Weight reductions for the airbus A380; postbuckling of the A380 VTP skin panels
Kroese, R.
2014-01-01
The skin panels of the Vertical Tail Plane (VTP) are the largest single piece composite components assembled on the Airbus A380. By allowing postbuckling to these skin panels might result in severe weight reductions for the VTP of the A380. The goal of the study is to give an indication of possible
Plieninger, Jürgen
2005-01-01
Wie man für eine kleine Bibliothek eine Homepage plant, konzipiert, gestaltet, erstellt, inhaltlich füllt, pflegt und evaluiert, wird hier in knappen Stichpunkten erläutert. This tutorial deals with how to plan, concept, create, fill with informations and services a homepage for a small library.
Homepage for the Global Tropospheric Experiment
Ward, Eugene
1995-01-01
The objective of my NASA summer research project was to create a homepage to describe and present results from the NASA Global Tropospheric Experiment (GTE). The GTE is a major component of NASA's Tropospheric Chemistry Program and is managed in the Atmospheric Studies Branch, Atmospheric Sciences Division at the NASA Langley Research Center.
Homepages: Built-in Motivation.
McKenzie, Cheryl
2000-01-01
Describes a Web-building class aimed at motivating English-as-a-Foreign-Language students to improve their English writing and editing skills while building a homepage. All students had a basic or better knowledge of keyboarding and Internet search techniques, two had advanced computer skills, but none had ever created a homepage. (Author/VWL)
Nelson, David R
2009-10-01
The Cytochrome P450 Homepage is a universal resource for nomenclature and sequence information on cytochrome P450 ( CYP ) genes. The site has been in continuous operation since February 1995. Currently, naming information for 11,512 CYPs are available on the web pages. The P450 sequences are manually curated by David Nelson, and the nomenclature system conforms to an evolutionary scheme such that members of CYP families and subfamilies share common ancestors. The organisation and content of the Homepage are described.
Kupersmith, John
2003-01-01
Examines special-purpose entry points to library Web sites. Discusses in-house homepages; branch-specific pages or single library system-wide pages; staff use pages; versions in different languages; "MyLibrary" pages where users can customize the menu; standalone "branded" sites; publicly accessible pages; and best practices.…
Implementasi Seo Web Design Methodology Pada Official Homepage Pondok Pesantren Qodratullah
Ependi, Usman
2013-01-01
Homepage or website for an organization is a way to deliver information to the public. Now the number of homepage or website of the day is always increasing both personal or owned by the organization. To communicate or disseminate information homepage/ website Islamic Boarding School of Qodratullah need a surefire way to use the Search Engine Optimization Web Design Methodology. Conducted with the implementation of the Search Engine Optimization Web Design Methodology on the homepage/ website...
Personal Homepage Construction as an Expression of Social Development
Schmitt, Kelly L.; Dayanim, Shoshana; Matthias, Stacey
2008-01-01
In 2 studies, the authors explored preadolescent and adolescent use of personal homepages in relation to mastery and identity formation. In Study 1, the authors attempted to determine the prevalence of personal homepage and online journal (blog) construction among a random sample (N = 500) of preadolescents and adolescents. Adolescents were more…
World Wide Web Homepage Design.
Tillman, Michael L.
This paper examines hypermedia design and draws conclusions about how educational research and theory applies to various aspects of World Wide Web (WWW) homepage design. "Hypermedia" is defined as any collection of information which may be textual, graphical, visual, or auditory in nature and which may be accessed via a nonlinear route.…
Hijmans, E.J.S.; Selm, M. van
2002-01-01
This article aims to examine existential meaning constructions from an action theoretical perspective in a specific Internet environment: the personal homepage. Personal homepages are on-line multi-media documents addressing the question Who am I? Authors of personal homepages provide information on
A Structured Approach to Homepage Design.
Gregory, Gwen; Brown, M. Marlo
With no standards governing their creation, a variety of formats are being used for World Wide Web homepages. Some are well organized, present their information clearly, and work with multiple browsers. Others, however, are slow to load, function poorly with some Web browsing software, and are so badly structured that they are very difficult to…
Build a WWW Homepage for Your School!
Chrobak, Kimberly
1995-01-01
Discusses the use of World Wide Web (WWW) Homepage for school information. Topics include school sites; installation of a WWW browser; file tags; sites for beginner's guides to the language (HTML); two Usenet discussion groups; and a sample lesson plan including objective, procedure, and evaluation. (AEF)
Homepage of the Philosophy Meets Popular Culture Initiative
DEFF Research Database (Denmark)
Grund, Cynthia M.
2008-01-01
-modern students, whose knowledge of various aspects of popular culture often is as encyclopedic as their classical liberal arts background is limited (some might say impoverished). One goal of the PHILOSOPHY meets POPULAR CULTURE homepage (launched on October 7, 2008) is to provide a forum for researchers, teachers...
Development of the Homepage for the HANARO information platform
Energy Technology Data Exchange (ETDEWEB)
Sohn, J. M.; Park, K. B.; Kim, H. R. [Korea Atomic Energy Research Institute, Taejeon (Korea)
2002-05-01
I - Object and Importance- Following in the footsteps of internationalization and the information-oriented society, we need to open the HANARO to the public, and to serve more detailed, accurate, and varied information rapidly via the internet to enhance the HANARO Utilization efficiency. II- Scope and Contents- We develope the HANARO Homepage using ORACLE DBMS and APACJE, it has function as an information platform for HANARO. In this report, we describe its design, implementation, management and operation. III-Result -The HANARO homepage was developed successfully, and it was opened to HANARO users from March 20, 2002 through the KAERI-Net. IV- Proposal for Application-The data of HANARO should be processed and organized systematically for its better utilization. A supplementation of the functions is needed and the HANARO web should be operated practically with maximum efficiency and advertise the activities locally and internationally. 3 refs., 11 figs., 9 tabs. (Author)
Vehicle Technologies' Fact of the Week 2011
Energy Technology Data Exchange (ETDEWEB)
Davis, Stacy Cagle [ORNL; Diegel, Susan W [ORNL; Boundy, Robert Gary [ORNL
2012-04-01
Each week the U.S. Department of Energy s Vehicle Technology Program (VTP) posts a Fact of the Week on their website: http://www1.eere.energy.gov/vehiclesandfuels/. These Facts provide statistical information, usually in the form of charts and tables, on vehicle sales, fuel economy, gasoline prices, and other transportation-related trends. Each Fact is a stand-alone page that includes a graph, text explaining the significance of the data, the supporting information on which the graph was based, and the source of the data. A link to the current Fact is available Monday through Friday on the VTP homepage, but older Facts are archived and still available at: http://www1.eere.energy.gov/vehiclesandfuels/facts/. This report is a compilation of the Facts that were posted during calendar year 2011. The Facts were written and prepared by staff in Oak Ridge National Laboratory's Center for Transportation Analysis.
GEOGRAPHY nEtQUIPMENT to study geography: the homepage and reflections from the users
Pajtok-Tari, I.
2009-04-01
The main objective of the GEOGRAPHY nEtQUIPMENT is to convey structured information to teachers and pupils, as well as, professors and students of geography. This learning aid is a homepage, first published in Hungarian still in 2006 (http://netszkozkeszlet.ektf.hu), to help in orientation among the rapidly growing information on the Internet, to provide extra digitalized professional materials that are not yet available digitally and to share experiences of the teachers and professors working in the same area of interest and language environment. At present, its English version is already prepared and partly available at the same address. The GEOGRAPHY nEtQUIPMENT can be used free after registration, at present the homepage counts 2807 registered users. The interested user first enters a virtual office where the entries of the Menu can be opened by clicking at the drawer, shelf, wall map, globe, laptop, TV-set, etc. These entries are professional lesson plans using digital technology, photos, video clips, animations on physical and social geography. The homepage also mirrors pieces of music, maps, collection of minerals, database links, diagrams, bibliography, lecture notes, dictionaries, scientific and popular journals, geography games, web pages, etc. The whole set of appliances is based on Dreamweaver MX program. During the past 2.5 years some experience has been gained about the GEOGRAPHY nEtQUIPMENT in use, mainly from teachers of geography, who downloaded and responded to the questionnaire. Another source of information is the group of students in the College, where future teachers of geography are trained in a one-semester course on application of the Info-Communication Technology. From the first group, i.e. 59 active teachers of geography, 54 % use the Internet "always" or "frequently" in the classroom, whereas 75 % of them rely on it for preparation to the lessons. Before trying the homepage, these numbers were 25 % and 54 %, only. From among the listed
Library Homepage Design at Smaller Bachelor of Arts Institutions
Jones, Scott L.; Leonard, Kirsten
2011-01-01
This study examined the homepages of the libraries of 175 smaller bachelor of arts institutions, coding for the presence of 98 design elements. By reporting and examining the frequency of these features, the authors noted what is and is not common practice at these libraries. They found that only fourteen elements were present on at least half of…
Homepages of German dental schools - a target group-oriented evaluation.
Wehlers, A; Schäfer, I; Sehner, S; Kahl-Nieke, B; Kuhnigk, O
2014-08-01
The Internet represents the central communication medium in higher education. University applicants, students, teachers and scientists use the Internet when seeking information on medicine. The homepages of dental schools are not just sources of information, but also a means of presenting the school. No comparative studies have been undertaken concerning the content and extent of their Internet sites so far. Based on the literature and assessments of medical school websites, 136 criteria were defined within the setting of a Delphi procedure and drawn upon for a standardised evaluation of the websites of all 30 German dental schools. Structure and extent of the content of the websites were evaluated. Possible influencing factors, such as financial resources and number of applicants, were investigated. The results yielded by the homepages varied considerably. The best Internet site received 84% of the possible points, the poorest 38%. On average, 62% of the criteria were fulfilled. Influencing factors, such as the amount of funding by the particular state government, could not be detected. Two-thirds of the dental schools addressed students, three-fourth teachers and scientists as target groups. More than 50% did not address applicants. Specific requirements regarding barrier-free accessibility of information were hardly met. Individual faculties already have homepages of a high quality; for others, there is a need for improvement. General recommendations for university websites should be discussed at the European level to ensure a uniform standard of quality. The criteria presented here offer faculties the possibility to reflect upon their own Internet sites. © 2013 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Characteristics and Communication--Effectiveness of "Fortune 500" Company Corporate Homepages
Truell, Allen D.; Zhao, Jensen J.; Alexander, Melody W.; Whitesel, Joel A.
2005-01-01
The Internet and its component parts, email and the World Wide Web (Web), have had a tremendous impact on how companies communicate with their various audiences. Thus, the twofold purpose of this study was (a) to determine the characteristics of "Fortune 500" company homepage components and (b) to determine the communication effectiveness of…
World Wide Web Homepages: An Examination of Content and Audience.
Reynolds, Betty; And Others
This paper shows how the content of a World Wide Web page is selected and how an examination of the intended audience influences content. Examples from the New Mexico Tech (NMT) Library homepage show what sources are selected and what level of detail is appropriate for the intended audience. Six fundamental functions of libraries and information…
CERN Public homepage takes its first step towards web 2.0
2009-01-01
Some of you may have noticed a change of format on the CERN public homepage recently. The Bulletin catches up with Dan Noyes, CERN web content manager, to find out what is happening. With over 7000 websites in the cern.ch domain, CERN’s web landscape is a challenging one to manage. Dan Noyes, who joined CERN a year ago, is the web content manager within the Communication group, which is mandated to develop the public and user websites as well as developing standards and guidelines for the wider CERN web. The recent changes made to the public homepage were the first small step towards some quite major changes proposed for CERN’s websites over the next couple of years. Currently, one of the problems of CERN’s websites is that the quantity and the diversity of the information in them make them difficult to manage, if one wants to avoid duplication and to keep information updated and easy to find. This is also aggravated by the lack of a standard design philosophy a...
Chung, Beom Sun; Chung, Min Suk
2018-03-01
The authors have operated the homepage (http://anatomy.co.kr) to provide the learning contents of anatomy. From the homepage, sectioned images, volume models, and surface models-all Visible Korean products-can be downloaded. The realistic images can be interactively manipulated, which will give rise to the interest in anatomy. The various anatomy comics (learning comics, comic strips, plastination comics, etc.) are approachable. Visitors can obtain the regional anatomy book with concise contents, mnemonics, and schematics as well as the simplified dissection manual and the pleasant anatomy essay. Medical students, health allied professional students, and even laypeople are expected to utilize the easy and comforting anatomy contents. It is hoped that other anatomists successively produce and distribute their own informative contents.
Chung, Beom Sun
2018-01-01
The authors have operated the homepage (http://anatomy.co.kr) to provide the learning contents of anatomy. From the homepage, sectioned images, volume models, and surface models—all Visible Korean products—can be downloaded. The realistic images can be interactively manipulated, which will give rise to the interest in anatomy. The various anatomy comics (learning comics, comic strips, plastination comics, etc.) are approachable. Visitors can obtain the regional anatomy book with concise contents, mnemonics, and schematics as well as the simplified dissection manual and the pleasant anatomy essay. Medical students, health allied professional students, and even laypeople are expected to utilize the easy and comforting anatomy contents. It is hoped that other anatomists successively produce and distribute their own informative contents. PMID:29644104
HOMEPAGE: UM MATERIAL EDUCACIONAL DIGITAL NA APRENDIZAGEM DE INGLÊS
Directory of Open Access Journals (Sweden)
Marcus de Souza ARAÚJO
2017-07-01
Full Text Available Este artigo tem como objetivo relatar uma atividade de produção escrita em inglês dos gêneros discursivos apresentação pessoal e homepage no contexto acadêmico. O estudo se desenvolve por meio de referenciais teóricos da perspectiva do material didático (DUDLEY EVANS; ST. JOHN, 1998; GRAVES, 2000; RAMOS, 2009; entre outros, da escrita como processo (BROWN, 2004; DIAS, 2004; FIGUEIREDO, 2005 e de contribuições da tecnologia digital no ensino de línguas (PRENSKY, 2012; ROJO, 2012; entre outros. A atividade relatada levou em consideração a abordagem da escrita como processo, ou seja, geração e estruturação das ideias, rascunho, avaliação, revisão, correção em pares, edição. Pensando no compartilhamento das produções escritas dos alunos, o resultado final da atividade foi a criação coletiva de uma homepage para a publicação do gênero apresentação pessoal, além de postagens de vídeos e sugestões de sites e outros links. Os resultados da pesquisa apontam aumento na motivação dos alunos em processo de formação inicial para produzir gêneros escritos a partir das tecnologias digitais.
