 - ruthenium 106 - cerium 144 en particulier. L'installation est composee de cellules etanches et protegees, chacune d'elles etant affectee a une fabrication particuliere. La securite et la surete de fonctionnement de l'ensemble sont parmi les elements principaux qui ont guide l'etude. Le rapport decrit l'installation et plus particulierement l'appareillage utilise ainsi que les divers controles et commandes. Le bilan de fonctionnement apres 6 ans d'exploitation sert de conclusion. (auteurs)
Energy Technology Data Exchange (ETDEWEB)
Canale, Cristiane Lopes de Almeida; Arruda, Jose Eduardo; Miocque, Andre [VICEL, Rio das Ostras, RJ (Brazil)
2008-07-01
In response to the constant increase of the marine environment destruction, due to the exploration of its natural resources, several important international conventions have been edited since the years 60's aiming to improve the control of the pollution in the oceans. Annex IV of MARPOL 73/78 (The international Convention for the Prevention of Pollution from Ships) issued by the International Maritime Organization (IMO) entered in force in August 1st, 2005 establishing international rules for controlling the pollution caused by human sewage discharged from ships and offshore platforms. The rules established by IMO Resolutions go through constant improvements due to frequent innovations on technology, science and politics. Brazil as one of the MARPOL 73/78 Convention signatory countries, applies all the rules determined in this Convention through specific legislation. In October 2006 the IMO Marine Environment Protection Committee established the new resolution MEPC.159 (55) amending the parameters of sewage analysis and the performance tests for Sewage Treatment Units to be installed on board ships and offshore platforms from January 1st 2010, with the purpose to reduce the parameters of the pollution caused by human sewage discharge on board ships and offshore platforms. (author)
Identification of Radiation Sources in a Peacetime Environment
1998-04-01
Radionuclides in Medicine, Research, and Industry (continued) Isotope Symbol Polonium - 210 Po- 210 Promethium-147 Pr-147 Radium-226 Ra-226 Selenium-75 Se...equip- ment seen in a nuclear medicine department or nuclear pharmacy, radia- tion therapy sources, industrial food irradiation facilities, and small... Food Irradiator 28 Commercial Irradiator Facility 28 Appendix 1. Commonly Used Radionuclides in Medicine, Research, and Industry 29 General
Rietveld refinement of the mixed boracite Fe1.59Zn1.41B7O13Br
Directory of Open Access Journals (Sweden)
Sandra Ulloa-Godínez
2009-11-01
Full Text Available The structural characterization of the new iron–zinc heptaborate bromide with composition Fe1.59Zn1.41B7O13Br, prepared by chemical transport is reported. A rigid-body model with constrained generalized coordinates was defined in order to hold the positions of the B atoms at reasonable interatomic distances that typically would reach unacceptable values because of the weak scattering power of boron. There are three independent sites for the B atoms of which two are tetrahedrally coordinated. The bond-valence sum around the third B atom, located on a threefold rotation axis, was calculated considering two cases of coordination of boron with oxygens: trigonal-planar and tetrahedral. The contribution of the fourth O atom to the bond-valence sum was found to be only 0.06 v.u., indicating the presence of a very weak bond in the right position to have a distorted tetrahedral coordination in favour of the trigonal-planar coordination for the third B atom. X-ray fluorescence (XRF was used to determinate the Fe/Zn ratio.
Rietveld refinement of the mixed boracite Fe(1.59)Zn(1.41)B(7)O(13)Br.
Ulloa-Godínez, Sandra; Rosales, Ivonne; Bucio, Lauro; Farías, Mario H; Campa-Molina, Jorge
2009-10-31
The structural characterization of the new iron-zinc hepta-borate bromide with composition Fe(1.59)Zn(1.41)B(7)O(13)Br, prepared by chemical transport is reported. A rigid-body model with constrained generalized coordinates was defined in order to hold the positions of the B atoms at reasonable inter-atomic distances that typically would reach unacceptable values because of the weak scattering power of boron. There are three independent sites for the B atoms of which two are tetra-hedrally coordinated. The bond-valence sum around the third B atom, located on a threefold rotation axis, was calculated considering two cases of coordination of boron with oxygens: trigonal-planar and tetrahedral. The contribution of the fourth O atom to the bond-valence sum was found to be only 0.06 v.u., indicating the presence of a very weak bond in the right position to have a distorted tetra-hedral coordination in favour of the trigonal-planar coordination for the third B atom. X-ray fluorescence (XRF) was used to determinate the Fe/Zn ratio.
International Nuclear Information System (INIS)
Miyano, M.H.
1990-01-01
Solid state compounds involving Ln and DMBP, where Ln trivalent lanthanides (except promethium) and yttrium; DMBP 4-dimethyl amino benzylidene pyruvate, were prepared by addition of ligand to the corresponding metal ions chlorides, both in aqueous solution. The precipitates were washed with distilled water and dried at 40 0 C in a forced circulation oven. Complexometry with EDTA, thermogravimetry (TG), differential thermal analysis (DTA), infra-red absorption and X-ray diffraction have been used in the study of these compounds. (author)
Sorption and chromatographic techniques for processing liquid waste of nuclear fuel cycle
International Nuclear Information System (INIS)
Gelis, V.M.; Milyutin, V.V.; Chuveleva, E.A.; Maslova, G.B.; Kudryavtseva, S.P.; Firsova, L.A.; Kozlitin, E.A.
2000-01-01
In the spent nuclear fuel processing procedures the significant quantity of high level liquid waste containing long-lived high toxic radionuclides of cesium, strontium, promethium, americium, curium, etc. is generated. Separation of those radionuclides from the waste not merely simplifies the further safe waste handling but also reduces the waste processing operation costs due to the market value of certain individual radionuclide preparations. Recovery and separation of high grade pure long-lived radionuclide preparations is frequently performed by means of chromatographic techniques. (authors)
Casualty Estimation for Nuclear and Radiological Weapons
2016-06-01
rate 2.69 d β Metal Polonium - 210 210Po Static eliminators 138 d α Metal foil Radium-226 226Ra Brachytherapy - low dose rate 1600 y α Salt...Promethium-147 153Gd Gadolinium-153 169Yb Ytterbium-169 170Tm Thulium-170 192Ir Iridium-192 210Po Polonium - 210 226Ra Radium-226 238Pu Plutonium-238...Brussels: NATO, in development). iv present in a large food irradiator facility, and constitutes about 34.5 kg of 137Cs. To illustrate alternative
Surface-ionization ion source designed for in-beam operation with the BEMS-2 isotope separator
International Nuclear Information System (INIS)
Bogdanov, D.D.; Voboril, J.; Demyanov, A.V.; Karnaukhov, V.A.; Petrov, L.A.
1976-01-01
A surface-ionization ion source designed to operate in combination with the BEMS-2 isotope separator in a heavy ion beam is described. The ion source is adjusted for the separation of rare-earth elements. The separation efficiency for 150 Dy is determined to be equal to about 20% at the ionizer temperature of 2600 deg K. The hold-up times for praseodymium, promethium and dysprosium in the ion source range from 5 to 10 sec at the ionizer temperature of 2500-2700 deg K
Methods radiation protection data sheets for the use radionuclides in unsealed sources
International Nuclear Information System (INIS)
Anon.
1999-01-01
These radiation protection data sheets are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to safety in this field. They contain the essential radiation protection data for the use of radionuclides in unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: bromine 82, cobalt 58, cobalt 60, manganese 54, mercury 197, mercury 203, promethium 147, xenon 133 and ytterbium 169. (O.M.)
International Nuclear Information System (INIS)
Martinelli, P.
1960-01-01
The process for analysing and measuring the thickness of deposits by β-X fluorescence which we have already described has undergone further development. The use of promethium-147 and krypton-85 sources makes it possible to reduce the background noise which is observed with strontium-90. We present the results obtained for various measurements of the thickness of metallic coatings and the continuous measurement of calcium and of iron in ore samples. We describe the tests carried out with a view to analysing the X-rays by means of a crystal. (author) [fr
International Nuclear Information System (INIS)
Tekuchev, V.V.; Barashkov, B.I.; Rygalov, L.N.; Dolzhikov, Yu.S.
2001-01-01
For the first time one obtained the polytherms of ultrasound velocity for liquid high-melting metals within wide temperature range. In terms of the rigid sphere model on the basis of the acoustic data one calculated the entropy values for 34 liquid metals at the melting point. The average discrepancy of the calculated values of entropy with the published one constitutes 8.2%. With increase of metal valency the error increases from 2.8 up to 13%. In case of francium, radium, promethium, actinium, hafnium, polonium, rhenium one obtained data for the first time [ru
Installation for producing sealed radioactive sources
International Nuclear Information System (INIS)
Fradin, J.; Hayoun, C.
1969-01-01
This installation has been designed and built for producing sealed sources of fission elements: caesium 137, strontium 90, promethium 147, ruthenium 106 and cerium 144 in particular. The installation consists of sealed and protected cells, each being assigned to a particular production. The safety and the operational reliability of the equipment are the principal considerations which have governed this work. The report describes the installation and, in particular, the apparatus used as well as the various control devices. In conclusion, a review as presented of six years operation. (authors) [fr
Mpakopoulou, Maria; Brotis, Alexandros G; Gatos, Haralampos; Paterakis, Konstantinos; Fountas, Kostas N
2012-01-01
The aim of this study was to present our 10-year experience with the use of fixed-pressure and programmable valves in the treatment of adult patients requiring cerebrospinal fluid (CSF) diversion. Patients (n = 159; 89 male and 70 female) suffering from hydrocephalus of various causes underwent CSF shunt implantation. Forty fixed-pressure and 119 programmable valves were initially implanted. The observed revision rate was 40% in patients with fixed-pressure valves. In 20% of these patients, a revision due to valve mechanism malfunction was undertaken, and the initial valve was replaced with a programmable one. The revision rate in the adjustable-pressure valve subgroup was 20%. The infection rate for the fixed-pressure and programmable valve subgroups were 3%, and 1.7%, respectively. Similarly, subdural fluid collections were noticed in 17% and 4% of patients with fixed-pressure valves and programmable valves, respectively. The revision and over-drainage rates were significantly lower when using programmable valves, and thus, this type of valve is preferred whenever CSF has to be diverted.
Cai, Jian-Na; Kim, Mi-A; Jung, Ji-Eun; Pandit, Santosh; Song, Kwang-Yeob; Jeon, Jae-Gyu
2015-01-01
Despite the widespread use of fluoride, dental caries, a biofilm-related disease, remains an important health problem. This study investigated whether oleic acid, a monounsaturated fatty acid, can enhance the effect of fluoride on extracellular polysaccharide (EPS) formation by Streptococcus mutans UA159 biofilms at sub-minimum inhibitory concentration levels, via microbiological and biochemical methods, confocal fluorescence microscopy, and real-time PCR. The combination of oleic acid with fluoride inhibited EPS formation more strongly than did fluoride or oleic acid alone. The superior inhibition of EPS formation was due to the combination of the inhibitory effects of oleic acid and fluoride against glucosyltransferases (GTFs) and GTF-related gene (gtfB, gtfC, and gtfD) expression, respectively. In addition, the combination of oleic acid with fluoride altered the bacterial biovolume of the biofilms without bactericidal activity. These results suggest that oleic acid may be useful for enhancing fluoride inhibition of EPS formation by S. mutans biofilms, without killing the bacterium.
African Journals Online (AJOL)
User
Short branched e.g. xanxan gum, and guar gum. - Branch ... carbohydrates, flavonoids terpenoids, amino acid, saponins, oil .... is a branched molecule with the main chain consisting of 1, 3- .... children and adolescent cholesterol and diabetes.
Elastic and Raman scattering of 8.5-11.4 MeV photons from 159Tb, 165Ho, and 237Np
International Nuclear Information System (INIS)
Bar-Noy, T.; Moreh, R.
1977-01-01
Differential cross sections for elastic and inelastic Raman scattering from the deformed heavy nuclei 159 Tb, 165 Ho and 237 Np were measured at five energies between 8.5 and 11.4 MeV. Angular distributions at four angles between 90 0 and 140 0 for both elastic and inelastic scattering at 9.0 and 11.4 MeV were also measured. The monoenergetic photons were obtained from thermal neutron capture in Ni and Cr. All the angular distributions and the elastic and Raman scattering at the higher energies are in good overall agreement with theoretical predictions. The theory is based on a modified simple rotator model of the giant resonance in which the effect of Delbrueck scattering was included. A trend of both the elastic and Raman scattering at lower energies to be stronger than expected are suggested by the data. However, the ratio between the Raman and elastic scattering seem to be in good agreement with theory throughout the whole energy range. This shows that there is no need to introduce a direct nonresonant component to the imaginary part of the elastic scattering amplitude to explain the experimental data. (Auth.)
A method for atomic spectroscopy of highly charged ions in the Pm isoelectronic sequence
International Nuclear Information System (INIS)
Andersson, Oe.
1995-08-01
The aim was to search for alkali-like spectra in the Promethium isoelectronic sequence. Pb 22+ ions were produced by means of an ECR-ion source and accelerated towards a target of He gas. Colliding with He atoms the Pb 22+ ions are likely to capture an electron, thus forming an excited Pm-like ion (Pb 21+ ). A 2 m grazing-incidence spectrometer was used for recording the spectra arising as the accelerated ions impinge on the target. No lines were recorded throughout the wavelength region where the spectrometer is sensitive. Further experiments are needed to make clear if this is due to experimental errors or not. 14 refs, 8 figs
African Journals Online (AJOL)
boaz
petroleum ether extract showed activity only on the fungal isolate C. albicans. The study demonstrated ... In addition to natural ..... essential oils from Origanum, Thymbra and Satureja species with ... protein from Moringa seeds". Colloids and.
International Nuclear Information System (INIS)
Ellis, D.G.; Curtis, L.J.
1982-01-01
Term values and ionization potentials have been calculated for several ions in the promethium (N = 61) isoelectronic sequence. As the nuclear charge is increased, the ground configuration changes from 4f 13 5s 2 to 4f 14 5s giving the upper portion of the sequence an alkali-like character. According to our most recent Hartree-Fock calculations with first-order relativistic corrections, the ground term is 5s 2 S for Z > 77 (Ir XVII) and the first excited term is 5p 2 P 0 for Z > 84 (P 0 XXIV). Comparisons are made with calculations of Cowan in W XIV. The prospects for observation of these spectra in fast ion beams are discussed. (orig.)
A method for atomic spectroscopy of highly charged ions in the Pm isoelectronic sequence
Energy Technology Data Exchange (ETDEWEB)
Andersson, Oe
1995-08-01
The aim was to search for alkali-like spectra in the Promethium isoelectronic sequence. Pb{sup 22+} ions were produced by means of an ECR-ion source and accelerated towards a target of He gas. Colliding with He atoms the Pb{sup 22+} ions are likely to capture an electron, thus forming an excited Pm-like ion (Pb{sup 21+}). A 2 m grazing-incidence spectrometer was used for recording the spectra arising as the accelerated ions impinge on the target. No lines were recorded throughout the wavelength region where the spectrometer is sensitive. Further experiments are needed to make clear if this is due to experimental errors or not. 14 refs, 8 figs.
Acoustic study of the characteristic temperature of metals
International Nuclear Information System (INIS)
Tekuchev, V.V.; Rygalov, L.N.; Ivanova, I.V.; Barashkov, B.I.
2000-01-01
The calculation of the Debye temperature for 64 metals, including Be, La, Mo, W, Os, Ni, Cd, In, Ta, U, Sc, Cs, Sr, Ce, Pr, Nd, Pm, Sm, Eu, Gd, Dy, Ho, Er, Yb, Lu, Th is carried out. The data on polonium and promethium are obtained for the first time. The calculation is performed with application of ultrasound velocity value at the melting temperature of the given metal. The average derivation of the calculational data on the Debye temperature from the published ones equals 12%. It is noted, that application of the acoustic method for determination of the characteristic temperature makes it possible to solve the wide range of theoretical and applied problems [ru
International Nuclear Information System (INIS)
Manpreet Kaur; Singh, BirBikram
2016-01-01
The heavy ion induced reactions lead to the formation of composite systems, which subsequently decay because of high excitation energy and angular momentum. The study of decaying composite system facilitates to explore the number of nuclear characteristics and the reaction dynamics. The medium mass composite systems 164 Yb*, 176,182,188,196 Pt* and 200,202 Pb* have been studied successfully within the framework of dynamical cluster decay model (DCM). These studies show the emission of light particles, LP (or evaporation residues, ER), intermediate mass fragments, IMF, heavy mass fragments, HMF and symmetric fragments, SF along with signatures of quasi-fission, qf, process in their decay path. The decay of medium mass composite system 179 Re* has also been studied within DCM. In the present work, we investigate the comparative decay of two medium mass composite systems 179 Re* and 189 Au formed in the reactions with same projectile ( 20 Ne) having same E lab (or same E/A) on two different targets 159 Tb and 169 Tm, for which the experimental data is available
Kokou, Vonor; Nidain, Maneh; Kassoula, Nononsaa Batomguela; Kwassi, Fiaty- Amenouvor; Meba, Banla; Patrice, Balo Komi
2016-01-01
Introduction Le but de l’étude était décrire les aspects épidémiologiques des conjonctivites néonatales dans le canton de Glidji au Sud du Togo. Methodes Nous avons mené une étude transversale dans les 4 Unités Sanitaires Périphériques du canton de Glidji du 19 Mars au 13 Mai 2009 soit 8 semaines. Tous les nouveau-nés ont été inclus et la conjonctivite néonatale était définie par la présence chez un nouveau-né d'au moins deux des signes suivants: hyperhémie conjonctivale, œdème palpébral, chémosis, sécrétions purulentes, larmoiement. Les paramètres étudiés étaient l’âge, le sexe, les facteurs de risque, les antécédents, la présence ou non de conjonctivite, les germes en causes et l’évolution sous traitement. Resultats Sur la période, 159 nouveau-nés ont été examinés. L’âge moyen était de 10,9 jours avec des extrêmes de 0 à 28 jours. Il y avait 80 garçons pour 79 filles soit un sex-ratio de 1,01. Sur les 159 nouveau-nés, 7 cas de conjonctivite ont été diagnostiqués soit une prévalence de 4,4%. Les facteurs de risque identifiés étaient l'accouchement par voie basse et la présence d'IST chez la mère pendant la grossesse. Sur les 7 cas de conjonctivite, l'examen cytobactériologique a permis d'isoler le staphylococcus aureus dans 2 cas. L’évolution des cas de conjonctivite sous traitement était favorable avec régression des signes dès le 3è jour. Conclusion Les conjonctivites néonatales avaient une prévalence de 4,4% dans le canton de Glidji au sud du Togo et le staphylocoque doré était le germe en cause. Leur prévention passe par un bon suivi lors de la consultation prénatale et l'instillation de collyre antibiotique à la naissance PMID:27642383
Directory of Open Access Journals (Sweden)
Haq Qazi MR
2010-10-01
Full Text Available Abstract Background Tomato leaf curl virus (ToLCV, a constituent of the genus Begomovirus, infects tomato and other plants with a hallmark disease symptom of upward leaf curling. Since microRNAs (miRs are known to control plants developmental processes, we evaluated the roles of miRNAs in Tomato leaf curl New Delhi virus (ToLCNDV induced leaf curling. Results Microarray analyses of miRNAs, isolated from the leaves of both healthy and ToLCNDV agroinfected tomato cv Pusa Ruby, revealed that ToLCNDV infection significantly deregulated various miRNAs representing ~13 different conserved families (e.g., miR319, miR172, etc.. The precursors of these miRNAs showed similar deregulated patterns, indicating that the transcription regulation of respective miRNA genes was perhaps the cause of deregulation. The expression levels of the miRNA-targeted genes were antagonistic with respect to the amount of corresponding miRNA. Such deregulation was tissue-specific in nature as no analogous misexpression was found in flowers. The accumulation of miR159/319 and miR172 was observed to increase with the days post inoculation (dpi of ToLCNDV agroinfection in tomato cv Pusa Ruby. Similarly, these miRs were also induced in ToLCNDV agroinfected tomato cv JK Asha and chilli plants, both exhibiting leaf curl symptoms. Our results indicate that miR159/319 and miR172 might be associated with leaf curl symptoms. This report raises the possibility of using miRNA(s as potential signature molecules for ToLCNDV infection. Conclusions The expression of several host miRNAs is affected in response to viral infection. The levels of the corresponding pre-miRs and the predicted targets were also deregulated. This change in miRNA expression levels was specific to leaf tissues and observed to be associated with disease progression. Thus, certain host miRs are likely indicator of viral infection and could be potentially employed to develop viral resistance strategies.
Osinga, Rik; Babst, Doris; Bodmer, Elvira S; Link, Bjoern C; Fritsche, Elmar; Hug, Urs
2017-12-01
This work assessed both subjective and objective postoperative parameters after breast reduction surgery and compared between patients and plastic surgeons. After an average postoperative observation period of 6.7 ± 2.7 (2 - 13) years, 159 out of 259 patients (61 %) were examined. The mean age at the time of surgery was 37 ± 14 (15 - 74) years. The postoperative anatomy of the breast and other anthropometric parameters were measured in cm with the patient in an upright position. The visual analogue scale (VAS) values for symmetry, size, shape, type of scar and overall satisfaction both from the patient's and from four plastic surgeons' perspectives were assessed and compared. Patients rated the postoperative result significantly better than surgeons. Good subjective ratings by patients for shape, symmetry and sensitivity correlated with high scores for overall assessment. Shape had the strongest influence on overall satisfaction (regression coefficient 0.357; p reduction surgery, long-term outcome is rated significantly better by patients than by plastic surgeons. Good subjective ratings by patients for shape, symmetry and sensitivity correlated with high scores for overall assessment. Shape had the strongest influence on overall satisfaction, followed by symmetry and sensitivity of the breast. Postoperative size of the breast, resection weight, type of scar, age or BMI was not of significant influence. Symmetry was the only assessed subjective parameter of this study that could be objectified by postoperative measurements. Georg Thieme Verlag KG Stuttgart · New York.
Measurement of 147Pm in-vivo using phoswich detectors
International Nuclear Information System (INIS)
Johnson, J.R.
1977-10-01
Recently an individual was suspected of having inhaled significant amounts of the almost pure beta emitter, 147 Pm. Urine analysis confirmed that contaminations had occurred but these results could not be used to evaluate the amount of material deposited in the lungs because an acceptable model of promethium clearance from the lung to blood and hence to urine has not been developed. Therefore another method of evaluation, that of the measurement, using phoswich detectors, of the soft photons emitted by the deposited 147 Pm was used. This paper describes the calibrations and measurements that were done in order that an upper limit on the deposited activity, and hence limits for committed dose to the various organs, could be assigned. (author)
Energy Technology Data Exchange (ETDEWEB)
Li, Donghui, E-mail: dli@mdanderson.org [Department of Gastrointestinal Medical Oncology, University of Texas MD Anderson Cancer Center, Houston, Texas (United States); Moughan, Jennifer [NRG Oncology Statistics and Data Management Center, Philadelphia, Pennsylvania (United States); Crane, Christopher [Department of Gastrointestinal Medical Oncology, University of Texas MD Anderson Cancer Center, Houston, Texas (United States); Hoffman, John P. [Department of Surgical Oncology, Fox Chase Cancer Center, Philadelphia, Pennsylvania (United States); Regine, William F. [Department of Radiation Oncology, University of Maryland, Baltimore, Maryland (United States); Abrams, Ross A. [Rush University Medical Center, Chicago, Illinois (United States); Safran, Howard [Brown University Oncology Group, Providence, Rhode Island (United States); Liu, Chang; Chang, Ping [Department of Gastrointestinal Medical Oncology, University of Texas MD Anderson Cancer Center, Houston, Texas (United States); Freedman, Gary M. [Department of Radiation Oncology, University of Pennsylvania, Philadelphia, Pennsylvania (United States); Winter, Kathryn A. [NRG Oncology Statistics and Data Management Center, Philadelphia, Pennsylvania (United States); Guha, Chandan [Department of Radiation Oncology, Montefiore Medical Center, Bronx, New York (United States); Abbruzzese, James L. [Duke University Medical Center, Durham, North Carolina (United States)
2016-03-01
Purpose: To confirm whether a previously observed association between RECQ1 A159C variant and clinical outcome of resectable pancreatic cancer patients treated with preoperative chemoradiation is reproducible in another patient population prospectively treated with postoperative chemoradiation. Methods and Materials: Patients were selected, according to tissue availability, from eligible patients with resected pancreatic cancer who were enrolled on the NRG Oncology Radiation Therapy Oncology Group 9704 trial of 5-fluorouacil (5-FU)-based chemoradiation preceded and followed by 5-FU or gemcitabine. Deoxyribonucleic acid was extracted from paraffin-embedded tissue sections, and genotype was determined using the Taqman method. The correlation between genotype and overall survival was analyzed using a Kaplan-Meier plot, log-rank test, and multivariate Cox proportional hazards models. Results: In the 154 of the study's 451 eligible patients with evaluable tissue, genotype distribution followed Hardy-Weinberg equilibrium (ie, 37% had genotype AA, 43% AC, and 20% CC). The RECQ1 variant AC/CC genotype carriers were associated with being node positive compared with the AA carrier (P=.03). The median survival times (95% confidence interval [CI]) for AA, AC, and CC carriers were 20.6 (16.3-26.1), 18.8 (14.2-21.6), and 14.2 (10.3-21.0) months, respectively. On multivariate analysis, patients with the AC/CC genotypes were associated with worse survival than patients with the AA genotype (hazard ratio [HR] 1.54, 95% CI 1.07-2.23, P=.022). This result seemed slightly stronger for patients on the 5-FU arm (n=82) (HR 1.64, 95% CI 0.99-2.70, P=.055) than for patients on the gemcitabine arm (n=72, HR 1.46, 95% CI 0.81-2.63, P=.21). Conclusions: Results of this study suggest that the RECQ1 A159C genotype may be a prognostic or predictive factor for resectable pancreatic cancer patients who are treated with adjuvant 5-FU before and after 5-FU-based chemoradiation. Further study is
Energy Technology Data Exchange (ETDEWEB)
Oliveira, Andre Felipe de
2013-07-01
Cancer is a leading cause of death worldwide, and malignant neoplasms of the lung, stomach, liver, colon and breast in greater numbers. And recently observed in the literature a large number of reviews where new materials, especially nanoparticle, has been studied as drug carriers and radioisotopes applied to cancer treatment. How mesoporous materials based on silica, thanks to its huge surface area and biocompatibility, have been studied intensively providing broad applications in various areas, the use of nanostructured silica SBA-16 might be a carrier specific radioisotope accumulate in the cells malignant. Thus the aim of this study is to develop in vitro studies using SBA-16 can selectively concentrate in malignant cells therapeutic amounts of the radioisotope Gadolinium-159 escorting them to death. This work was performed orderly synthesis of mesoporous silica, SBA-16 and incorporating the complex Gd-DTPA-BMA, as well as chemical and structural characterization. The techniques used to analyze the occurrence of the incorporation of the gadolinium complex in the silica matrix were elemental analysis (CHN), atomic emission spectroscopy (ICP-AES), infrared spectroscopy (FTIR), nitrogen adsorption (BET), small-angle X-ray scattering (SAXS) and thermogravimetric analysis (TG). To analyze the morphology of pure silica used the scanning electron microscopy (SEM) and transmission electron microscopy (TEM). By photon correlation spectroscopy (PCS) it was possible to obtain a measure of mean particle size, the polydispersity index (PDI) of the silica SBA-16, and the zeta potential by laser Doppler anemometry (LDA). The results of incorporation analyzed by ICP-AES indicated that the material SBA-16 had a higher rate of incorporation of gadolinium (93%). The release kinetics in simulated body fluid, showed considerable stability and low release (1%). The mesoporous silica SBA-16 showed cell viability in direct contact with cell culture. Samples with gadolinium
Separation device of radio lanthanides (DISER)
International Nuclear Information System (INIS)
Vera T, A.L.; Monroy G, F.; Vazquez M, J.C.; Jimenez B, F.
2008-01-01
At the present time the cancer is one of the main causes of mortality in our country, therefore, its prevention, diagnostic and treatment is of vital importance for those health systems. The treatment of the cancer and other illnesses, starting from monoclonal antibodies, peptides, macro aggregates or marked aminoacids with beta particles emitting radioisotopes, it is an extremely promising field. The radioactive lanthanides: Promethium 149, Terbium 161, Holmium 166 and Lutetium 177 are beta emitting (β), which possess nuclear and chemical properties that have shown their feasibility like radioisotopes of radiotherapeutic use. However, these radioisotopes are not commercially available; to this respect, the Radioactive Materials Research Laboratory (LIMR) of the National Institute of Nuclear Research (ININ), it has developed the methodology of production of these radioisotopes and based on these works, there is designed, built and mounted the Radio lanthanides Separation Device (DISER) able to carry out the radioisotopes production in a routine way. This device is content in a cell that has an auxiliary air service, an extraction system and it is protected with a lead armor-plating of 10 cm. The DISER it is manual and easy of managing. The main function of this equipment is the radio lanthanides separation starting from the extractive chromatography by means of packed columns with a commercial resin (LnSPS) and recovered in the superior and inferior part by fiber glass. The DISER is composed by a main carrousel where the separation columns and the elution recipients are mounted. Also counts with an opening system of irradiation vials, port samples for columns and glass material. The present work presents a detailed description of the DISER, as well as its handling that allows to produce the radioisotopes Promethium-149, Terbium-161, Holmium-166 and Lutetium-177 starting from the separation of its parent elements Neodymium-149, Gadolinium-161, Dysprosium-166 and
Separation device of radio lanthanides (DISER); Dispositivo de separacion de radiolantanidos (DISER)
Energy Technology Data Exchange (ETDEWEB)
Vera T, A.L. [FES-Zaragoza, UNAM, 09000 Mexico D.F. (Mexico); Monroy G, F.; Vazquez M, J.C.; Jimenez B, F. [ININ, 52750 La Marquesa, Estado de Mexico (Mexico)]. e-mail: veratrevino@hotmail.com
2008-07-01
At the present time the cancer is one of the main causes of mortality in our country, therefore, its prevention, diagnostic and treatment is of vital importance for those health systems. The treatment of the cancer and other illnesses, starting from monoclonal antibodies, peptides, macro aggregates or marked aminoacids with beta particles emitting radioisotopes, it is an extremely promising field. The radioactive lanthanides: Promethium 149, Terbium 161, Holmium 166 and Lutetium 177 are beta emitting ({beta}), which possess nuclear and chemical properties that have shown their feasibility like radioisotopes of radiotherapeutic use. However, these radioisotopes are not commercially available; to this respect, the Radioactive Materials Research Laboratory (LIMR) of the National Institute of Nuclear Research (ININ), it has developed the methodology of production of these radioisotopes and based on these works, there is designed, built and mounted the Radio lanthanides Separation Device (DISER) able to carry out the radioisotopes production in a routine way. This device is content in a cell that has an auxiliary air service, an extraction system and it is protected with a lead armor-plating of 10 cm. The DISER it is manual and easy of managing. The main function of this equipment is the radio lanthanides separation starting from the extractive chromatography by means of packed columns with a commercial resin (LnSPS) and recovered in the superior and inferior part by fiber glass. The DISER is composed by a main carrousel where the separation columns and the elution recipients are mounted. Also counts with an opening system of irradiation vials, port samples for columns and glass material. The present work presents a detailed description of the DISER, as well as its handling that allows to produce the radioisotopes Promethium-149, Terbium-161, Holmium-166 and Lutetium-177 starting from the separation of its parent elements Neodymium-149, Gadolinium-161, Dysprosium-166
African Journals Online (AJOL)
Administrator
Methods: Convenience sampling method was used to recruit 69 pregnant women aged 21-41 years with gestational age of. 0-20 weeks in ... Keywords: progesterone, oxidative stress, recurrent spontaneous abortion, trace metals, antioxidants. African Health ... spontaneous abortion in women might be related to selenium ...