The Presentation of Self in Scholarly Life: Identity and Marginalization in Academic Homepages
Hyland, Ken
2011-01-01
The academic homepage is now a ubiquitous genre of scholarly life, but despite considerable interest in issues of identity and the ways individuals self-consciously manage the impression they give of themselves, it has been slow to attract the attention of ESP researchers. This may be because of the institutional control exercised by employing…
Improving the Library Homepage through User Research — Without a Total Redesign
Amy Deschenes
2014-01-01
Conducting user research doesn't have to be difficult, time consuming, or expensive. Your Library website can be improved through user research even if you have design restrictions because of a prescribed branding scheme, content management system, or any other reason. At Simmons College in Boston, we recently performed a user research study that took an in-depth look at the content organization and wording of links on the Library homepage. We conducted an in-person paper survey using paper p...
NASA GSFC Tin Whisker Homepage http://nepp.nasa.gov/whisker
Shaw, Harry
2000-01-01
The NASA GSFC Tin Whisker Homepage provides general information and GSFC Code 562 experimentation results regarding the well known phenomenon of tin whisker formation from pure tin plated substrates. The objective of this www site is to provide a central repository for information pertaining to this phenomenon and to provide status of the GSFC experiments to understand the behavior of tin whiskers in space environments. The Tin Whisker www site is produced by Code 562. This www site does not provide information pertaining to patented or proprietary information. All of the information contained in this www site is at the level of that produced by industry and university researchers and is published at international conferences.
Launching a palliative care homepage: the Edmonton experience.
Pereira, J; Macmillan, A; Bruera, E
1997-11-01
The Internet, with its graphical subdivision, the World Wide Web (WWW). has become a powerful tool for the dissemination of information and for communication. This paper discusses the authors' experiences with creating, launching and maintaining an official publication on the Internet by the Edmonton Regional Palliative Care Program and the Division of Palliative Medicine, University of Alberta, Canada. It describes the content and format of the homepage and the process of publication. Over a six-month period there were 892 visits to the site and 84 separate items of correspondence to the site's editors. Of these correspondence items, 36 were requesting further information regarding clinical and other programme information. Sixty-nine of the 84 communications came from North America and Europe. The pattern of readership is briefly discussed as are some of the potential advantages and challenges when utilizing this electronic medium. To promote the dissemination of reliable information on the Internet, the authors encourage other palliative care groups and organizations to publish on the WWW. The URL is http:/(/)www.palliative.org (previously http:/(/)www.caritas.ab.ca/approximately palliate).
[Preparation of the database and the homepage on chemical accidents relating to health hazard].
Yamamoto, M; Morita, M; Kaminuma, T
1998-01-01
We collected the data on accidents due to chemicals occurred in Japan, and prepared the database. We also set up the World Wide Web homepage containing the explanation on accidents due to chemicals and the retrieval page for the database. We designed the retrieval page so that users can search the data from keywords such as chemicals (e.g. chlorine gas, hydrogen sulfide, pesticides), places (e.g. home, factory, vehicles, tank), causes (e.g. reaction, leakage, exhaust gas) and others (e.g. cleaning, painting, transportation).
Constructing hotel brands: A multimodal analysis of luxury hotel homepages
Directory of Open Access Journals (Sweden)
Fei-Wen Cheng
2016-04-01
Full Text Available As e-marketing has become the dominant marketing mode in the hospitality industry, this study investigates how two luxury hotels represent and promote themselves through their major e-commerce platforms (i.e. hotel-owned websites. The verbal and visual texts of 51 website homepages owned by these two hotel chains are compiled and analyzed by drawing upon the corpus linguistic approach for verbal analysis and Kress and van Leeuwen’s (2006 visual grammar framework for image analysis. The findings indicate that despite some similarities in their web-mediated communication strategies, each hotel firm has discursive strategies that reveal diverging attitudes in their choices of various semiotic resources to construct their own brand identities. This study contributes to the academic literature on web-mediated tourism discourse by showing how a multimodal analysis can add insights to brand formulation.
Cruz, Cláudia Ferreira; Ferreira, Aracéli Cristina de Sousa; Silva, Lino Martins da; Macedo, Marcelo Álvaro da Silva
2012-01-01
This study attempts to check the transparency level of information in public administration published in the homepages of 96 municipalities included among the 100 most populous in Brazil and what characteristics and socioeconomic indicators of the municipalities can contribute to explain the level of transparency observed. The level of transparency in public administration was established from a research model called Transparency Index Municipal Public Management (ITGP-M) constructed based on...
[Preparation of the database and the Internet (WWW) homepage for regulations on chemicals in Japan].
Yamamoto, M; Morita, M; Kaminuma, T
1999-01-01
We prepared a database on chemical regulations in Japan. The regulations consist of "The Law concerning the Examination and Regulation of Manufacture, etc., of Chemical Substances", "Poisonous and Deleterious Substances", Control Law", "Waterworks Law", "Law for the Control of Household Products containing Harmful Substances", and Pesticide Residues in Food Sanitation Law". We also set up a World Wide Web (WWW) homepage containing an explanation of the law as well as chemical names, CAS registry numbers, and standards. The WWW pages contain lists of chemicals and the retrieval page for the database.
Doarn, Charles R; Zacharias, Stephanie; Keck, Casey Stewart; Tabangin, Meredith; DeAlarcon, Alessandro; Kelchner, Lisa
2018-06-05
This article describes the design and implementation of a web-based portal developed to provide supported home practice between weekly voice therapy sessions delivered through telehealth to children with voice disorders. This in-between care consisted of supported home practice that was remotely monitored by speech-language pathologists (SLPs). A web-based voice therapy portal (VTP) was developed as a platform so participants could complete voice therapy home practice by an interdisciplinary team of SLPs (specialized in pediatric voice therapy), telehealth specialists, biomedical informaticians, and interface designers. The VTP was subsequently field tested in a group of children with voice disorders, participating in a larger telehealth study. Building the VTP for supported home practice for pediatric voice therapy was challenging, but successful. Key interactive features of the final site included 11 vocal hygiene questions, traditional voice therapy exercises grouped into levels, audio/visual voice therapy demonstrations, a store-and-retrieval system for voice samples, message/chat function, written guidelines for weekly therapy exercises, and questionnaires for parents to complete after each therapy session. Ten participants (9-14 years of age) diagnosed with a voice disorder were enrolled for eight weekly telehealth voice therapy sessions with follow-up in-between care provided using the VTP. The development and implementation of the VTP as a novel platform for the delivery of voice therapy home practice sessions were effective. We found that a versatile individual, who can work with all project staff (speak the language of both SLPs and information technologists), is essential to the development process. Once the website was established, participants and SLPs effectively utilized the web-based VTP. They found it feasible and useful for needed in-between care and reinforcement of therapeutic exercises.
Energy Technology Data Exchange (ETDEWEB)
Ward, J.; Stephens, T. S.; Birky, A. K. (Energy Systems); (DOE-EERE); (TA Engineering)
2012-08-10
The U.S. Department of Energy's Office of Energy Efficiency and Renewable Energy has defined milestones for its Vehicle Technologies Program (VTP). This report provides estimates of the benefits that would accrue from achieving these milestones relative to a base case that represents a future in which there is no VTP-supported vehicle technology development. Improvements in the fuel economy and reductions in the cost of light- and heavy-duty vehicles were estimated by using Argonne National Laboratory's Autonomie powertrain simulation software and doing some additional analysis. Argonne also estimated the fraction of the fuel economy improvements that were attributable to VTP-supported development in four 'subsystem' technology areas: batteries and electric drives, advanced combustion engines, fuels and lubricants, and materials (i.e., reducing vehicle mass, called 'lightweighting'). Oak Ridge National Laboratory's MA{sup 3}T (Market Acceptance of Advanced Automotive Technologies) tool was used to project the market penetration of light-duty vehicles, and TA Engineering's TRUCK tool was used to project the penetrations of medium- and heavy-duty trucks. Argonne's VISION transportation energy accounting model was used to estimate total fuel savings, reductions in primary energy consumption, and reductions in greenhouse gas emissions that would result from achieving VTP milestones. These projections indicate that by 2030, the on-road fuel economy of both light- and heavy-duty vehicles would improve by more than 20%, and that this positive impact would be accompanied by a reduction in oil consumption of nearly 2 million barrels per day and a reduction in greenhouse gas emissions of more than 300 million metric tons of CO{sub 2} equivalent per year. These benefits would have a significant economic value in the U.S. transportation sector and reduce its dependency on oil and its vulnerability to oil price shocks.
Hodas, Steven
1995-01-01
This paper describes efforts to identify issues and design implementation strategies to better promote the NASA IITA K-12 project on the world wide web and, in so doing, better serve our constituents.
Lukasczik, M; Löffler, S; Gerlich, C; Wolf, H-D; Neuderth, S
2011-06-01
Vocational orientation in medical rehabilitation has become an important issue in rehabilitation science and practice in Germany. Although a variety of vocationally oriented interventions has been developed in recent years, there is still a lack of consensus with regard to the definition of specific types of interventions as well as relevant criteria (e. g., methods; instruments; duration/frequency; patient groups). Building on preliminary definitions, basic types of vocationally oriented measures/interventions were conceptually modified and refined in the context of a consensual process. 39 experts of various professions were contacted during a 2-stage Delphi survey to evaluate existing definitions of vocationally oriented interventions using key questions. Standardized descriptions of 5 vocationally oriented basic interventions were specified in cooperation with an interdisciplinary panel of experts. Descriptions were published in a workbook and a homepage for researchers and clinicians, which also contain information on the implementation of measures into rehabilitative care as well as good practice examples. The media developed in this project may contribute to the transfer of research results on vocationally oriented rehabilitation into health care practice. © Georg Thieme Verlag KG Stuttgart · New York.
Telescopic projective methods for parabolic differential equations
Gear, C W
2003-01-01
Projective methods were introduced in an earlier paper [C.W. Gear, I.G. Kevrekidis, Projective Methods for Stiff Differential Equations: problems with gaps in their eigenvalue spectrum, NEC Research Institute Report 2001-029, available from http://www.neci.nj.nec.com/homepages/cwg/projective.pdf Abbreviated version to appear in SISC] as having potential for the efficient integration of problems with a large gap between two clusters in their eigenvalue spectrum, one cluster containing eigenvalues corresponding to components that have already been damped in the numerical solution and one corresponding to components that are still active. In this paper we introduce iterated projective methods that allow for explicit integration of stiff problems that have a large spread of eigenvalues with no gaps in their spectrum as arise in the semi-discretization of PDEs with parabolic components.
Telescopic projective methods for parabolic differential equations
International Nuclear Information System (INIS)
Gear, C.W.; Kevrekidis, Ioannis G.
2003-01-01
Projective methods were introduced in an earlier paper [C.W. Gear, I.G. Kevrekidis, Projective Methods for Stiff Differential Equations: problems with gaps in their eigenvalue spectrum, NEC Research Institute Report 2001-029, available from http://www.neci.nj.nec.com/homepages/cwg/projective.pdf Abbreviated version to appear in SISC] as having potential for the efficient integration of problems with a large gap between two clusters in their eigenvalue spectrum, one cluster containing eigenvalues corresponding to components that have already been damped in the numerical solution and one corresponding to components that are still active. In this paper we introduce iterated projective methods that allow for explicit integration of stiff problems that have a large spread of eigenvalues with no gaps in their spectrum as arise in the semi-discretization of PDEs with parabolic components
Ohio Lake Erie Commission Homepage
management of Lake Erie: including, water quality protection, fisheries management, wetlands restoration over 365 projects since 1993. Projects have focused on an array of issues critical to the effective quality of its waters and ecosystem, and to promote economic development of the region by ensuring the
Vitality training-A mindfulness- and acceptance-based intervention for chronic pain.
Zangi, Heidi A; Haugli, Liv
2017-11-01
Chronic non-malign pain has a substantial impact on all parts of an individual's life. Mindfulness- and acceptance- based interventions are increasingly offered to help people manage their pain and strengthening their health promoting resources. In this paper, we present a mindfulness- and acceptance-based intervention, the Vitality Training Programme (VTP), to mitigating pain and accompanying symptoms and increasing pain coping abilities. Based on a clinical case presentation, we discuss how the VTP can help individuals to live a better life with pain. The VTP has been evaluated in two randomised controlled trials and two qualitative studies. Existing evidence is presented. Finally, based on a recently published theoretical model, we present some possible common explanatory mechanisms across various mindfulness- and acceptance-based interventions that might also apply to the VTP. Copyright © 2017 Elsevier B.V. All rights reserved.