African Journals Online (AJOL)
DR. AMINU
of the treated sludge were determined (using the liquor and settled solid of the sludge) as was done for the raw sludge. RESULTS AND DISCUSSION. Table1 presents the result of the characterization of the sludge samples from the rubber processing industry. Triplicate determinations were done in each case and the mean ...
African Journals Online (AJOL)
pc
mechanical properties of doped polyester fabric with aniline w s of various ... tion of the PANI solution rly constant up to ... computer interface and printer according to the AS. Figure 2: .... Material Systems and Structures, 23(17), pp. 1969-1986.
International Nuclear Information System (INIS)
Peterson, J.R.
1989-01-01
For some time the author has been using solid state absorption spectrophotometry to identify the crystal structure of selected transuranium (5f) and promethium (4f) compounds, based on spectral-structural correlations in his data base. More recently he has shown that Raman phonon spectroscopy is also very useful in this regard. These spectral probes of structure have their specific advantages and disadvantages; however, both are applicable to the structural characterization of radioactive compounds and can provide data for interpretation faster and more reliably than the commonly used X-ray powder diffraction method. The experimental methods, examples from the growing data bases, successes and limitations of these spectral probes of crystal structure, and some useful applications to the study of f-element compounds under varying conditions of temperature and pressure are presented
Li, Mingwu; Bai, Ming; Qi, Xingshun; Li, Kai; Yin, Zhanxin; Wang, Jianhong; Wu, Wenbing; Zhen, Luanluan; He, Chuangye; Fan, Daiming; Zhang, Zhuoli; Han, Guohong
2015-06-01
To investigate and compare the efficacy and safety of percutaneous transhepatic biliary stenting (PTBS) using a one- or two-stage procedure and determine the predictive factors for the efficacious treatment of malignant hilar obstruction (MHO). 159 consecutive patients with MHO who underwent PTBS were enrolled between January 2010 and June 2013. Patients were classified into one- or two-stage groups. Independent predictors of therapeutic success were evaluated using a logistic regression model. 108 patients were treated with one-stage PTBS and 51 patients were treated with two-stage PTBS. The stents were technically successful in all patients. Successful drainage was achieved in 114 patients (71.4 %). A total of 42 early major complications were observed. Re-interventions were attempted in 23 patients during follow-up. The cumulative primary patency rates at 3, 6, and 12 months were 88, 71, and 48 %, respectively. Stent placement using a one- or two-stage procedure did not significantly affect therapeutic success, early major complications, median stent patency, or survival. A stent placed across the duodenal papilla was an independent predictor of therapeutic success (odds ratio = 0.262, 95 % confidence interval [0.107-0.642]). Patients with stents across papilla had a lower rate of cholangitis compared with patients who had a stent above papilla (7.1 vs. 20.3 %, respectively, p = 0.03). The majority of patients with MHO who underwent one-stage PTBS showed similar efficacy and safety outcomes compared with those who underwent two-stage PTBS. Stent placement across the duodenal papilla was associated with a higher therapeutic success rate.
Directory of Open Access Journals (Sweden)
Emilie Javelle
2015-03-01
Full Text Available BACKGROUND: Since 2003, the tropical arthritogenic chikungunya (CHIK virus has become an increasingly medical and economic burden in affected areas as it can often result in long-term disabilities. The clinical spectrum of post-CHIK (pCHIK rheumatic disorders is wide. Evidence-based recommendations are needed to help physicians manage the treatment of afflicted patients. PATIENTS AND METHODS: We conducted a 6-year case series retrospective study in Reunion Island of patients referred to a rheumatologist due to continuous rheumatic or musculoskeletal pains that persisted following CHIK infection. These various disorders were documented in terms of their clinical and therapeutic courses. Post-CHIK de novo chronic inflammatory rheumatisms (CIRs were identified according to validated criteria. RESULTS: We reviewed 159 patient medical files. Ninety-four patients (59% who were free of any articular disorder prior to CHIK met the CIR criteria: rheumatoid arthritis (n=40, spondyloarthritis (n=33, undifferentiated polyarthritis (n=21. Bone lesions detectable by radiography occurred in half of the patients (median time: 3.5 years pCHIK. A positive therapeutic response was achieved in 54 out of the 72 patients (75% who were treated with methotrexate (MTX. Twelve out of the 92 patients (13% received immunomodulatory biologic agents due to failure of contra-indication of MTX treatment. Other patients mainly presented with mechanical shoulder or knee disorders, bilateral distal polyarthralgia that was frequently associated with oedema at the extremities and tunnel syndromes. These pCHIK musculoskeletal disorders (MSDs were managed with pain-killers, local and/or general anti-inflammatory drugs, and physiotherapy. CONCLUSION: Rheumatologists in Reunion Island managed CHIK rheumatic disorders in a pragmatic manner following the outbreak in 2006. This retrospective study describes the common mechanical and inflammatory pCHIK disorders. We provide a diagnostic
Etude critique de la prise en charge de 159 personnes âgées en consultation de psychiatrie
Ben Thabet, Jihène; Ammar, Yousra; Charfi, Nada; Zouari, Lobna; Zouari, Nasreddine; Gaha, Lotfi; Maalej, Mohamed
2014-01-01
Introduction Le phénomène de vieillissement des populations est associé à une augmentation de la prévalence de la morbidité liée à l’âge. La prescription des psychotropes chez le sujet âgé est de plus en plus fréquente dans les institutions, les doses sont de plus en plus élevées, avec un recours fréquent à une poly pharmacothérapie. Nous nous sommes proposé de décrire les conduites thérapeutiques chez le sujet âgé consultant en psychiatrie, en vue de les confronter aux dernières recommandations en la matière. Méthodes L’étude était de type rétrospectif et descriptif. Elle a concerné les sujets âgés d'au moins 60 ans ayant consulté pour la première fois en psychiatrie, au CHU Hédi Chaker à Sfax, en 2010 ou 2011. Résultats Nous avons colligé 159 dossiers. L’âge moyen était de 73 ans. La démence et les troubles de l'humeur étaient les diagnostics les plus fréquents. Sur le plan thérapeutique, une poly thérapie faite d'au moins deux psychotropes de familles différentes a été prescrite pour 55,9%. Chez 60.3% des sujets, le traitement a été prescrit d'emblée à dose complète. Aucun dossier ne faisait état d'une prise en charge psychothérapeutique. Conclusion La prise en charge des malades de notre étude n’était pas conforme aux recommandations, notamment en matière d'association médicamenteuse, de progression des doses et d'association de la psychothérapie à la pharmacothérapie. L'information des médecins et leur sensibilisation aux particularités du sujet âgé contribuerait à optimiser les soins qui leur sont prodigués, y compris en psychiatrie. PMID:25120873
Energy Technology Data Exchange (ETDEWEB)
Li, Mingwu, E-mail: lmw-jack@china.com.cn; Bai, Ming, E-mail: mingbai1983@gmail.com; Qi, Xingshun, E-mail: qixingshun19840717@126.com; Li, Kai, E-mail: lkiscoming@163.com; Yin, Zhanxin, E-mail: yinzhanxin@sina.com [Fourth Military Medical University, Department of Digestive Interventional Radiology, Xijing Hospital of Digestive Diseases (China); Wang, Jianhong, E-mail: 54526844@qq.com [Fourth Military Medical University, Department of Ultrasound, Xijing Hospital of Digestive Diseases (China); Wu, Wenbing, E-mail: wuwb211@126.com; Zhen, Luanluan, E-mail: zll2007101@163.com; He, Chuangye, E-mail: sxhechuangye@126.com [Fourth Military Medical University, Department of Digestive Interventional Radiology, Xijing Hospital of Digestive Diseases (China); Fan, Daiming, E-mail: fandaim@fmmu.edu.cn [Fourth Military Medical University, State Key Laboratory of Cancer Biology and Xijing Hospital of Digestive Diseases (China); Zhang, Zhuoli, E-mail: Zhuoli-Zhang@northwestern.edu [Northwestern University, Department of Radiology (United States); Han, Guohong, E-mail: hangh2009@gmail.com, E-mail: Hangh@fmmu.edu.cn [Fourth Military Medical University, Department of Digestive Interventional Radiology, Xijing Hospital of Digestive Diseases (China)
2015-06-15
AimTo investigate and compare the efficacy and safety of percutaneous transhepatic biliary stenting (PTBS) using a one- or two-stage procedure and determine the predictive factors for the efficacious treatment of malignant hilar obstruction (MHO).Methods159 consecutive patients with MHO who underwent PTBS were enrolled between January 2010 and June 2013. Patients were classified into one- or two-stage groups. Independent predictors of therapeutic success were evaluated using a logistic regression model.Results108 patients were treated with one-stage PTBS and 51 patients were treated with two-stage PTBS. The stents were technically successful in all patients. Successful drainage was achieved in 114 patients (71.4 %). A total of 42 early major complications were observed. Re-interventions were attempted in 23 patients during follow-up. The cumulative primary patency rates at 3, 6, and 12 months were 88, 71, and 48 %, respectively. Stent placement using a one- or two-stage procedure did not significantly affect therapeutic success, early major complications, median stent patency, or survival. A stent placed across the duodenal papilla was an independent predictor of therapeutic success (odds ratio = 0.262, 95 % confidence interval [0.107–0.642]). Patients with stents across papilla had a lower rate of cholangitis compared with patients who had a stent above papilla (7.1 vs. 20.3 %, respectively, p = 0.03).ConclusionsThe majority of patients with MHO who underwent one-stage PTBS showed similar efficacy and safety outcomes compared with those who underwent two-stage PTBS. Stent placement across the duodenal papilla was associated with a higher therapeutic success rate.
International Nuclear Information System (INIS)
Oliveira, Andre Felipe de
2013-01-01
Cancer is a leading cause of death worldwide, and malignant neoplasms of the lung, stomach, liver, colon and breast in greater numbers. And recently observed in the literature a large number of reviews where new materials, especially nanoparticle, has been studied as drug carriers and radioisotopes applied to cancer treatment. How mesoporous materials based on silica, thanks to its huge surface area and biocompatibility, have been studied intensively providing broad applications in various areas, the use of nanostructured silica SBA-16 might be a carrier specific radioisotope accumulate in the cells malignant. Thus the aim of this study is to develop in vitro studies using SBA-16 can selectively concentrate in malignant cells therapeutic amounts of the radioisotope Gadolinium-159 escorting them to death. This work was performed orderly synthesis of mesoporous silica, SBA-16 and incorporating the complex Gd-DTPA-BMA, as well as chemical and structural characterization. The techniques used to analyze the occurrence of the incorporation of the gadolinium complex in the silica matrix were elemental analysis (CHN), atomic emission spectroscopy (ICP-AES), infrared spectroscopy (FTIR), nitrogen adsorption (BET), small-angle X-ray scattering (SAXS) and thermogravimetric analysis (TG). To analyze the morphology of pure silica used the scanning electron microscopy (SEM) and transmission electron microscopy (TEM). By photon correlation spectroscopy (PCS) it was possible to obtain a measure of mean particle size, the polydispersity index (PDI) of the silica SBA-16, and the zeta potential by laser Doppler anemometry (LDA). The results of incorporation analyzed by ICP-AES indicated that the material SBA-16 had a higher rate of incorporation of gadolinium (93%). The release kinetics in simulated body fluid, showed considerable stability and low release (1%). The mesoporous silica SBA-16 showed cell viability in direct contact with cell culture. Samples with gadolinium
African Journals Online (AJOL)
User
of interaction occurring in this natural system (Dube et al.,2000). Many soils ... minerals including gold, copper, zinc etc. The Zamfara ... contain unusually problematic concentration of lead and other ..... Copper (Cu) is an essential micronutrient ...
2010-04-01
... detail the duly authorized succession by which it is entitled to file the certification. (ii) A member... produced. A company, business or person that has ceased production of the product covered by the... under this section. (ii) Acquisition by related company—(A) Related company defined. A company, business...
2010-10-01
...(b)(2) of the PHSA. Health Insurance Product: Means a package of benefits that an issuer offers that... Group Coverage: Means health insurance coverage offered to employees of small employers in the small... apply unless otherwise provided: Health Insurance Coverage: We adopt the Public Health Service Act (PHSA...
32 CFR 159.5 - Responsibilities.
2010-07-01
... include an Internet Web site, consistent with security considerations and requirements). (f) The Heads of... Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE SECURITY PRIVATE SECURITY CONTRACTORS... accountability and visibility of contracts, contractors, and specified equipment associated with private security...
19 CFR 159.63 - Certifications.
2010-04-01
... the Assistant Commissioner, Office of Finance, Headquarters, or designee, that must be received within...; acquisition by related company. The statement must include information as to whether the domestic producer... whether it has been acquired by a company or business that is related to a company, within the meaning of...
2010-07-01
... identify the organization responsible for managing these processes: (i) Registering, processing, accounting... of weapons by civilians, and the Law of Armed Conflict. (E) Written acknowledgment by the PSC and its...
2010-07-01
... tolerance, food additive regulation, action level, or other limitation on pesticide residues imposed by law... requirement are: mammals, birds, reptiles, amphibians, fish, aquatic invertebrates, insects, arachnids...
International Nuclear Information System (INIS)
1990-08-01
The Reports cover six contributions to various topics, five of which (nondestructive materials testing; gamma radiation transport model; mathematical modelling of a special Compton tomography arrangement, of gamma radiation transport, and of a gamma radiation backscatter arrangement) are reported separately in the data bank. (BBR) [de
Baker, E. T.; Hahm, D.; Rhee, T. S.; Park, S. H.; Lupton, J. E.; Walker, S. L.; Choi, H.
2014-12-01
Circum-Antarctic Ridges (CARs) comprise almost one-third of the global Mid-Ocean Ridge, yet remain terra incognita for hydrothermal activity and chemosynthetic ecosystems. The InterRidge Vents Database lists only 3 confirmed (visualized) and 35 inferred (plume evidence) active sites along the ~21,000 km of CARs. Here, we report on a multi-year effort to locate and characterize hydrothermal activity on two 1st-order segments of the Australian-Antarctic Ridge that are perhaps more isolated from other known vent fields than any other vent site on the Mid-Ocean Ridge. KR1 is a 300-km-long segment near 62°S/159°E, and KR2 a 90-km-long segment near 60°S/152.5°E. We used profiles collected by Miniature Autonomous Plume Recorders (MAPRs) on rock corers in March and December of 2011 to survey each segment, and an intensive CTD survey in Jan/Feb 2013 to pinpoint sites and sample plumes on KR1. Optical and oxidation-reduction potential (ORP, aka Eh) anomalies indicate multiple active sites on both segments. Seven profiles on KR2 found 3 sites, each separated by ~25 km. Forty profiles on KR1 identified 13 sites, some within a few km of each other. The densest site concentration on KR1 occurred along a relatively inflated, 90-km-long section near the segment center. CTD tows covered 20 km of the eastern, most inflated portion of this area, finding two 6-km-long zones centered near 158.6°E and 158.8°E with multiple plume anomalies. Three ORP anomalies within 50 m of the seafloor indicate precise venting locations. We call this area the Mujin "Misty Harbor" vent field. Vent frequency sharply decreases away from Mujin. 3He/heat ratios determined from 20 plume samples in the Mujin field were mostly <0.015 fM/J, indicative of chronic venting, but 3 samples, 0.021-0.034 fM/J, are ratios typical of a recent eruption. The spatial density of hydrothermal activity along KR1 and KR2 is similar to other intermediate-rate spreading ridges. We calculate the plume incidence (ph) along
Radioactive rare earths from fallout for study of particle movement in the sea
International Nuclear Information System (INIS)
Sugihara, Thomas T.; Bowen, Vaughan T.
1962-01-01
As part of an extensive study of the distribution of long-lived radionuclides from fallout in the Atlantic Ocean, a large number of measurements of cerium-144 and promethium-147 concentration have been made. Comparison of these concentrations as they vary both horizontally and vertically, with simultaneously measured concentrations of strontium-90, indicates that the rare earths are generally depleted in surface water, by comparison with the nuclides known to be soluble. This observation, coupled with frequent observation of rare-earth enrichment at depth, leads us to postulate rapid vertical transport of rare earths by attachment to particles undergoing sedimentation. This is completely plausible in terms of the 'radiocolloid' behaviour generally observed for rare earths at sea-water pH. An attempt is made to interpret this study in the overall picture of the marine geochemistry of the trivalent cations, as well as to emphasize the unique and generally useful aspects of the fallout tracer experiment. (author) [fr
Determination of stability constants of lanthanide complexes with tetracycline
International Nuclear Information System (INIS)
Saiki, Mitiko
1975-01-01
The stability constants of complexes compounds formed with tetracycline and lanthanides elements were determined for all lanthanides except promethium. The experimental procedure used was solvent extraction of the lanthanides labelled with their radioactive isotopes. It was shown that the formed complexes are mononuclear and that no hydroxo complexes or negatively charged complexes are formed in the experimental conditions of this work. Four methods of calculation were used for all complexes studied: the method of the average number of ligands, the method of limiting value, the method of two parameters and the method of weighted least squares. A comparison was made of the graphical methods with the method of least squares, showing the convenience of preceding least squares calculation by the graphical methods, in order to verify eventual mistakes of numerical data. It was shown the advantage of using radioisotopes of the elements for such a study, specially if the solvent extraction technique is used to-get the experimental data. (author)
Dosimetry in single lung cells by means of microautoradiographic activity measurements
International Nuclear Information System (INIS)
Kraus, W.
1976-01-01
After inhalation of compounds containing promethium-147 in the lungs of mice most of the activity was deposited in the form of local concentrations (hotspots). By means of a special quantitative microautoradiographic method using stripping film ORWO K 105, measurements of the activity of single hotspots of about 10 -14 Ci were possible. A microphotometer with a variable measuring diaphragm was used for the determination of the density profile of the autoradiographic image in order to get hotspot depth within the biological specimen. To determine hotspot activity it was necessary to calibrate the film with a Pm-147 plane source. The systematic and random errors of the method are discussed in detail, giving a total error of +- 21% (SD) for one hotspot activity measurement. A few examples of biological results obtained by the method are given. Simple models were used to calculate doses absorbed in macrophage and alveolar cell nuclei from the measured activities. (author)
Studies of photon spectra from a thallium-204 foil source as an aid to dosimetry and shielding
Francis, T M
1976-01-01
Beta ray foil sources incorporating nuclides such as thallium-204, promethium-147 and strontium-90 plus yttrium-90 ar increasingly used in industrial devices such as thickness gauges. These sources are so constructed that they give rise to complex photon spectra containing low energy Bremsstrahlung and X-rays characteristic of the constructional materials. The energy response of practical monitoring instruments is such that they are likely to underestimate the dose due to such spectra unless they are calibrated using appropriate spectra. This report describes a series of measurements carried out on a commercially available thallium-204 foil source and five commonly used shielding materials. The measurements made with a NaI(T1) spectrometer have been corrected for instrumental distortions to obtain the photon spectra in air. These spectra are presented and have been used to compute dose in air with the help of published data on mass energy-absorption coefficients. Also included in the report are data derived f...
Results of submerged sediment core sampling and analysis on Par Pond, Pond C, and L Lake: July 1995
International Nuclear Information System (INIS)
Koch, J.W. II; Martin, F.D.; Friday, G.P.
1996-06-01
Sediment cores from shallow and deep water locations in Par Pond, Pond C, and L Lake were collected and analyzed in 1995 for radioactive and nonradioactive constituents. This core analysis was conducted to develop a defensible characterization of contaminants found in the sediments of Par Pond, Pond C, and L Lake. Mercury was the only nonradiological constituent with a nonestimated quantity that was detected above the U.S Environmental Protection Agency Region IV potential contaminants of concern screening criteria. It was detected at a depth of 0.3--0.6 meters (1.0--2.0 feet) at one location in L Lake. Cesium-137, promethium-146, plutonium-238, and zirconium-95 had significantly higher concentrations in Par Pond sediments than in sediments from the reference sites. Cobalt-60, cesium-137, plutonium-238, plutonium-239/240, and strontium-90 had significantly higher concentrations in L-Lake sediments than sediments from the reference sites
Influence of projectile α-breakup threshold on complete fusion
International Nuclear Information System (INIS)
Mukherjee, A.; Subinit Roy; Pradhan, M.K.; Saha Sarkar, M.; Basu, P.; Dasmahapatra, B.; Bhattacharya, T.; Bhattacharya, S.; Basu, S.K.; Chatterjee, A.; Tripathi, V.; Kailas, S.
2006-01-01
Complete fusion excitation functions for B11,10+Tb159 have been measured at energies around the respective Coulomb barriers, and the existing complete fusion measurements for Li7+Tb159 have been extended to higher energies. The measurements show significant reduction of complete fusion cross sections at above-barrier energies for both the reactions, B10+Tb159 and Li7+Tb159, when compared to those for B11+Tb159. The comparison shows that the extent of suppression of complete fusion cross sections is correlated with the α-separation energies of the projectiles. Also, the two reactions, B10+Tb159 and Li7+Tb159 were found to produce incomplete fusion products at energies near the respective Coulomb barriers, with the α-particle emitting channel being the favoured incomplete fusion process in both the cases
Ghosh, Amlan; Dutta, Shampa; Podder, Sanjoy; Mondal, Priti; Laha, Arghya; Saha, Nimai Chandra; Moitra, Saibal; Saha, Goutam Kumar
2018-01-10
India is the home to around 15-20 million asthmatics, and asthma prevalence is increasing in Indian metropolitan area, including Kolkata, West Bengal. Complex interactions of genetic and environmental factors are involved in asthma. Genome-wide search for susceptible loci regulating IgE response (atopy) have identified a candidate gene CD14 which is most important in the context of allergic responses of respiratory system. This study was aimed to investigate the role of house dust and house dust mites in development of bronchial asthma and to explore the possible association of candidate gene CD14 with disease manifestation among Kolkata patient population. Skin-prick test was done among 950 asthmatic patients against 8 aeroallergens, including house dust and house dust mites and total serum IgE and allergen-specific IgE were measured. Polymerase chain reaction-restriction fragment length polymorphism was done in patients and nonasthmatic control (n = 255 in each) to characterize a functional polymorphism, C(-159)T, of CD14, a positional candidate gene for allergy. We identified house dust as the most common aeroallergen sensitizer among atopic patients in Kolkata followed by Dermatophagoides pteronyssinus and Dermatophagoides farinae Hughes (Acari: Pyroglyphidae) mites. Patient's sera contain significantly higher IgE level than that of control. Allergen-specific IgE antibody test revealed that 76.36% patients had specific IgE antibody against D. pteronyssinus mite. There was a significant difference in the distribution of alleles and genotypes for CD14 polymorphism with an increase in disease severity. So, in Kolkata, house dust mite is a common aeroallergen and D. pteronyssinus is predominant among mites. The present study revealed that bronchial asthma has a genetic background. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
159 THEORETICAL SYNTAX IN SECOND LANGUAGE ...
African Journals Online (AJOL)
Second language teaching practicioners have tried to a greater or lesser extent in the past to apply the insights of linguistic .... The actual processes, procedures, activities and techniques of teachers and learners within the classroom ..... English relative clauses by adult Spanish and Japanese speakers. In S. Gass and.
7 CFR 930.159 - Handler diversion.
2010-01-01
... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... normal market channels. Products which are voluntarily destroyed must have deteriorated in condition to such an extent that they are not acceptable for use in normal market channels. (e) Contributions to...
14 CFR 171.159 - Installation requirements.
2010-01-01
... Installation requirements. (a) The facility must be installed according to accepted good engineering practices... must have a reliable source of suitable primary power, either from a power distribution system or...
Publications | Page 159 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
IDRC works with developing-country researchers and institutions to build local capacity ... Innovation and productivity in information technology services and ... than 700 Senegalese women for work in the agricultural sector in Spain since then.
76 FR 159 - Discretionary Grant Program
2011-01-03
... these funds to initiate an orderly closeout of HRSA-funded activities which clearly fall within the... Supplemental Funding: $250,000. Authority: Section 501(c)(1) of the Social Security Act, as amended. CFDA... requirements, deeming this quality check of sufficient importance to mandate successful participation as a...
Hazir, T; Qazi, S; Nisar, Y B; Ansari, S; Maqbool, S; Randhawa, S; Kundi, Z; Asghar, R; Aslam, S
2004-11-01
Using current WHO guidelines, children with wheezing are being over prescribed antibiotics and bronchodilators are underutilised. To improve the WHO case management guidelines, more data is needed about the clinical outcome in children with wheezing/pneumonia overlap. In a multicentre prospective study, children aged 1-59 months with auscultatory/audible wheeze and fast breathing and/or lower chest indrawing were screened. Response to up to three cycles of inhaled salbutamol was recorded. The responders were enrolled and sent home on inhaled bronchodilators, and followed up on days 3 and 5. A total of 1622 children with wheeze were screened from May 2001 to April 2002, of which 1004 (61.8%) had WHO defined non-severe and 618 (38.2%) severe pneumonia. Wheeze was audible in only 595 (36.7%) of children. Of 1004 non-severe pneumonia children, 621 (61.8%) responded to up to three cycles of bronchodilator. Of 618 severe pneumonia children, only 166 (26.8%) responded. Among responders, 93 (14.9%) in the non-severe and 63 (37.9%) children in the severe pneumonia group showed subsequent deterioration on follow ups. No family history of wheeze, temperature >100 degrees F, and lower chest indrawing were identified as predictors of subsequent deterioration. Two third of children with wheeze are not identified by current WHO ARI (acute respiratory infections) guidelines. Antibiotics are over prescribed and bronchodilators under utilised in children with wheeze. Children with wheeze constitute a special ARI group requiring a separate management algorithm. In countries where wheeze is common it would be worthwhile to train health workers in use of the stethoscope to identify wheeze.
Expression of artificial microRNAs in transgenic Arabidopsis thaliana confers virus resistance.
Niu, Qi-Wen; Lin, Shih-Shun; Reyes, Jose Luis; Chen, Kuan-Chun; Wu, Hui-Wen; Yeh, Shyi-Dong; Chua, Nam-Hai
2006-11-01
Plant microRNAs (miRNAs) regulate the abundance of target mRNAs by guiding their cleavage at the sequence complementary region. We have modified an Arabidopsis thaliana miR159 precursor to express artificial miRNAs (amiRNAs) targeting viral mRNA sequences encoding two gene silencing suppressors, P69 of turnip yellow mosaic virus (TYMV) and HC-Pro of turnip mosaic virus (TuMV). Production of these amiRNAs requires A. thaliana DICER-like protein 1. Transgenic A. thaliana plants expressing amiR-P69(159) and amiR-HC-Pro(159) are specifically resistant to TYMV and TuMV, respectively. Expression of amiR-TuCP(159) targeting TuMV coat protein sequences also confers specific TuMV resistance. However, transgenic plants that express both amiR-P69(159) and amiR-HC-Pro(159) from a dimeric pre-amiR-P69(159)/amiR-HC-Pro(159) transgene are resistant to both viruses. The virus resistance trait is displayed at the cell level and is hereditable. More important, the resistance trait is maintained at 15 degrees C, a temperature that compromises small interfering RNA-mediated gene silencing. The amiRNA-mediated approach should have broad applicability for engineering multiple virus resistance in crop plants.
76 FR 29158 - Amendment of the Schedule of Application Fees Set
2011-05-20
... Filing Required). c. Auxiliary Test (Per 601 & 159 345.00 CLD Transmitter); Consolidate Call Signs (Per Call Sign) (Electronic Filing Required). d. Special Temporary Authority 601 & 159 345.00 CLD (Per Location/Per Frequency). e. Special Temporary Authority 601 & 159 345.00 CLD (Per Location/Per Frequency...
Astronomy Matters for Chemistry Teachers
Huebner, Jay S.; Vergenz, Robert A.; Smith, Terry L.
1996-11-01
The purpose of this paper is to encourage more chemistry teachers to become familiar with some of the basic ideas described in typical introductory astronomy courses (1 - 9), including those about the origin of elements and forms of matter. These ideas would enrich chemistry courses and help resolve some basic misconceptions that are expressed in many introductory texts (10 - 16) and journal articles for chemistry teachers (17, 18). These misconceptions are typified by statements such as "we can classify all substances as either elements or compounds," and "nature has provided 92 elements out of which all matter is composed." If students accept these misconceptions, they could be deprived of (i) an appreciation of the history of elements and knowing that the elemental composition of the universe continues to evolve, (ii) knowing that of the first 92 elements in the periodic table, technetium and promethium do not occur naturally on Earth, and (iii) understanding that there are forms of matter other than elements and compounds. This paper briefly explores these ideas.
International Nuclear Information System (INIS)
Herbert, R.A.; Scott, B.R.; Hahn, F.F.; Newton, G.J.; Snipes, M.B.; Damon, E.G.; Boecker, B.B.
1988-01-01
To determine the biological response following low-energy, beta irradiation of the lung, F344/Crl rats were exposed to aerosols of promethium-147 in fused aluminosilicate particles and observed for their life spans. Radiation pneumonitis and pulmonary fibrosis caused the majority of deaths during the first year after exposure with cumulative doses to the lungs of 210 to 630 Gy. Primary pulmonary neoplasms were responsible for the majority of deaths that occurred beyond 1 yr after exposure and in rats receiving lower cumulative doses to the lung. Hemangiosarcomas and squamous cell carcinomas were the most prevalent pulmonary neoplasms. Three adenocarcinomas were found. The uncorrected crude incidence of primary lung tumors increased with increasing dose to the lung for cumulative doses less than 140 Gy. With higher doses, the incidence declined. Adjusting the data for competing risks eliminated the turnover in the dose-response curve. The times of onset of pulmonary tumors and median survival times were dose-dependent. Rats with higher accumulated radiation doses developed fatal lung tumors at earlier times after exposure. (author)
2010-10-01
...); Consolidate Call Signs (Per Call Sign) (Electronic Filing Required) 601 & 159 335.00 CLD d. Special Temporary Authority (Per Location/Per Frequency) 601 & 159 335.00 CLD e. Special Temporary Authority (Per Location/Per Frequency) (Electronic Filing) 601 & 159 335.00 CLD f. Assignment of License or Transfer of Control; 603...
Engineering of an E. coli outer membrane protein FhuA with increased channel diameter
Directory of Open Access Journals (Sweden)
Dworeck Tamara
2011-08-01
Full Text Available Abstract Background Channel proteins like FhuA can be an alternative to artificial chemically synthesized nanopores. To reach such goals, channel proteins must be flexible enough to be modified in their geometry, i.e. length and diameter. As continuation of a previous study in which we addressed the lengthening of the channel, here we report the increasing of the channel diameter by genetic engineering. Results The FhuA Δ1-159 diameter increase has been obtained by doubling the amino acid sequence of the first two N-terminal β-strands, resulting in variant FhuA Δ1-159 Exp. The total number of β-strands increased from 22 to 24 and the channel surface area is expected to increase by ~16%. The secondary structure analysis by circular dichroism (CD spectroscopy shows a high β-sheet content, suggesting the correct folding of FhuA Δ1-159 Exp. To further prove the FhuA Δ1-159 Exp channel functionality, kinetic measurement using the HRP-TMB assay (HRP = Horse Radish Peroxidase, TMB = 3,3',5,5'-tetramethylbenzidine were conducted. The results indicated a 17% faster diffusion kinetic for FhuA Δ1-159 Exp as compared to FhuA Δ1-159, well correlated to the expected channel surface area increase of ~16%. Conclusion In this study using a simple "semi rational" approach the FhuA Δ1-159 diameter was enlarged. By combining the actual results with the previous ones on the FhuA Δ1-159 lengthening a new set of synthetic nanochannels with desired lengths and diameters can be produced, broadening the FhuA Δ1-159 applications. As large scale protein production is possible our approach can give a contribution to nanochannel industrial applications.
2012-10-12
... stricken. Digestive System [ssquf] The ICD-9 heading code 154.8 should have been included for ``malignant... digestive system,'' and ``ill-defined sites within the digestive system'' should be 159.0, 159.8, and 159.9... DEPARTMENT OF HEALTH AND HUMAN SERVICES 42 CFR Part 88 [Docket No. CDC-2012-0007; NIOSH-257] RIN...
Organ-on-a-Chip for Aerospace Physiology and Toxicology
2014-12-15
Medicine 4(159): 159ra147-159ra147. Huh, D., B. D. Matthews, A. Mammoto, M. Montoya -Zavala, H . Y. Hsin and D. E. Ingber (2010). "Reconstituting Organ...Level Lung Functions on a Chip." Science 328(5986): 1662- 1668. Huh, D., Y.-s. Torisawa, G. A. Hamilton, H . J. Kim and D. E. Ingber (2012
International Nuclear Information System (INIS)
2002-01-01
The objective is to modify and extend the existing system at the Ignalina Nuclear Power Plant (INPP) for handling of Very Low Level Waste (VLLW), short lived Low and Intermediate Level Waste (LLW-SL and ILW-SL). The ultimate aim is to reduce the risks and the influence on the personnel and the environment. According to the request from INPP, the modified system is based on the existence of an incineration plant. This system description describes treatment of non-combustible VLLW, LLW-SL and ILW-SL at a new waste handling facility (WHF) located in the future buildings 159/2 and 159/3 at the INPP. The new WHF is also handling Exempt Waste (EW), Reusable Material (RM) and Free Release Goods (FRG). The buildings 159/2 and 159/3 are future extensions of the existing building 159. (author)
19 CFR 159.34 - Certified quarterly rate.
2010-04-01
..., Denmark, Finland, France, Germany, Hong Kong, India, Iran, Ireland, Italy, Japan, Malaysia, Mexico... Customs purposes in connection with merchandise exported on such date. (2) Certified daily rate. If the... merchandise exported on such day. [T.D. 73-175, 38 FR 17482, July 2, 1973, as amended by T.D. 81-117, 46 FR...
36 CFR 1192.159 - Mobility aid accessibility.
2010-07-01
... covered by this subpart shall provide a level-change mechanism or boarding device (e.g., lift or ramp... provide other appropriate mechanisms or systems, to ensure that the vehicle cannot be moved when the lift... entrance ramp) shall not deflect more than 3 degrees (exclusive of vehicle roll or pitch) in any direction...
49 CFR 38.159 - Mobility aid accessibility.
2010-10-01
.... (a)(1) General. All vehicles covered by this subpart shall provide a level-change mechanism or... brakes, transmission, or door, or shall provide other appropriate mechanisms or systems, to ensure that... entrance ramp) shall not deflect more than 3 degrees (exclusive of vehicle roll or pitch) in any direction...
Search Results | Page 159 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Quantifying the direct and indirect effects of Dissolved Organic Matter (DOM) on ... quantitative open economy models to study international trade transmission, the ... cost, user-friendly risk mapping system that can be used in any community.
Search Results | Page 159 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
The diffusion of information and communication technologies (ICTs), notably the mobile ... Survey on the Use of Mobile Telephone for Micro and Small Business ... (ICTs) have become key factors driving social and economic advancement.
33 CFR 159.14 - Application for certification.
2010-07-01
... description of the manufacturer's production quality control and inspection methods, record keeping systems pertaining to the manufacture of marine sanitation devices, and testing procedures; (2) The design for the... device; and (4) The name and address of the applicant and the manufacturing facility. (c) The...
Search Results | Page 159 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
GFU for Underutilized Species : towards an enabling environment for the ... sector microcredit programs in Ghana : does infant and young child nutrition improve? ... effects on aquatic organisms, and points to new directions for future work.
Page | 159 UNIVERSALITY OF PRISONERS' RIGHT AND ...
African Journals Online (AJOL)
Fr. Ikenga
Abstract. This paper examines the concept of human right as well as the universality in the application of the concept to the prisoners' welfare in most countries of the world. To determine the level of conformity of this concept in Nigeria, the paper discusses the post-conviction problems prisoners face in Nigeria as against ...
Energy Technology Data Exchange (ETDEWEB)
Ferreira, Carolina de Aguiar
2014-06-01
Colorectal cancer (CRC) is a malignancy that affects large intestine and rectum, and it is the most common malignancy of the gastrointestinal tract, the third most commonly diagnosed type of cancer in the world and the second leading cause of cancer-related death in the United States. Nowadays, available therapeutic procedures for this type of cancer are limited and ineffective. Conventional radiotherapy is not an often used approach in the treatment of CRC due to the fact that peristaltic movements hamper the targeting of ionizing radiation and this type of treatment is used as adjuvant and palliative to control symptoms. Therefore, surgical intervention is the primary therapeutic choice against this disease. Researches based on the combination of radioisotopes and nanostructured carriers systems have demonstrated significant results in improving the selectivity action as well as reducing the radiation dose into healthy tissues. MCM-41 mesoporous silica nanoparticles have unique characteristics such as high surface area and well-defined pore diameters making these nanoparticles an ideal candidate of therapeutic agent carrier. Thus, the objective of this work is to synthesize and characterize MCM-41 mesoporous silica nanoparticles conjugated with yttrium-90 and gadolinium-159 and evaluate this system as a potential therapeutic agent. The nanoparticles were synthesized via sol-gel method. The sample was characterized using FTIR, SAXS, PCS, Zeta Potential analysis, Thermal analysis, CHN elemental analysis, nitrogen adsorption, scanning and transmission electron microscopy. The ability to incorporate Y{sup +3} and Gd{sup +3} ion was determined in vitro using different ratios (1:1, 1:3, 1:5 v/v) of YCL{sub 3} and Gd{sub 2}O{sub 3} and silica nanoparticles dispersed in saline, pH 7.4. The non-incorporated Y{sup +3} and Gd{sup +3} ions were removed by ultracentrifugation procedure and the concentration of ions in the supernatant was determined by ICP-AES. Cell viability
Directory of Open Access Journals (Sweden)
Jianmin Yan
Full Text Available The translocon at the outer envelope membrane of chloroplasts (Toc mediates the recognition and initial import into the organelle of thousands of nucleus-encoded proteins. These proteins are translated in the cytosol as precursor proteins with cleavable amino-terminal targeting sequences called transit peptides. The majority of the known Toc components that mediate chloroplast protein import were originally identified in pea, and more recently have been studied most extensively in Arabidopsis. With the completion of the tomato genome sequencing project, it is now possible to identify putative homologues of the chloroplast import components in tomato. In the work reported here, the Toc GTPase cDNAs from tomato were identified, cloned and analyzed. The analysis revealed that there are four Toc159 homologues (slToc159-1, -2, -3 and -4 and two Toc34 homologues (slToc34-1 and -2 in tomato, and it was shown that tomato Toc159 and Toc34 homologues share high sequence similarity with the comparable import apparatus components from Arabidopsis and pea. Thus, tomato is a valid model for further study of this system. The expression level of Toc complex components was also investigated in different tissues during tomato development. The two tomato Toc34 homologues are expressed at higher levels in non-photosynthetic tissues, whereas, the expression of two tomato Toc159 homologues, slToc159-1 and slToc159-4, were higher in photosynthetic tissues, and the expression patterns of slToc159-2 was not significantly different in photosynthetic and non-photosynthetic tissues, and slToc159-3 expression was limited to a few select tissues.
Czech Academy of Sciences Publication Activity Database
Morgan, T.W.; van Eden, G.G.; de Kruif, T.M.; van den Berg, A.; Matějíček, Jiří; Chráska, Tomáš; De Temmerman, G.
-, T159 (2014), 014022-014022 ISSN 0031-8949. [International Conference on Plasma-Facing Materials and Components for Fusion Applications/14./. Jülich, 13.05.2013-17.05.2013] Institutional support: RVO:61389021 Keywords : melting * tungsten * ELMs * divertor * ITER * DEMO Subject RIV: JG - Metallurgy Impact factor: 1.126, year: 2014 http://iopscience.iop.org/1402-4896/2014/T159/014022/pdf/1402-4896_2014_T159_014022.pdf
International Nuclear Information System (INIS)
Ferreira, Carolina de Aguiar
2014-01-01
Colorectal cancer (CRC) is a malignancy that affects large intestine and rectum, and it is the most common malignancy of the gastrointestinal tract, the third most commonly diagnosed type of cancer in the world and the second leading cause of cancer-related death in the United States. Nowadays, available therapeutic procedures for this type of cancer are limited and ineffective. Conventional radiotherapy is not an often used approach in the treatment of CRC due to the fact that peristaltic movements hamper the targeting of ionizing radiation and this type of treatment is used as adjuvant and palliative to control symptoms. Therefore, surgical intervention is the primary therapeutic choice against this disease. Researches based on the combination of radioisotopes and nanostructured carriers systems have demonstrated significant results in improving the selectivity action as well as reducing the radiation dose into healthy tissues. MCM-41 mesoporous silica nanoparticles have unique characteristics such as high surface area and well-defined pore diameters making these nanoparticles an ideal candidate of therapeutic agent carrier. Thus, the objective of this work is to synthesize and characterize MCM-41 mesoporous silica nanoparticles conjugated with yttrium-90 and gadolinium-159 and evaluate this system as a potential therapeutic agent. The nanoparticles were synthesized via sol-gel method. The sample was characterized using FTIR, SAXS, PCS, Zeta Potential analysis, Thermal analysis, CHN elemental analysis, nitrogen adsorption, scanning and transmission electron microscopy. The ability to incorporate Y +3 and Gd +3 ion was determined in vitro using different ratios (1:1, 1:3, 1:5 v/v) of YCL 3 and Gd 2 O 3 and silica nanoparticles dispersed in saline, pH 7.4. The non-incorporated Y +3 and Gd +3 ions were removed by ultracentrifugation procedure and the concentration of ions in the supernatant was determined by ICP-AES. Cell viability was assessed by colorimetric MTT
Directory of Open Access Journals (Sweden)
Fioroni Marco
2011-03-01
Full Text Available Abstract Background Channel proteins like the engineered FhuA Δ1-159 often cannot insert into thick polymeric membranes due to a mismatch between the hydrophobic surface of the protein and the hydrophobic surface of the polymer membrane. To address this problem usually specific block copolymers are synthesized to facilitate protein insertion. Within this study in a reverse approach we match the protein to the polymer instead of matching the polymer to the protein. Results To increase the FhuA Δ1-159 hydrophobic surface by 1 nm, the last 5 amino acids of each of the 22 β-sheets, prior to the more regular periplasmatic β-turns, were doubled leading to an extended FhuA Δ1-159 (FhuA Δ1-159 Ext. The secondary structure prediction and CD spectroscopy indicate the β-barrel folding of FhuA Δ1-159 Ext. The FhuA Δ1-159 Ext insertion and functionality within a nanocontainer polymeric membrane based on the triblock copolymer PIB1000-PEG6000-PIB1000 (PIB = polyisobutylene, PEG = polyethyleneglycol has been proven by kinetic analysis using the HRP-TMB assay (HRP = Horse Radish Peroxidase, TMB = 3,3',5,5'-tetramethylbenzidine. Identical experiments with the unmodified FhuA Δ1-159 report no kinetics and presumably no insertion into the PIB1000-PEG6000-PIB1000 membrane. Furthermore labeling of the Lys-NH2 groups present in the FhuA Δ1-159 Ext channel, leads to controllability of in/out flux of substrates and products from the nanocontainer. Conclusion Using a simple "semi rational" approach the protein's hydrophobic transmembrane region was increased by 1 nm, leading to a predicted lower hydrophobic mismatch between the protein and polymer membrane, minimizing the insertion energy penalty. The strategy of adding amino acids to the FhuA Δ1-159 Ext hydrophobic part can be further expanded to increase the protein's hydrophobicity, promoting the efficient embedding into thicker/more hydrophobic block copolymer membranes.
Muhammad, Noor; Dworeck, Tamara; Fioroni, Marco; Schwaneberg, Ulrich
2011-03-17
Channel proteins like the engineered FhuA Δ1-159 often cannot insert into thick polymeric membranes due to a mismatch between the hydrophobic surface of the protein and the hydrophobic surface of the polymer membrane. To address this problem usually specific block copolymers are synthesized to facilitate protein insertion. Within this study in a reverse approach we match the protein to the polymer instead of matching the polymer to the protein. To increase the FhuA Δ1-159 hydrophobic surface by 1 nm, the last 5 amino acids of each of the 22 β-sheets, prior to the more regular periplasmatic β-turns, were doubled leading to an extended FhuA Δ1-159 (FhuA Δ1-159 Ext). The secondary structure prediction and CD spectroscopy indicate the β-barrel folding of FhuA Δ1-159 Ext. The FhuA Δ1-159 Ext insertion and functionality within a nanocontainer polymeric membrane based on the triblock copolymer PIB(1000)-PEG(6000)-PIB(1000) (PIB = polyisobutylene, PEG = polyethyleneglycol) has been proven by kinetic analysis using the HRP-TMB assay (HRP = Horse Radish Peroxidase, TMB = 3,3',5,5'-tetramethylbenzidine). Identical experiments with the unmodified FhuA Δ1-159 report no kinetics and presumably no insertion into the PIB(1000)-PEG(6000)-PIB(1000) membrane. Furthermore labeling of the Lys-NH(2) groups present in the FhuA Δ1-159 Ext channel, leads to controllability of in/out flux of substrates and products from the nanocontainer. Using a simple "semi rational" approach the protein's hydrophobic transmembrane region was increased by 1 nm, leading to a predicted lower hydrophobic mismatch between the protein and polymer membrane, minimizing the insertion energy penalty. The strategy of adding amino acids to the FhuA Δ1-159 Ext hydrophobic part can be further expanded to increase the protein's hydrophobicity, promoting the efficient embedding into thicker/more hydrophobic block copolymer membranes.
Plasma Separation Process: Betacell (BCELL) code: User's manual. [Bipolar barrier junction
Energy Technology Data Exchange (ETDEWEB)
Taherzadeh, M.
1987-11-13
The emergence of clearly defined applications for (small or large) amounts of long-life and reliable power sources has given the design and production of betavoltaic systems a new life. Moreover, because of the availability of the plasma separation program, (PSP) at TRW, it is now possible to separate the most desirable radioisotopes for betacell power generating devices. A computer code, named BCELL, has been developed to model the betavoltaic concept by utilizing the available up-to-date source/cell parameters. In this program, attempts have been made to determine the betacell energy device maximum efficiency, degradation due to the emitting source radiation and source/cell lifetime power reduction processes. Additionally, comparison is made between the Schottky and PN junction devices for betacell battery design purposes. Certain computer code runs have been made to determine the JV distribution function and the upper limit of the betacell generated power for specified energy sources. A Ni beta emitting radioisotope was used for the energy source and certain semiconductors were used for the converter subsystem of the betacell system. Some results for a Promethium source are also given here for comparison. 16 refs.
Technology for recovery of by-products
International Nuclear Information System (INIS)
Van Tuy, H.H.
1983-01-01
Products of conventional nuclear fuel processing plants are uranium and plutonium, and any other recovered material is considered to be a by-product. Some by-products have been recovered from past nuclear fuel processing operations, either as a normal mode of operation or by special campaigns. Routing recovery over an extended period has been limited to neptunium, but extended campaigns were used at Hanford to recover strontium for radioisotope thermoelectric generators. Krypton is recovered at Idaho Chemical Processing Plant on a campaign basis, and isotope separation of krypton is done at Oak Ridge National Laboratory. Past campaigns at Hanford PUREX have recovered cesium, promethium, amercium, cerium, and technetium. Past by-product recovery efforts were usually severely constrained by the status of flowsheet development and availability of existing facilities at the time decisions wee made to recover the by-products. Additional processes were developed to accommodate other unit operations and in response to changes in waste management objectives or user requirements. Now an impressive variety of recovery technology is available for most potential by-products, with varying degrees of demonstration under conditions which satisfy today's environmental protection and waste management constraints
Energy Technology Data Exchange (ETDEWEB)
Martinelli, P [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires; Seibel, G [Institut de Recherches de la Siderurgie, 78 - Saint-Germain-en-Laye (France)
1960-07-01
The process for analysing and measuring the thickness of deposits by {beta}-X fluorescence which we have already described has undergone further development. The use of promethium-147 and krypton-85 sources makes it possible to reduce the background noise which is observed with strontium-90. We present the results obtained for various measurements of the thickness of metallic coatings and the continuous measurement of calcium and of iron in ore samples. We describe the tests carried out with a view to analysing the X-rays by means of a crystal. (author) [French] Le procede d'analyse et de mesure des epaisseurs de depots par fluorescence {beta}-X que nous avons precedemment decrit a fait l'objet de nouveaux developpements. L'emploi de sources de prometheum-147 et de krypton-85 permet de reduire le bruit de fond que l'on observe avec le strontium-90. Nous dormons les resultats obtenus pour diverses mesures d'epaisseurs de depots metalliques et la mesure en continu du calcium et du fer dans les carottes de minerais. Nous decrivons les essais effectues en vue d'analyser le rayonnement X au moyen d'un cristal. (auteur)
International Nuclear Information System (INIS)
Ammerich, M.
2009-01-01
This article goes back over the incidents occurring during the summer 2008, that is to say the uranium release from the Socatri facility in the South of France. From this point, the purpose studies the radiological situation of the Camargue seashore; the levels of radioactivity are from 3 to thirty times higher than these ones expected in this area, but the natural radioactivity with thorium and uranium coming from the granitic massifs erosion brings an important part. It is difficult to make the part between human and natural contribution to ambient radioactivity. However, it appears that to limit the water consumption until the time of dilution played its part was absolutely necessary. Then, because it is question of water, the drinking water is tackled. Some mineral waters go over the recommended limits of doses. A last return to the past with the radioactive watches, but this time with actual watches that activate detection. Two watches contained promethium 147, 147 Pm is a beta emitter but also gamma emitter. To end, in Ireland and Great Britain, some fire detectors contain americium 241. In fact, this article constitutes a summary of different abnormalities around radioactivity. (N.C.)
Nuclear spectroscopy study of the 117 Sn by the angular correlation technique
International Nuclear Information System (INIS)
Borges, Joao Baptista
1977-01-01
The directional correlation of gamma cascade (553-159) keV populated in 117 Sn through the β - decay of 117 In has been measured. An automatic gamma spectrometer utilizing Ge(Li) and NaI (Tl) detectors was used to measure the angular correlation. The results are analysed in terms of the multipole mixing ratio for the 159 keV transition in 117 Sn. The results are: A 22 = -0 064±0.005, A 44 = 0.005±0.007 with δ(E2/M1) 159keV = 0.036+0.021. The life time of the 159 keV state has also been determined by using the plastic scintillator detectors, and utilizing the delayed gamma-gamma coincidence method the resulting value of the life time is T 1/2 = 275±15 psec. Further measurements have been carried out to determine the nuclear g-factor of the 159 keV state utilizing the NaI(Tl) detectors and an external magnetic field of 25.5 k Gauss. The method of 'integral rotation with reverse field and constant angle' was utilized for the determination of the g-factor with the resulting value of g(159 keV) = +0.47±0.10. The experimental results are discussed in terms of single particle model and the pairing plus quadrupole model of Kisslinger and Sorensen. (author)
40 CFR 159.165 - Toxicological and ecological studies.
2010-07-01
... the median lethal dose (LD50), median lethal concentration (LC50) or irritation indices, are not... lethal dose (LD50), median lethal concentration (LC50), or median effective concentration (EC50). (2) At... less of the lowest LC50 or LD50 for a similar species. (4) For plants when tested at the maximum label...
South of Sahara | Page 159 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Language English. Les acquisitions massives de terres peuvent s'accompagner d'avantages comme des emplois, des infrastructures et un accès à la nourriture et aux ... Research will focus on a systems approach to improving maternal and child healthcare delivery in Kenya, specifically within primary care facilities.
19 CFR 159.22 - Net weights and tares.
2010-04-01
... per half box for paper wrappings, and actual tare for outer containers. Ocher, dry, in casks: Eight... importer is not satisfied with the invoice tare or with the schedule tare; (2) If the port director is of...
What we do | Page 159 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
North And Central America, South America, Colombia, Ecuador, Canada ... through simple resource-based activities: oil, minerals, tourism and labour migration. ... University will conduct three case studies on democratic transition in Liberia, ...
Lifescience Database Archive (English)
Full Text Available *tttkmlfkmstkt*m*sxplw*rmlc*ssprxmfiemxxrp*m*s*st wkrmlrccp*tttxmlikmsxkt*m*nxslw*rmlc*k*x*lfnl*rlkl*kkrftlc...wkrmlrccp*tttkmlfkmstkt*m*sxplw*rmlc*ssprxmfiemxxrp*m*s*st wkrmlrccp*tttxmlikmsxkt*m*nxslw*rmlc*k*x*lfnl*rlk
46 CFR 159.001-5 - Correspondence and applications.
2010-10-01
....001-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND... Correspondence and applications. Unless otherwise specified, all correspondence and applications in connection with approval and testing of equipment and materials must be addressed to: Commandant (CG-5214), U.S...
What we do | Page 159 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Red de Líderes de Gobierno Electrónico de América Latina y El Caribe -RED GEALC) was initiated in 2003 under the first phase ... Peru, South America, North And Central America, Argentina, Colombia, Dominican Republic, Ecuador, Mexico.
7 CFR 457.159 - Stonefruit crop insurance provisions.
2010-01-01
... selling through an on-farm or roadside stand, farmer's market, and permitting the general public to enter...); (f) That are grown in an orchard that, if inspected, is considered acceptable by us; and (g) That... or to determine the condition of the orchard. (2) The calendar date for the end of the insurance...
Oil pollution: A danger to the marine food web
Digital Repository Service at National Institute of Oceanography (India)
Gajbhiye, S
stream_size 9 stream_content_type text/plain stream_name Mahasagar_Samsadhan_1994_159.pdf.txt stream_source_info Mahasagar_Samsadhan_1994_159.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...
Is chloroplast import of photosynthesis proteins facilitated by an actin-TOC-TIC-VIPP1 complex?
Jouhet, Juliette; Gray, John C
2009-10-01
Actin filaments are major components of the cytoskeleton that interact with chloroplast envelope membranes to allow chloroplast positioning and movement, stromule mobility and gravitropism perception. We recently reported that Toc159, a component of the TOC complex of the chloroplast protein import apparatus, interacts directly with actin. The interaction of Toc159 and actin was identified by co-immunoprecipitation and co-sedimentation experiments with detergent-solubilised pea chloroplast envelope membranes. In addition, many of the components of the TOC-TIC protein import apparatus and VIPP1 (vesicle-inducing protein in plastids 1) were identified by mass spectroscopy in the material co-immunoprecipitated with antibodies to actin. Toc159 is the receptor for the import of photosynthesis proteins and VIPP1 is involved in thylakoid membrane formation by inducing vesicle formation from the chloroplast inner envelope membrane, suggesting we may have identified an actin-TOC-TIC-VIPP1 complex that may provide a means of channeling cytosolic preproteins to the thylakoid membrane. The interaction of Toc159 with actin may facilitate exchange between the putative soluble and membrane forms of Toc159 and promote the interaction of cytosolic preproteins with the TOC complex.
76 FR 2745 - Federal Aviation Administration
2011-01-14
... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Eighty-Fourth Meeting: RTCA Special Committee 159: Global Positioning System (GPS) AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of RTCA Special Committee 159 meeting: Global Positioning System (GPS). SUMMARY: The FAA is...
Analysing Drug Oversue in a Prescription database: estimation Method Matters
DEFF Research Database (Denmark)
Andersen, Morten; Søndergaard, Jens
2004-01-01
20 th International Conference on Pharmacoepiemiology and Risk Management. Bordeaux, France. Pharmacoepidemiology and Drug Safety, 2004;13:Sl 1:159......20 th International Conference on Pharmacoepiemiology and Risk Management. Bordeaux, France. Pharmacoepidemiology and Drug Safety, 2004;13:Sl 1:159...
Excavation of the legendary city of Dwarka in the Arabian Sea
Digital Repository Service at National Institute of Oceanography (India)
Rao, S.R.
stream_size 40 stream_content_type text/plain stream_name J_Mar_Archaeol_1_59.pdf.txt stream_source_info J_Mar_Archaeol_1_59.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...
Macro and meiofaunal abundance in six sandy beaches of Lakshadweep islands
Digital Repository Service at National Institute of Oceanography (India)
Ansari, Z.A; Ramani, P.; Rivonker, C.U.; Parulekar, A
stream_size 6 stream_content_type text/plain stream_name Indian_J_Mar_Sci_19_159.pdf.txt stream_source_info Indian_J_Mar_Sci_19_159.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...
Digital Repository Service at National Institute of Oceanography (India)
Anil, A.C.; Chiba, K.; Okamoto, K.; Kurokura, H.
stream_size 8 stream_content_type text/plain stream_name Mar_Ecol_Prog_Ser_118_159.pdf.txt stream_source_info Mar_Ecol_Prog_Ser_118_159.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...
Paalman, Carmen; van Domburgh, Lieke; Stevens, Gonneke; Vermeiren, Robert; van de Ven, Peter; Branje, Susan; Frijns, Tom; Meeus, Wim; Koot, Hans; van Lier, Pol; Jansen, Lucres; Doreleijers, Theo
2015-01-01
This longitudinal study explores differences between native Dutch and immigrant Moroccan adolescents in the relationship between internalizing and externalizing problems across time. By using generalized estimating equations (GEE), the strength and stability of associations between internalizing and externalizing problems in 159 Moroccan and 159…
Czech Academy of Sciences Publication Activity Database
Tenorio-Tagle, G.; Silich, S.; Martínez-Gonzáléz, Sergio; Munoz-Tunon, C.; Palouš, Jan; Wünsch, Richard
2013-01-01
Roč. 778, č. 2 (2013), 159/1-159/6 ISSN 0004-637X R&D Projects: GA ČR GAP209/12/1795 Institutional support: RVO:67985815 Keywords : dust * extinction * galaxie Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 6.280, year: 2013
Co-fluctuation among bird species in their migration timing
Czech Academy of Sciences Publication Activity Database
Hubálek, Zdeněk
2005-01-01
Roč. 54, 1-2 (2005), s. 159-164 ISSN 0139-7893 Institutional research plan: CEZ:AV0Z60930519 Keywords : migratory birds * phenology * spring arrival Subject RIV: EG - Zoology Impact factor: 0.585, year: 2005 http://www.ivb.cz/folia/54/1-2/159-164.pdf
2010-10-13
... (or a remittance voucher form in lieu of an advice form) must accompany any payment to the Federal... Collection; Form 159-E, Remittance Voucher; and Form 159-W, Interstate Telephone Service Provider Worksheet. Type of Review: Extension of a currently approved collection. Respondents: Individuals or households...
Suzuki, Yusuke; Nagasawa, Ryo; Senpuku, Hidenobu
2017-09-01
Streptococcus mutans produces glucosyltransferases encoded by the gtfB and gtfC genes, which synthesize insoluble glucan, and both insoluble and soluble glucans by conversion of sucrose, and are known as principal agents to provide strong biofilm formation and demineralization on tooth surfaces. S. mutans possess a Com-dependent quorum sensing (QS) system, which is important for survival in severe conditions. The QS system is stimulated by the interaction between ComD {Receptor to competence-stimulating peptide (CSP)} encoded by the comD and CSP encoded by the comC, and importantly associated with bacteriocin production and genetic competence. Previously, we found enzyme fructanase (FruA) as a new inhibitor for the glucan-dependent biofilm formation. In the present study, inhibiting effects by FruA on glucan-independent biofilm formation of S. mutans UA159, UA159.gtfB - , UA159.gtfC - , and UA159.gtfBC - were observed in sucrose and no sucrose sugars-supplemented conditions using the plate assay. The reduction of UA159.comC - and UA159.comD - biofilm formation were also observed as compared with UA159 in same conditions. These results suggested that inhibitions of glucan-independent and Com-dependent biofilm formation were involved in the inhibiting mechanism by FruA. To more thoroughly investigate effects by FruA on the QS system, we examined on CSP-stimulated and Com-dependent bacteriocin production and genetic transformation. FruA inhibited bacteriocin production in collaboration with CSP and genetic transformation in bacterial cell conditions treated with FruA. Our findings show that FruA has multiple effects that inhibit survival functions of S. mutans, including biofilm formation and CSP-dependent QS responses, indicating its potential use as an agent for prevention of dental caries. Copyright © 2017 Japanese Society of Chemotherapy and The Japanese Association for Infectious Diseases. Published by Elsevier Ltd. All rights reserved.
2011-02-10
... electronically file a payment. A remittance advice form (or a remittance voucher form in lieu of an advice form... Advice Bill for Collection; Form 159-E, Remittance Voucher; and Form 159-W, Interstate Telephone Service Provider Worksheet. Type of Review: Extension of a currently approved collection. Respondents: Individuals...