Blackie, Caroline A; Coleman, Christy A; Holland, Edward J
2016-01-01
To evaluate the sustained effect (up to 1 year) of a single, 12-minute vectored thermal pulsation (VTP) treatment in improving meibomian gland function and dry eye symptoms in patients with meibomian gland dysfunction and evaporative dry eye. The prospective, multicenter, open-label clinical trial included 200 subjects (400 eyes) who were randomized to a single VTP treatment (treatment group) or twice-daily, 3-month, conventional warm compress and eyelid hygiene therapy (control group). Control group subjects received crossover VTP treatment at 3 months (crossover group). Effectiveness measures of meibomian gland secretion (MGS) and dry eye symptoms were evaluated at baseline and 1, 3, 6, 9, and 12 months. Subjects with inadequate symptom relief could receive additional meibomian gland dysfunction therapy after 3 (treatment group) and 6 months (crossover group). At 3 months, the treatment group had greater mean improvement in MGS (Pdry eye symptoms (P=0.0068), compared to controls. At 12 months, 86% of the treatment group had received only one VTP treatment, and sustained a mean improvement in MGS from 6.4±3.7 (baseline) to 17.3±9.1 (Pdry eye symptoms from 44.1±20.4 to 21.6±21.3 (Pdry eye symptoms from 49.1±21.0 to 24.0±23.2 (Pdry eye symptoms, over 12 months. A single VTP treatment provides significantly greater mean improvement in meibomian gland function and dry eye symptoms as compared to a conventional, twice-daily, 3-month regimen. Early VTP intervention for meibomian gland dysfunction is associated with improved treatment outcomes.
Hagen, Kerry B; Bedi, Raman; Blackie, Caroline A; Christenson-Akagi, Kellie J
2018-01-01
The aim of this study was to compare the efficacy of a single bilateral 12-minute vectored thermal pulsation (VTP) procedure versus daily oral doxycycline for 3 months for moderate-to-severe meibomian gland dysfunction (MGD). This prospective, randomized, parallel-group, single-masked study included 28 subjects who received either a single-dose VTP or 3 months of doxycycline treatment. At baseline and 3 months post treatment, all subjects were evaluated for the following: dry eye symptoms with a standard dry eye questionnaire (the Standard Patient Evaluation for Eye Dryness [SPEED]), meibomian gland (MG) function by counting the number of glands yielding liquid secretion with the MG evaluator (MGE), tear breakup time (TBUT) and corneal and conjunctival staining. In the VTP group, at 3 months, there was a significant improvement in MG function (4.00±1.47 to 7.73±5.53), SPEED score (11.00±3.30 to 5.42±2.15), TBUT (6.26±2.01 to 8.44±1.81), corneal staining (0.38±0.50 to 0.12±0.33) and conjunctival staining (1.69±1.93 to 0.62±0.85). In the doxycycline group, there was a significant improvement in MG function (4.63±1.41 to 10.63±5.91), SPEED score (13.42±4.17 to 9.42±5.47) and conjunctival staining (2.38±1.88 to 1.13±1.51), but the improvement in TBUT (6.90±2.56 to 7.59±2.03) and corneal staining (0.21±0.41 to 0.13±0.34) was not statistically significant ( p =0.262 and p =0.414, respectively). At 3 months, SPEED score was significantly better in the VTP group ( p oral doxycycline at improving the dry eye symptoms secondary to MGD. A single 12-minute VTP treatment was at least as effective as a dose of doxycycline for 3 months, in improving MG function and all measured signs of MGD. Given the minimal risk profile of the single VTP procedure over long-term doxycycline use, a single VTP presents a favorable alternative to long-term antibiotic use.
Energy Technology Data Exchange (ETDEWEB)
NONE
2001-03-01
With the purpose of sharing environmental technology information of the APEC countries, the homepage structuring was commenced linking and systematizing the home pages owned by governments, institutions, enterprises, etc., as the APEC Virtual Center (APEC-VC) project, with the fiscal 2000 results reported. In creating the homepage contents, in order to disseminate more useful information for the developing countries, 'Environmental Technology Cooperation for Developing Countries' as the original contents was prepared. In building a search engine, for the purpose of improving convenience for website users of the Virtual Center, APEC VC Japan created a retrieval system on the site. In overseas investigation, the researchers visited local plants to grasp problems and the needs by enterprises and organizations on water-pollution, waste treatment and the like, with the purpose of reflecting the investigation result in the website. In addition, the researchers visited APEC VC coordinators and/or contact points to exchange opinions with the view of expanding the network. (NEDO)
Energy Technology Data Exchange (ETDEWEB)
NONE
2001-03-01
With the purpose of sharing environmental technology information of the APEC countries, the homepage structuring was commenced linking and systematizing the home pages owned by governments, institutions, enterprises, etc., as the APEC Virtual Center (APEC-VC) project, with the fiscal 2000 results reported. In creating the homepage contents, in order to disseminate more useful information for the developing countries, 'Environmental Technology Cooperation for Developing Countries' as the original contents was prepared. In building a search engine, for the purpose of improving convenience for website users of the Virtual Center, APEC VC Japan created a retrieval system on the site. In overseas investigation, the researchers visited local plants to grasp problems and the needs by enterprises and organizations on water-pollution, waste treatment and the like, with the purpose of reflecting the investigation result in the website. In addition, the researchers visited APEC VC coordinators and/or contact points to exchange opinions with the view of expanding the network. (NEDO)
Janssen, Stefan; Meyer, Andreas; Vordermark, Dirk; Steinmann, Diana
2010-12-01
the internet as a source of medical information has emerged during the last years. There is a confusing amount of medical websites with a great diversity of quality. Websites of radiotherapy institutions could offer a safe and an easy-to-control way to assist patients' requests. 205 internet appearances of German radiotherapy institutions were analyzed in June 2009 (nonuniversity hospitals n = 108, medical practices n = 62, university hospitals n = 35). For the evaluation of each homepage verifiable criteria concerning basic information, service and medical issues were used. the quality of information published via internet by different radiotherapy institutions showed a large variety. Basic information like telephone numbers, operating hours, and direction guidance were provided in 96.7%, 40%, and 50.7%, respectively. 85% of the websites introduced the staff, 50.2% supplied photos and 14% further information on the attending physicians. The mean amount of continuative links to other websites was 5.4, the mean amount of articles supplying medical information for patients summed up to 4.6. Medical practices and university hospitals had statistically significant more informative articles and links to other websites than nonuniversity hospitals. No statistically significant differences could be found in most other categories like service issues and basic information. internet presences of radiotherapy institutions hold the chance to supply patients with professional and individualized medical information. While some websites are already using this opportunity, others show a lack of basic information or of user-friendliness.
Directory of Open Access Journals (Sweden)
Hagen KB
2018-01-01
Full Text Available Kerry B Hagen,1 Raman Bedi,2 Caroline A Blackie,3 Kellie J Christenson-Akagi1 1EyeHealth Northwest, Portland, OR, USA; 2Iris Advanced Eye Centre, Chandigarh, India; 3TearScience, Inc., Morrisville, NC, USA Purpose: The aim of this study was to compare the efficacy of a single bilateral 12-minute vectored thermal pulsation (VTP procedure versus daily oral doxycycline for 3 months for moderate-to-severe meibomian gland dysfunction (MGD.Methods: This prospective, randomized, parallel-group, single-masked study included 28 subjects who received either a single-dose VTP or 3 months of doxycycline treatment. At baseline and 3 months post treatment, all subjects were evaluated for the following: dry eye symptoms with a standard dry eye questionnaire (the Standard Patient Evaluation for Eye Dryness [SPEED], meibomian gland (MG function by counting the number of glands yielding liquid secretion with the MG evaluator (MGE, tear breakup time (TBUT and corneal and conjunctival staining.Results: In the VTP group, at 3 months, there was a significant improvement in MG function (4.00±1.47 to 7.73±5.53, SPEED score (11.00±3.30 to 5.42±2.15, TBUT (6.26±2.01 to 8.44±1.81, corneal staining (0.38±0.50 to 0.12±0.33 and conjunctival staining (1.69±1.93 to 0.62±0.85. In the doxycycline group, there was a significant improvement in MG function (4.63±1.41 to 10.63±5.91, SPEED score (13.42±4.17 to 9.42±5.47 and conjunctival staining (2.38±1.88 to 1.13±1.51, but the improvement in TBUT (6.90±2.56 to 7.59±2.03 and corneal staining (0.21±0.41 to 0.13±0.34 was not statistically significant (p=0.262 and p=0.414, respectively. At 3 months, SPEED score was significantly better in the VTP group (p<0.05; other parameters were comparable between the two groups.Conclusion: A single 12-minute bilateral VTP procedure was significantly more effective than the 3-month daily course of oral doxycycline at improving the dry eye symptoms secondary to MGD. A single
Technology Change And Working Conditions – A Cultural Perspective
DEFF Research Database (Denmark)
Sørensen, Ole Henning
2004-01-01
When technology change improves working conditions, the success is often attributed to skilful change agents. When it is not, the blame is on “resistance to change” and “resilient cultures”. How can these failures be understood differently? A cultural perspective on technology change might be a way...... to facilitate technology change processes that lead to improved working conditions. The research based project described here has developed a special homepage that explains how this might be achieved. The homepage is targeted at working life professionals. The homepage presents theoretical explanations...... of the concept of organizational culture, a model for analysis and several practical case stories. This paper explains how the project tries to reach a broad spectrum of professionals in order to facilitate their use of a cultural perspective. It also discusses the ethical consequences of the cultural...
Czech Academy of Sciences Publication Activity Database
Přibilová, Anna; Přibil, Jiří
2006-01-01
Roč. 48, č. 12 (2006), s. 1691-1703 ISSN 0167-6393 R&D Projects: GA MŠk(CZ) OC 277.001; GA AV ČR(CZ) 1QS108040569 Grant - others:MŠk(SK) 102/VTP/2000; MŠk(SK) 1/3107/06 Institutional research plan: CEZ:AV0Z20670512 Keywords : signal processing * speech processing * speech synthesis Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.678, year: 2006
Incidence of Symptomatic Vertebral Fractures in Patients After Percutaneous Vertebroplasty
International Nuclear Information System (INIS)
Hierholzer, Johannes; Fuchs, Heiko; Westphalen, Kerstin; Baumann, Clemens; Slotosch, Christine; Schulz, Rudolf
2008-01-01
The aim of this study was to evaluate the incidence of secondary symptomatic vertebral compression fractures (VCFs) in patients previously treated by percutaneous vertebroplasty (VTP). Three hundred sixteen patients with 486 treated VCFs were included in the study according to the inclusion criteria. Patients were kept in regular follow-up using a standardized questionairre before, 1 day, 7 days, 6 months, and 1 year after, and, further on, on a yearly basis after VTP. The incidence of secondary symptomatic VCF was calculated, and anatomical distribution with respect to previous fractures characterized. Mean follow-up was 8 months (6-56 months) after VTP. Fifty-two of 316 (16.4 %) patients (45 female, 7 male) returned for treatment of 69 secondary VCFs adjacent to (35/69; 51%) or distant from (34/69; 49%) previously treated levels. Adjacent secondary VCF occurred significantly more often compared to distant secondary VCF. Of the total 69 secondary VCFs, 35 of 69 occurred below and 27 of 69 above pretreated VCFs. Of the 65 sandwich levels generated, in 7 of 65 (11%) secondary VCFs were observed. Secondary VCF below pretreated VCF occurred significantly earlier in time compared to VCF above and compared to sandwich body fractures. No major complication occurred during initial or follow-up intervention. We conclude that secondary VCFs do occur in individuals after VTP but the rate found in our study remains below the level expected from epidemiologic studies. Adjacent fractures occur more often and follow the cluster distribution of VCF as expected from the natural history of the underlying osteoporosis. No increased rate of secondary VCF after VTP was observed in this retrospective analysis. In accordance with the pertinent literature, short-term and also midterm clinical results are encouraging and provide further support for the usefulness and the low complication rate of this procedure as an adjunct to the spectrum of pain management in patients with severe
PSB goes personal: The failure of personalised PSB web pages
Directory of Open Access Journals (Sweden)
Jannick Kirk Sørensen
2013-12-01
Full Text Available Between 2006 and 2011, a number of European public service broadcasting (PSB organisations offered their website users the opportunity to create their own PSB homepage. The web customisation was conceived by the editors as a response to developments in commercial web services, particularly social networking and content aggregation services, but the customisation projects revealed tensions between the ideals of customer sovereignty and the editorial agenda-setting. This paper presents an overview of the PSB activities as well as reflections on the failure of the customisable PSB homepages. The analysis is based on interviews with the PSB editors involved in the projects and on studies of the interfaces and user comments. Commercial media customisation is discussed along with the PSB projects to identify similarities and differences.
FY2012 Progress Report for Energy Storage Research & Development
Energy Technology Data Exchange (ETDEWEB)
none,
2013-01-01
FY 2012 annual report of the energy storage research and development effort within the VT Office. An important step for the electrification of the nation’s light duty transportation sector is the development of more cost-effective, long lasting, and abuse-tolerant PEV batteries. In fiscal year 2012, battery R&D work continued to focus on the development of high-energy batteries for PEVs and very high power devices for hybrid vehicles. This document provides a summary and progress update of the VTP battery R&D projects that were supported in 2012.
VirtuelGalathea 3. Slutrapport
DEFF Research Database (Denmark)
Hasager, Charlotte Bay
Galathea cooperate with skilled teachers in order to provide educational material across several disciplines with focus on the physical sciences. The homepage vg3.dk contains material which includes 54 new projects developed in 2007-2011 in VirtuelGalathea3 and 40 developed in the Satellite Eye project...