Estimation of the contribution of gaps to tritium retention in the divertor of ITER
Czech Academy of Sciences Publication Activity Database
Matveev, D.; Kirschner, A.; Schmid, K.; Litnovsky, A.; Borodin, D.; Komm, Michael; Van Oost, G.; Samm, U.
-, T159 (2014), 014063-014063 ISSN 0031-8949 Institutional support: RVO:61389021 Keywords : plasma * tokamak * tritium retention * ITER * castellated surfaces * gaps * divertor * impurity deposition Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.126, year: 2014 http://iopscience.iop.org/1402-4896/2014/T159/014063/
International Nuclear Information System (INIS)
Heldal, Hilde Elise; Vikebø, Frode; Johansen, Geir Odd
2013-01-01
Dispersal of 137 Cs from the nuclear submarine wrecks Komsomolets and K-159, which are resting on the seabed in the Norwegian and Barents Seas, respectively, is simulated using realistic rates and hypothetical scenarios. Furthermore, spatiotemporal 137 Cs concentrations in Northeast Arctic cod and capelin are estimated based on survey data. The results indicate that neither continuous leakages nor pulse discharges will cause concentrations of 137 Cs in cod muscle or whole body capelin exceeding the intervention level of 600 Bq/kg fw. Continuous leakages from Komsomolets and K-159 and pulse discharges from Komsomolets induced negligible activity concentrations in cod and capelin. A pulse discharge of 100% of the 137 Cs-inventory of K-159 will, however, result in concentrations in muscle of cod of above 100 times the present levels in the eastern Barents Sea. Within three years after the release, 137 Cs levels above 20 Bq/kg fw in cod are no longer occurring in the Barents Sea. -- Highlights: •The dispersal of 137 Cs from the wrecks of Komsomolets and K-159 are simulated. •The submarine wrecks are resting on the seabed in the Norwegian and Barents Seas. •Both realistic rates of discharges and what-if scenarios are simulated. •Concentrations of 137 Cs are estimated in observational records of cod and capelin. •Only pulse discharges from K-159 causes high 137 Cs concentrations in cod and capelin. -- A pulse discharge of 137 Cs from K-159 may cause concentrations in muscle of cod up to 63 and 123 Bq/kg fresh weight in the near-surface and near-bottom layer, respectively
Rare-earth metal prices in the USA ca. 1960 to 1994
Hedrick, James B.
1997-01-01
Rare-earth metal prices were compiled from the late 1950s and early 1960s through 1994. Although commercial demand for rare-earth metals began in 1908, as the alloy mischmetal, commercial quantities of a wide range of individual rare-earth metals were not available until the late 1950s. The discovery of a large, high-grade rare-earth deposit at Mountain Pass. CA, USA, in 1949, was significant because it led to the production of commercial quantities or rare-earth elements that reduced prices and encouraged wider application of the materials. The availability of ore from Mountain Pass, and other large rare-earth deposits, especially those in Australia and China, has provided the world with abundant resources for rare-earth metal production. This availability, coupled with improved technology from Government and private-sector metallurgical research, has resulted in substantial decreases in rare-earth metal prices since the late 1950s and early 1960s. Price series for the individual rare-earth metals (except promethium) are quoted on a kilogram basis from the late 1950s and early 1960s through 1994. Prices are given in US dollars on an actual and constant dollar basis. Industrial and economic factors affecting prices during this time period are examined.
AJNT volume 5 issue 3 [Sep 2012].indd
African Journals Online (AJOL)
159. Arab Journal of Nephrology and Transplantation. Arab Journal of Nephrology and Transplantation. 2012 Sep;5(3):159-61. Case report. AJNT. Abstract. Introduction: The Saharan horned viper (Cerastes cerastes) is a common snake in the sandy and rocky regions in the south of Morocco. Although nearly all snakes with.
Does the Current 20th Century Navy Personnel Management System Meet 21st Century Sailors’ Needs
2003-04-01
49 Personnel Management and Labor Economics Literature . . . . 56 Technical Reports of Defense Manpower Analysis...4. MANPOWER MODELING AND PERSONNEL CHARACTERISTICS 159 Labor Economics and Requirements Determination . . . . . . 159...assigned in courses. The second grouping concerns the key ideas of other authors on the subjects of personnel management and labor economics . Although the
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics; Volume 69; Issue 2. Issue front cover thumbnail. Volume 69, Issue 2. August 2007, pages 159-316. pp 159-166 Research Articles. Bianchi Type-I, V and VIo models in modified generalized scalar–tensor theory · T Singh R Chaubey · More Details Abstract Fulltext PDF.
Proceedings – Mathematical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Proceedings – Mathematical Sciences; Volume 118; Issue 2. Issue front cover thumbnail. Volume 118, Issue 2. May 2008, pages 159-320. pp 159-160. Note on Plagiarism · Gadadhar Misra N Mukunda · More Details Fulltext PDF. pp 161-182 Invited Article. Large Deviations: An Introduction to 2007 Abel ...
Bulletin of Materials Science | News
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science; Volume 23; Issue 3. Issue front cover thumbnail. Volume 23, Issue 3. June 2000, pages 159-238. pp 159-163 Nanomaterials. A note on the use of ellipsometry for studying the kinetics of formation of self-assembled monolayers · Murali Sastry · More Details Abstract Fulltext PDF.
Czech Post-industrial Landscapes in the Border Zone with Austria: Identification, Typology nad Value
Czech Academy of Sciences Publication Activity Database
Kolejka, Jaromír; Klimánek, M.; Hrádek, Mojmír; Kirchner, Karel
2017-01-01
Roč. 159, č. 159 (2017), s. 221-242 ISSN 0029-9138 R&D Projects: GA AV ČR IAA300860903 Institutional support: RVO:68145535 Keywords : post-industrial landscape * mapping * GIS * border zone with Austria * classification Subject RIV: DE - Earth Magnetism, Geodesy, Geography OBOR OECD: Physical geography Impact factor: 0.167, year: 2016
Politsei ostab ja rendib 159 uut teenistusautot / Kadri Põldaru
Põldaru, Kadri
2005-01-01
Politseiamet sõlmib lepingu firmadega Amserv Auto ja Elke Auto, ostes nendelt ühispakkumise alusel 59 Toyota Corollat. 100 Nissan Primera kasutusrendiks sõlmib politsei lepingu AS-iga Balti Liising
Test of ground-based lidar instrument WLS7-159
DEFF Research Database (Denmark)
Gómez Arranz, Paula; Wagner, Rozenn
This report presents the result of the test performed for the given Windcube at DTU’s test site for large wind turbine at Høvsøre, Denmark. The test aims at establishing a relation between the reference wind measurements and corresponding lidar wind indications, and evaluating a set of quality...
33 CFR 159.126 - Coliform test: Type II devices.
2010-07-01
... follows: During each of the 10 test days, one sample must be taken at the beginning, middle and end of an 8-consecutive hour period with one additional sample taken immediately following the peak capacity...: Type II devices. (a) The arithmetic mean of the fecal coliform bacteria in 38 of 40 samples of effluent...
33 CFR 159.123 - Coliform test: Type I devices.
2010-07-01
... as follows: During each of the 10-test days, one sample must be taken at the beginning, middle, and end of an 8-consecutive hour period with one additional sample taken immediately following the peak...: Type I devices. (a) The arithmetic mean of the fecal coliform bacteria in 38 of 40 samples of effluent...
27_159 - 166_Abdullahi et al.,_Manuscript for BAJOPAS
African Journals Online (AJOL)
user pc
2017-12-02
Dec 2, 2017 ... L STEM BARK EXTRACTS OF Jatropha curcas (Physic Nut). , Amina Shehu1, Ibrahim ... bial, anti-inflammatory, principles .... 5% parasitemia erythrocytes and mixed thoroughly. The sensitivity of ..... plasma membrane bebs in hepatocytes. Hepatology ... Antimicrobial screening and stability studies of crude ...
159 Aspects technico-économiques de la transformation de ...
African Journals Online (AJOL)
PR BOKO
plant species used as non-timber forest products such as timber and in public Savè and Glazoué in the hills department .... Par rapport aux vendeurs des objets de vannerie, les enquêtes ont été faites dans les marchés les arrêts de ... Dans la commune de Glazoué, l'enquête a été faite à Tiho et dans le marché de Glazoué.
Publications | Page 159 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Japan's System of Official Development Assistance. Une contribution des plus précieuses non seulement aux milieux de la coopération au service du développement dans le monde, mais aussi aux milieux universitaires en général qui aident à comprendre l'APD du Japon – Kimio Fujita, Président, Agence japonaise de ...
27_159 - 166_Abdullahi et al.,_Manuscript for BAJOPAS
African Journals Online (AJOL)
user pc
2017-12-02
Dec 2, 2017 ... nd ethanol stem bark extracts of Jatropha curcas were effective against er, the aqueous extract ... quality biodiesel fuel el engine (Agbogidi et .... erythrocytes appearing as blue discoid cells containing life rings of the parasite ...
All projects related to | Page 159 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2012-12-21
Displaying 1581 - 1590 of 6834. Catalyzing Broadband Internet in Africa. Project. This project aims to inform policies that help marginalized groups in Africa, such as women and the poor, to take advantage of the social and economic opportunities of broadband Internet. ... Start Date: December 21, 2012. Topic: VIOLENCE ...
159 THE ROLE OF MUSIC AND MUSICIANS IN PROMOTING ...
African Journals Online (AJOL)
User
instability, musicians and music have a holistic role to play. And this is ... musicians useful, so that the child grows up a responsible ... endearing messages of body movements… ... In a similar development, he encouraged people never to be.
Prokopowicz, Małgorzata; Greń, Bartosz; Cieśla, Joanna; Kierdaszuk, Borys
2017-11-01
The aim of this study is threefold: (1) augmentation of the knowledge of the E. coli PNP binding mechanism; (2) explanation of the previously observed 'lack of FRET' phenomenon and (3) an introduction of the correction (modified method) for FRET efficiency calculation in the PNP-FA complexes. We present fluorescence studies of the two E. coli PNP mutants (F159Y and F159A) with formycin A (FA), that indicate that the aromatic amino acid is indispensable in the nucleotide binding, additional hydroxyl group at position 159 probably enhances the strength of binding and that the amino acids pair 159-160 has a great impact on the spectroscopic properties of the enzyme. The experiments were carried out in hepes and phosphate buffers, at pH7 and 8.3. Two methods, a conventional and a modified one, that utilizes the dissociation constant, for calculations of the energy transfer efficiency (E) and the acceptor-to-donor distance (r) between FA and the Tyr (energy donor) were employed. Total difference spectra were calculated for emission spectra (λ ex 280nm, 295nm, 305nm and 313nm) for all studied systems. Time-resolved techniques allowed to conclude the existence of a specific structure formed by amino acids at positions 159 and 160. The results showed an unexpected pattern change of FRET in the mutants, when compared to the wild type enzyme and a probable presence of a structure created between 159 and 160 residue, that might influence the binding efficiency. Additionally, we confirmed the indispensable role of the modification of the FRET efficiency (E) calculation on the fraction of enzyme saturation in PNP-FA systems. Copyright © 2017 Elsevier B.V. All rights reserved.
Evaluation of care of the Newborn in delivery facilities at Osogbo ...
African Journals Online (AJOL)
All the 159(100.0%) neonates delivered at the State and Teaching hospitals received administration of vitamin k, while all the 34(100.0%) neonates delivered at other health facilities, did not receive vitamin k. The differences between the greater proportion of all the 159(100.0%) neonates delivered at the state and teaching ...
Production of a tracer packet of heavier rare earth elements
International Nuclear Information System (INIS)
Lahiri, S.; Nayak, D.; Maji, S.
2004-01-01
Production of a tracer packet of heavier rare earth elements containing carrier-free radionuclides of 153,155 Tb, 153,155,157 Dy, 159 Ho, 159,161 Er, 161 Tm produced by medium energy 7 Li and 12 C irradiation on an europium oxide target and the subsequent separation of bulk europium from the carrier-free products is described. (author)
Spin vector and shape of (6070) Rheinland and their implications
Czech Academy of Sciences Publication Activity Database
Vokrouhlický, D.; Ďurech, J.; Polishook, D.; Krugly, Yu. N.; Gaftonyuk, N. M.; Burkhonov, O.A.; Ehgamberdiev, S.A.; Karimov, R.; Molotov, I.E.; Pravec, Petr; Hornoch, Kamil; Kušnirák, Peter; Oey, J.; Galád, A.; Žižka, J.
2011-01-01
Roč. 142, č. 5 (2011), 159/1-159/8 ISSN 0004-6256 R&D Projects: GA ČR GA205/09/1107 Grant - others:GA ČR(CZ) GA205/08/0064 Institutional research plan: CEZ:AV0Z10030501 Keywords : minor planets * asteroids * ganeral Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.035, year: 2011
2011-04-12
... Co. ( 37-119-1009). Rowan County (NC) 301 West St. & Gold 0.084 0.071 0.077 0.077 Hill Ave. (37-159...). Rowan County (NC) 301 West St & Gold 93 91 95 93 Hill Ave. (37-159- 0021). Rowan County (NC) 925 N... 40 CFR Part 52 Environmental protection, Air pollution control, Intergovernmental relations, Oxides...
Czech Academy of Sciences Publication Activity Database
Nagyová, Eva; Camaioni, A.; Procházka, Radek; Day, A. J.; Salustri, A.
2005-01-01
Roč. 72, Special Issue (2005), s. 159-159 ISSN 0006-3363. [Annual meeting of the society for the study of reproduction /38./. 24.07.2005-27.07.2005, Quebec] R&D Projects: GA ČR GA305/05/0960 Institutional research plan: CEZ:AV0Z50450515 Keywords : porcine follicle Subject RIV: EB - Genetics ; Molecular Biology
Directory of Open Access Journals (Sweden)
Benjamin B. Kasten
2018-03-01
Full Text Available Triple-negative breast cancer (TNBC is an aggressive subtype of breast cancer with a poor prognosis. There is a clinical need for effective, targeted therapy strategies that destroy both differentiated TNBC cells and TNBC cancer initiating cells (CICs, as the latter are implicated in the metastasis and recurrence of TNBC. Chondroitin sulfate proteoglycan 4 (CSPG4 is overexpressed on differentiated tumor cells and CICs obtained from TNBC patient specimens, suggesting that CSPG4 may be a clinically relevant target for the imaging and therapy of TNBC. The purpose of this study was to determine whether α-particle radioimmunotherapy (RIT targeting TNBC cells using the CSPG4-specific monoclonal antibody (mAb 225.28 as a carrier was effective at eliminating TNBC tumors in preclinical models. To this end, mAb 225.28 labeled with 212Pb (212Pb-225.28 as a source of α-particles for RIT was used for in vitro Scatchard assays and clonogenic survival assays with human TNBC cells (SUM159 and 2LMP grown as adherent cells or non-adherent CIC-enriched mammospheres. Immune-deficient mice bearing orthotopic SUM159 or 2LMP xenografts were injected i.v. with the targeted (225.28 or irrelevant isotype-matched control (F3-C25 mAbs, labeled with 99mTc, 125I, or 212Pb for in vivo imaging, biodistribution, or tumor growth inhibition studies. 212Pb-225.28 bound to adherent SUM159 and 2LMP cells and to CICs from SUM159 and 2LMP mammospheres with a mean affinity of 0.5 nM. Nearly ten times more binding sites per cell were present on SUM159 cells and CICs compared with 2LMP cells. 212Pb-225.28 was six to seven times more effective than 212Pb-F3-C25 at inhibiting SUM159 cell and CIC clonogenic survival (p < 0.05. Radiolabeled mAb 225.28 showed significantly higher uptake than radiolabeled mAb F3-C25 in SUM159 and 2LMP xenografts (p < 0.05, and the uptake of 212Pb-225.28 in TNBC xenografts was correlated with target epitope expression. 212Pb-225.28 caused dose
DEFF Research Database (Denmark)
Pless, Stephan Alexander; Hanek, Ariele P; Price, Kerry L
2011-01-01
. In the current study, we investigated whether the lower efficacy agonists of the human GlyR β-alanine and taurine also form cation-π interactions with Phe159. By incorporating a series of unnatural amino acids, we found cation-π interactions between Phe159 and the amino groups of β-alanine and taurine....... The strengths of these interactions were significantly weaker than for glycine. Modeling studies suggest that β-alanine and taurine are orientated subtly differently in the binding pocket, with their amino groups further from Phe159 than that of glycine. These data therefore show that similar agonists can have...... similar but not identical orientations and interactions in the binding pocket and provide a possible explanation for the lower potencies of β-alanine and taurine....
Průzkum historických materiálů s využitím rentgenové radiografie a tomografie
Czech Academy of Sciences Publication Activity Database
Kumpová, Ivana; Vavřík, Daniel; Vopálenský, Michal
2017-01-01
Roč. 2017, č. 1 (2017), s. 159-159 ISSN 1805-0050. [Konference konzervátorů-restaurátorů. 19.09.2017-21.09.2017, Litomyšl] EU Projects: European Commission(XE) ATCZ38 - Com3d-XCT Keywords : X-Ray imaging * X-Ray tomography * TORATOM * historical materials * non-destructive testing Subject RIV: AL - Art, Architecture, Cultural Heritage OBOR OECD: Arts, Art history
Přivítejte ve výuce mikroskopy se skenující sondou
Czech Academy of Sciences Publication Activity Database
Hájková, Zdeňka; Fejfar, Antonín; Ledinský, Martin; Píč, Vlastimil; Křížek, Filip; Šulc, D.; Nováček, Z.; Wertheimer, P.
2016-01-01
Roč. 110, č. 2 (2016), s. 153-159 ISSN 0009-2770 R&D Projects: GA ČR GA14-15357S; GA MŠk(CZ) LM2011026 Institutional support: RVO:68378271 Keywords : scanning probe microscopy * scanning tunnelling microscopy * atomic force microscopy * models * demonstrations * analogies * education al materials Subject RIV: AM - Education Impact factor: 0.387, year: 2016 http://chemicke-listy.cz/docs/full/2016_02_153-159.pdf
1991-01-01
Rudolf Miiller, A combinatorial approach to obtain bounds for stochastic project neworka, Tech. report, Technische Universitit Berlin, 1991. [Pou851 M...appear). 600 ANDRZEJ PROSKUROWSKI [201 J.A. Wald and C.J. Colbourn, Steiner trees, partial 2-trees, and minimum IFI networks, Networks 13 (1983), 159-167...Colbourn, Steiner trees, partial 2-trees and minimum IFI networks, Networks 13, (1983), 159-167. DEPARTMENT OF COMPUTER SCIENCE, UNIVERSITY OF
Shen, Shicai; Xu, Gaofeng; Clements, David Roy; Jin, Guimei; Zhang, Fudou; Tao, Dayun; Xu, Peng
2016-01-01
The competitive and allelopathic effects of wild rice (Oryza longistaminata) accessions on barnyard grass at different growth stages determined by days after sowing (0, 30, 60 and 90 days) were studied in greenhouse pot experiments. Wild rice accession RL159 exhibited the greatest height and tillering. The weed suppression rates of wild rice accessions OL and F1 on barnyard grass were significantly higher than for other rice accessions, with the lowest being O. sativa cultivar RD23. The highest suppression rates of OL and F1 were 80.23 and 73.96% at barnyard grass growth stages of 90 days and 60 days. At a 90 growth stage, wild rice accessions RL159 and RL169 caused 61.33 and 54.51% inhibition in barnyard grass growth, respectively. Under the same conditions, the competitive inhibition rates of OL, F1, RL159, RL169 and RL219 against barnyard grass were markedly lower than their weed suppressive effects, but were relatively similar for RD23. The allelopathic inhibition of OL and F1 on barnyard grass was significantly higher than other rice accessions. The highest allelopathic rates of OL and F1 were 60.61 and 56.87% at the 0 day growth stage. It is concluded that wild rice accessions OL and F1 exhibited the highest allelopathic activity along with moderate competitive ability against barnyard grass; wild rice accession RL159 had the highest competitive ability and moderate allelopathic activity on barnyard grass. Thus, the three wild rice accessions OL, F1 and RL159 could be used as ideal breeding materials for cultivated rice improvement.
International Nuclear Information System (INIS)
Heldal, Hilde Elise; Vikebø, Frode; Johansen, Geir Odd
2012-01-01
Dispersal of 137 Cs from Komsomolets and K-159 is simulated using realistic rates and hypothetical scenarios. Furthermore, spatiotemporal 137 Cs concentrations in Northeast Arctic cod and capelin are estimated based on survey data. The results indicate that only pulse discharges from K-159 will cause concentrations of 137 Cs in cod muscle exceeding the intervention level of 600 Bq/kg fresh weight. A discharge of ≥10% of the 137 Cs-inventory will result in concentrations in muscle of cod exceeding the intervention level for approximately two years. In fact, a discharge of 10% of the 137 Cs-inventory results in an overlap of 8–30% between the different size groups of cod and levels that exceed the intervention level during the first year after the discharge. For capelin, individuals less than one year old during the first year after a discharge are more likely to be severely affected by discharges comprising ≥50% of the inventory. - Highlights: ► The dispersal of 137 Cs from the wrecks of Komsomolets and K-159 are simulated. ► The submarine wrecks are resting on the seabed in the Norwegian and Barents Seas. ► Both realistic rates of discharges and what-if scenarios are simulated. ► Concentrations of 137 Cs are estimated in observational records of cod and capelin. ► Only pulse discharges from K-159 causes high 137 Cs concentrations in cod and capelin. - A leakage of 137 Cs from K-159 may cause concentrations in muscle of cod exceeding the intervention level of 600 Bq/kg fresh weight for up to two years after the leakage.
International Nuclear Information System (INIS)
Furusawa, Yoshiya; Maezawa, Hiroshi; Suzuki, Kenshi; Kobayashi, Katsumi; Suzuki, Masao; Hieda, Kotaro
1992-01-01
Killing effect on bacteriophage T1 by the Auger cascade of phosphorus in DNA following K shell photoabsorption was studied with monoenergetic X rays obtained from synchrotron radiations. Phages embedded in nutrient broth were irradiated under vacuum with X rays at the resonance peak (2,153 eV), and below (2,147 eV) and above (2,159 eV) the peak. The corresponding mean lethal exposures (D 0 ) were 554, 332 and 434 kR, respectively. The Auger enhancements, as an energy dependent fractional increment of phase sensitivity, were 0.67 at 2,153 eV and 0.28 at 2,159 eV. Using the DNA absorption spectrum measured in this experiment, photoionization cross sections of Scofield (17), and the Auger yield after creation of a K shell vacancy, the number of phosphorus Auger cascades in one phage DNA at D 0 were calculated to be 0.00, 0.98 and 0.25 at 2,147, 2,153 and 2,159 eV, respectively. Comparison between the Auger enhancement of phage killing and the number of Auger cascades indicated that one phosphorus Auger cascade in phage DNA caused about 0.41 (at 2,153 eV) or 0.84 (at 2,159 eV) lethal events
40 CFR 159.184 - Toxic or adverse effect incident reports.
2010-07-01
... site (e.g., home, yard, commercial turf, agricultural (specify crop), industrial, building/office... domestic animal: (A) Type of animal (e.g., livestock, poultry, bird, fish, household pet e.g., dog/cat etc...
People’s Republic of China Scientific Abstracts, Number 159
1976-12-14
down sensation in the anal canal, lower abdominal pain and distension , borborygmus, urgency, and sudden passage of large amounts of fowl smelling...cases; bleeding from incompletely thrombosed artery after slough in 4 cases; injection of too large quantity or too deep causing muscular layer slough...reactions to treatment occurred. They included: sudden capillary distension , scattered red patches, foreign body rejection reaction and secondary
Television Programming, Monopolistic Competition and Welfare. Technical Report No. 159.
Spence, Michael; Owen, Bruce
An economic analysis of television programing was conducted focusing on the public welfare implications of alternative market structures and policies in the broadcasting industry. Welfare was measured by the sum of producer's and consumer's surplus. It was demonstrated that any of the private market systems considered contain biases against…
46 CFR 159.010-3 - Independent laboratory: Standards for acceptance.
2010-10-01
... engaged, as a regular part of its business, in performing inspections and tests that are the same as or... manufacturer; (4) Not be dependent on Coast Guard acceptance under this subchapter to remain in business; and (5) Not advertise or promote the manufacturer's equipment or material that the laboratory inspects...
DEFF Research Database (Denmark)
Andersen, Lars L.; Fallentin, Nils; Thorsen, Sannie Vester
2016-01-01
with a bent or twisted back (HR 1.59 (95% CI 1.39 to 1.83)), arms above shoulder height (HR 1.35 (95% CI 1.14 to 1.59)), squatting or kneeling (HR 1.30 (95% CI 1.09 to 1.54)), pushing/pulling or lifting/carrying (HR 1.40 (95% CI 1.22 to 1.62)) and standing in the same place for 50% or more of total work time...
Effects of missense mutations in sortase A gene on enzyme activity in Streptococcus mutans.
Zhuang, P L; Yu, L X; Tao, Y; Zhou, Y; Zhi, Q H; Lin, H C
2016-04-11
Streptococcus mutans (S. mutans) is the major aetiological agent of dental caries, and the transpeptidase Sortase A (SrtA) plays a major role in cariogenicity. The T168G and G470A missense mutations in the srtA gene may be linked to caries susceptibility, as demonstrated in our previous studies. This study aimed to investigate the effects of these missense mutations of the srtA gene on SrtA enzyme activity in S. mutans. The point mutated recombinant S.mutans T168G and G470A sortases were expressed in expression plasmid pET32a. S. mutans UA159 sortase coding gene srtA was used as the template for point mutation. Enzymatic activity was assessed by quantifying increases in the fluorescence intensity generated when a substrate Dabcyl-QALPNTGEE-Edans was cleaved by SrtA. The kinetic constants were calculated based on the curve fit for the Michaelis-Menten equation. SrtA△N40(UA159) and the mutant enzymes, SrtA△N40(D56E) and SrtA△N40(R157H), were expressed and purified. A kinetic analysis showed that the affinity of SrtA△N40(D56E) and SrtA△N40(R157H) remained approximately equal to the affinity of SrtA△N40(UA159), as determined by the Michaelis constant (K m ). However, the catalytic rate constant (k cat ) and catalytic efficiency (k cat /K m ) of SrtA△N40(D56E) were reduced compared with those of SrtA△N40(R157H) and SrtA△N40(UA159), whereas the k cat and k cat /K m values of SrtA△N40(R157H) were slightly lower than those of SrtA△N40(UA159). The findings of this study indicate that the T168G missense mutation of the srtA gene results in a significant reduction in enzymatic activity compared with S. mutans UA159, suggesting that the T168G missense mutation of the srtA gene may be related to low cariogenicity.
The Fitness Cost of Fluoride Resistance for Different Streptococcus mutans Strains in Biofilms
Directory of Open Access Journals (Sweden)
Yanling Cai
2017-08-01
Full Text Available The cariogenic bacterium Streptococcus mutans can develop stable resistance to fluoride through chromosomal mutations in vitro. Fluoride-resistant S. mutans has seldom been isolated in clinical settings, despite the wide application of fluoride in oral-care products. One explanation is that the fluoride-resistant S. mutans strains have decreased fitness. However, so far, there has been no conclusive evidence to support this idea. The aim of this study was to investigate the fitness cost of 48-h biofilms of two fluoride-resistant S. mutans strains, UF35 and UA159-FR (UAFR, using the wild-type fluoride-sensitive strain UA159 as a reference. The engineered UF35 strain contains one point mutation, whereas UAFR, selected from NaF-containing agar plates, has multiple chromosomal mutations. All biofilms were formed for 48 h under a constantly neutral pH or a pH-cycling (8 h of neutral pH and 16 h of pH 5.5 condition in the absence of fluoride. The biomass of the biofilms was quantified with a crystal violet assay. The biofilms were also treated with chlorhexidine or solutions at pH 3.0, after which their lactic acid production was quantified. Compared to the UF35 and UA159 biofilms, the biomass of UAFR biofilms was two–four fold higher, and the UAFR biofilms were more resistant to chlorhexidine and low pH in terms of lactic acid production. No difference in biomass and lactic acid production was detected between UF35 and UA159 biofilms. The fluoride resistance of UAFR and UF35 strains in biofilms was further confirmed by treating the biofilms with NaF solutions. The level of NaF resistance of the three biofilms is generally ranked as follows: UAFR > UF35 > UA159. In conclusion, there is indeed a fitness consequence in UAFR, but surprisingly, this fluoride-resistant strain performs better than UF35 and UA159 under the described conditions. In addition, UF35 did not display a reduced fitness; it performed as well as the wild-type fluoride
Directory of Open Access Journals (Sweden)
Paul Walsh
2014-11-01
Full Text Available Objectives. To measure inter-rater agreement of overall clinical appearance of febrile children aged less than 24 months and to compare methods for doing so.Study Design and Setting. We performed an observational study of inter-rater reliability of the assessment of febrile children in a county hospital emergency department serving a mixed urban and rural population. Two emergency medicine healthcare providers independently evaluated the overall clinical appearance of children less than 24 months of age who had presented for fever. They recorded the initial ‘gestalt’ assessment of whether or not the child was ill appearing or if they were unsure. They then repeated this assessment after examining the child. Each rater was blinded to the other’s assessment. Our primary analysis was graphical. We also calculated Cohen’s κ, Gwet’s agreement coefficient and other measures of agreement and weighted variants of these. We examined the effect of time between exams and patient and provider characteristics on inter-rater agreement.Results. We analyzed 159 of the 173 patients enrolled. Median age was 9.5 months (lower and upper quartiles 4.9–14.6, 99/159 (62% were boys and 22/159 (14% were admitted. Overall 118/159 (74% and 119/159 (75% were classified as well appearing on initial ‘gestalt’ impression by both examiners. Summary statistics varied from 0.223 for weighted κ to 0.635 for Gwet’s AC2. Inter rater agreement was affected by the time interval between the evaluations and the age of the child but not by the experience levels of the rater pairs. Classifications of ‘not ill appearing’ were more reliable than others.Conclusion. The inter-rater reliability of emergency providers’ assessment of overall clinical appearance was adequate when described graphically and by Gwet’s AC. Different summary statistics yield different results for the same dataset.
International Nuclear Information System (INIS)
Xu, Wei; Debeb, Bisrat G.; Lacerda, Lara; Li, Jessica; Woodward, Wendy A.
2011-01-01
Tetrandrine is a bisbenzylisoquinoline alkaloid found in Stephania tetrandra, a Chinese medicine commonly used as an anti-inflammatory. It has extensive pharmacological activity, including positive ion channel blockade and inhibition of multiple drug resistance proteins. These activities are very similar to that of salinomycin, a known drug targeting breast cancer initiation cells (TICs). Herein, we tested tetrandrine targeting of breast cancer TICs. SUM-149, an inflammatory breast cancer cell line and SUM-159, a non-inflammatory metaplastic breast cancer cell line were used in these studies. In proliferation assays using 3-(4,5-dimethylthiazol-2-yl)-5-(3-carboxymethoxyphenyl)-2-(4-sulfophenyl) -2H-tetrazolium (MTS), we found that the IC 50 for inhibition of proliferation is 15.3 ± 4.1 μM for SUM-149 and 24.3 ± 2.1 μM for SUM-159 cells. Tetrandrine also inhibited mammosphere formation, a surrogate for breast cancer TICs growth in vitro with IC 50 around 1 μM for SUM-149 and around 2 μM for SUM-159 cells. Tetrandrine has similar effects on the mammosphere formation from cells isolated from fresh patient sample. Moreover, tetrandrine decreases the aldehyde dehydrogenase (ALDH) positive population in SUM-159 by 45% ± 5.45% P = 0.005. In summary, tetrandrine demonstrates significant efficacy against in vitro surrogates for inflammatory and aggressive breast cancer TICs
Energy Technology Data Exchange (ETDEWEB)
Xu, Wei; Debeb, Bisrat G.; Lacerda, Lara; Li, Jessica; Woodward, Wendy A., E-mail: wwoodward@mdanderson.org [Division of Radiation Oncology, University of Texas M.D. Anderson Cancer Center, Houston, TX 77030 (United States)
2011-05-04
Tetrandrine is a bisbenzylisoquinoline alkaloid found in Stephania tetrandra, a Chinese medicine commonly used as an anti-inflammatory. It has extensive pharmacological activity, including positive ion channel blockade and inhibition of multiple drug resistance proteins. These activities are very similar to that of salinomycin, a known drug targeting breast cancer initiation cells (TICs). Herein, we tested tetrandrine targeting of breast cancer TICs. SUM-149, an inflammatory breast cancer cell line and SUM-159, a non-inflammatory metaplastic breast cancer cell line were used in these studies. In proliferation assays using 3-(4,5-dimethylthiazol-2-yl)-5-(3-carboxymethoxyphenyl)-2-(4-sulfophenyl) -2H-tetrazolium (MTS), we found that the IC{sub 50} for inhibition of proliferation is 15.3 ± 4.1 μM for SUM-149 and 24.3 ± 2.1 μM for SUM-159 cells. Tetrandrine also inhibited mammosphere formation, a surrogate for breast cancer TICs growth in vitro with IC{sub 50} around 1 μM for SUM-149 and around 2 μM for SUM-159 cells. Tetrandrine has similar effects on the mammosphere formation from cells isolated from fresh patient sample. Moreover, tetrandrine decreases the aldehyde dehydrogenase (ALDH) positive population in SUM-159 by 45% ± 5.45% P = 0.005. In summary, tetrandrine demonstrates significant efficacy against in vitro surrogates for inflammatory and aggressive breast cancer TICs.
Evidence for Roles of the Escherichia coli Hda Protein Beyond RIDA
Baxter, Jamie C.; Sutton, Mark D.
2012-01-01
The ATP-bound form of the Escherichia coli DnaA protein binds ‘DnaA boxes’ present in the origin of replication (oriC) and operator sites of several genes, including dnaA, to coordinate their transcription with initiation of replication. The Hda protein, together with the β sliding clamp, stimulates the ATPase activity of DnaA via a process termed Regulatory Inactivation of DnaA (RIDA), to regulate the activity of DnaA in DNA replication. Here, we used the mutant dnaN159 strain, which expresses the β159 clamp protein, to gain insight into how the actions of Hda are coordinated with replication. Elevated expression of Hda impeded growth of the dnaN159 strain in a Pol II- and Pol IV-dependent manner, suggesting a role for Hda managing the actions of these Pols. In a wild type strain, elevated levels of Hda conferred sensitivity to nitrofurazone, and suppressed the frequency of −1 frameshift mutations characteristic of Pol IV, while loss of hda conferred cold sensitivity. Using the dnaN159 strain, we identified 24 novel hda alleles, four of which supported E. coli viability despite their RIDA defect. Taken together, these findings suggest that although one or more Hda functions are essential for cell viability, RIDA may be dispensable. PMID:22716942
Evidence for roles of the Escherichia coli Hda protein beyond regulatory inactivation of DnaA.
Baxter, Jamie C; Sutton, Mark D
2012-08-01
The ATP-bound form of the Escherichia coli DnaA protein binds 'DnaA boxes' present in the origin of replication (oriC) and operator sites of several genes, including dnaA, to co-ordinate their transcription with initiation of replication. The Hda protein, together with the β sliding clamp, stimulates the ATPase activity of DnaA via a process termed regulatory inactivation of DnaA (RIDA), to regulate the activity of DnaA in DNA replication. Here, we used the mutant dnaN159 strain, which expresses the β159 clamp protein, to gain insight into how the actions of Hda are co-ordinated with replication. Elevated expression of Hda impeded growth of the dnaN159 strain in a Pol II- and Pol IV-dependent manner, suggesting a role for Hda managing the actions of these Pols. In a wild-type strain, elevated levels of Hda conferred sensitivity to nitrofurazone, and suppressed the frequency of -1 frameshift mutations characteristic of Pol IV, while loss of hda conferred cold sensitivity. Using the dnaN159 strain, we identified 24 novel hda alleles, four of which supported E. coli viability despite their RIDA defect. Taken together, these findings suggest that although one or more Hda functions are essential for cell viability, RIDA may be dispensable. © 2012 Blackwell Publishing Ltd.
Directory of Open Access Journals (Sweden)
Jessica Li
2011-05-01
Full Text Available Tetrandrine is a bisbenzylisoquinoline alkaloid found in Stephania tetrandra, a Chinese medicine commonly used as an anti-inflammatory. It has extensive pharmacological activity, including positive ion channel blockade and inhibition of multiple drug resistance proteins. These activities are very similar to that of salinomycin, a known drug targeting breast cancer initiation cells (TICs. Herein, we tested tetrandrine targeting of breast cancer TICs. SUM-149, an inflammatory breast cancer cell line and SUM-159, a non-inflammatory metaplastic breast cancer cell line were used in these studies. In proliferation assays using 3-(4,5-dimethylthiazol-2-yl-5-(3-carboxymethoxyphenyl-2-(4-sulfophenyl-2H-tetrazolium (MTS, we found that the IC50 for inhibition of proliferation is 15.3 ± 4.1 µM for SUM-149 and 24.3 ± 2.1 µM for SUM-159 cells. Tetrandrine also inhibited mammosphere formation, a surrogate for breast cancer TICs growth in vitro with IC50 around 1 µM for SUM-149 and around 2 µM for SUM-159 cells. Tetrandrine has similar effects on the mammosphere formation from cells isolated from fresh patient sample. Moreover, tetrandrine decreases the aldehyde dehydrogenase (ALDH positive population in SUM-159 by 45% ± 5.45% P = 0.005. In summary, tetrandrine demonstrates significant efficacy against in vitro surrogates for inflammatory and aggressive breast cancer TICs.
International Nuclear Information System (INIS)
Timofeev, V. I.; Smirnova, E. A.; Chupova, L. A.; Esipov, R. S.; Kuranova, I. P.
2012-01-01
Crystals of phosphopantetheine adenylyltransferase (PPAT) from Mycobacterium tuberculosis in the apo form and in complexes with coenzyme A (PPAT/CoA) and dephosphocoenzyme A (PPAT/dPCoA) were grown in microgravity by the capillary counter-diffusion method. The structures of PPAT Mt in the apo form and in complexes with ligands were solved based on the X-ray diffraction data collected from the grown crystals. The crystal structures were refined at 1.76, 1.59, and 1.59 Å resolution to Rf factors of 0.175, 0.159, and 0.157 and Rfree of 0.224, 0.208, and 0.206 for PPAT, PPAT/CoA, and PPAT/dPCoA, respectively. The atomic coordinates of the structures were deposited in the Protein Data Bank (PDB ID: 3RFF, 3RHS, and 3RBA). In these structures, the ligand-binding sites were determined, the environment of these sites was characterized, and the conformational changes accompanying the ligand binding were analyzed.
ORF Alignment: NC_002695 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 159 GIALGAEDYVRNLRTERSPEGTELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEA 218 ... GIALGAEDYVRNLRTERSPEGTELLFARC...SILQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...
Field, Frank R; Wallington, Timothy J; Everson, Mark; Kirchain, Randolph E
2017-12-19
A comprehensive component-level assessment of several strategic and minor metals (SaMMs), including copper, manganese, magnesium, nickel, tin, niobium, light rare earth elements (LREEs; lanthanum, cerium, praseodymium, neodymium, promethium, and samarium), cobalt, silver, tungsten, heavy rare earth elements (yttrium, europium, gadolinium, terbium, dysprosium, holmium, erbium, thulium, ytterbium, and lutetium), and gold, use in the 2013 model year Ford Fiesta, Focus, Fusion, and F-150 is presented. Representative material contents in cars and light-duty trucks are estimated using comprehensive, component-level data reported by suppliers. Statistical methods are used to accommodate possible errors within the database and provide estimate bounds. Results indicate that there is a high degree of variability in SaMM use and that SaMMs are concentrated in electrical, drivetrain, and suspension subsystems. Results suggest that trucks contain greater amounts of aluminum, nickel, niobium, and silver and significantly greater amounts of magnesium, manganese, gold, and LREEs. We find tin and tungsten use in automobiles to be 3-5 times higher than reported by previous studies which have focused on automotive electronics. Automotive use of strategic and minor metals is substantial, with 2013 vehicle production in the United States, Canada, EU15, and Japan alone accounting for approximately 20% of global production of Mg and Ta and approximately 5% of Al, Cu, and Sn. The data and analysis provide researchers, recyclers, and decision-makers additional insight into the vehicle content of strategic and minor metals of current interest.
Cosmic radiation and the Earth rotation
International Nuclear Information System (INIS)
Pil'nik, G.P.
1986-01-01
On the basis of classical astronomical observations of time, waves of nonuniformity in the Earth rotation were found. The wave with the period of 159sup(m).566 is very close to the period of global oscillations of the Sun surface 160sup(m).r-1 and to the period of the Germinga gamma-ray radiatnon 159sup(m).96. The necessity is pointed out of a detailed study of the Earth rotation in the days of great developments of astrophysical and geophysical research
ORF Alignment: NC_004307 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available uery: 121 QVPVNAIASSGTSEQALFTGAGERDKESISNMRTIAAAARKAGMEVTELIVPGAGHDW 178 ... QVPVNAIASSGTSEQALFTGAGERD...KESISNMRTIAAAARKAGMEVTELIVPGAGHDW Sbjct: 159 QVPVNAIASSGTSEQALFTGAGERDKESISNMRTIAAAARKAGMEVTELIVPGAGHDW 216
Estudo retrospectivo de afecções cirúrgicas em aves
Directory of Open Access Journals (Sweden)
Patrícia F. Castro
2013-05-01
Full Text Available Avaliaram-se retrospectivamente as cirurgias realizadas em aves no Serviço de Cirurgia de Pequenos Animais do Hospital Veterinário da Faculdade de Medicina Veterinária e Zootecnia, Universidade de São Paulo, durante período de oito anos. De um total de 90 intervenções cirúrgicas para diagnóstico e/ou tratamento de afecções, 27 foram ortopédicas e 63 de tecidos moles. Quanto ao percentual de cirurgias ortopédicas realizadas segundo as diferentes ordens, observou-se: Psittaciformes 85,19%, Piciformes 7,41%, Anseriformes 3,70% e Falconiformes 3,70%. Para as de tecidos moles os Psittaciformes representaram 92,06%, Columbiformes 3,17%, Passeriformes 3,17% e Anseriformes 1,60%. Entre os tipos de afecções ortopédicas encontradas as fraturas apresentaram a maior ocorrência (88,90%, seguidas de luxação (3,70%, avulsão traumática de extremidade (3,70% e artrite/osteomielite (3,70%. Dentre as afecções cirúrgicas de tecidos moles as neoplasias apresentaram a maior ocorrência (30,15%, seguidas das neoformações cutâneas ou de anexos não neoplásicos (17,46%, neoformações cutâneas sem diagnóstico (7,94%, distocia (7,94%, fístula de papo (7,94%, hérnia abdominal (4,76%, sinusite (4,76%, gangrena de extremidade de membros (3,17%, perfuração de esôfago (3,17%, prolapso de cloaca (3,17%, "Necrose avascular de dígito" (1,59%, ferida na região da quilha (1,59%, perfuração de cavidade celomática (1,59%, neoformação em cavidade celomática sem diagnóstico (1,59%, corpo estranho em trato gastrointestinal (1,59% e otite (1,59%. A distribuição das afecções cirúrgicas segundo as espécies acometidas mostrou o "grupo dos papagaios", representado em sua maioria por espécies do gênero Amazona, como prevalente. O conhecimento das afecções cirúrgicas e espécies de aves mais acometidas acrescentam informações para aqueles que já atuam nesta área e servem como indicador de estudo para futuros cirurgiões de aves.
Directory of Open Access Journals (Sweden)
Xiulai Chen
Full Text Available Fumarate is a well-known biomass building block compound. However, the poor catalytic efficiency of fumarase is one of the major factors preventing its widespread production. To address this issue, we selected residues 159HPND162 of fumarase from Rhizopus oryzae as targets for site-directed mutagenesis based on molecular docking analysis. Twelve mutants were generated and characterized in detail. Kinetic studies showed that the Km values of the P160A, P160T, P160H, N161E, and D162W mutants were decreased, whereas Km values of H159Y, H159V, H159S, N161R, N161F, D162K, and D162M mutants were increased. In addition, all mutants displayed decreased catalytic efficiency except for the P160A mutant, whose kcat/Km was increased by 33.2%. Moreover, by overexpressing the P160A mutant, the engineered strain T.G-PMS-P160A was able to produce 5.2 g/L fumarate. To further enhance fumarate production, the acid tolerance of T.G-PMS-P160A was improved by deleting ade12, a component of the purine nucleotide cycle, and the resulting strain T.G(△ade12-PMS-P160A produced 9.2 g/L fumarate. The strategy generated in this study opens up new avenues for pathway optimization and efficient production of natural products.
Zufferey, Mónica; Montandon, Cyrille; Douet, Véronique; Demarsy, Emilie; Agne, Birgit; Baginsky, Sacha; Kessler, Felix
2017-04-28
The biogenesis and maintenance of cell organelles such as mitochondria and chloroplasts require the import of many proteins from the cytosol, a process that is controlled by phosphorylation. In the case of chloroplasts, the import of hundreds of different proteins depends on translocons at the outer and inner chloroplast membrane (TOC and TIC, respectively) complexes. The essential protein TOC159 functions thereby as an import receptor. It has an N-terminal acidic (A-) domain that extends into the cytosol, controls receptor specificity, and is highly phosphorylated in vivo However, kinases that phosphorylate the TOC159 A-domain to enable protein import have remained elusive. Here, using co-purification with TOC159 from Arabidopsis , we discovered a novel component of the chloroplast import machinery, the regulatory kinase at the outer chloroplast membrane 1 (KOC1). We found that KOC1 is an integral membrane protein facing the cytosol and stably associates with TOC. Moreover, KOC1 phosphorylated the A-domain of TOC159 in vitro , and in mutant koc1 chloroplasts, preprotein import efficiency was diminished. koc1 Arabidopsis seedlings had reduced survival rates after transfer from the dark to the light in which protein import into plastids is required to rapidly complete chloroplast biogenesis. In summary, our data indicate that KOC1 is a functional component of the TOC machinery that phosphorylates import receptors, supports preprotein import, and contributes to efficient chloroplast biogenesis. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.
ORF Alignment: NC_004459 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available AMAKQRIIGKDNQMPWHLPADFAWFKRCTMGKPIVMGRKTYDSIGRPLPGRLNIV 60 ... Query: 123 GDTQFPDWGEQWCESHREHYSADEKNRYAMDFVILER... 159 ... GDTQFPDWGEQWCESHREHYSADEKNRYAMDFVILER Sbjct: 121 GDTQFPDWGEQWCESHREHYSADEKNRYAMDFVILER 157
ORF Alignment: NC_005139 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available AAMAKQRIIGKDNQMPWHLPADFAWFKRCTMGKPVVMGRKTYDSIGRPLPGRLNIV 60 ... Query: 123 GDTQFPDWGEQWCESHREHYSADEKNRYAMDFVILER... 159 ... GDTQFPDWGEQWCESHREHYSADEKNRYAMDFVILER Sbjct: 121 GDTQFPDWGEQWCESHREHYSADEKNRYAMDFVILER 157
Directory of Open Access Journals (Sweden)
Murilo de Albuquerque Regina
2006-08-01
Full Text Available A avaliação do comportamento de novas cultivares de videiras destinadas à elaboração de vinhos é importante no sentido de se melhorar a qualidade dos vinhos produzidos no sul de Minas Gerais. Neste sentido, avaliaram-se alguns híbridos de videiras tradicionais e de novas obtenções, nas condições de cultivo de Caldas, Minas Gerais. Foram avaliadas oito cultivares, enxertadas sobre o porta-enxerto RR 101-14, conduzidas em espaldeira. As avaliações foram efetuadas no período de 1999 a 2002 e constituíram-se de anotações dos estádios fenológicos de brotação, floração e maturação, da produção e qualidade dos frutos, além da incidência de antracnose e míldio. O ciclo entre brotação e colheita oscilou entre 147 e 169 dias, destacando 'Seyve Villard 5276' como o ciclo de menor duração e 'Seibel 10173' como o ciclo mais longo. As colheitas mais precoces foram 'G 159 OC 32258', 'G 159 OC 32458' e 'Seyve Villard 5276', enquanto as mais tardias foram as variedades 'Moscato Embrapa' e 'Baco blanc'. As maiores produções foram registradas para 'Couderc 13' (10,31 kg.pl-1, 'Baco blanc' (9,02 kg.pl-1, 'Moscato Embrapa' (7,66 kg.pl-1 e 'Villenave' (5,66 kg.pl-1 e as menores para 'G 159 OC 32258' (2,97 kg.pl-1 e 'Seibel 10173' (3,20 kg.pl-1. Os índices médios de sólidos solúveis totais oscilaram entre 14,63 e 19,23 ºBrix, respectivamente, para as cultivares 'Couderc 13' e 'G 159 OC 32258', e os valores de acidez total variaram de 91,7 meq.L-1 a 153,2 meq.L-1, respectivamente, para as cultivares 'Baco blanc' e 'Seibel 10173'.Environmental conditions and growing practices determine the vine's quality. The knowledge of new grapevine's cultivars responses to these factors within the growing season contributes to improve the quality of the wines produced in a specific region. Thus, traditional grapevines hybrids and new attainments were evaluated in Caldas, Minas Gerais conditions. The study was carried out from 1999 to 2002
Diet Therapy Career Ladder, AFSC 926XO.
1985-12-01
ACCORDING TO PHYSICIAN’S OR DIETITIAN’S GUIDELINES AND AFR 160-8 50% 5.81 F171 PREPARE PUDDINGS 49% 5.74 F159 PREPARE DEHYDRATED FOODS (E.G., INSTANT MASHED...COOKING TECHNIQUES 100 F143 COOK POULTRY 100 F135 CLEAN FOOD PRIOR TO COOKING OR SERVING 100 F159 PREPARE DEHYDRATED FOODS (E.G., INSTANT MASHED POTATOES...FOR COOKING OR SERVING 100 ~, F142 COOK PASTA, SUCH AS NOODLES OR SPAGHETTI 100 F166 PREPARE GRAVIES 100 F176 SAM4PLE FOODS BY TASTE AND SMELL 100
Coastal sea level response to the tropical cyclonic forcing in the northern Indian Ocean
Digital Repository Service at National Institute of Oceanography (India)
Mehra, P.; Soumya, M.; Vethamony, P.; Vijaykumar, K.; Nair, T.M.B.; Agarvadekar, Y.; Jyoti, K.; Sudheesh, K.; Luis, R.; Lobo, S.; Halmalkar, B.
–173, 2015 www.ocean-sci.net/11/159/2015/ doi:10.5194/os-11-159-2015 © Author(s) 2015. CC Attribution 3.0 License. Coastal sea level response to the tropical cyclonic forcing in the northern Indian Ocean P. Mehra1, M. Soumya1, P. Vethamony1, K. Vijaykumar1, T.... Note: sea level data at Colombo, Kochi, Karachi, Chabahar, Jask, Masirah, Minocoy and Hanimaadhoo are downloaded from www.gloss-sealevel.org and are shown with red stars. (Time is in Indian standard time (IST).) land locations of India are provided...
Development of fabric using chemically-treated sisal fibres
CSIR Research Space (South Africa)
Zwane, PE
2006-06-01
Full Text Available .875 total 1094.000 159 Resilience between groups 28.369 3 9.456 1.812 .147 within groups 814.125 156 5.219 total 842.494 159 Surf. cont. between groups 12.325 3 4.108 1.270 .287 within groups 504.650 156 3... will be discussed as seen in Table 6. The control fabric was highly rated as being harder, rougher, harsher and more open rather than soft, smooth, slippery and compact compared to all the other fabric types. For flexibility, extensibility, resiliency...
Seunghwa Yoo; Dongwon Kim; Youngmin Moon; Jeongyeon Yi; Taebong Choi
2016-01-01
Our survey of the avifauna in the eastern and central parts of the Civilian Control Zone (CCZ) in 2012 and 2013 found a total of 14,390 individuals of 159 species belonging to 17 orders, 44 families and 88 genera. The 159 species of birds found in the central and eastern CCZ constitute 29.4% of the 540 bird species recorded in the Korean Peninsula, showing considerable biodiversity in the bird species that inhabit the surveyed regions. In the central CCZ, we found 9,916 individuals of 117 bir...
FULL SCIENTIFIC REPORTS - Complex vertebral malformation in Holstein calves
DEFF Research Database (Denmark)
Agerholm, Jørgen S.; Bendixen, Christian; Andersen, Ole
2001-01-01
A recently observed lethal congenital defect of purebred Holstein calves is reported. Eighteen genetically related calves were necropsied. One calf had been aborted on gestation day 159, and the others were delivered between day 250 and day 285. Birth weights were reduced. The defect was characte......A recently observed lethal congenital defect of purebred Holstein calves is reported. Eighteen genetically related calves were necropsied. One calf had been aborted on gestation day 159, and the others were delivered between day 250 and day 285. Birth weights were reduced. The defect...
DEFF Research Database (Denmark)
Iversen, Astrid K N; Christiansen, Claus Bohn; Attermann, Jørn
2003-01-01
The relationship among CCR5 genotype, cytomegalovirus infection, and disease progression and death was studied among 159 human immunodeficiency virus (HIV)-infected patients with hemophilia. One patient (0.6%) had the CCR5Delta32/CCR5Delta32 genotype (which occurs in approximately 2% of the Scand......The relationship among CCR5 genotype, cytomegalovirus infection, and disease progression and death was studied among 159 human immunodeficiency virus (HIV)-infected patients with hemophilia. One patient (0.6%) had the CCR5Delta32/CCR5Delta32 genotype (which occurs in approximately 2...
Production of a heterologous proteinase A by Saccharomyces kluyveri
DEFF Research Database (Denmark)
Møller, Kasper; Tidemand, L.D.; Winther, J.R.
2001-01-01
In order to evaluate the potential of Saccharomyces kluyveri for heterologous protein production, S. kluyveri Y159 was transformed with a S. cerevisiae-based multi-copy plasmid containing the S. cerevisiae PEP4 gene, which encodes proteinase A, under the control of its native promoter. As a refer......In order to evaluate the potential of Saccharomyces kluyveri for heterologous protein production, S. kluyveri Y159 was transformed with a S. cerevisiae-based multi-copy plasmid containing the S. cerevisiae PEP4 gene, which encodes proteinase A, under the control of its native promoter...
Gas‒phase reactions of NO+ with Glu and γ‒Glu–Met
Wincel, H.; Fokkens, R. H.; Nibbering, N. M. M.
2000-01-01
The reactivity of the nitrosonium ion, NO+, with the amino acid Glu and the dipeptide γ‒Glu–Met in the gas phase has been investigated using the combination of chemical ionisation mass spectrometry and MS/MS. It is shown that NO+ reacts efficiently with both Glu and Glu–Met leading to the formation of the nitroso‒group containing ions at m/z 159 and 288.The formation of m/z 159, (GluNO‒18)+, is rationalized by a mechanism involving an electrophilic attack of NO+ upon the carbonyl oxygen atom ...
Sud du Sahara | Page 159 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
En cas de perte d'emploi, de maladie ou de mauvaise récolte, la principale source de protection sociale vers laquelle ils peuvent se tourner est l'appui que leur accorde ... Thaven Naidoo of the Climate Technology Initiative Private Finance Advisory Network (CTI PFAN) spoke about the importance of interesting the impact ...
Ce que nous faisons | Page 159 | CRDI - Centre de recherches pour ...
International Development Research Centre (IDRC) Digital Library (Canada)
Le CRDI appuie des travaux de recherche dans les pays en voie de développement en vue de produire un changement réel et durable. Ce savoir peut servir d'outil pour résoudre des problèmes mondiaux urgents. Nous partageons ce savoir avec les autres en :
27 CFR 1.59 - Public information as to applications acted upon.
2010-04-01
... business; whether the applicant is an individual, a partnership or a corporation; if a partnership, the... officers and of each stockholder owning 10 percent or more of the corporate stock. (b) The time and place... hearing, a copy of the administrative law judge's recommended decision, a copy of the appropriate TTB...
: tous les projets | Page 159 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
À mesure que les pays de l'Asie du Sud s'acheminent vers une plus grande intégration économique, on voit apparaître tout un éventail de difficultés interreliées ayant trait aux garanties constitutionnelles et aux garanties des droits de la personne. End Date: 17 mars 2016. Sujet: PRISONS. Région: Bangladesh, India, Nepal ...
49 CFR 1.59 - Delegations to the Assistant Secretary for Administration.
2010-10-01
...) Carry out the functions delegated to the Secretary from time to time by the Administrator of General Services to lease real property for Department use. (5) Carry out the duties and responsibilities of agency... connection with claims of the United States for erroneous payment of pay and allowances or of travel...
ORF Alignment: NC_004631 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available PLYRDVETIVRVNALDSEWGVNDLEAVVRGGAD 60 ... Query: 159 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQE...A 218 ... GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...
ORF Alignment: NC_003197 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available PLYRDVETIVRVNALDSEWGVNDLEAVVRGGAD 60 ... Query: 159 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQE...A 218 ... GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...
ORF Alignment: NC_006905 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available AVVRGGAD 60 ... Query: 159 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFL...QEA 218 ... GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...
The TOC complex: preprotein gateway to the chloroplast.
Andrès, Charles; Agne, Birgit; Kessler, Felix
2010-06-01
Photosynthetic eukaryotes strongly depend on chloroplast metabolic pathways. Most if not all involve nuclear encoded proteins. These are synthesized as cytosolic preproteins with N-terminal, cleavable targeting sequences (transit peptide). Preproteins are imported by a major pathway composed of two proteins complexes: TOC and TIC (Translocon of the Outer and Inner membranes of the Chloroplasts, respectively). These selectively recognize the preproteins and facilitate their transport across the chloroplast envelope. The TOC core complex consists of three types of components, each belonging to a small family: Toc34, Toc75 and Toc159. Toc34 and Toc159 isoforms represent a subfamily of the GTPase superfamily. The members of the Toc34 and Toc159 subfamily act as GTP-dependent receptors at the chloroplast surface and distinct members of each occur in defined, substrate-specific TOC complexes. Toc75, a member of the Omp85 family, is conserved from prokaryotes and functions as the unique protein-conducting channel at the outer membrane. In this review we will describe the current state of knowledge regarding the composition and function of the TOC complex.
Castillo Pedraza, Midian C.; Novais, Tatiana F.; Faustoferri, Roberta C.; Quivey, Robert G.; Terekhov, Anton; Hamaker, Bruce R.; Klein, Marlise I.
2018-01-01
Streptococcus mutans -derived exopolysaccharides are virulence determinants in the matrix of biofilms that cause caries. Extracellular DNA (eDNA) and lipoteichoic acid (LTA) are found in cariogenic biofilms, but their functions are unclear. Therefore, strains of S. mutans carrying single deletions that would modulate matrix components were used: eDNA – ΔlytS and ΔlytT; LTA – ΔdltA and ΔdltD; and insoluble exopolysaccharide – ΔgtfB. Single-species (parental strain S. mutans UA159 or individual mutant strains) and mixed-species (UA159 or mutant strain, Actinomyces naeslundii and Streptococcus gordonii) biofilms were evaluated. Distinct amounts of matrix components were detected, depending on the inactivated gene. eDNA was found to be cooperative with exopolysaccharide in early phases, while LTA played a larger role in the later phases of biofilm development. The architecture of mutant strains biofilms was distinct (vs UA159), demonstrating that eDNA and LTA influence exopolysaccharide distribution and microcolony organization. Thus, eDNA and LTA may shape exopolysaccharide structure, affecting strategies for controlling pathogenic biofilms. PMID:28946780
Castillo Pedraza, Midian C; Novais, Tatiana F; Faustoferri, Roberta C; Quivey, Robert G; Terekhov, Anton; Hamaker, Bruce R; Klein, Marlise I
2017-10-01
Streptococcus mutans-derived exopolysaccharides are virulence determinants in the matrix of biofilms that cause caries. Extracellular DNA (eDNA) and lipoteichoic acid (LTA) are found in cariogenic biofilms, but their functions are unclear. Therefore, strains of S. mutans carrying single deletions that would modulate matrix components were used: eDNA - ∆lytS and ∆lytT; LTA - ∆dltA and ∆dltD; and insoluble exopolysaccharide - ΔgtfB. Single-species (parental strain S. mutans UA159 or individual mutant strains) and mixed-species (UA159 or mutant strain, Actinomyces naeslundii and Streptococcus gordonii) biofilms were evaluated. Distinct amounts of matrix components were detected, depending on the inactivated gene. eDNA was found to be cooperative with exopolysaccharide in early phases, while LTA played a larger role in the later phases of biofilm development. The architecture of mutant strains biofilms was distinct (vs UA159), demonstrating that eDNA and LTA influence exopolysaccharide distribution and microcolony organization. Thus, eDNA and LTA may shape exopolysaccharide structure, affecting strategies for controlling pathogenic biofilms.
Heldal, Hilde Elise; Vikebø, Frode; Johansen, Geir Odd
2013-09-01
Dispersal of (137)Cs from the nuclear submarine wrecks Komsomolets and K-159, which are resting on the seabed in the Norwegian and Barents Seas, respectively, is simulated using realistic rates and hypothetical scenarios. Furthermore, spatiotemporal (137)Cs concentrations in Northeast Arctic cod and capelin are estimated based on survey data. The results indicate that neither continuous leakages nor pulse discharges will cause concentrations of (137)Cs in cod muscle or whole body capelin exceeding the intervention level of 600 Bq/kg fw. Continuous leakages from Komsomolets and K-159 and pulse discharges from Komsomolets induced negligible activity concentrations in cod and capelin. A pulse discharge of 100% of the (137)Cs-inventory of K-159 will, however, result in concentrations in muscle of cod of above 100 times the present levels in the eastern Barents Sea. Within three years after the release, (137)Cs levels above 20 Bq/kg fw in cod are no longer occurring in the Barents Sea. Copyright © 2013 Elsevier Ltd. All rights reserved.