Energy Technology Data Exchange (ETDEWEB)
NONE
2005-12-15
This report explains the R and D project and provides the background for the developed overview model and the established homepage under www.horesta/elfor.dk, where the results from the project are published. The aim of this project has been to develop and test a method that can support learning and competence development in relation to energy consumption in hotels and restaurants. The aim being to support the employee's ability and will to act towards occurring problems and provide solutions to energy consumption. The project has resulted in the development of an overview model, which support the learning, and competence development of the employees. The model has three main elements or pillars: the hotel, the strategy of involvement and the energy conservation process. Each of them contains a 'descriptive level' and a 'result layer' with conclusions in relation to potentials and barriers. Furthermore there is included a layer of examples. Initial there has been made a systematic mapping of the energy consumption in hotels and restaurants in relation to the building design and the behaviours of the employees. Special focus has been given to the possibilities for energy conservation through change in the behaviour and habits of consuming energy. The mapping is based on already available materials/methods to up-date these materials/methods the energy consumption was registered in 6 typical hotels and restaurants. The mapping covered measurement of the total electricity consumption and the consumption at selected areas/apparatus followed by a registration of the utilisation of locations and apparatus to identify significant possibilities for conservation of electricity. The effect for savings on electricity and especially the behavioural related savings was evaluated and good practices were established. The most promising possibilities for savings were described in guidelines. These guidelines, which are registered at the project homepage and have been forwarded to
The KFB Program on Biobased Fuels for Vehicles
International Nuclear Information System (INIS)
1996-12-01
KFB supports research and demonstration projects for bio-based transport fuels, alcohols and biogas. The program started in 1991 and will continue through 1997. The program focuses on heavy vehicles, e.g. buses for public transportation. Projects and intermediate results are described in the brochure. Information is also available at the KFB homepage. //www.kfb.se
Energy Technology Data Exchange (ETDEWEB)
NONE
2005-12-15
This report explains the R and D project and provides the background for the developed overview model and the established homepage under www.horesta/elfor.dk, where the results from the project are published. The aim of this project has been to develop and test a method that can support learning and competence development in relation to energy consumption in hotels and restaurants. The aim being to support the employee's ability and will to act towards occurring problems and provide solutions to energy consumption. The project has resulted in the development of an overview model, which support the learning, and competence development of the employees. The model has three main elements or pillars: the hotel, the strategy of involvement and the energy conservation process. Each of them contains a 'descriptive level' and a 'result layer' with conclusions in relation to potentials and barriers. Furthermore there is included a layer of examples. Initial there has been made a systematic mapping of the energy consumption in hotels and restaurants in relation to the building design and the behaviours of the employees. Special focus has been given to the possibilities for energy conservation through change in the behaviour and habits of consuming energy. The mapping is based on already available materials/methods to up-date these materials/methods the energy consumption was registered in 6 typical hotels and restaurants. The mapping covered measurement of the total electricity consumption and the consumption at selected areas/apparatus followed by a registration of the utilisation of locations and apparatus to identify significant possibilities for conservation of electricity. The effect for savings on electricity and especially the behavioural related savings was evaluated and good practices were established. The most promising possibilities for savings were described in guidelines. These guidelines, which are registered at the project homepage and
Shear Ram Verification Test Protocol (VTP) Best Practices
Energy Technology Data Exchange (ETDEWEB)
Lindley, Roy A. [Argonne National Lab. (ANL), Argonne, IL (United States); Braun, Joseph C. [Argonne National Lab. (ANL), Argonne, IL (United States)
2017-01-01
A blowout preventer (BOP) is a critical component used on subsea oil and gas wells during drilling, completion, and workover operations on the U. S. outer continental shelf (OCS). The purpose of the BOP is to seal oil and gas wells, and in the case of an emergency well-control event, to prevent the uncontrolled release of hydrocarbons. One of the most important components of the BOP is the hydraulically operated blind shear ram (BSR) that shears drilling-related components, such as drill pipes, casings, tubings, and wire-related tools that may have been placed in the well. In addition to shearing these components, the BSR must form a seal to keep hydrocarbons within the well bore, even when under the highest well-fluid pressures expected. The purpose of this document is for Argonne National Laboratory (ANL) to provide an independent view, based on current regulations, and best practices for testing and confirming the operability and suitability of BSRs under realistic (or actual) well conditions.
Gene : CBRC-XTRO-01-2206 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-2206 Novel UN D UNKNOWN VTP3_TTV1V 1e-11 32% dbj|BAC87052.1| unnamed protein product [Homo sapi...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLHAHTPAPIGTYMPTHLPPLAPTCPHTCPHWHLYAHTPAPIGTYMPTHLPPLAPTCPHTCPHWHLHAHTPAPIGTYM...PTHLPPLAPTCPHTCPHWHLHAHTPAPTDTYMPTHLPPLAPTCPHTCPHWHLHAHTPAPIGTYMPTHLPPLAPTCPHTCPHWHLHAHTPAPIGTYMPTHLPPLAPTCPHTCPHWHLHAHTPAPIGTYMPTHLPPLAPTCPHTCPH ...
Search Results | Page 4 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 31 - 40 of 41 ... From increasing access to nutritious food to boosting women's opportunities to lead safe and healthy lives, the most popular content featured on our homepage in 2014 showcases IDRC-funded research that has made a difference across the developing world. Project.
Biometry | Division of Cancer Prevention
[[{"fid":"66","view_mode":"default","fields":{"format":"default","field_file_image_alt_text[und][0][value]":"Biometry Research Group Homepage Logo","field_file_image_title_text[und][0][value]":"Biometry Research Group Homepage Logo","field_folder[und]":"15"},"type":"media","attributes":{"alt":"Biometry Research Group Homepage Logo","title":"Biometry Research Group Homepage
Algorithms for worst-case tolerance optimization
DEFF Research Database (Denmark)
Schjær-Jacobsen, Hans; Madsen, Kaj
1979-01-01
New algorithms are presented for the solution of optimum tolerance assignment problems. The problems considered are defined mathematically as a worst-case problem (WCP), a fixed tolerance problem (FTP), and a variable tolerance problem (VTP). The basic optimization problem without tolerances...... is denoted the zero tolerance problem (ZTP). For solution of the WCP we suggest application of interval arithmetic and also alternative methods. For solution of the FTP an algorithm is suggested which is conceptually similar to algorithms previously developed by the authors for the ZTP. Finally, the VTP...... is solved by a double-iterative algorithm in which the inner iteration is performed by the FTP- algorithm. The application of the algorithm is demonstrated by means of relatively simple numerical examples. Basic properties, such as convergence properties, are displayed based on the examples....
The aldo-keto reductase superfamily homepage.
Hyndman, David; Bauman, David R; Heredia, Vladi V; Penning, Trevor M
2003-02-01
The aldo-keto reductases (AKRs) are one of the three enzyme superfamilies that perform oxidoreduction on a wide variety of natural and foreign substrates. A systematic nomenclature for the AKR superfamily was adopted in 1996 and was updated in September 2000 (visit www.med.upenn.edu/akr). Investigators have been diligent in submitting sequences of functional proteins to the Web site. With the new additions, the superfamily contains 114 proteins expressed in prokaryotes and eukaryotes that are distributed over 14 families (AKR1-AKR14). The AKR1 family contains the aldose reductases, the aldehyde reductases, the hydroxysteroid dehydrogenases and steroid 5beta-reductases, and is the largest. Other families of interest include AKR6, which includes potassium channel beta-subunits, and AKR7 the aflatoxin aldehyde reductases. Two new families include AKR13 (yeast aldose reductase) and AKR14 (Escherichia coli aldehyde reductase). Crystal structures of many AKRs and their complexes with ligands are available in the PDB and accessible through the Web site. Each structure has the characteristic (alpha/beta)(8)-barrel motif of the superfamily, a conserved cofactor binding site and a catalytic tetrad, and variable loop structures that define substrate specificity. Although the majority of AKRs are monomeric proteins of about 320 amino acids in length, the AKR2, AKR6 and AKR7 family may form multimers. To expand the nomenclature to accommodate multimers, we recommend that the composition and stoichiometry be listed. For example, AKR7A1:AKR7A4 (1:3) would designate a tetramer of the composition indicated. The current nomenclature is recognized by the Human Genome Project (HUGO) and the Web site provides a link to genomic information including chromosomal localization, gene boundaries, human ESTs and SNPs and much more.
Comet: Multifunction VOEvent broker
Swinbank, John
2014-04-01
Comet is a Python implementation of the VOEvent Transport Protocol (VTP). VOEvent is the IVOA system for describing transient celestial events. Details of transients detected by many projects, including Fermi, Swift, and the Catalina Sky Survey, are currently made available as VOEvents, which is also the standard alert format by future facilities such as LSST and SKA. The core of Comet is a multifunction VOEvent broker, capable of receiving events either by subscribing to one or more remote brokers or by direct connection from authors; it can then both process those events locally and forward them to its own subscribers. In addition, Comet provides a tool for publishing VOEvents to the global VOEvent backbone.
DEFF Research Database (Denmark)
2002-01-01
The ambition of the project, published in the current homepage, was to rediscover the spatial reflection within the expressive turbulent thought, and to rebuild it as an architecturally perceived space, i.e. to retell the story of the period and to reproduce its perceived space in the materials...
Development of a geo-information system for the evaluation of active faults
International Nuclear Information System (INIS)
Hwang, Sang Gi; Kim, Hyun Ju; Min, Gi Hong; Cho, Chan Sung
2006-01-01
The followings are the major contents and scope of the research : maps - production of geologic and topographic maps of various scales for Yeongkwang and Uljin area. S/W - update of the previously made geological system. Known problems and functional defects should be upgraded. Homepage - additional information of this year's project
Moog, R; Fourné, K
2007-08-01
of donation, e.g. whole blood donation or apheresis donation. Information about the use of the donated blood products, remuneration and laboratory tests performed were also required. The Internet is an important new tool for the recruitment of prospective donors. Donors want to be informed about organizational details of the donation. In the meantime, we have implemented a homepage for our transfusion service meeting the demands of prospective donors.
Video teaching program on management of colostomy: Evaluation of its impact on caregivers
Directory of Open Access Journals (Sweden)
Heena Dabas
2016-01-01
Full Text Available Context: Care of a child having colostomy has not been institutionalized for a long time for economic and administrative reasons. After stoma formation, stoma care has to be provided to the child by caregivers at home. Hence, caregivers need to be provided with ongoing education and support, commencing from preoperative teaching to discharge from the hospital and home care. Aims: The aims of this study were to develop video-based learning resource material and to evaluate its effectiveness in terms of knowledge and skill attainment by caregivers. Settings and Design: The study design was time series, one group pretest and post test. This was conducted among 30 caregivers attending pediatric surgery outpatients and indoor departments of a tertiary level care center. Materials and Methods: A video teaching program (VTP related to pediatric colostomy was developed and used to teach the caregivers about colostomy care. Pretested and validated knowledge questionnaire, observational checklist, and stoma assessment scale (SAS were used to assess the knowledge and skills of caregivers before and after the administration of VTP immediately (post test 1 after and 2 weeks (post test 2 after the intervention. Statistical Analysis Used: Repeated measures analysis of variance (ANOVA, Bonferroni correction, Mann-Whitney U test, and Kruskal-Wallis test were used. Results: There were significant increases in knowledge (from 10.9 ± 2.5 to 16.4 ± 1.67 and 15.9 ± 4.02, P = 0.001, maximum score 20 and skill scores as assessed by the observation checklist (from 5.6 ± 2.0 to 9.8 ± 1.6 and 8.6 ± 2.1, P = 0.001, maximum score 12 immediately after and 2 weeks after the VTP. However, a decline in skills was observed at 2 weeks when compared with immediate scores, as measured by the observation checklist. There was no significant increase in the skill scores of caregivers as measured by SAS at 2 weeks compared to the immediate scores. Conclusion: The VTP was
Find the index of Training Modules for AVERT, with instructions for using the training and what you'll need. AVERT can be used to estimate the potential of energy efficiency and renewable energy programs to reduce air pollution.
2010-09-01
The importance of an up to date and easy to find website should not be underestimated by scientists looking to establish links to others in their community - and represents good value for relatively little effort.
Vulnerability and adaptation of ecologically sensitive mangrove habitats to the changing climate
Digital Repository Service at National Institute of Oceanography (India)
Jagtap, T.G.; Kulkarni, V.A.; Verlekar, X.N.
has risen 10-20cm during the Twentieth century. General Circulation Models (GCM) projected a 9.88cm rise in sea level, increased extreme weather events and precipitation over the Asian region (UNEP / UNESCO, 1992, IPPC, 2001). However a lot... Scientific Assessment. Cambridge University Press, Cambridge, UK, 578 pp. INQUA, 2000. Homepage of the Commission on Sea Level Changes and Coastal Evolution, www.pog.su.se/sea. Sea level changes, News and Views, The Maldives Project IPPC, 2001. Climate...
Euler European Libraries and Electronic Resources in Mathematical Sciences
The Euler Project. Karlsruhe
The European Libraries and Electronic Resources (EULER) Project in Mathematical Sciences provides the EulerService site for searching out "mathematical resources such as books, pre-prints, web-pages, abstracts, proceedings, serials, technical reports preprints) and NetLab (for Internet resources), this outstanding engine is capable of simple, full, and refined searches. It also offers a browse option, which responds to entries in the author, keyword, and title fields. Further information about the Project is provided at the EULER homepage.
Smith, Susan
2012-01-01
The homepage of the Project on Fair Representation (POFR) features a smiling photo of Abigail Fisher, the young White woman at the center of "Fisher v. the University of Texas," which could end race as a criterion in university admissions. Edward Blum, founder of POFR, a conservative advocacy group, connected Fisher with Wiley Rein LLP,…
Weaving the Web into Course Integrated Instruction.
Wallach, Ruth; McCann, Linda
In the fall 1995, a professor teaching an undergraduate course asked the Reference Center at the University of Southern California to conduct a research session on Dante related resources on the Internet, and to show her students how to search the Dartmouth Dante Project. A simple homepage was created for the class, which listed the course…
Evaluation of Quality Aspects in Vocational Training Programmes. Synthesis Report. CEDEFOP Document.
Seyfried, Erwin
National evaluations of quality aspects of vocational training programs (VTPs) in five European countries--Belgium, Germany, France, Greece, and Portugal--were reviewed to determine how VTP quality is currently being evaluated and identify a more coherent approach to evaluating VTPs. Special attention was paid to how existing evaluation studies…
OSIRIX: open source multimodality image navigation software
Rosset, Antoine; Pysher, Lance; Spadola, Luca; Ratib, Osman
2005-04-01
The goal of our project is to develop a completely new software platform that will allow users to efficiently and conveniently navigate through large sets of multidimensional data without the need of high-end expensive hardware or software. We also elected to develop our system on new open source software libraries allowing other institutions and developers to contribute to this project. OsiriX is a free and open-source imaging software designed manipulate and visualize large sets of medical images: http://homepage.mac.com/rossetantoine/osirix/
[Internet presence of neurologists, psychiatrists and medical psychotherapists in private practice].
Kuhnigk, Olaf; Ramuschkat, Meike; Schreiner, Julia; Anger, Anina; Reimer, Jens
2014-04-01
The world wide web provides new options to physicians in terms practice marketing, information brokerage, and process optimization. This study explores prevalence and content of homepages of neurologists, psychiatrists and medical psychotherapists in private practice. Through the legal bodies of physicians in private practice in six northern German states neurologists, psychiatrists and medical psychotherapists were identified. According to a standardized and operationalized criteria catalogue, homepages were rated. 1804 physicians were identified, 352 (19.5 %) had operated a homepage. Higher frequencies of homepages found for male physicians (vs. female physicians), practice centres (vs. single practices) and urban practices (vs. rural practices). In average, practices reached 18.8 (± 5.3) of 42 points; contact data and accessibility information were generally available; information as to qualification and specialization was provided more infrequently. Legal specifications were not considered in more than every second homepage, interactive elements like online appointment of follow-up prescription were only rarely offered. Only every fifth neurological or psychiatric practice operates an own homepage, higher competition (urban area) and higher professionalization (practice centres) seem to act as promotors. The legal framework has to be focused, and patient needs should be taken into account. © Georg Thieme Verlag KG Stuttgart · New York.
Directory of Open Access Journals (Sweden)
LADOSKY WALDEMAR
2002-01-01
Full Text Available Objetivo: O presente trabalho dá prosseguimento ao estudo da validade de equações para valores teóricos (VT para cálculos espirométricos na população brasileira. Foi feita a comparação entre as equações propostas por Mallozzi (VT-M para população brasileira e as de Polgar (VT-P, utilizadas especialmente na Europa e Estados Unidos. Métodos: Foram analisados os VT medidos em 185 pacientes de ambos os sexos, com idade entre 6 e 17 anos, sendo 89 meninos e 96 meninas. Para cada paciente foi feito o cálculo do VT para CVF, VEF1 e FEF25-75 segundo as equações de Mallozi VT-M e de Polgar VT-P. Em seguida foram comparados os laudos obtidos por um e por outro, segundo o Consenso de Espirometria da SBPT. Resultados: O VT-M para CVF é 0,38% maior para os meninos e 2,19% para as meninas que o calculado segundo Polgar. Os VT-P para o VEF1 são 6,67% (p < 0,05 menores para as meninas e 7,26% para os meninos. Para o FEF25-75 os valores diferem apenas em 0,35 e 0,43% para cada um dos sexos, sem significância estatística. Conclusão: Os VTs de CVF e VEF1 para crianças brasileiras, avaliados segundo Mallozzi, diferem significativamente quanto aos VTs de Polgar. Como conseqüência, encontramos, utilizando as equações de Mallozzi, tendência maior em diagnosticar dificuldade obstrutiva e menor em achados de insuficiência ventilatória restritiva.
Treatment planning and dose analysis for interstitial photodynamic therapy of prostate cancer
Energy Technology Data Exchange (ETDEWEB)
Davidson, Sean R H; Gertner, Mark R; Bogaards, Arjen; Sherar, Michael D; Wilson, Brian C [Division of Biophysics and Bioimaging, Ontario Cancer Institute, University Health Network, 610 University Avenue, Toronto, Ontario M5G 2M9 (Canada); Weersink, Robert A; Giewercer, David [Laboratory for Applied Biophysics, Ontario Cancer Institute, University Health Network, 610 University Avenue, Toronto, Ontario M5G 2M9 (Canada); Haider, Masoom A [Joint Department of Medical Imaging, University Health Network, 610 University Avenue, Toronto, Ontario M5G 2M9 (Canada); Scherz, Avigdor [Department of Plant Science, Weizmann Institute of Science, PO Box 26, Rehovot 76100 (Israel); Elhilali, Mostafa [Department of Surgery, McGill University, 3655 Promenade Sir William Osler, Montreal, Quebec H3G 1Y6 (Canada); Chin, Joseph L [Department of Oncology, University of Western Ontario, 800 Commissioners Road East, PO Box 5010, London, Ontario N6A 5W9 (Canada); Trachtenberg, John [Department of Urology, University Health Network, 610 University Avenue, Toronto, Ontario M5G 2M9 (Canada)], E-mail: wilson@uhnres.utoronto.ca
2009-04-21
With the development of new photosensitizers that are activated by light at longer wavelengths, interstitial photodynamic therapy (PDT) is emerging as a feasible alternative for the treatment of larger volumes of tissue. Described here is the application of PDT treatment planning software developed by our group to ensure complete coverage of larger, geometrically complex target volumes such as the prostate. In a phase II clinical trial of TOOKAD vascular targeted photodynamic therapy (VTP) for prostate cancer in patients who failed prior radiotherapy, the software was used to generate patient-specific treatment prescriptions for the number of treatment fibres, their lengths, their positions and the energy each delivered. The core of the software is a finite element solution to the light diffusion equation. Validation against in vivo light measurements indicated that the software could predict the location of an iso-fluence contour to within approximately {+-}2 mm. The same software was used to reconstruct the treatments that were actually delivered, thereby providing an analysis of the threshold light dose required for TOOKAD-VTP of the post-irradiated prostate. The threshold light dose for VTP-induced prostate damage, as measured one week post-treatment using contrast-enhanced MRI, was found to be highly heterogeneous, both within and between patients. The minimum light dose received by 90% of the prostate, D{sub 90}, was determined from each patient's dose-volume histogram and compared to six-month sextant biopsy results. No patient with a D{sub 90} less than 23 J cm{sup -2} had complete biopsy response, while 8/13 (62%) of patients with a D{sub 90} greater than 23 J cm{sup -2} had negative biopsies at six months. The doses received by the urethra and the rectal wall were also investigated.
FY2010 Annual Progress Report for Vehicle and Systems Simulation and Testing
Energy Technology Data Exchange (ETDEWEB)
Slezak, Lee [Office of Energy Efficiency and Renewable Energy (EERE), Washington, DC (United States)
2011-01-15
The VSST team evaluates the technologies and performance characteristics of advanced automotive powertrain components and subsystems in an integrated vehicle systems context, covering light to heavy platforms. This work is directed toward evaluating and verifying the targets of the VTP R&D teams and to provide guidance in establishing roadmaps for achievement of these goals.
Evaluation of the Internet precence of diagnostic radiology units at German universities
International Nuclear Information System (INIS)
Seitz, J.; Siegmund, M.; Voelk, M.; Feuerbach, S.; Strotzer, M.
2002-01-01
Purpose. Analyzing the availability and the contents of the internet homepages of the radiological departments of German universities.Material and method. In June and July 2001 the internet homepages of 36 radiological departments of German universities were evaluated in a study. A medical student experienced in using the world wide web examined the websites concerning the following criteria: research, teaching, informations for patients, clinical topics and general information. Additionally an evaluation of the technical standard of the presentation was performed.Results. 31 of the 36 radiological departments presented a homepage in the world wide web. The subject research was presented by 29 institutes. Also 29 departments provided information concerning teaching in their presentations. In 24 cases informations especially for patients were given. In all topics there is a huge variety of the quality and quantity of the provided information throughout the different institutions. 21 homepages available without restriction during the study period; 3 were nearly completely under construction. Multimedia techniques were only used in 2 homepages. The structural hierarchy of the webpages was in the average only two or three levels. Only 6 providers presented an additional version of their homepage in english.Conclusion. In the moment the possibility of internet-presentation is sub-optimal used by the responsible persons of the radiological institutions. The main emphasis is on research and teaching. There is nearly no use of multimedial elements in the presentations. Only a minority of the homepages can be read by international viewers because of the lack of an english version of the pages. (orig.) [de
VirtuelGalathea 3. Årsrapport 2009
DEFF Research Database (Denmark)
Hasager, Charlotte Bay
project in 2006-2008. The aim is to have around 100 educational projects online. There are also near-real-time satellite images of several parameters and a large satellite images database archive from August 2006 to present day – updated every day!. Furthermore many short videos and photos from....../2010. From the typical weekly cycle with maximum number of visits during working days and minimum on Saturdays and during school holidays, the homepage obviously is used mainly in schools. Marketing effects are through electronic media, educational training courses and seminars for teachers and participation...
Communications Focal Point Contracting Squadron Force Support Squadron Mortuary Affairs Logistics Readiness Squadron Cadet Logistics Deployment and Distribution Material Management Operations PM Equipment Lab
Acquisition Research Program Homepage
2015-01-01
Includes an image of the main page on this date and compressed file containing additional web pages. Established in 2003, Naval Postgraduate School’s (NPS) Acquisition Research Program provides leadership in innovation, creative problem solving and an ongoing dialogue, contributing to the evolution of Department of Defense acquisition strategies.
Top Department of Administration logo Alaska Department of Administration Division of Finance Search Search the Division of Finance site DOF State of Alaska Finance Home Content Area Accounting Charge Cards You are here Administration / Finance Division of Finance Updates IRIS Expenditure Object Codes
PSB goes personal: The failure of personalised PSB web pages
Jannick Kirk Sørensen
2013-01-01
Between 2006 and 2011, a number of European public service broadcasting (PSB) organisations offered their website users the opportunity to create their own PSB homepage. The web customisation was conceived by the editors as a response to developments in commercial web services, particularly social networking and content aggregation services, but the customisation projects revealed tensions between the ideals of customer sovereignty and the editorial agenda-setting. This paper presents an over...
Wilén, Sara
2017-01-01
This dissertation explores performative perspectives on classical and contemporary vocal improvisation (CCVI) as a critical, creative tool for development of and research in vocal performance. It consists of one introductory part and five articles, with additional documentation on a homepage. The artistic projects have been performed in close collaboration with fellow classically trained singers and musicians. The practice of CCVI is contextualised in relation to vocal history, opera, improvi...
M.Sc. in Civil and Structural Engineering
DEFF Research Database (Denmark)
Clausen, Johan Christian
The following pages contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. Most of the project ideas in this catalogue may form the basis for long and short master projects as well as regular 3rd...... semester projects at the M.Sc. programme in Civil and Structural Engineering. Each project description provides a brief overview of the purpose as well as the main activities. Further, a weighting between theoretical analysis, experimental work and computer modelling has been proposed. Usually...... page. Furthermore, other ideas for projects may be discussed with a potential supervisor. Many private engineering companies have a homepage on which they state that they would like to collaborate with students on a master project....
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-03-01
As a part of the cooperative work with Indonesia of R and D of a laser radar for environmental measurement, the paper described the development of an environmental network. The field survey was conducted in April, July and December 1995 and in March 1996. For the investigational research, five meetings of the committee and four times of group work were held. The Asian environmental network was studied in terms of its arrangement, operation and management, and the overall network/path control design were being prepared. To make the persons concerned abroad and in Japan understood the APEC Osaka Conference held in November 1995, a homepage APEC `95 Kansai was opened using WWW (World Wide Web, a decentralized hyper media system which can dispatch information to the whole world by network using hyper text). Moreover, in connection with this, a homepage was opened of CICC (Center of the International Cooperation for Computerization, a center controlling the whole Asian environmental information network system where E-mail and data are exchangeable with Indonesia via Tokyo NOC (Network Operation Center)). 49 figs., 8 tabs.
Light-Duty Vehicle Fuel Consumption Displacement Potential up to 2045
Energy Technology Data Exchange (ETDEWEB)
Moawad, Ayman [Argonne National Lab. (ANL), Argonne, IL (United States); Rousseau, Aymeric [Argonne National Lab. (ANL), Argonne, IL (United States)
2016-04-01
The U.S. Department of Energy (DOE) Vehicle Technologies Program (VTP) is developing more energy-efficient and environmentally friendly highway transportation technologies that will enable America to use less petroleum. The long-term aim is to develop "leapfrog" technologies that will provide Americans with greater freedom of mobility and energy security, while lowering costs and reducing impacts on the environment.
Airway Clearance Techniques (ACTs)
Full Text Available Skip to Main Content Skip to Footer CFF Homepage Menu Search What Is CF? X close ABOUT ... may be right for you. Search Trials CFF Homepage Cystic Fibrosis Foundation 4550 Montgomery Ave. Suite 1100 ...
Iplt--image processing library and toolkit for the electron microscopy community.
Philippsen, Ansgar; Schenk, Andreas D; Stahlberg, Henning; Engel, Andreas
2003-01-01
We present the foundation for establishing a modular, collaborative, integrated, open-source architecture for image processing of electron microscopy images, named iplt. It is designed around object oriented paradigms and implemented using the programming languages C++ and Python. In many aspects it deviates from classical image processing approaches. This paper intends to motivate developers within the community to participate in this on-going project. The iplt homepage can be found at http://www.iplt.org.