ORF Alignment: NC_006511 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available : 1 ... LMFDLEDSVALREKDAARRLVYHALQHPLYRDVETIVRVNALDSEWGVNDLEAVVRGGAD 60 ... Query: 159 GIALGAEDYVRNLRTERSPEGTELLFARC...AILQAARSAGIQAFDTVYSDANNEAGFLQEA 218 ... GIALGAEDYVRNLRTERSPEGTELLFARCAI...LQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...
ORF Alignment: NC_003198 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available IALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 218 ... GIALGAEDYVRNLRTERSPEGTELLFARCAILQ...AARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ... ...1 ... LMFDLEDSVALREKHAARRLVYHALQHPLYRDVETIVRVNALDSEWGVNDLEAVVRGGAD 60 ... Query: 159 G
Fine structure studies of terbium atoms
International Nuclear Information System (INIS)
Abhay Kumar; Bandyopadhyay, Krishnanath; Niraj Kumar
2012-01-01
Terbium (Z = 65) is a typical rare-earth element. Fine structure of spectural lines of terbium (Tb) are presented using the laser optogalvanic spectroscopic technique. Altogether eighty transitions in the 5686-6367 A range have been observed in the fine structure spectrum of 159 Tb. Wavelengths of all the observed transitions have been determined. Out of 80 transitions of Tb, a total of 59 transitions are being reported for the first time. Classifications of 39 new transitions have been provided using the known energy levels, Doppler-limited optogalvanic spectroscopic technique is employed to study the fine structure (fs) 159 Tb. (author)
ORF Alignment: NC_002944 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available h = 159 ... Query: 5 ... SFDIVSKVDRQEVDNALNQAAKELATRFDFRGTDTTIAWKGDEAIELTSSTGERVKAAVD... 64 ... SFDIVSKVDRQEVDNALNQAAKELATRFDFRGTDTTIAWKGDEAIELTSSTGERVKAAVD Sbjct: 1 ... SFDIVSKVDRQEVDNALNQAA...KELATRFDFRGTDTTIAWKGDEAIELTSSTGERVKAAVD 60 ... Query: 125 QIQGDEIRVSSKKRDDLQAVIAMLKQADLDVALQFVNYR 163 ...
ORF Alignment: NC_004605 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available [Vibrio ... parahaemolyticus RIMD 2210633] ... Length = 159 ... Query: 4 ... QVKQERLQGRLGPEIKEFRQE...RRTLQLATVDSEGRPNVSYAPYVQNQEGYFVLISQIARH 63 ... QVKQERLQGRLGPEIKEFRQERRTLQL...ATVDSEGRPNVSYAPYVQNQEGYFVLISQIARH Sbjct: 1 ... QVKQERLQGRLGPEIKEFRQERRTLQLATVDSEGRPNVSYAPYVQNQEGYFVLISQIARH 60
ORF Alignment: NC_004350 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Streptococcus mutans UA159] ... Length = 118 ... Query: 2 ... IKIYTISSCTSCKKAKTWLNAHQLPYKEQNLAKDPLSKEEILNILSKTENGIE...SIVSSKN 61 ... IKIYTISSCTSCKKAKTWLNAHQLPYKEQNLAKDPLSKEEILNILSKTENGIE...SIVSSKN Sbjct: 1 ... IKIYTISSCTSCKKAKTWLNAHQLPYKEQNLAKDPLSKEEILNILSKTENGIESIVSSKN 60 ...
ORF Alignment: NC_004347 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available s MR-1] ... Length = 228 ... Query: 39 ... NIKFALDDIVKNFSAETGLKVRVSYGSSGNFVAQIQHGAPFEM...LLSADERYIHELQKAGF 98 ... NIKFALDDIVKNFSAETGLKVRVSYGSSGNFVAQIQHGAPFEMLLSADERYIHELQKAGF Sbjct: 6 ... ... NIKFALDDIVKNFSAETGLKVRVSYGSSGNFVAQIQHGAPFEMLLSADERYIHELQKAGF 65 ... Query: 159 LLQKLGLWDGLQTKLILGENASQAAQFAVS
International Nuclear Information System (INIS)
Honious, H.B.; Janzow, E.F.; Malson, H.A.; Moyer, S.E.
1980-01-01
The invention relates to radiation sources comprising a substrate having an electrically-conductive non-radioactive metal surface, a layer of a metal radioactive isotope of the scandium group, which in addition to scandium, yttrium, lanthanum and actinium, includes all the lanthanide and actinide series of elements, with the actinide series usually being preferred because of the nature of the radioactive isotopes therein, particularly americium-241, curium-244, plutonium-238, californium-252 and promethium-147, and a non-radioactive bonding metal codeposited on the surface by electroplating the isotope and bonding metal from an electrolytic solution, the isotope being present in the layer in minor amount as compared to the bonding metal, and with or without a non-radioactive protective metal coating covering the isotoype and bonding metal on the surface, the coating being sufficiently thin to permit radiation to pass through the coating. The invention also relates to a process for providing radiation sources comprising codepositing a layer of the metal radioactive isotope with a non-radioactive bonding metal from an electrolytic solution in which the isotope is present in minor molar amount as compared to the bonding metal such that the codeposited layer contains a minor molar amount of the isotope compared to the bonding metal by electroplating on an electrically-conductive non-radioactive metal surface of a cathode substrate, and with or without depositing a nonradioactive protective metal coating over the isotope and bonding metal on the surface, the coating being sufficiently thin to permit radiation to pass through the coating
ORF Alignment: NC_005004 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... epidermidis ATCC 12228] ... Length = 258 ... Query: 159 PNEIWQADHTLLDIYILDQTGNINRPWLTIIMDDYSRAIAGY...FISFEAPNAQNTALTLHQ 218 ... PNEIWQADHTLLDIYILDQTGNINRPWLTIIMDDYSRAIAGYFISFE...APNAQNTALTLHQ Sbjct: 1 ... PNEIWQADHTLLDIYILDQTGNINRPWLTIIMDDYSRAIAGYFISFEAPNAQNTALTLHQ 60 ... Query: 279 FQTVNQT
ORF Alignment: NC_002663 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available multocida ... subsp. multocida str. Pm70] ... Length = 159 ... Query: 2 ... TTNRQEVLQNRLGPEIQELKAQ...CKTVMLATVGEDGNPNVSYAPFAINNGEYQVFISTIAR 61 ... TTNRQEVLQNRLGPEIQELKAQCKTVML...ATVGEDGNPNVSYAPFAINNGEYQVFISTIAR Sbjct: 1 ... TTNRQEVLQNRLGPEIQELKAQCKTVMLATVGEDGNPNVSYAPFAINNGEYQVFISTIAR 60
A study of dietary habits and eating-out behavior of college students in Cheongju area.
Lee, Joo-Eun; Yoon, Wan-Young
2014-01-01
To find out the effects of the general characteristic on dietary habits and eating out behavior of college students in Cheongju area. The ratios of major were 50.3% (80/159) for food and nutrition and 49.7% (79/159) for the others. The most of respondents missed breakfast and the most reason for skipping meal was no time. Older and younger group were different significantly in skipping meal, reason of meal skip, place of lunch, cost of lunch, and preferred lunch menu (Peating-out behaviors in the results of this study through education, and by seeking for alternatives from different angles such as various nutrition education and nutrition improvement programs.
ORF Alignment: NC_004350 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ococcus mutans UA159] ... Length = 355 ... Query: 3 ... KLAQIVQKLKKQGIEAAVLSDPVSINYLTGFYSDPHERLMFLFLFADQEP...LLFLPELDAL 62 ... KLAQIVQKLKKQGIEAAVLSDPVSINYLTGFYSDPHERLMFLFLFADQEPLLFLPE...LDAL Sbjct: 1 ... KLAQIVQKLKKQGIEAAVLSDPVSINYLTGFYSDPHERLMFLFLFADQEPLLFLPELDAL 60 ... Query: 123 LTPLINRMRLIKSADE
ORF Alignment: NC_004350 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Streptococcus mutans UA159] ... Length = 138 ... Query: 19 ... LVNTRFAKLFAHFGQKVDGRTLANRYQNFLSQQGQTLT...GAETLLEKLTDEGYRIFGATNG 78 ... LVNTRFAKLFAHFGQKVDGRTLANRYQNFLSQQGQTLTGAETLL...EKLTDEGYRIFGATNG Sbjct: 1 ... LVNTRFAKLFAHFGQKVDGRTLANRYQNFLSQQGQTLTGAETLLEKLTDEGYRIFGATNG 60 ... Query: 139 ADIQ
ORF Alignment: NC_006677 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available aC family ... [Gluconobacter oxydans 621H] ... Length = 94 ... Query: 159 RVANTLSDNPADNRDQKDWAELA...AMSLRSFVRHFTLETGLPFSVWRQRLRILNAQEKLAR 218 ... RVANTLSDNPADNRDQKDWAELAAMSLR...SFVRHFTLETGLPFSVWRQRLRILNAQEKLAR Sbjct: 1 ... RVANTLSDNPADNRDQKDWAELAAMSLRSFVRHFTLETGLPFSVWRQRLRILNAQEKLAR 60 ...
ORF Alignment: NC_004350 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available [Streptococcus mutans UA159] ... Length = 440 ... Query: 5 ... FGTDGVRGEANVELTPELAFKLGRFGGYVLSQHEPDRPRVFV...ARDTRISGELLESALVAG 64 ... FGTDGVRGEANVELTPELAFKLGRFGGYVLSQHEPDRPRVFVARDTRI...SGELLESALVAG Sbjct: 1 ... FGTDGVRGEANVELTPELAFKLGRFGGYVLSQHEPDRPRVFVARDTRISGELLESALVAG 60 ... Query: 125 EAEIEALL
ORF Alignment: NC_004350 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Streptococcus mutans UA159] ... Length = 169 ... Query: 2 ... KLVAIVGSNASFSYNRLLLQFIKERFGQAFALEILEIKELPLFNQDSSAADCP...LIQKLNE 61 ... KLVAIVGSNASFSYNRLLLQFIKERFGQAFALEILEIKELPLFNQDSSAADCP...LIQKLNE Sbjct: 1 ... KLVAIVGSNASFSYNRLLLQFIKERFGQAFALEILEIKELPLFNQDSSAADCPLIQKLNE 60 ... Query: 122 LRQILN
Evaluation of Gd and Gd159 as new approaches for cancer treatment
International Nuclear Information System (INIS)
Galvao, I.; Neves, M.J.
2011-01-01
Metal compounds have shown many biological activities and have been successfully used as anticancer agents such cisplatin. Actually gadolinium (Gd) complexed with a porphyrin Motexafin (MGd) has been investigated as redox-active compound for treatment of cancer. 1 59G d decays by beta emission with an energy of 970 keV and half-life of 18.59 hours. The de-excitation can be via gamma ray and internal conversion electron emission followed by auger electrons and x rays. Considering all of this 1 59G d could be a interesting radionuclide to be as a radio therapeutical agent. The aims of this works were to evaluate the cytotoxicity of Gd and 1 59G d on malignant brain tumors such as glioblastoma multiform, the most frequent brain tumors which has a very poor prognosis. For this purpose, it was used human glioblastoma cell lines T98 (mutant p53) and U87 (wild-type p53) to investigate the cytotoxicity of gadolinium on cell metabolism by MTT assay and also morphological changes, chromatin condensation by DAPI assay and ROS generation. Gadolinium was able to decrease cell viability, the cells presented morphological changes like round shapes and blebs formation after cell treatment with 5x10 -6 M of Gd. Nuclear changing and ROS generation occurred in a dose dependent way indicating the cytotoxic effect of Gd. Treatment with 1 59G d increased all of changes observed with treatment with Gd. These results state for an additive effect of metal toxicity and radioactivity inducing ROS generation as the main mechanism of anti tumoral action of 1 59G d. The results obtained indicated that the radioactive analogues of Gd have increased cytotoxic effects and gadolinium can be a metal of choice for development of new drugs for cancer treatment. (author)
40 CFR 93.159 - Procedures for conformity determinations of general Federal actions.
2010-07-01
... assumptions must be derived from the estimates of population, employment, travel, and congestion most recently... geographic location or level of population, employment, travel, and congestion, must be approved by the MPO... this subpart must be based on the latest and most accurate emission estimation techniques available as...
FCJ-159 /b/lack up: What Trolls Can Teach Us About Race
Directory of Open Access Journals (Sweden)
Tanner Higgin
2013-12-01
Full Text Available This article explores the racial politics of trolling by examining virtual world raids conducted by users of the internet message board 4chan. Since these raids deploy offensive language and imagery that play upon African American stereotypes and history, they can be understood as participating in an ironic, post-political racism that masquerades as enlightened yet maintains online spaces as bastions of white heterosexual masculinity. Moving beyond this frame, however, this article looks awry at these performances and considers how they might also be understood as unintentional yet productive interrogations of racial politics and logics within game cultures and technologies.
10 CFR 26.159 - Assuring specimen security, chain of custody, and preservation.
2010-01-01
... other entity has reason to question the integrity and identity of the specimens, the specimens may not... identification numbers on the custody-and-control form; (iii) A specimen bottle seal is broken or shows evidence... of the shipping containers are inaccessible without breaking a tamper-evident seal. (g) Couriers...
ISO far-infrared observations of rich galaxy clusters II. Sersic 159-03
DEFF Research Database (Denmark)
Hansen, Lene; Jørgensen, H.E.; Nørgaard-Nielsen, Hans Ulrik
2000-01-01
In a series of papers we investigate far-infrared emission from rich galaxy clusters. Maps have been obtained by ISO at 60 mu m, 100 mu m, 135 mu m, and 200 mu m using the PHT-C camera. Ground based imaging and spectroscopy were also acquired. Here we present the results for the cooling flow...
ORF Alignment: NC_006814 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 153 ... Query: 25 ... LKVIYDKLLELGYVKGDFLSHIIEREHNFPTGLDTDTLGKDIPNIAIPHTEGEFVNTRLI 84 ... ...LKVIYDKLLELGYVKGDFLSHIIEREHNFPTGLDTDTLGKDIPNIAIPHTEGEFVNTRLI Sbjct: 19 ... LKVIYDKLL...ELGYVKGDFLSHIIEREHNFPTGLDTDTLGKDIPNIAIPHTEGEFVNTRLI 78 ... Query: 145 NFTNSEAIYEFLEQK 159 ... NFTNSEAIYEFLEQK Sbjct: 139 NFTNSEAIYEFLEQK 153
ORF Alignment: NC_005785 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 314 ... Query: 39 ... FQLIDSTLREGEQFANAFFSTEKKIEIARALDDFGVDYIELTSPVASEQSLRDCQAICKL 98 ... F...QLIDSTLREGEQFANAFF TEKKIEIA+ALDDFGVDYIELTSPVASEQS+RDC+AIC L Sbjct: 3 ... FQLIDSTLRE...GEQFANAFFDTEKKIEIAKALDDFGVDYIELTSPVASEQSFRDCKAICNL 62 ... Query: 159 VKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIAD
The SloR metalloregulator is involved in the Streptococcus mutans oxidative stress response.
Crepps, S C; Fields, E E; Galan, D; Corbett, J P; Von Hasseln, E R; Spatafora, G A
2016-12-01
SloR, a 25-kDa metalloregulatory protein in Streptococcus mutans modulates the expression of multiple genes, including the sloABC operon that encodes essential Mn 2+ transport and genes that promote cariogenesis. In this study, we report on SloC- and SloR-deficient strains of S. mutans (GMS284 and GMS584, respectively) that demonstrate compromised survivorship compared with their UA159 wild-type progenitor and their complemented strains (GMS285 and GMS585, respectively), when challenged with streptonigrin and/or in growth competition experiments. The results of streptonigrin assays revealed significantly larger zones of inhibition for GMS584 than for either UA159 or GMS585, indicating weakened S. mutans survivorship in the absence of SloR. Competition assays revealed a compromised ability for GMS284 and GMS584 to survive peroxide challenge compared with their SloC- and SloR-proficient counterparts. These findings are consistent with a role for SloC and SloR in S. mutans aerotolerance. We also predicted differential expression of oxidative stress tolerance genes in GMS584 versus UA159 and GMS585 when grown aerobically. The results of quantitative RT-PCR experiments revealed S. mutans sod, tpx, and sloC expression that was upregulated in GMS584 compared with UA159 and GMS585, indicating that the impact of oxidative stress on S. mutans is more severe in the absence of SloR than in its presence. The results of electrophoretic mobility shift assays indicate that SloR does not bind to the sod or tpx promoter regions directly, implicating intermediaries that may arbitrate the SloR response to oxidative stress. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
CARM1 modulators affect epigenome of stem cells and change morphology of nucleoli.
Franek, M; Legartová, S; Suchánková, J; Milite, C; Castellano, S; Sbardella, G; Kozubek, S; Bártová, E
2015-01-01
CARM1 interacts with numerous transcription factors to mediate cellular processes, especially gene expression. This is important for the maintenance of ESC pluripotency or intervention to tumorigenesis. Here, we studied epigenomic effects of two potential CARM1 modulators: an activator (EML159) and an inhibitor (ellagic acid dihydrate, EA). We examined nuclear morphology in human and mouse embryonic stem cells (hESCs, mESCs), as well as in iPS cells. The CARM1 modulators did not function similarly in all cell types. EA decreased the levels of the pluripotency markers, OCT4 and NANOG, particularly in iPSCs, whereas the levels of these proteins increased after EML159 treatment. EML159 treatment of mouse ESCs led to decreased levels of OCT4 and NANOG, which was accompanied by an increased level of Endo-A. The same trend was observed for NANOG and Endo-A in hESCs affected by EML159. Interestingly, EA mainly changed epigenetic features of nucleoli because a high level of arginine asymmetric di-methylation in the nucleoli of hESCs was reduced after EA treatment. ChIP-PCR of ribosomal genes confirmed significantly reduced levels of H3R17me2a, in both the promoter region of ribosomal genes and rDNA encoding 28S rRNA, after EA addition. Moreover, EA treatment changed the nuclear pattern of AgNORs (silver-stained nucleolus organizer regions) in all cell types studied. In EA-treated ESCs, AgNOR pattern was similar to the pattern of AgNORs after inhibition of RNA pol I by actinomycin D. Together, inhibitory effect of EA on arginine methylation and effect on related morphological parameters was especially observed in compartment of nucleoli.
Fellner, Matthias; Aloi, Sekotilani; Tchesnokov, Egor P; Wilbanks, Sigurd M; Jameson, Guy N L
2016-03-08
Thiol dioxygenases catalyze the synthesis of sulfinic acids in a range of organisms from bacteria to mammals. A thiol dioxygenase from the bacterium Pseudomonas aeruginosa oxidizes both 3-mercaptopropionic acid and cysteine, with a ∼70 fold preference for 3-mercaptopropionic acid over all pHs. This substrate reactivity is widened compared to other thiol dioxygenases and was exploited in this investigation of the residues important for activity. A simple model incorporating two protonation events was used to fit profiles of the Michaelis-Menten parameters determined at different pH values for both substrates. The pKs determined using plots of k(cat)/Km differ at low pH, but not in a way easily attributable to protonation of the substrate alone and share a common value at higher pH. Plots of k(cat) versus pH are also quite different at low pH showing the monoprotonated ES complexes with 3-mercaptopropionic acid and cysteine have different pKs. At higher pH, k(cat) decreases sigmoidally with a similar pK regardless of substrate. Loss of reactivity at high pH is attributed to deprotonation of tyrosine 159 and its influence on dioxygen binding. A mechanism is proposed by which deprotonation of tyrosine 159 both blocks oxygen binding and concomitantly promotes cystine formation. Finally, the role of tyrosine 159 was further probed by production of a G95C variant that is able to form a cysteine-tyrosine crosslink homologous to that found in mammalian cysteine dioxygenases. Activity of this variant is severely impaired. Crystallography shows that when un-crosslinked, the cysteine thiol excludes tyrosine 159 from its native position, while kinetic analysis shows that the thioether bond impairs reactivity of the crosslinked form.
Directory of Open Access Journals (Sweden)
Alves Leonardo
2010-03-01
Full Text Available Abstract Background microRNAs (miRNAs are endogenous small non-coding RNAs that post-transcriptionally regulate gene expression. In plants, they typically show high complementarity to a single sequence motif within their target mRNAs and act by catalyzing specific mRNA cleavage and degradation. miRNAs are processed from much longer primary transcripts via precursor miRNAs containing fold-back structures. Leaving these secondary structures intact, miRNAs can be re-designed experimentally to target mRNAs of choice. Results We designed primary synthetic miRNAs (pri-smiRNAs on the basis of the primary transcript of the Arabidopsis MIR159A gene by replacing the original miR159a and the corresponding miR159a* with novel sequences, keeping the overall secondary structure as predicted by the program RNAfold. We used the program RNAhybrid to optimize smiRNA design and to screen the complete Arabidopsis transcriptome for potential off-targets. To improve the molecular cloning of the pri-smiRNA we inserted restriction sites in the original MIR159A primary transcript to easily accommodate the smiRNA/smiRNA* DNA fragment. As a proof-of-concept, we targeted the single gene encoding chalcone synthase (CHS in Arabidopsis. We demonstrate smiRNA(CHS expression and CHS mRNA cleavage in different transgenic lines. Phenotypic changes in these lines were observed for seed color and flavonol derivatives, and quantified with respect to anthocyanin content. We also tested the effect of mismatches and excess G:U base pairs on knockdown efficiency. Conclusions RNAhybrid-assisted design of smiRNAs and generation of pri-smiRNAs using a novel vector containing restriction sites greatly improves specificity and speed of the generation of stable knockdown lines for functional analyses in plants.
Blahopřání Alexandře Navrátilové
Czech Academy of Sciences Publication Activity Database
Frolcová, Věra
2016-01-01
Roč. 33, č. 2 (2016), s. 159-162 ISSN 1211-8117 Institutional support: RVO:68378076 Keywords : congratulations * ethnology * anniversary * personality Subject RIV: AC - Archeology, Anthropology, Ethnology
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available scriptional regulator [Burkholderia fungorum LB400] ... Length = 200 ... Query: 100 VTLSVSSAFTTHWLMPRIDK...LQRQFPEVDLRFQLISGALRGPVENVDLGMRFRDRDEPSS 159 ... VTLSVS+AFTTHWLMPR+ +L + FP VDLRFQLISG + GP+ +VDLGMRF... ... DE ... Sbjct: 1 ... VTLSVSTAFTTHWLMPRMSRLNQAFPNVDLRFQLISGRIGGPLVDVDLGMRFLREDEIGE
ORF Alignment: NT_033777 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Drosophila melanogaster] ... Length = 130 ... Query: 100 IDDLAVVDIRTRSFDLHRQEILTRDMVTISIDGV...VYYSIKSPFDAMLQVYDPEEATEKLA 159 ... IDDLAVVDIRTRSFDLHRQEILTRDMVTISIDGVVYYSI...KSPFDAMLQVYDPEEATEKLA Sbjct: 1 ... IDDLAVVDIRTRSFDLHRQEILTRDMVTISIDGVVYYSIKSPFDAMLQVYDPEEATEKLA 60 ... Query: 220 AVEQEAMRE 228 ... AVEQEAMRE Sbjct: 121 AVEQEAMRE 129
Levy, Tomer; Apter, Alan; Djalovski, Amir; Peskin, Miriam; Fennig, Silvana; Gat-Yablonski, Galia; Bar-Maisels, Meytal; Borodkin, Katy; Bloch, Yuval
2017-10-01
The present study evaluated the self-report version of the Inventory of Callous-Unemotional Traits (ICU-SR) in terms of reliability, concurrent validity, and correlation with salivary oxytocin levels, a potential biomarker of CU traits. 67 socially at-risk male adolescents (mean 16.2 years) completed the ICU-SR, ICU teacher-version (ICU-TR), Strengths and Difficulties Questionnaire, and their medical files were coded for previous antisocial acts using Brown-Goodwin Lifetime Aggression Scale. Salivary samples were assayed for oxytocin. The reliability of ICU-SR was lower (α = 0.71) than ICU-TR (α = 0.86). ICU-SR mean score was significantly lower than ICU-TR (M = 25.29, SD = 8.02; M = 33.14, SD = 9.47). ICU-TR but not ICU-SR, significantly correlated with history of antisocial acts (r = 0.40). Two-way analysis of variance showed a significant effect of conduct disorder and oxytocin on ICU-TR but not ICU-SR [F(1,59) = 6.53; F(1,59) = 6.08], and a significant interaction only for ICU-TR [F(1,59) = 2.89]. Subjective self-reports of CU traits may be less reliable and valid than teachers' reports. Copyright © 2017 Elsevier B.V. All rights reserved.
Comparison of retinal vascular geometry in obese and non-obese children.
Directory of Open Access Journals (Sweden)
Evelyn Li Min Tai
Full Text Available Childhood obesity is associated with adult cardiometabolic disease. We postulate that the underlying microvascular dysfunction begins in childhood. We thus aimed to compare retinal vascular parameters between obese and non-obese children.This was a cross-sectional study involving 166 children aged 6 to 12 years old in Malaysia. Ocular examination, biometry, retinal photography, blood pressure and body mass index measurement were performed. Participants were divided into two groups; obese and non-obese. Retinal vascular parameters were measured using validated software.Mean age was 9.58 years. Approximately 51.2% were obese. Obese children had significantly narrower retinal arteriolar caliber (F(1,159 = 6.862, p = 0.010, lower arteriovenous ratio (F(1,159 = 17.412, p < 0.001, higher venular fractal dimension (F(1,159 = 4.313, p = 0.039 and higher venular curvature tortuosity (F(1,158 = 5.166, p = 0.024 than non-obese children, after adjustment for age, gender, blood pressure and axial length.Obese children have abnormal retinal vascular geometry. These findings suggest that childhood obesity is characterized by early microvascular abnormalities that precede development of overt disease. Further research is warranted to determine if these parameters represent viable biomarkers for risk stratification in obesity.
Directory of Open Access Journals (Sweden)
Mohamad Kourghi
2018-04-01
Full Text Available Aquaporins are integral proteins that facilitate the transmembrane transport of water and small solutes. In addition to enabling water flux, mammalian Aquaporin-1 (AQP1 channels activated by cyclic GMP can carry non-selective monovalent cation currents, selectively blocked by arylsulfonamide compounds AqB007 (IC50 170 μM and AqB011 (IC50 14 μM. In silico models suggested that ligand docking might involve the cytoplasmic loop D (between AQP1 transmembrane domains 4 and 5, but the predicted site of interaction remained to be tested. Work here shows that mutagenesis of two conserved arginine residues in loop D slowed the activation of the AQP1 ion conductance and impaired the sensitivity of the channel to block by AqB011. Substitution of residues in loop D with proline showed effects on ion conductance amplitude that varied with position, suggesting that the structural conformation of loop D is important for AQP1 channel gating. Human AQP1 wild type, AQP1 mutant channels with alanines substituted for two arginines (R159A+R160A, and mutants with proline substituted for single residues threonine (T157P, aspartate (D158P, arginine (R159P, R160P, or glycine (G165P were expressed in Xenopus laevis oocytes. Conductance responses were analyzed by two-electrode voltage clamp. Optical osmotic swelling assays and confocal microscopy were used to confirm mutant and wild type AQP1-expressing oocytes were expressed in the plasma membrane. After application of membrane-permeable cGMP, R159A+R160A channels had a significantly slower rate of activation as compared with wild type, consistent with impaired gating. AQP1 R159A+R160A channels showed no significant block by AqB011 at 50 μM, in contrast to the wild type channel which was blocked effectively. T157P, D158P, and R160P mutations had impaired activation compared to wild type; R159P showed no significant effect; and G165P appeared to augment the conductance amplitude. These findings provide evidence for the
Czech Academy of Sciences Publication Activity Database
Hlobil, Ivo
-, č. 2 (2014), s. 148-159 ISSN 1805-3742 Institutional support: RVO:68378033 Keywords : romantic painting * altarpieces * Olomouc cathedral * Anton Petter Subject RIV: AL - Art, Architecture, Cultural Heritage
Perturbation theory of quantum resonances
Czech Academy of Sciences Publication Activity Database
Durand, P.; Paidarová, Ivana
2016-01-01
Roč. 135, č. 7 (2016), s. 159 ISSN 1432-2234 Institutional support: RVO:61388955 Keywords : Partitioning technique * Analytic continuation * Perturbative expansion Subject RIV: CF - Physical ; Theoretical Chemistry
National Research Council Canada - National Science Library
Mehra, Rohit
2007-01-01
.... We constructed 5 tissue microarrays representing 40 African-American and 159 Caucasian prostate cancer patients and performed immunohistochemistry on these arrays using antibody to AMACR and EZH2...
National Research Council Canada - National Science Library
Mehra, Rohit
2006-01-01
.... We constructed 5 tissue microarrays representing 40 African-American and 159 Caucasian prostate cancer patients and performed immunohistochemistry on these arrays using antibodies to AMACR and EZH2...
Price distortions under coarse reasoning with frequent trade
Czech Academy of Sciences Publication Activity Database
Steiner, Jakub; Stewart, C.
159 A, September (2015), s. 574-595 ISSN 0022-0531 Institutional support: RVO:67985998 Keywords : categorization * bounded rationality * prices Subject RIV: AH - Economics Impact factor: 1.097, year: 2015
2012 ja 2013 - aastad täis põnevaid Euroopa noorte projekte / Maali Pert
Pert, Maali
2013-01-01
2012. aastal toetas SA Archimedes Euroopa Noored Eesti büroo programmi Euroopa Noored vahenditest 159 noorte projekti. Vestlusest büroo avalike suhete ja teavitusvaldkonna koordinaatori Marit Valgega
Phylogeny and taxonomy of the Inonotus linteus complex
Czech Academy of Sciences Publication Activity Database
Tian, X.-M.; Yu, H.-Y.; Zhou, L.-W.; Decock, C.; Vlasák, Josef; Dai, Y.C.
2013-01-01
Roč. 58, č. 1 (2013), s. 159-169 ISSN 1560-2745 Institutional support: RVO:60077344 Keywords : Hymenochaetaceae * Phellinus * Phylogeny * ITS Subject RIV: EF - Botanics Impact factor: 6.938, year: 2013
Bioaccumulation of thallium in a neutral soil as affected by solid-phase association
Czech Academy of Sciences Publication Activity Database
Grösslová, Z.; Vaněk, A.; Mihaljevič, M.; Ettler, V.; Hojdová, Maria; Zádorová, T.; Pavlů, L.; Penížek, V.; Vaněčková, B.; Komárek, M.; Chrastný, V.; Ash, Ch.