Numerical Procedures for Analyzing Dynamical Processes.
1992-02-29
7 < I - 2/p ’’ Clatm. For fixed , < . with - sufficiently small, there ex- ists a .E F( ) such that the nth iterate of the primary parabola...4a. 1,4’ ,jh))<.,((P ,ia))< v,(a)= vIh ). and \\, 0 ,c)) < v,tP ;it)) < ic ) = \\,(. Setting F= F(x,. ’t. T). this means that in the reconstruction , pace
FY2011 Annual Progress Report for Vehicle and Systems Simulation and Testing
Energy Technology Data Exchange (ETDEWEB)
None
2012-01-15
The VSST team's mission is to evaluate the technologies and performance characteristics of advanced automotive powertrain components and subsystems in an integrated vehicle systems context. These evaluations address light-, medium-, and heavy-duty vehicle platforms. This work is directed toward evaluating and verifying the targets of the VTP R&D teams and to providing guidance in establishing roadmaps for achievement of these goals.
Energy Technology Data Exchange (ETDEWEB)
Olszewski, Mitchell [ORNL
2010-10-01
, subsystems, and component research and development activities; (2) develop and validate individual subsystems and components, including electric motors and PE; and (3) determine how well the components and subsystems work together in a vehicle environment or as a complete propulsion system and whether the efficiency and performance targets at the vehicle level have been achieved. The research performed under this subprogram will help remove technical and cost barriers to enable the development of technology for use in such advanced vehicles as hybrid electric vehicles (HEVs), plug-in HEVs (PHEVs), battery electric vehicles, and fuel-cell-powered automobiles that meet the goals of the VTP. A key element in making these advanced vehicles practical is providing an affordable electric traction drive system. This will require attaining weight, volume, and cost targets for the PE and electrical machines subsystems of the traction drive system. Areas of development include: (1) novel traction motor designs that result in increased power density and lower cost; (2) inverter technologies involving new topologies to achieve higher efficiency, with the ability to accommodate higher temperature environments while achieving high reliability; (3) converter concepts that use methods of reducing the component count and integrating functionality to decrease size, weight, and cost; (4) new onboard battery charging concepts that result in decreased cost and size; (5) more effective thermal control through innovative packaging technologies; and (6) integrated motor/inverter concepts. ORNL's Power Electronics and Electric Machines Research Program conducts fundamental research, evaluates hardware, and assists in the technical direction of the VTP APEEM subprogram. In this role, ORNL serves on the FreedomCAR Electrical and Electronics Technical Team, evaluates proposals for DOE, and lends its technological expertise to the direction of projects and evaluation of developing technologies. ORNL
DEFF Research Database (Denmark)
Lenau, Torben Anker
1999-01-01
A homepage on the internet with course material, lecture plan, student exercises, etc. Continuesly updated during the course Integrated Design (80402, 80403)......A homepage on the internet with course material, lecture plan, student exercises, etc. Continuesly updated during the course Integrated Design (80402, 80403)...
Kimm, Simon Y.; Tarin, Tatum V.; Monette, Sébastien; Srimathveeravalli, Govindarajan; Gerber, Daniel; Durack, Jeremy C.; Solomon, Stephen B.; Scardino, Peter T.; Scherz, Avigdor
2016-01-01
Purpose To examine the hypothesis that vascular-targeted photodynamic therapy (VTP) with WST11 and clinically relevant parameters can be used to ablate target tissues in a non–tumor-bearing large-animal model while selectively sparing blood vessels and collagen. Materials and Methods By using an institutional animal care and use committee–approved protocol, 68 ablations were performed in the kidneys (cortex and medulla) and livers of 27 adult pigs. Posttreatment evaluation was conducted with contrast material–enhanced computed tomography in the live animals at 24 hours. Immunohistochemistry was evaluated and histologic examination with hematoxylin-eosin staining was performed at 4 hours, 24 hours, and 7 days. Intravenous infusion of WST11 (4 mg per kilogram of body weight) was followed by using near-infrared illumination (753 nm for 20 minutes) through optical fibers prepositioned in target tissues by using a fixed template. Treated areas were scanned, measured, and statistically analyzed by using the Student t test and two-way analysis of variance. Results Focal WST11 VTP treatment in the liver and kidney by using a single optical fiber resulted in well-demarcated cylindrical zones of nonthermal necrosis concentrically oriented around the light-emitting diffuser, with no intervening viable parenchymal cells. The radius of ablated tissue increased from approximately 5 mm at 150 mW to approximately 7 mm at 415 mW (P necrosis. Patterns of acute injury within 24 hours were consistent with microcirculatory flow arrest and collagen preservation (demonstrated with trichrome staining). In the peripheral ablation zone, blood vessels at least 40 μm in diameter were selectively preserved and remained functional at 7 days. Ablated tissues exhibited progressive fibrosis and chronic inflammatory cell infiltrates. No histologic changes consistent with thermal injury were observed in blood vessels or collagen. The renal hilum and collecting system did not show treatment
Brezinski, C
2012-01-01
Numerical analysis has witnessed many significant developments in the 20th century. This book brings together 16 papers dealing with historical developments, survey papers and papers on recent trends in selected areas of numerical analysis, such as: approximation and interpolation, solution of linear systems and eigenvalue problems, iterative methods, quadrature rules, solution of ordinary-, partial- and integral equations. The papers are reprinted from the 7-volume project of the Journal of Computational and Applied Mathematics on '/homepage/sac/cam/na2000/index.html<
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-03-01
It is intended to participate in the IEA international cooperation project related to DSA, exchange items of information, and promote demonstration and survey of new load leveling methods. The existing and newly proposed DSM mechanisms as the achievement of the previous tasks were put into order. The arena of information exchange and discussions was prepared through use of the Internet homepage for the IEA/DSM implementation agreement. Necessary official policies were also made available. Points of precautions when the mechanisms of other countries are used in Japan: the key to the success depends on social or cultural situations that work as the base; therefore, comparisons and analyses are necessary on such elements as customers as the object, energy projects and governments; compatibility of the situation and pattern of the demand side with the DSM technologies governs the reasonability thereof; the types of the mechanisms are narrowed down by size of the customer division, consumption pattern, electric power quality and safety, and needs on the flexibility; proliferation levels of the DSM technologies determine the appropriate mechanisms; and how the DSM is conceived against the final consumption is governed by the conception by both of the customers and the government. (NEDO)
GPA Homepage -- Present and future
International Nuclear Information System (INIS)
Harris, S.C.
1997-01-01
The Gas Processors Association has established its presence on the Internet through the development of its Web Page. This site will continue to be developed and expanded so as to strive towards the goal defined in the GPA mission statement of delivering value to the global membership. The current address for the site is http://www.galstar.com/~gpa
Folch, A.; Costa, A.; Cordoba, G.
2009-04-01
Tephra fallout following explosive volcanic eruptions produces several hazardous effects on inhabitants, infrastructure, and property and represents a serious threat for communities located around active volcanoes. In order to mitigate the effects on the surrounding areas, scientists and civil decision-making authorities need reliable short-term forecasts during episodes of eruptive crisis and long-term probabilistic maps to plan territorial policies and land use. Modelling, together with field studies and volcano monitoring, constitutes an indispensable tool to achieve these objectives. The UNESCO-IGCP research project proposal "Forecast of tephra fallout" has the aim to produce a series of tools capable to elaborate both short-term forecasts and long-term hazard assessments using the cutting-edge models for tephra transport and sedimentation. A special project website will be designed to supply a set of models, procedures and expertise to several Latino-American Institutes based in countries seriously threatened by this geo-hazard (Argentina, Chile, Colombia, Ecuador, Mexico, and Nicaragua). This will proportionate to the final users a tool to elaborate short-term forecasts of tephra deposition on the ground, and determine airborne ash concentrations (a quantity of special relevance for aerial navigation safety) during eruptions and emergencies. The project web-site will have a public section and a password-protected area to exchange information and data among participants and, eventually, to allow remote execution of high-resolution mesoscale meteorological forecasts at the BSC facilities. The public website section will be updated periodically and will include sections describing the project objectives and achievements as well as the hazard maps for the investigated volcanoes, and will be linked to other relevant websites such as IAVCEI, IGCP, IUGS and UNESCO homepages. A part of the public section of the website will be devoted to disseminate achieved
Separate but Equal? A Comparison of Content on Library Web Pages and Their Text Versions
Hazard, Brenda L.
2008-01-01
This study examines the Web sites of the Association of Research Libraries member libraries to determine the presence of a separate text version of the default graphical homepage. The content of the text version and the homepage is compared. Of 121 Web sites examined, twenty libraries currently offer a text version. Ten sites maintain wholly…
Energy Technology Data Exchange (ETDEWEB)
Broehl-Kerner, Horst; Elander, Maria; Koch, Martin; Vendramin, Claudio [Bundesarbeitsgemeinschaft Arbeit e.V., Berlin (Germany)
2012-07-15
In project Second Life the existing basic conditions and framework, as well as the different aspects of high-quality reuse were researched and documented. In addition, innovative attempts of the procurement were tested and the feasibility of a quality labeling for electric and electronic devices was analyzed and documented. The results deliver at all important levels of consideration the topically necessary orientation on the subject of reuse of E- devices referring to the product spectrum focused in the project. On the basis of the achieved project results the project partners work on the following aims for the future: First, Informal interlinking of the stakeholder and actors brought together in the project via a new homepage (www.bagsecondlife.de) and newsletter of bag arbeit department for Labour and Environment (FAU) in order to inform about new and changing legislation more actually and also to help them participating in activities of creating contents of a label. Second, establishing a label (e.g. ''ECO Second'') that will be successful on the market. An important base for the project work is the interdisciplinary cooperation of four partners from different fields of action. Thus they were able to cover the required expertise in the fields of protection of environment and climate as well as environmental communication. Both the last aspects were introduced by the Deutsche Umwelthilfe. The operational or practical aspects were represented by Arbeitskreis Recycling and Werkstatt Frankfurt as well as by FAU. Project coordination, spreading of information and the necessary law expertise were perceived from bag arbeit respectively members of FAU-board. With the contributions of Oekopol GmbH and Dr. Bruening engineering to norms, rules, market sphere and ecological classification of the plan, demanded and necessary technical expert's assessment were integrated. Further single results of the project are the project homepage mentioned above
Third Semester and Master’s Thesis Ideas 2016
DEFF Research Database (Denmark)
The following pages contain a list of project ideas proposed by the scientific staff at the Department of Civil Engineering, Aalborg University, and a number of companies. The project ideas in this catalogue may form the basis for long and short master projects as well as regular 3rd semester...... overview of the purpose as well as the main activities. Further, a weighting between theoretical analysis, experimental work and computer modelling has been proposed. Usually, this weighting can be changed slightly in accordance with the wishes of the students. The contact persons listed will usually act...... in this catalogue can reveal the expertise and research areas of the different supervisors. Many private engineering companies have a homepage on which they state that they would like to collaborate with students on a master project. Find out more on the individual company home pages....
[Digital Information on Rehabilitation and Retirement for Physicians - A Practical Test].
Deck, Ruth; Waschkau, Alexander; Götz, Katja; Schwill, Simon; Flum, Elisabeth; Steinhäuser, Jost
2018-06-14
About 1.6 million rehabilitation applications are submitted to the German pension insurance annually. Physicians working in ambulatory care play an important role in the application process. Studies show that there is too little knowledge about medical rehabilitation in these groups of physicians, the detection of rehabilitation needs and the process of application for rehabilitation. Against this background, a website Information for Doctors on Rehabilitation & Retirement was developed which addresses especially these needs. The aim of the study was to evaluate the website within a practical test. The practical test was performed with a mixed Methods Approach: 1) Quantitative survey with respect to increased knowledge after using the homepage, 2) assessment of cases with regard to rehabilitation indication and 3) evaluation of the user friendliness of the homepage by participating doctors by means of think-aloud technique. A total of 79 postgraduate General Practice trainees participated. They had high information needs regarding different aspects of rehabilitation, which were partly satisfied by the use of the homepage. The correct assessment of rehabilitation cases improved with the aid of the website for general practitioners with experience with application for rehabilitation only. The homepage was evaluated as clear and helpful, but the texts were judged as too extensive. The homepage can support physicians working in ambulatory care with respect to rehabilitation. Some impulses for optimization of the content have been identified and can help to further increase the usefulness of the website. © Georg Thieme Verlag KG Stuttgart · New York.
What is Clean Cities? October 2011 (Brochure)
Energy Technology Data Exchange (ETDEWEB)
2011-10-01
Brochure describes the Clean Cities program and includes the contact information for its 85 coalitions. Sponsored by the U.S. Department of Energy's (DOE) Vehicle Technologies Program (VTP), Clean Cities is a government-industry partnership that reduces petroleum consumption in the transportation sector. Clean Cities contributes to the energy, environmental, and economic security of the United States by supporting local decisions to reduce our dependence on imported petroleum. Established in 1993 in response to the Energy Policy Act (EPAct) of 1992, the partnership provides tools and resources for voluntary, community-centered programs to reduce consumption of petroleum-based fuels. In nearly 100 coalitions, government agencies and private companies voluntarily come together under the umbrella of Clean Cities. The partnership helps all parties identify mutual interests and meet the objectives of reducing the use of petroleum, developing regional economic opportunities, and improving air quality. Clean Cities deploys technologies and practices developed by VTP. These include idle-reduction equipment, electric-drive vehicles, fuel economy measures, and renewable and alternative fuels, such as natural gas, liquefied petroleum gas (propane), electricity, hydrogen, biofuels, and biogas. Idle-reduction equipment is targeted primarily to buses and heavy-duty trucks, which use more than 2 billion gallons of fuel every year in the United States while idling. Clean Cities fuel economy measures include public education on vehicle choice and fuel-efficient driving practices.
Combat Wound Initiative Program
2010-07-01
Government as part of that person’s official duties. Deliver~~ by Publishing Technology to: Waiter Reed Army Institute of R~l!il>~~vTP:11~1~:S6;!4!B1...develop a predictive model, which could serve as a clinical decision support tool in the management of complex war wounds. Bayesian belief networks...decisions regarding the surgical management of wounds and estimate overall out- come of patients on the basis of casualty-specific factors in wounded
International Nuclear Information System (INIS)
Yun, Y. C.; Lee, J. H.; Lee, H. C.; Lee, J. S.
2000-01-01
In order to achieve the safety of the Korea Next Generation Reactors (KNGR), the Korea Institute of Nuclear Safety has carried out the Safety and Regulatory Requirements and Guidance (SRRG) development program from 1992 such as establishment of the SRRG hierarchy, development of technical requirements and guidance, and consideration of new licensing system. The SRRG hierarchy for the KNGR was consisted of five tiers; Safety Objectives, Safety Principles, General Safety Criteria, Specific Safety Requirements and Safety Regulatory Guides. The developed SRRG have been compared the criteria in 10CFR and Reg. Guide in the U.S.A and the IAEA documents for assuring internationally acceptable level of the SRRG. To improve the efficiency and accuracy of SRRG development, the construction of database system was required in the course of development. Therefore, the Information Management System of SRRG for the KNGR has been developed which enables developers to quickly and accurately seek and systematically manage whole contexts of the SRRG, reference requirements, and current atomic energy regulation rules. Moreover, through homepage whose URL is 'http://kngr.kins.re.kr', the concerned persons and public can acquire the information related with SRRG and KNGR project, and post his/her thought to the opinion forum in the homepage
Energy Technology Data Exchange (ETDEWEB)
Yun, Y. C. [LG-EDS Systems, Seoul (Korea, Republic of); Lee, J. H.; Lee, H. C.; Lee, J. S. [Korea Institute of Nuclear Safety, Taejon (Korea, Republic of)
2000-05-01
In order to achieve the safety of the Korea Next Generation Reactors (KNGR), the Korea Institute of Nuclear Safety has carried out the Safety and Regulatory Requirements and Guidance (SRRG) development program from 1992 such as establishment of the SRRG hierarchy, development of technical requirements and guidance, and consideration of new licensing system. The SRRG hierarchy for the KNGR was consisted of five tiers; Safety Objectives, Safety Principles, General Safety Criteria, Specific Safety Requirements and Safety Regulatory Guides. The developed SRRG have been compared the criteria in 10CFR and Reg. Guide in the U.S.A and the IAEA documents for assuring internationally acceptable level of the SRRG. To improve the efficiency and accuracy of SRRG development, the construction of database system was required in the course of development. Therefore, the Information Management System of SRRG for the KNGR has been developed which enables developers to quickly and accurately seek and systematically manage whole contexts of the SRRG, reference requirements, and current atomic energy regulation rules. Moreover, through homepage whose URL is 'http://kngr.kins.re.kr', the concerned persons and public can acquire the information related with SRRG and KNGR project, and post his/her thought to the opinion forum in the homepage.
scikit-image: image processing in Python.
van der Walt, Stéfan; Schönberger, Johannes L; Nunez-Iglesias, Juan; Boulogne, François; Warner, Joshua D; Yager, Neil; Gouillart, Emmanuelle; Yu, Tony
2014-01-01
scikit-image is an image processing library that implements algorithms and utilities for use in research, education and industry applications. It is released under the liberal Modified BSD open source license, provides a well-documented API in the Python programming language, and is developed by an active, international team of collaborators. In this paper we highlight the advantages of open source to achieve the goals of the scikit-image library, and we showcase several real-world image processing applications that use scikit-image. More information can be found on the project homepage, http://scikit-image.org.
scikit-image: image processing in Python
Directory of Open Access Journals (Sweden)
Stéfan van der Walt
2014-06-01
Full Text Available scikit-image is an image processing library that implements algorithms and utilities for use in research, education and industry applications. It is released under the liberal Modified BSD open source license, provides a well-documented API in the Python programming language, and is developed by an active, international team of collaborators. In this paper we highlight the advantages of open source to achieve the goals of the scikit-image library, and we showcase several real-world image processing applications that use scikit-image. More information can be found on the project homepage, http://scikit-image.org.
Gasoline Combustion Fundamentals DOE FY17 Report
Energy Technology Data Exchange (ETDEWEB)
Ekoto, Isaac W. [Sandia National Lab. (SNL-CA), Livermore, CA (United States)
2017-11-01
Advanced automotive gasoline engines that leverage a combination of reduced heat transfer, throttling, and mechanical losses; shorter combustion durations; and higher compression and mixture specific heat ratios are needed to meet aggressive DOE VTP fuel economy and pollutant emission targets. Central challenges include poor combustion stability at low-power conditions when large amounts of charge dilution are introduced and high sensitivity of conventional inductive coil ignition systems to elevated charge motion and density for boosted high-load operation. For conventional spark ignited operation, novel low-temperature plasma (LTP) or pre-chamber based ignition systems can improve dilution tolerances while maintaining good performance characteristics at elevated charge densities. Moreover, these igniters can improve the control of advanced compression ignition (ACI) strategies for gasoline at low to moderate loads. The overarching research objective of the Gasoline Combustion Fundamentals project is to investigate phenomenological aspects related to enhanced ignition. The objective is accomplished through targeted experiments performed in a single-cylinder optically accessible research engine or an in-house developed optically accessible spark calorimeter (OASC). In situ optical diagnostics and ex situ gas sampling measurements are performed to elucidate important details of ignition and combustion processes. Measurements are further used to develop and validate complementary high-fidelity ignition simulations. The primary project audience is automotive manufacturers, Tier 1 suppliers, and technology startups—close cooperation has resulted in the development and execution of project objectives that address crucial mid- to long-range research challenges.
Changing the Department of Defense’s Policy on Homosexuals
2008-02-19
Illegal for Gay People to be Honest, The Human Rights Campaign Homepage, retrieved 7 December 2007 from http://www.hrc.org/alva/dadt.html 7. Belkin...Don’t Ask, Don’t Tell”, The US Military: Where it’s Illegal for Gay People to be Honest, The Human Rights Campaign Homepage, retrieved 7 December...2007 from http://www.hrc.org/alva/dadt.html 18. Ottosson, D (2006, November), LGBT World Legal Wrap Up Survey, International Lesbian Gay
Collinson, Timothy; Williams, A.
2004-01-01
Much time and effort has been devoted to designing and developing library Web sites that are easy to navigate by both new students and experienced researchers. In a review of the Southampton Institute Library it was decided that in addition to updating the existing homepage an alternative would be offered. Drawing on theory relating to user interface design, learning styles and creative thinking, an Alternative Library navigation system was added to the more traditional library homepage. The ...
FY2011 Advanced Power Electronics and Electric Motors Annual Progress Report
Energy Technology Data Exchange (ETDEWEB)
Rogers, Susan A. [Office of Energy Efficiency and Renewable Energy (EERE), Washington, DC (United States)
2012-01-31
The Advanced Power Electronics and Electric Motors (APEEM) program within the DOE Vehicle Technologies Program (VTP) provides support and guidance for many cutting-edge automotive technologies now under development. Research is focused on developing revolutionary new power electronics (PE), electric motor (EM), thermal management, and traction drive system technologies that will leapfrog current on-the-road technologies. The research and development (R&D) is also aimed at achieving a greater understanding of and improvements in the way the various new components of tomorrow’s automobiles will function as a unified system to improve fuel efficiency.
FY2009 Annual Progress Report for Advanced Combustion Engine Research and Development
Energy Technology Data Exchange (ETDEWEB)
none,
2009-12-01
Fiscal Year 2009 Annual Progress Report for the Advanced Combustion Engine Research and Development (R&D) subprogram. The Advanced Combustion Engine R&D subprogram supports the mission of the VTP program by removing the critical technical barriers to commercialization of advanced internal combustion engines (ICEs) for passenger and commercial vehicles that meet future Federal emissions regulations. Dramatically improving the efficiency of ICEs and enabling their introduction in conventional as well as hybrid electric vehicles is the most promising and cost-effective approach to increasing vehicle fuel economy over the next 30 years.
Energy Technology Data Exchange (ETDEWEB)
Olszewski, Mitchell [ORNL
2011-10-01
The U.S. Department of Energy (DOE) announced in May 2011 a new cooperative research effort comprising DOE, the U.S. Council for Automotive Research (composed of automakers Ford Motor Company, General Motors Company, and Chrysler Group), Tesla Motors, and representatives of the electric utility and petroleum industries. Known as U.S. DRIVE (Driving Research and Innovation for Vehicle efficiency and Energy sustainability), it represents DOE's commitment to developing public-private partnerships to fund high risk-high reward research into advanced automotive technologies. The new partnership replaces and builds upon the partnership known as FreedomCAR (derived from 'Freedom' and 'Cooperative Automotive Research') that ran from 2002 through 2010 and the Partnership for a New Generation of Vehicles initiative that ran from 1993 through 2001. The Oak Ridge National Laboratory's (ORNL's) Power Electronics and Electric Machines (PEEM) subprogram within the DOE Vehicle Technologies Program (VTP) provides support and guidance for many cutting-edge automotive technologies now under development. Research is focused on developing revolutionary new power electronics (PE), electric motor (EM), and traction drive system technologies that will leapfrog current on-the-road technologies. The research and development (R&D) is also aimed at achieving a greater understanding of and improvements in the way the various new components of tomorrow's automobiles will function as a unified system to improve fuel efficiency. In supporting the development of advanced vehicle propulsion systems, the PEEM subprogram has enabled the development of technologies that will significantly improve efficiency, costs, and fuel economy. The PEEM subprogram supports the efforts of the U.S. DRIVE partnership through a three phase approach intended to: (1) identify overall propulsion and vehicle related needs by analyzing programmatic goals and reviewing industry
Directory of Open Access Journals (Sweden)
Jose Luiz Rodrigues Torres
2011-06-01
Full Text Available O cultivo do solo pode alterar alguns atributos físicos em relação ao solo não cultivado. Diante disso, neste estudo objetivou-se verificar as alterações provocadas pelos sistemas de uso do solo sobre alguns atributos físicos de um Latossolo Vermelho no Triângulo Mineiro. Os tratamentos utilizados foram: Campo nativo (CN (testemunha; preparo convencional do solo (PC; pastagem irrigada de braquiária sob pastejo rotacionado tipo VoIsin (PT e Semeadura direta (SD. Utilizou-se o delineamento inteiramente casualizado, com 4 repetições, onde foram avaliados os seguintes atributos físicos: densidade do solo (Ds, volume total de poros (VTP, microporosidade (MI, macroporosidade (MA, condutividade hidráulica saturada (Kθ, resistência mecânica do solo à penetração (RP e o índice de sensibilidade (Is. Nas áreas sob PC, SD e PT não foram observadas alterações significativas com relação aos atributos físicos avaliados. Para as profundidades avaliadas só ocorreram diferenças significativas entre as profundidades de 0,0 - 0,05 e a de 0,15 a 0,20 m para os parâmetros Ds e VTP. PC, SD, PT e CN apresentaram valores médios de volumes de MA próximos ou superiores daquele considerado ideal (0,33 dm-3dm-3. Apenas no CN não ocorreu valores maiores que 2 MPa. No CN, PC, e SD não ocorreram limitações ao desenvolvimento das culturas até a profundidade de 0,08 m. O Is calculado para os atributos CC e Kθ nos sistemas PC e PT demonstraram o efeito prejudicial desses sistemas de manejo sobre a estrutura do solo, quando comparados ao SD.The cultivation of the soil may alter some physical attributes compared to non cultivated soil. The objective of this study to verify changes caused by land use systems on some physical attributes of an Oxisol in the Triângulo Mineiro. The used treatments were: Native field (CN (control; Conventional preparation of the soil (PC; Irrigated pasture of brachiaria under pasture alternate (PT and Direct tillage
River-flow predictions for the South African mid-summer using a coupled general circulation model
CSIR Research Space (South Africa)
Olivier, C
2013-09-01
Full Text Available African Society for Atmospheric Sciences (SASAS) 2013 http://sasas.ukzn.ac.za/homepage.aspx 1 Tel: +27 12 367 6008 Fax: +27 12 367 6189 Email: cobus.olivier@weathersa.co.za RIVER-FLOW PREDICTIONS FOR THE SOUTH AFRICAN MID-SUMMER USING A COUPLED... for Atmospheric Sciences (SASAS) 2013 http://sasas.ukzn.ac.za/homepage.aspx 2 drops to 127 nationally and 65 stations for the area of interest. A recent coupled modeling system developed at the South African Weather Service (SAWS), that utilizes...
The "SignOn"-Model for Teaching Written Language to Deaf People
Directory of Open Access Journals (Sweden)
Marlene Hilzensauer
2012-08-01
Full Text Available This paper shows a method of teaching written language to deaf people using sign language as the language of instruction. Written texts in the target language are combined with sign language videos which provide the users with various modes of translation (words/phrases/sentences. As examples, two EU projects for English for the Deaf are presented which feature English texts and translations into the national sign languages of all the partner countries plus signed grammar explanations and interactive exercises. Both courses are web-based; the programs may be accessed free of charge via the respective homepages (without any download or log-in.
Promotion of HANARO Utilization for Year 2004
International Nuclear Information System (INIS)
Sohn, J. M.; Kim, Y. J.; Kim, H. R.