2015-01-01
Roč. 159, December (2015), s. 208-212 ISSN 0375-6742 Institutional support: RVO:67985831 Keywords : birnessite * carbonate * oxide * plant * uptake Subject RIV: DD - Geochemistry Impact factor: 2.147, year: 2015
Czech Academy of Sciences Publication Activity Database
Zakharov, S.; Navrátil, Tomáš; Salek, T.; Kurcová, I.; Pelclová, D.
2015-01-01
Roč. 159, č. 4 (2015), s. 666-676 ISSN 1213-8118 Institutional support: RVO:61388955 Keywords : methanol poisoning * ethanol * antidote Subject RIV: CG - Electrochemistry Impact factor: 0.924, year: 2015
Kontsernisisese cash pooling'u kasutamise võimalikud piirangud / Karl Kull
Kull, Karl, 1987-
2011-01-01
Cash pooling’ust kui finantsjuhtimise ühest alaliigist. Cash pooling’u kasutamise piirangutest: äriseadustiku §-des 159 ja 281 sätestatud laenukeelust ning emaettevõtja kohustuste võimalikust rikkumisest
Development of a GIS approach to mining risk assessment. Supervising Scientist report 159
International Nuclear Information System (INIS)
Boggs, G.S.
2001-01-01
A Geographic Information System (GIS) offers a means by which the data collected during the assessment of possible mining impacts can be stored and manipulated. A GIS that provides a central focus point for the storage, manipulation and retrieval of information generated by the investigation into the geomorphological impact of the ERA Jabiluka Mine has been developed. Implementing a flexible, GIS-centred approach to data management allows the data storage, manipulation and retrieval powers of GIS to be retained whilst maintaining access to the functionality contained within these other software packages. The GIS has also been linked to the DistFW hydrology model and SIBERIA landform evolution model, to provide a more spatial approach to assessing the impact of mining on the long-term landform evolution of a catchment. A GIS based rapid erosion assessment method has been developed and evaluated. The method allows the user to quickly acquire and evaluate existing data to assist in the planning of more detailed monitoring, modelling and erosion assessment programs. The rapid erosion assessment method is based on a simplified version of the Revised Universal Soil Loss Equation (RUSLE), and allows the rapid parametrisation of the model from widely available land unit and elevation datasets. The rapid erosion assessment method is evaluated through the investigation of the effects of elevation data resolution on erosion predictions and field data validation. More detailed, quantitative risk assessment can be conducted using a combination of landform evolution modelling and basin analysis in a GIS framework. SIBERIA has been parameterized using field data from Ngarradj and applied to the catchment. Due to complexities of the catchment there were some difficulties with the hydrology component. However, the results indicate that SIBERIA is suitable and simulations showed little change in the catchment in the long term. Combining these with newly developed GIS tools to provide a geomorphometric basin analysis of the year 0 and year 1000 simulated catchments strengthens erosion risk impact assessment. The geomorphometric measures considered include the hypsometric curve, width function, cumulative area distribution and area-slope relationship. Three areas have been identified as requiring further study in order to consolidate mining impact assessment: the incorporation of spatial variation in SIBERIA input parameters in the modelling process, an analysis of the sensitivity of the SIBERIA model to input parameter variations or error and the practical application of the GIS/modelling approach to assessing the impact of the ERA Jabiluka Mine on landform evolution in the Ngarradj catchment. Copyright (2001) Commonwealth of Australia
159 Évaluation de l'activité biologique des feuilles de l'olivier ...
African Journals Online (AJOL)
PC
naturelles, nous avons essayé dans cette étude de contribuer à la connaissance de certains effets biologiques des feuilles ... alternative aux médicaments conventionnels. En Algérie, les plantes ... comparaison de deux moyennes de deux séries de mesure est réalisée grâce au test 't' de Student-Fisher. 2-5. Evaluation de ...
SU-E-J-159: Analysis of Total Imaging Uncertainty in Respiratory-Gated Radiotherapy
Energy Technology Data Exchange (ETDEWEB)
Suzuki, J; Okuda, T [Toyota memorial hospital, Toyota, Aichi (Japan); Sakaino, S; Yokota, N [Suzukake central hospital, Hamamatsu, Shizuoka (Japan)
2015-06-15
Purpose: In respiratory-gated radiotherapy, the gating phase during treatment delivery needs to coincide with the corresponding phase determined during the treatment plan. However, because radiotherapy is performed based on the image obtained for the treatment plan, the time delay, motion artifact, volume effect, and resolution in the images are uncertain. Thus, imaging uncertainty is the most basic factor that affects the localization accuracy. Therefore, these uncertainties should be analyzed. This study aims to analyze the total imaging uncertainty in respiratory-gated radiotherapy. Methods: Two factors of imaging uncertainties related to respiratory-gated radiotherapy were analyzed. First, CT image was used to determine the target volume and 4D treatment planning for the Varian Realtime Position Management (RPM) system. Second, an X-ray image was acquired for image-guided radiotherapy (IGRT) for the BrainLAB ExacTrac system. These factors were measured using a respiratory gating phantom. The conditions applied during phantom operation were as follows: respiratory wave form, sine curve; respiratory cycle, 4 s; phantom target motion amplitude, 10, 20, and 29 mm (which is maximum phantom longitudinal motion). The target and cylindrical marker implanted in the phantom coverage of the CT images was measured and compared with the theoretically calculated coverage from the phantom motion. The theoretical position of the cylindrical marker implanted in the phantom was compared with that acquired from the X-ray image. The total imaging uncertainty was analyzed from these two factors. Results: In the CT image, the uncertainty between the target and cylindrical marker’s actual coverage and the coverage of CT images was 1.19 mm and 2.50mm, respectively. In the Xray image, the uncertainty was 0.39 mm. The total imaging uncertainty from the two factors was 1.62mm. Conclusion: The total imaging uncertainty in respiratory-gated radiotherapy was clinically acceptable. However, an internal margin should be added to account for the total imaging uncertainty.
45 CFR 159.120 - Data submission for the individual and small group markets.
2010-10-01
... determined by the Secretary, submit pricing and benefit information for their portal plans on or before September 3, 2010, and annually thereafter. (c) Issuers must submit updated pricing and benefit data for their portal plans whenever they change premiums, cost-sharing, types of services covered, coverage...
Role of offending out-door aero-allergen and CD14 C(-159)T ...
African Journals Online (AJOL)
Child- hood-onset and adult-onset of asthma showed significant difference in allergen sensitivity as well as genetic background with respect to CD14 polymorphism. Keywords: Asthma, aero-allergen, skin prick test, total IgE, CD14 gene polymorphism. DOI: https://dx.doi.org/10.4314/ahs.v17i4.18. Cite as: Dutta S, Mondal P, ...
SU-E-J-159: Analysis of Total Imaging Uncertainty in Respiratory-Gated Radiotherapy
International Nuclear Information System (INIS)
Suzuki, J; Okuda, T; Sakaino, S; Yokota, N
2015-01-01
Purpose: In respiratory-gated radiotherapy, the gating phase during treatment delivery needs to coincide with the corresponding phase determined during the treatment plan. However, because radiotherapy is performed based on the image obtained for the treatment plan, the time delay, motion artifact, volume effect, and resolution in the images are uncertain. Thus, imaging uncertainty is the most basic factor that affects the localization accuracy. Therefore, these uncertainties should be analyzed. This study aims to analyze the total imaging uncertainty in respiratory-gated radiotherapy. Methods: Two factors of imaging uncertainties related to respiratory-gated radiotherapy were analyzed. First, CT image was used to determine the target volume and 4D treatment planning for the Varian Realtime Position Management (RPM) system. Second, an X-ray image was acquired for image-guided radiotherapy (IGRT) for the BrainLAB ExacTrac system. These factors were measured using a respiratory gating phantom. The conditions applied during phantom operation were as follows: respiratory wave form, sine curve; respiratory cycle, 4 s; phantom target motion amplitude, 10, 20, and 29 mm (which is maximum phantom longitudinal motion). The target and cylindrical marker implanted in the phantom coverage of the CT images was measured and compared with the theoretically calculated coverage from the phantom motion. The theoretical position of the cylindrical marker implanted in the phantom was compared with that acquired from the X-ray image. The total imaging uncertainty was analyzed from these two factors. Results: In the CT image, the uncertainty between the target and cylindrical marker’s actual coverage and the coverage of CT images was 1.19 mm and 2.50mm, respectively. In the Xray image, the uncertainty was 0.39 mm. The total imaging uncertainty from the two factors was 1.62mm. Conclusion: The total imaging uncertainty in respiratory-gated radiotherapy was clinically acceptable. However, an internal margin should be added to account for the total imaging uncertainty
40 CFR 86.159-00 - Exhaust emission test procedures for US06 emissions.
2010-07-01
... run on a large single roll electric dynamometer, or an approved equivalent dynamometer configuration... validity, shall be supplied on request of the Administrator. (6) The drive wheel tires may be inflated up... psi, in order to prevent tire damage. The drive wheel tire pressure shall be reported with the test...
40 CFR 86.159-08 - Exhaust emission test procedures for US06 emissions.
2010-07-01
..., CH4, and NOX. (b) Dynamometer activities. (1) All official US06 tests shall be run on a large single... be supplied on request of the Administrator. (6) The drive wheel tires may be inflated up to a gauge... prevent tire damage. The drive wheel tire pressure shall be reported with the test results. (7) The...
Selected translated abstracts of Russian-language climate-change publications: II, Clouds. Issue 159
Energy Technology Data Exchange (ETDEWEB)
Burtis, M.D. [comp.
1994-01-01
This report presents abstracts (translated into English) of important Russian-language literature concerning clouds as they relate to climate change. In addition to the bibliographic citations and abstracts translated into English, this report presents the original citations and abstracts in Russian. Author and title indexes are included to assist the reader in locating abstracts of particular interest.
Estimation of coincidence and correlation in non-analogous Monte Carlo particle transport - 159
International Nuclear Information System (INIS)
Szieberth, M.; Leen Kloosterman, J.
2010-01-01
The conventional non-analogous Monte Carlo methods are optimized to preserve the mean value of the distributions and therefore they are not suited for non-Boltzmann problems like the estimation of coincidences or correlations. This paper presents a general method called history splitting for the non-analogous estimation of such quantities. The basic principle of the method is that a non-analogous particle history can be interpreted as a collection of analogous histories with different weights according to the probability of their realization. Calculations with a simple Monte Carlo program for a pulse-height-type estimator prove that the method is feasible and provides unbiased estimation. Different variance reduction techniques have been tried with the method and Russian roulette turned out to be ineffective in high multiplicity systems. An alternative history control method is applied instead. Simulation results of a Feynman-α measurement shows that even the reconstruction of the higher moments is possible with the history splitting method, which makes the simulation of neutron noise measurements feasible. (authors)
Evaluation of Gd and Gd{sup 159} as new approaches for cancer treatment
Energy Technology Data Exchange (ETDEWEB)
Galvao, I.; Neves, M.J., E-mail: nevesmj@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil). Grupo de Desenvolvimento de Radiofarmacos; Santos, R.G., E-mail: santosr@cdtn.br [Instituto Nacional de Ciencia e Tecnologia em Medicina Molecular (INCT-MM), Belo Horizonte, MG (Brazil)
2011-07-01
Metal compounds have shown many biological activities and have been successfully used as anticancer agents such cisplatin. Actually gadolinium (Gd) complexed with a porphyrin Motexafin (MGd) has been investigated as redox-active compound for treatment of cancer. 1{sup 59G}d decays by beta emission with an energy of 970 keV and half-life of 18.59 hours. The de-excitation can be via gamma ray and internal conversion electron emission followed by auger electrons and x rays. Considering all of this 1{sup 59G}d could be a interesting radionuclide to be as a radio therapeutical agent. The aims of this works were to evaluate the cytotoxicity of Gd and 1{sup 59G}d on malignant brain tumors such as glioblastoma multiform, the most frequent brain tumors which has a very poor prognosis. For this purpose, it was used human glioblastoma cell lines T98 (mutant p53) and U87 (wild-type p53) to investigate the cytotoxicity of gadolinium on cell metabolism by MTT assay and also morphological changes, chromatin condensation by DAPI assay and ROS generation. Gadolinium was able to decrease cell viability, the cells presented morphological changes like round shapes and blebs formation after cell treatment with 5x10{sup -6}M of Gd. Nuclear changing and ROS generation occurred in a dose dependent way indicating the cytotoxic effect of Gd. Treatment with 1{sup 59G}d increased all of changes observed with treatment with Gd. These results state for an additive effect of metal toxicity and radioactivity inducing ROS generation as the main mechanism of anti tumoral action of 1{sup 59G}d. The results obtained indicated that the radioactive analogues of Gd have increased cytotoxic effects and gadolinium can be a metal of choice for development of new drugs for cancer treatment. (author)
Energy Technology Data Exchange (ETDEWEB)
Butler, T A; Lamb, E; Rupp, A F [Oak Ridge National Laboratory, Oak Ridge, TN (United States)
1962-01-15
Recent developments in the radioisotope production programme at Oak Ridge National Laboratory include new processes and process improvements for the production of cerium-144, promethium-147, technetium-99 and strontium-90. Cerium-144 has been produced in kc quantities in a test run. A product recovery of more than 98% with a product purity of more than 99% was attained. The cerium was further processed to obtain pure cerium-144 oxide powder having an activity concentration of 235 c/g. The powder was pressed into pellets which were sintered to a dense ceramic form. Promethium-147 has been produced in kc quantities by a combination of precipitation and ion exchange techniques. A solvent extraction system for separating promethium- 147 from other rare earths has been tested on a tracer scale. Gram quantities of technetium-99 have been recovered from fission-product waste streams by a combination of precipitation and solvent extraction processes. The technetium product was produced with a chemical purity of more than 99.9% and radiochemical purity of more than 99.99%. The separation and purification of strontium-90 from gross contaminants by a continuous solvent-extraction flowsheet has been demonstrated on a tracer scale. Product quality of 98% strontium has been achieved from feed containing 95% inert calcium contaminant. The strontium-90 is further processed to form strontium titanate ceramic elements. (author) [French] Les faits recents a noter dans le programme de production de radioisotopes du laboratoire national d'Oak Ridge sont l'introduction de nouvelles methodes et l'amelioration des techniques existantes pour la production du eerium-144, du prometheum-147, du technetium-99 et du strontium-90. Le cerium-144 a ete obtenu en quantites de l'ordre du kilocurie, lors d'une experience. On a obtenu un taux d'extraction de plus de 98% et un produit d'une purete superieure a 99%. On a ensuite traite le cerium pour avoir de l'oxyde de cerium-144 pur en poudre ayant
Canabis in the Development and Homeostasis of the Nerve System
Czech Academy of Sciences Publication Activity Database
Blahoš, J.; Blahoš, Jaroslav
2013-01-01
Roč. 76, č. 5 (2013), s. 559-564 ISSN 1210-7859 Institutional support: RVO:68378050 Keywords : endocannabinoid * cannabis * pregnancy Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.159, year: 2013
Czech Academy of Sciences Publication Activity Database
Schraml, Jan; Korec, S.; Krump, M.; Čermák, Jan
2015-01-01
Roč. 53, č. 2 (2015), s. 154-159 ISSN 0749-1581 Institutional support: RVO:67985858 Keywords : NMR * polymerization * 3-aminopropyltrimethoxysilane Subject RIV: CC - Organic Chemistry Impact factor: 1.226, year: 2015
Hudba mezi rozumem a citem. K vývoji kompozičního jazyka Jaroslava Novotného
Czech Academy of Sciences Publication Activity Database
Maňour, Ondřej
XLI, 1/2 (2004), s. 159-184 ISSN 0018-7003 Institutional research plan: CEZ:AV0Z8059909 Keywords : Jaroslav Novotný * composition language * development Subject RIV: AL - Art, Architecture, Cultural Heritage
76 FR 26240 - Butte County Resource Advisory Committee (RAC)
2011-05-06
... request amount; review and discuss examples of watershed/stream restoration and road maintenance projects..., USDA, Plumas National Forest, P.O. Box 11500/159 Lawrence Street, Quincy, CA 95971; (530) 283-7850; or...
Czech Academy of Sciences Publication Activity Database
Göransson, G.; Peter, M.; Franc, Jiří; Petrykin, Valery; Ahlberg, E.; Krtil, Petr
2012-01-01
Roč. 159, č. 9 (2012), D555-D562 ISSN 0013-4651 Institutional support: RVO:61388955 Keywords : NANOCRYSTALLINE NICKEL * COATINGS * ELECTRODEPOSITION Subject RIV: CG - Electrochemistry Impact factor: 2.588, year: 2012
CASSINI S MIMI CHEMS SENSOR CALIBRATED DATA V1.0
National Aeronautics and Space Administration — The Cassini Magnetospheric Imaging Instrument(MIMI) Charge Energy Mass Spectrometer (CHEMS) contains a deflection system and an overall field of view of 159 x 4 deg....
Directory of Open Access Journals (Sweden)
James M. Buchanan
2013-03-01
Full Text Available Contribution to a series of recollections and reflections on professional experiences of distinguished economists. Article originally published in vol. 39 n. 159 of Banca Nazionale del Lavoro Quarterly Review.
Ya-Lan, Zhang; Yan-Kun, Zhu; Wei-Qi, Chen; Yan, Deng; Peng, Li
2018-01-10
To understand the current status of human resources of parasitic disease control and prevention organizations in Henan Province, so as to provide the reference for promoting the integrative ability of the prevention and control of parasitic diseases in Henan Province. The questionnaires were designed and the method of census was adopted. The information, such as the amounts, majors, education background, technical titles, working years, and turnover in each parasitic disease control and prevention organization was collected by the centers for disease control and prevention (CDCs) at all levels. The data were descriptively analyzed. Totally 179 CDCs were investigated, in which only 19.0% (34/179) had the independent parasitic diseases control institution (department) . There were only 258 full-time staffs working on parasitic disease control and prevention in the whole province, in which only 61.9% (159/258) were health professionals. Those with junior college degree or below in the health professionals accounted for 60.3% (96/159) . Most of them (42.1%) had over 20 years of experience, but 57.9% (92/159) of their technical post titles were at primary level or below. The proportion of the health professionals is low in the parasitic disease control and prevention organizations in Henan Province. The human resource construction for parasitic disease control and prevention at all levels should be strengthened.
Výročí narození zakladatele brněnské balkanistiky prof. dr. Josefa Kabrdy
Czech Academy of Sciences Publication Activity Database
Hladký, Ladislav
2016-01-01
Roč. 102, č. 1 (2016), s. 159-161 ISSN 0037-6922 Institutional support: RVO:67985963 Keywords : Historian Josef Kabrda (1906–1968) * Balkan studies, history of Ottoman Empire Subject RIV: AB - History
Afican Health Sciences Vol 10 No 2.pmd
African Journals Online (AJOL)
Administrator
2007-01-23
Jan 23, 2007 ... Key Words: Zimbabwe, Gokwe, Outbreak, Anthrax, Bacillus anthracis. African Health Sciences 2010; 10(2): 159 - 164. Introduction. Anthrax is ... and establish factors associated with contracting anthrax in the affected area.
Birru, Worku Tuffa; Runhaar, Piety; Zaalberg, Ruud; Lans, Thomas; Mulder, Martin
2018-01-01
This study explores relationships between export performance and international business competencies (international orientation, export market orientation and international entrepreneurial orientation), and interactions between the competencies. Data from on-site structured interviews with 159
Evaluation of biological activities of new LH-RH antagonists (T-series) in male and female rats.
Pinski, J; Yano, T; Janaky, T; Nagy, A; Juhasz, A; Bokser, L; Groot, K; Schally, A V
1993-01-01
A series of new highly potent LH-RH antagonists (T-series) has been synthesized in our laboratory. Among these analogs, antagonists [Ac-D-Nal(2), D-Phe(4Cl)2, D-Pal(3)3, D-Lys(A2pr(Car)2)6, D-Ala10]LH-RH (T-140); [Ac-D-Nal(2)1, D-Phe(4Cl)2, D-Pal(3)3, D-Lys(A2pr(Ac)2)6, D-Ala10]LH-RH (T-148); [Ac-D-Nal(2)1, D-Phe(4Cl)2, D-Pal(3)3, D-Lys(A2pr(For)2)6, D-Ala10]LH-RH (T-151) and [Ac-D-Nal(2)1, D-Phe(4Cl)2, D-Pal(3)3, D-Lys(A2bu(For)2)6, D-Ala10]LH-RH (T-159) were the most powerful. Antagonists T-140, T-148 and T-151 produced a complete blockade of ovulation in normal cycling rats at a dose of 1.5 micrograms/rat and antagonist T-159 at a dose of only 0.75 micrograms/rat. The inhibitory effects of compounds T-148, T-151 and T-159 on gonadotropin and sex steroid secretion were investigated in male and female rats. To determine their effect on LH levels in castrated male and ovariectomized female rats, T-148, T-151 and T-159 were injected subcutaneously in doses of 0.625 and 2.5 micrograms/rat. Blood samples were taken at different intervals for 48 h. All three compounds at either dose caused a significant (P < 0.01) decrease in LH levels for more than 6 h. Significant (P < 0.01) inhibition of LH lasted for more than 24 h following a dose of 2.5 micrograms sc of all 3 antagonists in both male and female rats. Serum FSH levels were also suppressed significantly for more than 48 h in castrated male rats by all three antagonists at a dose of 5 micrograms/rat sc.(ABSTRACT TRUNCATED AT 250 WORDS)
Czech Verse Processing System KVĚTA: Phonetic and Metrical Components
Czech Academy of Sciences Publication Activity Database
Plecháč, Petr
2016-01-01
Roč. 7, č. 2 (2016), s. 159-174 ISSN 1337-7892 Institutional support: RVO:68378068 Keywords : Verse Processing * KVĚTA * Czech language * phonetic and metrical annotation Subject RIV: AJ - Letters, Mass-media, Audiovision
Czech Academy of Sciences Publication Activity Database
Horáček, J.; Tejkalová, H.; Novák, T.; Bubeníková-Valešová, V.; Páleníček, T.; Rambousek, L.; Růžičková, Šárka; Vaculín, Š.; Hoeschl, C.
2011-01-01
Roč. 41, č. 8 (2011), s. 1787-1789 ISSN 0033-2917 Institutional research plan: CEZ:AV0Z50520701 Keywords : serotonin * proinflammatory * cytokines Subject RIV: AN - Psychology Impact factor: 6.159, year: 2011
Radiochemistry and radiochemical separations. A current bibliography
International Nuclear Information System (INIS)
Bujdoso, E.
1999-01-01
A current bibliography for years 1993-1996 with 159 references was compiled on radiochemistry and radiochemical separations based on the INIS Atomindex. The references are arranged in alphabetical order of first authors. (N.T.)
Czech Academy of Sciences Publication Activity Database
Shaliutina, A.; Hulák, M.; Li, P.; Šulc, Miroslav; Dzyuba, B.; Linhart, O.
2013-01-01
Roč. 48, č. 1 (2013), s. 156-159 ISSN 0936-6768 Institutional support: RVO:61388971 Keywords : TROUT ONCORHYNCHUS - MYKISS * SEMEN CHARACTERISTICS * SPERMATOZOA Subject RIV: EE - Microbiology, Virology Impact factor: 1.177, year: 2013
Social benefits of the RIA technique in the State of Zacatecas
International Nuclear Information System (INIS)
Badillo R, Y.; Badillo A, V.
2004-01-01
Presently work was carried out tests of thyroid function to 159 patients with the purpose of evaluating the incidence of thyroid illnesses, being based these studies on the method of Radio immuno analysis (RIA). During this work they were studied 159 patients, men (21%) and women (79%), to which were practiced the tests of thyroid function, applying the technique of Radio immuno analysis, throwing the following results: Healthy patients (58.5%); Hyper thyroidal patients (22.6%), Hypo thyroidal patients (18.9%). The social benefit of this technique and their importance is because the patients that go to this laboratory are of scarce resources and otherwise; they would not simply be diagnose, since we have found patients that have taken until 10 years in that are diagnosed thyroid abnormalities. (Author)
Energy Technology Data Exchange (ETDEWEB)
Badillo R, Y.; Badillo A, V. [UAZ, Carretera a Ciudad Cuahutemoc Km. 0.5, Guadalupe, Zacatecas (Mexico)]. E-mail: yasminbadilloregis@hotmail.com
2004-07-01
Presently work was carried out tests of thyroid function to 159 patients with the purpose of evaluating the incidence of thyroid illnesses, being based these studies on the method of Radio immuno analysis (RIA). During this work they were studied 159 patients, men (21%) and women (79%), to which were practiced the tests of thyroid function, applying the technique of Radio immuno analysis, throwing the following results: Healthy patients (58.5%); Hyper thyroidal patients (22.6%), Hypo thyroidal patients (18.9%). The social benefit of this technique and their importance is because the patients that go to this laboratory are of scarce resources and otherwise; they would not simply be diagnose, since we have found patients that have taken until 10 years in that are diagnosed thyroid abnormalities. (Author)
The nev diffractometer ARES for the analysis of residual stresses
Czech Academy of Sciences Publication Activity Database
Staron, P.; Ruhnau, H. U.; Marmotti, M.; Mikula, Pavol; Kampmann, R.
276/278, - (2000), s. 158-159 ISSN 0921-4526 Institutional research plan: CEZ:AV0Z1048901 Keywords : neutron instruments * residual stress Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.893, year: 2000
As below, so above: A perspective on African Theology
African Journals Online (AJOL)
p1243322
of thinking and speaking about God. 1. ... indispensable contribution in Christian thinking about God. ..... because of the support of a community, one can grow. ..... Initiation into theology: The rich variety of theology and hermeneutics, 159-.
1-------------------------_ editorial i van die redaksie
African Journals Online (AJOL)
Spasticity as a clinical phenomenon is generally con- ... 159 cases, including 88 of spastic diplegia treated by .... Intra-operative monitoring of nerve root function by ... the management of cerebral palsy spasticity: a 10-year experience.
2011-12-29
....071 0.082 0.082 1009). Rowan County (NC) 301 West St & Gold Hill Ave. (37-159- 0.084 0.071 0.077 0.077... Environmental protection, Air pollution control, Incorporation by reference, Intergovernmental relations...
Czech Academy of Sciences Publication Activity Database
Dušková, M.; Kozák, J.; Mazánek, J.; Šmahel, Zbyněk; Vohradník, M.
2000-01-01
Roč. 23, - (2000), s. 57-63 ISSN 0930-343X Institutional research plan: CEZ:AV0Z5039906 Keywords : bioactive glass ceramics Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 0.159, year: 2000
The Relationship Between Solar Radio and Hard X-ray Emission
Czech Academy of Sciences Publication Activity Database
White, S.M.; Benz, A. O.; Christe, S.; Fárník, František; Kundu, M.R.; Mann, G.; Ning, Z.; Raulin, J.-P.; Silva-Valio, A.V.R.; Saint-Hilaire, P.; Vilmer, N.; Warmuth, A.
2011-01-01
Roč. 159, 1-4 (2011), s. 225-261 ISSN 0038-6308 Institutional support: RVO:67985815 Keywords : Sun * radio radiation * X-rays Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.611, year: 2011
Czech Academy of Sciences Publication Activity Database
Srholec, Martin
2015-01-01
Roč. 24, 1-2 (2015), s. 159-182 ISSN 1043-8599 R&D Projects: GA ČR GAP402/10/2310 Institutional support: RVO:67985998 Keywords : innovation * cooperation * multilevel model Subject RIV: AH - Economics
Czech Academy of Sciences Publication Activity Database
Franta, M.; Baruník, Jozef; Horváth, Roman; Šmídková, K.
2014-01-01
Roč. 10, č. 1 (2014), s. 159-187 ISSN 1815-4654 Institutional support: RVO:67985556 Keywords : Bayesian vector autoregression * fan chart * inflation targeting * stress tests Subject RIV: AH - Economics Impact factor: 0.800, year: 2014
Some aspects of pollution of coastal marine environment of Bombay
Digital Repository Service at National Institute of Oceanography (India)
Rokade, M.A.
stream_size 159 stream_content_type text/plain stream_name Rokade_MSc_thesis.pdf.txt stream_source_info Rokade_MSc_thesis.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...
Biophysical approach to low back pain: a pilot report
Czech Academy of Sciences Publication Activity Database
Foletti, A.; Pokorný, Jiří
2015-01-01
Roč. 34, č. 2 (2015), s. 156-159 ISSN 1536-8378 Institutional support: RVO:67985882 Keywords : Bioelectromagnetic medicine * Biophysical therapy * Coherence domains Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.208, year: 2015
S¯adhan¯a Vol. 30, 2005 Subject Index
Indian Academy of Sciences (India)
Access control. Trust management for e-transactions. 141 ... Design of supply chains: Unrealistic expecta- tions on .... Retail. Web services in the retail industry. 159. Retention basin. Assessment of retention basin volume and outlet capacity in ...
TMFunction data: 34 [TMFunction[Archive
Lifescience Database Archive (English)
Full Text Available hia coli ... Morona R, Klose M, Henning U. J Bacteriol. 1984 Aug;159(2):570-8. Phage inactivation ... 1BXW ... OMPA_ECOLI (P0A910) Strand ... receptor; phage resistant; binding; folding model
JOURNAL V12 NO 1 2OO7 FINAL EDIT TO BIOLINE
African Journals Online (AJOL)
user
East and Central African Journal of Surgery Volume 12 Number 1. April 2007. 159. Angio-Lymphoid Hyperplasia With Eosinophilia- Kimura's Disease: A Manifestation Of HIV. Desease? ... parts of Asia and affects young Asian men. It has.
Czech Academy of Sciences Publication Activity Database
Dušková, Dagmar; Marounek, Milan
2001-01-01
Roč. 33, č. 3 (2001), s. 159-163 ISSN 0266-8254 R&D Projects: GA AV ČR KSK2020602 Keywords : Lachnospira multiparus * anaerobic bacteria Subject RIV: ED - Physiology Impact factor: 1.151, year: 2001
Czech Academy of Sciences Publication Activity Database
Kletetschka, Günther
2006-01-01
Roč. 159, 1-2 (2006), s. 127-128 ISSN 0031-9201 Institutional research plan: CEZ:AV0Z30130516 Keywords : magnetization * modeling * modeled data Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.440, year: 2006
Ethiopian Journal of Environmental Studies & Management 7(2 ...
African Journals Online (AJOL)
Osondu
2013-11-01
Nov 1, 2013 ... Ethiopian Journal of Environmental Studies & Management 7(2): 153 – 159, 2014. ISSN:1998-0507 ... and food processing industries, battery, cement, milling and ..... risks, but can provide basic information on source of water ...
Effects of Weed Control and Cow Dung Manure on Growth ...
African Journals Online (AJOL)
ISSN 0794-5698. Effects of Weed Control and Cow Dung Manure on Growth Performance of Quality Protein Maize in ... worldwide on over 159.5 million hectares in the year. 2010. ...... Fertilizer company of Nigeria, NAFCON, Port. Harcourt.
Fission time-scale from the measurement of pre-scission light ...
Indian Academy of Sciences (India)
2015-07-19
scission neutron, proton, -particle and GDR -ray multiplicities for the reaction 28Si+175Lu at 159 MeV using the BARC–TIFR Pelletron–LINAC accelerator facility is given. The data were analysed using deformation-dependent ...
TZCF Oceanographic Survey (SE1505)
National Oceanic and Atmospheric Administration, Department of Commerce — Oceanographic data were collected along the 159W and Meridional from 26? 30'N-32? 30'N. CTD casts were conducted at predetermined stations. CTDs were equipped with...
77 FR 63296 - Fisheries of the Northeast Region
2012-10-16
... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration RIN 0648-XC159 Fisheries of the Northeast Region AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and Atmospheric Administration (NOAA), Commerce. ACTION: Notification of determination of overfishing and...
77 FR 3758 - Combined Notice of Filings #1
2012-01-25
...: Attachment H Schedule 7 Compliance Filing to be effective 6/1/2011. Filed Date: 1/13/12. Accession Number... filings: Docket Numbers: QF12-159-000. Applicants: City of Kinston, NC. Description: FERC Form 556 of City...
2012 GA-SC-NC red snapper multi-gear CRP project
National Oceanic and Atmospheric Administration, Department of Commerce — Surveys were completed at 1,656 locations, yielding 173 red snapper length and 159 red snapper age samples. Catches were greatest in waters off GA (n 133), and...
On the efficiency of the first price auction
Czech Academy of Sciences Publication Activity Database
Hernando-Veciana, Á.; Michelucci, Fabio
2017-01-01
Roč. 156, July (2017), s. 159-161 ISSN 0165-1765 Institutional support: Progres-Q24 Keywords : efficiency * first price auction * english auction Subject RIV: AH - Economics OBOR OECD: Economic Theory Impact factor: 0.558, year: 2016
Czech Academy of Sciences Publication Activity Database
Bujdošová, Z.; Gyoryova, K.; Kovářová, Jana; Hudecová, D.; Halás, L.
2009-01-01
Roč. 98, č. 1 (2009), s. 151-159 ISSN 1388-6150 Institutional research plan: CEZ:AV0Z40500505 Keywords : zinc(II) salicylate * theophylline * urea Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.587, year: 2009
Fibrillarin from Archaea to human
Czech Academy of Sciences Publication Activity Database
Rodriguez-Corona, U.; Sobol, Margaryta; Rodriguez-Zapata, L.C.; Hozák, Pavel; Castano, E.
2015-01-01
Roč. 107, č. 6 (2015), s. 159-174 ISSN 0248-4900 Institutional support: RVO:68378050 Keywords : Cancer * Methylation * p53 * Ribosomal biogenesis * RNA processing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.552, year: 2015
Streptococcus mutans competence-stimulating peptide inhibits Candida albicans hypha formation.
Jarosz, Lucja M; Deng, Dong Mei; van der Mei, Henny C; Crielaard, Wim; Krom, Bastiaan P
2009-11-01
The oral cavity is colonized by microorganisms growing in biofilms in which interspecies interactions take place. Streptococcus mutans grows in biofilms on enamel surfaces and is considered one of the main etiological agents of human dental caries. Candida albicans is also commonly found in the human oral cavity, where it interacts with S. mutans. C. albicans is a polymorphic fungus, and the yeast-to-hypha transition is involved in virulence and biofilm formation. The aim of this study was to investigate interkingdom communication between C. albicans and S. mutans based on the production of secreted molecules. S. mutans UA159 inhibited C. albicans germ tube (GT) formation in cocultures even when physically separated from C. albicans. Only S. mutans spent medium collected in the early exponential phase (4-h-old cultures) inhibited the GT formation of C. albicans. During this phase, S. mutans UA159 produces a quorum-sensing molecule, competence-stimulating peptide (CSP). The role of CSP in inhibiting GT formation was confirmed by using synthetic CSP and a comC deletion strain of S. mutans UA159, which lacks the ability to produce CSP. Other S. mutans strains and other Streptococcus spp. also inhibited GT formation but to different extents, possibly reflecting differences in CSP amino acid sequences among Streptococcus spp. or differences in CSP accumulation in the media. In conclusion, CSP, an S. mutans quorum-sensing molecule secreted during the early stages of growth, inhibits the C. albicans morphological switch.
AB Dor Moving Group Stars Resolved with the CHARA Array
Schaefer, G. H.; White, R. J.; Baines, E. K.; Boyajian, T. S.; ten Brummelaar, T. A.; Farrington, C. D.; Sturmann, J.; Sturmann, L.; Turner, N. H.
2018-05-01
We present interferometric measurements obtained with the CHARA Array of 13 adolescent-age stars in nearby moving groups. The motivation was to spatially resolve the largest stars and to search for binary companions. Nine stars have diameters smaller than the resolution limit and no evidence for companions within 0.5–50 mas and ΔH group, and former member HD 89744 (0.556 ± 0.032 mas). Combining the angular diameters with their distances and bolometric fluxes, we measured radii and effective temperatures. The temperatures of GJ 159 (6286 ± 123 K) and GJ 393 (3515 ± 68 K) are consistent with spectroscopic measurements. Comparisons with evolutionary models show that HD 89744 has evolved off the main sequence. GJ 159 and GJ 393 lie within 1.5σ of the zero-age main sequence, complicating their age estimates because it is unclear whether the stars are contracting or expanding. GJ 159 has a mass of 1.2 ± 0.1 {M}ȯ with an age spanning 0.021–3.0 Gyr. Its debris disk and lithium abundance favor a young age. GJ 393 has a mass of 0.42 ± 0.03 {M}ȯ and a lower limit on its age 0.06 Gyr. This overlaps with the age of the moving group; however, an older age would be more consistent with its slow rotation, low activity, and luminosity, suggesting that GJ 393 is a kinematic interloper.
Dispute Settlement Patterns on The Village Chief Election In Indonesia (Lumajang Regency
Directory of Open Access Journals (Sweden)
Fauziyah Fauziyah
2016-06-01
Full Text Available In the year of 2013, Lumajang Regency carries out 159 village chief election (Pilkades. There are 4 disputes of Pilkades, and all about voice counting result of Pilkades. Local Regulation No. 24 year 2006 and Local Regulation No. 6 year 2012 do not state any matter of dispute in village headman election and mechanism of solution, but Local Government Regulation determines Watchdog Committee in the level of sub-district and Team of Village Governance Issues Completion in the level of District. Watchdog committee conducts supervision by preventive and repressive act. Supervision is done through preventive act in the form of communications and socialization to the village officer, Village Consultative Council (BPD, and Pilkades Committee about the importance of honest, fair and democratic Pilkades. Meanwhile, supervision is conducted through repressive act by facilitating the parties if dispute happened. As the result, committee executes the monitoring well, proven from 159 Pilkades, there was only 4 disputes, three among others can be resolved in non litigation process. Existence of Watchdog Committee is supported by the availability of budget coming from help of region budget (APBD that is packed into village budget (APBDes, Rp.2.000.000 for every Pilkades. How to Cite: Fauziyah, F., & Praptianingsih, S. (2016. Dispute Settlement Patterns on The Village Chief Election In Indonesia (Lumajang Regency. Rechtsidee, 3(1, 53-62. doi: http://dx.doi.org/10.21070/jihr.v3i1.159
Growth and gas exchange in white pitaya under different concentrations of potassium and calcium
Directory of Open Access Journals (Sweden)
João Paulo Cajazeira
Full Text Available ABSTRACT Agriculture in Brazil has improved at a fast pace in recent years, given the growing demand for quality and the need for new products. In this respect, white pitaya [Hylocereus undatus (Haw. Britton & Rose] has become a feasible alternative for Northeast farmers. The limiting factors include a small amount of data on plant mineral nutrition and crop growth (phenology. Therefore, this study goal was to evaluate the effect of different concentrations of potassium (K and calcium (Ca on crop development and gas exchange in white pitaya grown in the coastal region of the state of Ceará, in Brazil. Sixteen treatments with three repetitions were organized in a completely randomized block design and a 4 × 4 factorial arrangement. Treatments consisted of various concentrations of K (0; 125; 250 and 375 mg dm-3 and Ca (0, 53, 106, and 159 mg dm-3. Biometric characteristics and gas exchange were determined after 270 and 240 days of treatment, respectively. For morphometric characteristics, the most significant nutrient combination was 250 mg dm-3 of K and 159 mg dm-3 of Ca. Net photosynthesis was higher at the dose of 125 mg dm-3 of K and 0 mg dm-3 of Ca. Our results indicate that, for the environmental conditions under which the test was conducted, an optimum nutrient combination for the analyzed variables was 250 mg dm-3 K and 159 mg dm-3 Ca.
Technical and socioeconomic assessment of honey production in ...
African Journals Online (AJOL)
... Guinean highlands zone of West Region of Cameroon were assessed through survey ... The interval between hives installation and bee populating as well as hives ... wax (69.9%), propolis (44.2%), pollen (15.9%) and royal jelly (3.5%).
Journal of Agriculture, Forestry and the Social Sciences - Vol 4, No 1 ...
African Journals Online (AJOL)
Evolving An Effective Trade Policy Against Agricultural Subsidies Of ... An analysis of the cost effectiveness of replacing maize with wheat offal in broiler ... A D Ologhobo, O A Adebiyi, S T Ogunbanwo, 150-159 ... AJOL African Journals Online.
Behaviour of arsenic in forested catchments following a high-pollution period
Czech Academy of Sciences Publication Activity Database
Novák, M.; Erbanová, L.; Fottová, D.; Cudlín, Pavel; Kubena, A.
2011-01-01
Roč. 159, č. 1 (2011), s. 204-211 ISSN 0269-7491 Institutional research plan: CEZ:AV0Z60870520 Keywords : Arsenic * Catchment * Soil * Flux * Mass balance * Biomass Subject RIV: DD - Geochemistry Impact factor: 3.746, year: 2011
NCBI nr-aa BLAST: CBRC-DRER-26-0474 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DRER-26-0474 ref|NP_384172.1| SENSOR HISTIDINE KINASE TRANSMEMBRANE PROTEIN [S...inorhizobium meliloti 1021] emb|CAC41453.1| SENSOR HISTIDINE KINASE TRANSMEMBRANE PROTEIN [Sinorhizobium meliloti] NP_384172.1 1e-159 68% ...
Czech Academy of Sciences Publication Activity Database
Chroust, K.; Pavlová, M.; Prokop, Z.; Mendel, Jan; Božková, K.; Kubát, Z.; Zajíčková, V.; Damborský, J.
2007-01-01
Roč. 67, č. 1 (2007), s. 152-159 ISSN 0045-6535 Institutional research plan: CEZ:AV0Z60930519 Keywords : toxicity * wing spot test * QSAR Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.739, year: 2007
The effects of grade, self-efficacy, learned-helpnessness, and ...
African Journals Online (AJOL)
helplessness, and cognitive engagement on liking mathematics, and b) assessing the developmental trends of these variables across grade levels. The subjects of the study are 159 primary school students. The results showed that the effect of the ...
Computing Beyond the Church-Turing Limit
Jones, Robert
2009-05-01
Dershowitz and Gurevich claim to have proven the Church-Turing theorem starting from a set of 4 reasonable postulates. (Bulletin of Symbolic Logic, vol. 14, num. 3, Sept. 2008, pg. 299) But their postulate II assumes fixed vocabulary. Humans, however, change their vocabulary words (and concepts) over time. My Asa H artificial intelligence also changes its vocabulary. (Trans. of the Kansas Acad. of Sci., vol. 109, no. 3/4, pg 159, 2006, www.bioone.org/archive/0022- 8443/109/3/pdf/i0022-8443-109-3-159.pdf) Their postulate I excludes nondeterministic transitions between states. I don't know how often humans flip a coin but my Asa H does employ random transitions under certain circumstances. Perhaps humans and Asa H go beyond the Church-Turing limit. (Trans. Kansas Acad. of Sci., 108, 3/4, pg. 169, 2005)
Proposal for the award of a contract for cleaning on the Swiss part of the CERN site
2005-01-01
This document concerns the award of a contract for cleaning on the Swiss part of the CERN site. The Finance Committee is invited to agree to the negotiation of a contract with TOP-NET SERVICES (CH), the lowest bidder complying with the specification, for the provision of cleaning and building maintenance work on the Swiss part of the CERN site for three years for a total amount of 5 841 159 Swiss francs, not subject to revision until 1 January 2009, with options for additional services for an additional amount of 350 000 Swiss francs, not subject to revision until 1 January 2009, bringing the total amount to 6 191 159 Swiss francs, not subject to revision until 1 January 2009. The contract will include options for two one-year extensions beyond the initial three-year period.
Tse, Pui-Kwan
2011-01-01
Introduction China's dominant position as the producer of over 95 percent of the world output of rare-earth minerals and rapid increases in the consumption of rare earths owing to the emergence of new clean-energy and defense-related technologies, combined with China's decisions to restrict exports of rare earths, have resulted in heightened concerns about the future availability of rare earths. As a result, industrial countries such as Japan, the United States, and countries of the European Union face tighter supplies and higher prices for rare earths. This paper briefly reviews China's rare-earth production, consumption, and reserves and the important policies and regulations regarding the production and trade of rare earths, including recently announced export quotas. The 15 lanthanide elements-lanthanum, cerium, praseodymium, neodymium, promethium, samarium, europium, gadolinium, terbium, dysprosium, holmium, erbium, thulium, ytterbium, and lutetium (atomic numbers 57-71)-were originally known as the rare earths from their occurrence in oxides mixtures. Recently, some researchers have included two other elements-scandium and yttrium-in their discussion of rare earths. Yttrium (atomic number 39), which lies above lanthanum in transition group III of the periodic table and has a similar 3+ ion with a noble gas core, has both atomic and ionic radii similar in size to those of terbium and dysprosium and is generally found in nature with lanthanides. Scandium (atomic number 21) has a smaller ionic radius than yttrium and the lanthanides, and its chemical behavior is intermediate between that of aluminum and the lanthanides. It is found in nature with the lanthanides and yttrium. Rare earths are used widely in high-technology and clean-energy products because they impart special properties of magnetism, luminescence, and strength. Rare earths are also used in weapon systems to obtain the same properties.
A novel 5p15.33-14.1 deletion and 4q34.24-35.2 duplication in a ...
Indian Academy of Sciences (India)
Both are normal in phenotype and intelligence. His mother ... Bacterial artificial chromosome (BAC) clone RP11-159A22. (4q35.1) was ... However, we can not exclude the impacts ... researchers of State Key Laboratory of Medical Genetics.
ORF Alignment: NC_004350 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004350 gi|24378587 >1t06A 1 191 11 210 3e-32 ... gb|AAN57848.1| DNA alkylation rep...air enzyme [Streptococcus mutans UA159] ... ref|NP_720542.1| DNA alkylation repair enzyme ...
Czech Academy of Sciences Publication Activity Database
Seminatore, CH.; Polentes, J.; Ellman, D.; Kozubenko, Nataliya; Itier, V.; Tine, S.; Tritschler, L.; Brenot, M.; Guidou, E.; Blondeau, J.; Lhuillier, M.; Bugi, A.; Aubry, L.; Jendelová, Pavla; Syková, Eva; Perrier, A. L.; Finsen, B.; Onteniente, B.
2010-01-01
Roč. 41, č. 1 (2010), s. 153-159 ISSN 0039-2499 Institutional research plan: CEZ:AV0Z50390703 Keywords : brain transplantation * human embryonic stem cells * neural differentiation Subject RIV: FH - Neurology Impact factor: 5.756, year: 2010
47 CFR 1.10009 - What are the steps for electronic filing?
2010-10-01
... technical data, or that require yes or no answers or other short answers. However, if documents or other... FCC Form 159, go to the IBFS Web site (http://www.fcc.gov/ibfs) and click on the “Getting Started...
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
hair conjecture in scalar–tensor theories · T Singh R Chaubey ... universe has been studied. Volume 69 Issue 2 August 2007 pp 159-166 Research Articles. Bianchi Type-I, V and VIo models in modified generalized scalar–tensor theory.
Olemuse teater. Kantor ja Brook / Jan Kott ; tõlk. Eva-Liisa Linder
Kott, Jan
2004-01-01
T. Kantori lavastustest "Surnud klass" ja "Wielopole Wielopole" ning P. Brooki "Carmeni" lavastusest. Tõlgitud raamatust : Jan Kott. The Theatre of Essence: Kantor and Brook.- The Theatre of Essence and other Essays. Evanston, Northwestern University Press, 1984, lk. 159-165
African Journals Online (AJOL)
Items 1 - 50 of 159 ... Vol 5, No 2 (2006), A comparison of Apgar Scores of neonates following ... Review Of Laparoscopy At A Dedicated Assisted Reproductive Technology ... As Part Of Clinical Presentation Of Urinary Tract Infection In An Infant.
... and minerals. In: Baynes JW, Dominiczak MH, eds. Medical Biochemistry . 4th ed. Elsevier Saunders; 2014:chap 11. Ginder GD. Microcytic and hypochromic anemias. In: Goldman L, Schafer AI, ... . 25th ed. Philadelphia, PA: Elsevier Saunders; 2015:chap 159.
Networking between Practitioners and Academics in Law Enforcement.
Caldwell, Dean S.; Dorling, Ernest W.
1995-01-01
A survey analyzing networking and contact with colleagues received 159 of 307 responses, 73% from criminal justice practitioners and 27% from criminal justice faculty. Apparent differences in communication practices disappear when educational level and research involvement are considered. (SK)
Penser, c'est penser a deux. Yves Aulas et Levinas
Czech Academy of Sciences Publication Activity Database
Bierhanzl, Jan
2012-01-01
Roč. 18, č. 159 (2012), s. 53-57 ISSN 1260-5921 R&D Projects: GA ČR(CZ) GAP401/10/1164 Institutional support: RVO:67985955 Keywords : mental disease * ethics * speech * thinking * philosophy Subject RIV: AA - Philosophy ; Religion
On Airborne Nano/Micro-Sized Particles Released from Low-Metallic Automotive Brakes
Czech Academy of Sciences Publication Activity Database
Kukutschová, J.; Moravec, Pavel; Tomášek, V.; Matějka, V.; Smolík, Jiří; Schwarz, Jaroslav; Seidlerová, J.; Šafářová, K.; Filip, P.
2011-01-01
Roč. 159, č. 4 (2011), s. 998-1006 ISSN 0269-7491 Institutional research plan: CEZ:AV0Z40720504 Keywords : brake wear debris * nanoparticles * oxidative wear Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.746, year: 2011
2011-01-26
... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration 50 CFR Part 665 RIN 0648-XA159 Hawaii Crustacean Fisheries; 2011 Northwestern Hawaiian Islands Lobster Harvest Guideline AGENCY: National Marine Fisheries Service (NMFS), National Oceanic and Atmospheric Administration (NOAA), Commerce...
Symptoms-Based Evaluation of Iron Deficiency Anemia in Students ...
African Journals Online (AJOL)
) in official hostels, 52.42 % (108) belonged to families of average socioeconomic status, 77.18 % (159) suffer from short-term memory, and 47.08 % (97) were unaware of IDA. The most commonly observed symptoms were flattened brittle nails ...
African Journals Online (AJOL)
ture ranges between 22oC (Guder) to 15.9oC (Holeta) and the rain fall ranges between ... tory of dermatophilosis in the farm, treatment response and practices of ecto- ..... Dermatophilus congolensis: A Manual of Diagnostic tests for Terrestrial.
Student Scientific Conference PriF UK 2014. Proceedings of reviewed contributions
International Nuclear Information System (INIS)
Galambos, M.; Dzugasova, V.
2014-01-01
The conference included the following sections: (i) Biology (159 contributions); (ii) Chemistry (54 contributions); (iii) Geology (25 contributions); (iv) Geography (35 contributions); (v) Didactics (7 contributions); (vi) Environmental Science (28 contributions);) Contributions relevant of INIS interest have been inputted to INIS.
Effect of Al doping on microstructure and optical band gap of ZnO ...
Indian Academy of Sciences (India)
micrograph shows that pure ZnO particles are spherical shaped. ... tions) on the other hand, are versatile, simple and cost-effective compared to ..... [45] G Knuyt, C Quaeyhagens, J D'Haen and L M Stals, Thin Solid Films 258, 159 (1995).
Konference Die Zeit a moderna / Die Zeit und die Moderne (1894-1904)
Czech Academy of Sciences Publication Activity Database
Kostrbová, Lucie
2010-01-01
Roč. 2, č. 1 (2010), s. 159 ISSN 1803-9243 R&D Projects: GA ČR GA405/08/0087 Institutional research plan: CEZ:AV0Z70900502 Keywords : Modernism * Central Europe * conference Subject RIV: AJ - Letters, Mass-media, Audiovision
Rozendaal, E.; Buijs, L.B.; Reijmersdal, E.A. van
2016-01-01
This study investigated whether a forewarning of advertising's intent can increase children's (N = 159, 8-10 years old) defenses against television commercials to lower their desire for advertised products. Two different forewarnings were tested, one for advertising's commercial intent or warning
Satellite cell frequency in cross-age transplanted rat extensor digitorum longus muscles
Czech Academy of Sciences Publication Activity Database
Rudež, M.; Carlson, B. M.; Sajko, Š.; Kubínová, Lucie; Wernig, A.; Eržen, I.
2004-01-01
Roč. 14, č. 3 (2004), s. 155-159 ISSN 1120-9992 Grant - others:European programme(XE) QLKG-1999-02034 Institutional research plan: CEZ:AV0Z5011922 Keywords : aging * confocal microscopy * satellite cell s Subject RIV: EA - Cell Biology
Tensile Strength of the Eggshell Membranes
Czech Academy of Sciences Publication Activity Database
Strnková, J.; Nedomová, Š.; Kumbár, V.; Trnka, Jan
2016-01-01
Roč. 64, č. 1 (2016), s. 159-164 ISSN 1211-8516 Institutional research plan: CEZ:AV0Z20760514 Institutional support: RVO:61388998 Keywords : eggshell membrane * tesile test * loading rate * tensile strength * fracture strain Subject RIV: GM - Food Processing
Jaeggi, Edgar T.; Carvalho, Julene S.; de Groot, Ernestine; Api, Olus; Clur, Sally-Ann B.; Rammeloo, Lukas; McCrindle, Brian W.; Ryan, Greg; Manlhiot, Cedric; Blom, Nico A.
2011-01-01
Fetal tachyarrhythmia may result in low cardiac output and death. Consequently, antiarrhythmic treatment is offered in most affected pregnancies. We compared 3 drugs commonly used to control supraventricular tachycardia (SVT) and atrial flutter (AF). We reviewed 159 consecutive referrals with fetal
Druhý, tělo a etika – fenomenologická perspektiva
Czech Academy of Sciences Publication Activity Database
Urban, Petr
2011-01-01
Roč. 66, Suppl. (2011), s. 145-159 ISSN 0046-385X R&D Projects: GA ČR(CZ) GAP401/10/1164 Institutional research plan: CEZ:AV0Z90090514 Keywords : intersubjectivity * body * ethics * phenomenology Subject RIV: AA - Philosophy ; Religion
Damage initiation and evolution in silicon nitride under\
Czech Academy of Sciences Publication Activity Database
Raga, R.; Khader, I.; Chlup, Zdeněk; Kailer, A.
360-361, AUG (2016), s. 147-159 ISSN 0043-1648 EU Projects: European Commission(XE) 263476 - ROLICER Institutional support: RVO:68081723 Keywords : Silicon nitride * Rollingcontactfatigue * Subsurface damage Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 2.531, year: 2016
Tvůrci administrativních textů jako tazatelé jazykové poradny
Czech Academy of Sciences Publication Activity Database
Martinkovičová, Barbora
2017-01-01
Roč. 100, č. 3 (2017), s. 159-167 ISSN 0027-8203 R&D Projects: GA MŠk(CZ) LM2015071 Institutional support: RVO:68378092 Keywords : Language Consulting Center * administrative style * authoritative language user Subject RIV: AI - Linguistics OBOR OECD: Linguistics
Analýza vzťahu medzi náletom kambiofágneho hmyzu a fyziologickým oslabením smerkových ekosystémov
Czech Academy of Sciences Publication Activity Database
Kmeť, J.; Kulla, L.; Jakuš, R.; Cudlín, Pavel; Lieutier, F.
-, č. 18 (2005), s. 151-159. ISBN 80-7157-297-7 R&D Projects: GA MŠk(CZ) OK 389 Institutional research plan: CEZ:AV0Z6087904 Keywords : Picea abies, ecophysiology, stress , Scolytidae, forest protection Subject RIV: GK - Forest ry
Cognitive coping in anxiety-disordered adolescents
Legerstee, Jeroen S.; Garnefski, Nadia; Verhulst, Frank C.; Utens, Elisabeth M. W. J.
2011-01-01
The present study investigated differences in cognitive coping strategies between anxiety-disordered and non-anxious adolescents. In addition, the interaction effect with gender as well as differences between specific anxiety diagnoses was examined. A clinical sample of 159 anxiety-disordered
Czech Academy of Sciences Publication Activity Database
Senguttuvan, N.; Ishii, M.; Tanji, K.; Kittaka, T.; Usuki, Y.; Kobayashi, M.; Nikl, Martin
2000-01-01
Roč. 39, 9A (2000), s. 5134-5138 ISSN 0021-4922 R&D Projects: GA MŠk ME 159 Institutional research plan: CEZ:AV0Z1010914 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.157, year: 2000
African Journals Online (AJOL)
USER
society the female partners are more willing to per take in ... focused on women without much consideration given to .... probably due to poor knowledge and subsequent .... Divorced. 126. 159. 15. 42.0. 53.0. 5.0. Level of Education No formal.
Paleolitická lokalita Skalka u Prostějova I – Na skalkách
Czech Academy of Sciences Publication Activity Database
Mlejnek, O.; Škrdla, Petr
2014-01-01
Roč. 99, č. 2 (2014), s. 159-167 ISSN 0323-0570 Institutional support: RVO:68081758 Keywords : Central Moravia * Palaeolithic * multiple-event site * surface survey * Late Middle Palaeolithic * Early Upper Palaeolithic * Aurignacian * Late Palaeolithic Subject RIV: AC - Archeology, Anthropology, Ethnology
76 FR 6587 - Pennsylvania Regulatory Program
2011-02-07
... [PA-159-FOR; OSM 2010-0017] Pennsylvania Regulatory Program AGENCY: Office of Surface Mining... remove a required amendment to the Pennsylvania regulatory program (the ``Pennsylvania program'') under... program amendment codified in the Federal regulations, Pennsylvania has submitted information that it...
Price distortions under coarse reasoning with frequent trade
Czech Academy of Sciences Publication Activity Database
Steiner, Jakub; Stewart, C.
159 A, September (2015), s. 574-595 ISSN 0022-0531 R&D Projects: GA ČR(CZ) GA13-34759S Institutional support: PRVOUK-P23 Keywords : categorization * bounded rationality * prices Subject RIV: AH - Economics Impact factor: 1.097, year: 2015
African Journals Online (AJOL)
Death rates per 1 000 hospital admissions were calculated for certain common ... 15.9 to 18.4 pet 1 000 admissions from 1999 to 2002, declining to ..... Bradshaw D, Kielkowski D, Sitas F. New birth and death registration forms- a foundation.
Czech Academy of Sciences Publication Activity Database
Chowdhury, A.; Bould, Jonathan; Londesborough, Michael Geoffrey Stephen; Milne, S.J.
2011-01-01
Roč. 184, č. 2 (2011), s. 317-324 ISSN 0022-4596 Institutional research plan: CEZ:AV0Z40320502 Keywords : sol-gel processes * spectroscopy * thermal properties * X-ray diffraction Subject RIV: CA - Inorganic Chemistry Impact factor: 2.159, year: 2011
Frenzied Attacks: A Micro-sociological Analysis of the Emotional Dynamics of Extreme Youth Violence
Weenink, D.
2014-01-01
Inspired by phenomenological and interactionist studies of youth violence, this article offers an empirical evaluation of Collins's micro-sociological theory of violence. The main question is whether situations of extreme violence have distinct situational dynamics. Based on analyses of 159
Soluble collagen dissolution and assembling in pressurized carbon dioxide water solutions
Czech Academy of Sciences Publication Activity Database
Zubal, L.; Bonani, W.; Maniglio, D.; Ceccato, R.; Renčiuk, Daniel; Hampl, A.; Migliaresi, C.; Jancar, J.; Vojtová, L.
2018-01-01
Roč. 12, č. 2 (2018), s. 159-170 ISSN 1788-618X Institutional support: RVO:68081707 Keywords : i collagen * fibril * protein * tissue * acid Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 2.983, year: 2016
Characteristics of peaks of inhalation exposure to organic solvents
Preller, L.; Burstyn, I.; Pater, N. de; Kromhout, H.
2004-01-01
Objectives: To determine which exposure metrics are sufficient to characterize 'peak' inhalation exposure to organic solvents (OS) during spraying operations. Methods: Personal exposure measurements (n = 27; duration 5-159 min) were collected during application of paints, primers, resins and glues
Indian Academy of Sciences (India)
2012; Eracleous et al. 2012; Popovic 2012; Gaskell & Goosmann 2013; Gaskell 2014; Goosmann et al. ..... Full lines correspond to (b, B) = (0.45,0.55), while lower (upper) dashed lines are minimums ..... 2014, ApJ, 788, 159. Kun, É., Karouzos ...
Czech Academy of Sciences Publication Activity Database
Krejčík, Zdeněk; Denger, K.; Weinitschke, S.; Hollemeyer, K.; Pačes, Václav; Cook, A.M.; Smits, T.H.M.
2008-01-01
Roč. 190, č. 2 (2008), s. 159-168 ISSN 0302-8933 Institutional research plan: CEZ:AV0Z50520514 Keywords : assimilation of taurine-nitrogen * sulfoacetaldehyde dehydrogenase * sulfoacetate exporter Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.975, year: 2008
2013-11-15
... Protection Zone of Runway 36. The fair market value of the parcel to be released has been determined to be $200,000. The fair market value of the parcel to be received has been determined to be $159,000. The...
Frenzied attacks. A micro-sociological analysis of the emotional dynamics of extreme youth violence
Weenink, D.
2014-01-01
Inspired by phenomenological and interactionist studies of youth violence, this article offers an empirical evaluation of Collins's micro-sociological theory of violence. The main question is whether situations of extreme violence have distinct situational dynamics. Based on analyses of 159
Interval matrices: Regularity generates singularity
Czech Academy of Sciences Publication Activity Database
Rohn, Jiří; Shary, S.P.
2018-01-01
Roč. 540, 1 March (2018), s. 149-159 ISSN 0024-3795 Institutional support: RVO:67985807 Keywords : interval matrix * regularity * singularity * P-matrix * absolute value equation * diagonally singilarizable matrix Subject RIV: BA - General Mathematics Impact factor: 0.973, year: 2016