2005-06-01
To activate the HANARO utilization by expanding HANARO utilization fields, recruiting and training new users. In order to promote the HANARO utilization, the following activities have been performed. The neutron usage fee in HANARO, Achievements of HANARO utilization, Project for Activation of the Research using HANARO, Operation and Management of HANARO Homepage, HANARO Workshop 2004, Management of HANARO related committees, Training of HANARO users, Related activities of HANARO publicity. The related activities to activate HANARO utilization have been carried out successfully. This report summarized the detailed activities to activate the HANARO utilization. They will be useful for expanding HANARO utilization in the near future
Promotion of HANARO utilization for year 2003
International Nuclear Information System (INIS)
Sohn, J. M.; Park, K. B.; Kim, Y. J.
2004-06-01
To activate the HANARO utilization by expanding HANARO utilization fields, recruiting and training new users. In order to promote the HANARO utilization, the following activities have been performed. - The neutron usage fee in HANARO - Achievements of HANARO utilization - Project for Activation of the Research using HANARO - Management of HANARO Homepage - HANARO Workshop 2003 - Operation and Management of HANARO related committees - Training of HANARO users - Related activities of HANARO publicity. The related activities to activate HANARO utilization have been carried out successfully. This report summarized the detailed activities to activate the HANARO utilization. They will be useful for expanding HANARO utilization in the near future
Promotion of HANARO utilization for year 2002
International Nuclear Information System (INIS)
Sohn, J. M.; Park, K. B.; Kim, Y. J.
2003-06-01
Object and importance to activate the HANARO utilization by expanding HANARO utilization fields, recruiting and training new users. In order to promote the HANARO utilization, the following activities have been performed. The neutron usage fee in HANARO, Achievements of HANARO utilization, Project for activation of the research using HANARO, Management of HANARO homepage, Management of HANARO related committees, Training of HANARO users, Establishment of user-room, Related activities of HANARO publicity. The related activities to activate HANARO utilization have been carried out successfully. This report summarized the detailed activities to activate the HANARO utilization. They will be useful for expanding HANARO utilization in the near future
phangorn: phylogenetic analysis in R.
Schliep, Klaus Peter
2011-02-15
phangorn is a package for phylogenetic reconstruction and analysis in the R language. Previously it was only possible to estimate phylogenetic trees with distance methods in R. phangorn, now offers the possibility of reconstructing phylogenies with distance based methods, maximum parsimony or maximum likelihood (ML) and performing Hadamard conjugation. Extending the general ML framework, this package provides the possibility of estimating mixture and partition models. Furthermore, phangorn offers several functions for comparing trees, phylogenetic models or splits, simulating character data and performing congruence analyses. phangorn can be obtained through the CRAN homepage http://cran.r-project.org/web/packages/phangorn/index.html. phangorn is licensed under GPL 2.
American Farm Bureau Foundation for Agriculture - Homepage
Literacy? What We Do Resources Sustainable Agriculture Food and Farm Facts Free Resources & Lesson Agriculture Food and Farm Facts Free Resources & Lesson Plans Bringing Biotech to Life Learn About Beef and their families about agriculture at the USA Science & Engineering Festival in April. Read More
WebVis: a hierarchical web homepage visualizer
Renteria, Jose C.; Lodha, Suresh K.
2000-02-01
WebVis, the Hierarchical Web Home Page Visualizer, is a tool for managing home web pages. The user can access this tool via the WWW and obtain a hierarchical visualization of one's home web pages. WebVis is a real time interactive tool that supports many different queries on the statistics of internal files such as sizes, age, and type. In addition, statistics on embedded information such as VRML files, Java applets, images and sound files can be extracted and queried. Results of these queries are visualized using color, shape and size of different nodes of the hierarchy. The visualization assists the user in a variety of task, such as quickly finding outdated information or locate large files. WebVIs is one solution to the growing web space maintenance problem. Implementation of WebVis is realized with Perl and Java. Perl pattern matching and file handling routines are used to collect and process web space linkage information and web document information. Java utilizes the collected information to produce visualization of the web space. Java also provides WebVis with real time interactivity, while running off the WWW. Some WebVis examples of home web page visualization are presented.
We've Got to Work Collaboratively! Homepage
Hawkins, Brian L.
2005-01-01
According to the recent ECAR report "IT Funding in Higher Education," nearly two-thirds of all campuses are facing budget cuts of some form or another. The study incorporated the results of surveys of higher education CIOs and CFOs, who were asked about their strategies for raising revenues and reducing costs in order to deal with these budget…
Directory of Open Access Journals (Sweden)
LADOSKY WALDEMAR
2001-01-01
Full Text Available Em revisão de 1991, a American Thoracic Society (ATS recomenda que cada região defina equações próprias para obtenção dos valores teóricos (VTs dos parâmetros espirométricos, que traduzam a realidade funcional para a população local. Quando dessa recomendação, os EUA já dispunham de diversos sistemas de equações próprios, bem como a Comunidade Européia e a Polônia em particular. Em 1992, Pereira et al., analisando 4.200 espirogramas de brasileiros normais, encontraram VT para capacidade vital forçada (CVF, volume expiratório forçado de 1 seg. (VEF1 e de fluxo expiratório médio (FEF25-75 diferentes dos descritos pelos autores americanos e europeus. Este estudo foi realizado para comparar as equações de Pereira et al., desenvolvida a partir de amostra de população brasileira, e as americanas de Knudson et al., bastante utilizadas em nosso meio. Foi também investigada a conseqüente influência nos laudos espirométricos, quando uma ou outra é empregada. Foram analisados 1.070 espirogramas de pacientes de ambos os sexos (389 homens e 681 mulheres que vieram ao serviço para avaliação funcional de rotina. Não foi excluída qualquer patologia nem levada em conta a situação tabágica do paciente. Para cada paciente foi feito o cálculo do VT para CVF, VEF1 e FEF25-75 segundo as equações de Pereira (VT-P e de Knudson 1983 (VT-K e comparados as médias, desvios padrões e os laudos obtidos por um e por outro. Os VT-K para a CVF foram de 4,01% [p < 0,005] maiores entre as mulheres, levando a sobrevalorização das restrições respiratórias, mas entre os homens não houve diferença relevante. Quanto à VEF1, os VT-P foram superiores tanto em homens (4,76% [p < 0,005] como em mulheres (5,04% [p < 0,05], levando a maior sensibilidade na identificação de obstruções respiratórias. Não se observou diferença relevante entre os VT-P e VT-K para o FEF25-75 em nenhum dos sexos.
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
Items of information were collected on development of technologies to put photovoltaic power generation systems into practical use, the international cooperation projects, and the IEA photovoltaic power generation program. This paper summarizes the achievements in fiscal 1999. In the activities of IEA/REWP/PVPS in the current fiscal year, the 13th and 14th Executive Committee meetings, and the 3rd Executive Conference were held. The Task 1 has performed such activities as ISR, NSR, Newsletters, and opening the Internet homepage. The Task 2 activities included structuring about 260 databases for the operation characteristics of photovoltaic power generation systems, and completing the internal material handbooks on measurement and monitoring. A new work plan was prepared for the Task 3 regarding an independent photovoltaic power generation plant for use in an island. For the building integrated photovoltaic power generation system in the Task 7, survey activities were executed by utilizing expertise conferences on building designs, system technologies, and non-technical impediments. In the feasibility survey and research on large-scale photovoltaic power generation utilizing unused land such as desert for the Task 8, the programs were established. (NEDO)
Internet usage and potential impact for acute care hospitals: survey in the United States.
Hatcher, M
1998-12-01
These survey results are from a national survey of acute care hospitals. A random sample of 813 hospitals was selected with 115 responding and 33 incorrect addresses resulting in a 15% response rate. The purpose of the study was to measure the extent of information systems integration in the financial, medical, and administrative systems of the hospitals. Internet usage including homepages and advertising was measured. Other selected telecommunication applications are analyzed. As demonstration projects from the literature are compared to the survey results, the potential for hospitals is tremendous. Resulting cost savings could be equally impressive. This information will provide a benchmark for hospitals to determine their position relative to Internet technology and to set goals.
Farhat, Naim; Zoeller, Christoph; Petersen, Claus; Ure, Benno
2016-08-01
Introduction The presentation of health institutions in the internet is highly variable concerning marketing features and medical information. We aimed to investigate the structure and the kind of information provided on the Web sites of all departments of pediatric surgery in Germany. Furthermore, we aimed to identify the degree to which these Web sites comply with internet marketing recommendations for generating business. Method The Web sites of all pediatric surgery units referred to as departments on the official Web site of the German Society of Pediatric Surgery (GSPS) were assessed. The search engine Google was used by entering the terms "pediatric surgery" and the name of the city. Besides general data eight content characteristics focusing on ranking, accessibility, use of social media, multilingual sites, navigation options, selected images, contact details, and medical information were evaluated according to published recommendations. Results A total of 85 departments of pediatric surgery were included. On Google search results 44 (52%) ranked number one and 34 (40%) of the department's homepages were accessible directly through the homepage link of the GSPS. A link to own digital and/or social media was offered on 11 (13%) homepages. Nine sites were multilingual. The most common navigation bar item was clinical services on 74 (87%) homepages. Overall, 76 (89%) departments presented their doctors and 17 (20%) presented other staff members with images of doctors on 53 (62%) and contact data access from the homepage on 68 (80%) Web sites. On 25 (29%) Web sites information on the medical conditions treated were presented, on 17 (20%) details of treating concepts, and on 4 (5%) numbers of patients with specific conditions treated in the own department per year. Conclusion We conclude that numerous of the investigated online presentations do not comply with recommended criteria for offering professional information for patients and for promoting
Project report - an overview of the project and experiences with project management
DEFF Research Database (Denmark)
Jørgensen, Michael Søgaard; Mikkelsen, Bent Egberg
1996-01-01
A collection of the project planning and the experiences with project management from the Catering 2000 project.As appendieces articles etc. from journals, newspapers etc. about the project.......A collection of the project planning and the experiences with project management from the Catering 2000 project.As appendieces articles etc. from journals, newspapers etc. about the project....
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-03-01
Described herein are the results of examination and promotion of measures to obtain international understanding and cooperation, and examination and development of measures to promote international exchange of technical information, conducted in the FY 1998 continuously from the previous year, with the object to realize the International Clean Energy Network Using Hydrogen Conversion (WE-NET) project. In the FY 1998, the English version of the 1997 annual summary report was distributed to a total of about 150 overseas organizations. The WE-NET project activities were presented to the 12th World Hydrogen Energy Conference, International Joint Power Generation Conference held in 1998 by American Society of Mechanical Engineers, and 2nd International Symposium on Advanced Energy Conversion Systems and Related Technologies. For the examination and development of measures to promote international exchange of technical information, the contracting party of Japan for the Hydrogen Implementation Agreement with IEA has been shifted from the government of Japan to NEDO. NEDO has been representing Japan for various workshops on the tasks. The hydrogen projects conducted by Germany and USA were also surveyed. The WE-NET project homepage was opened in June, 1998. (NEDO)
One project`s waste is another project`s resource
Energy Technology Data Exchange (ETDEWEB)
Short, J.
1997-02-01
The author describes the efforts being made toward pollution prevention within the DOE complex, as a way to reduce overall project costs, in addition to decreasing the amount of waste to be handled. Pollution prevention is a concept which is trying to be ingrained into project planning. Part of the program involves the concept that ultimately the responsibility for waste comes back to the generator. Parts of the program involve efforts to reuse materials and equipment on new projects, to recycle wastes to generate offsetting revenue, and to increase awareness, accountability and incentives so as to stimulate action on this plan. Summaries of examples are presented in tables.
Renewing library Web sites CMS at libraries
Vida, A
2006-01-01
The use of the Internet has a ten-year history in Hungary. In the beginning, users were surfing on textual Web sites with the browser Lynx (1991), then a range of graphic browsers appeared: Mosaic (1993) , Netscape (1994), and finally Internet Explorer (1995). More and more institutions, including libraries decided to enter the World Wide Web with their own homepage. The past ten years have brought enormous changes and new requirements in the way that institutional homepages are designed. This article offers an overview of the development phases of Web sites, presents the new tools necessary for the state-of-the-art design and gives advice on their up-to-date maintenance.
Well data summary sheets. Vol. 33: North sea wells
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-12-31
This 33rd volume of the `Well Data Summary sheets` includes data from seven recently released offshore wells from the North Sea. The wells Baron-2, S.E. Adda-1 and Skjold Flank-1 were presented in our `Well Data Summary Sheets, special volume`, published May 1, 1997. In volume 33, the wells Baron-2 and Skjold Flank-1 are updated with respect to information on sidewall cores. Information regarding all released well data, included in our well data summary sheets, are available on GEUS homepage: http://www.geus.dk/ or the departments homepage: http://www.geus.dk/departments/geol-info-data-centre/geoldata.htm/. A complete index of releases wells in volumes 17-33 is included. (au)
diArk – a resource for eukaryotic genome research
Directory of Open Access Journals (Sweden)
Kollmar Martin
2007-04-01
Full Text Available Abstract Background The number of completed eukaryotic genome sequences and cDNA projects has increased exponentially in the past few years although most of them have not been published yet. In addition, many microarray analyses yielded thousands of sequenced EST and cDNA clones. For the researcher interested in single gene analyses (from a phylogenetic, a structural biology or other perspective it is therefore important to have up-to-date knowledge about the various resources providing primary data. Description The database is built around 3 central tables: species, sequencing projects and publications. The species table contains commonly and alternatively used scientific names, common names and the complete taxonomic information. For projects the sequence type and links to species project web-sites and species homepages are stored. All publications are linked to projects. The web-interface provides comprehensive search modules with detailed options and three different views of the selected data. We have especially focused on developing an elaborate taxonomic tree search tool that allows the user to instantaneously identify e.g. the closest relative to the organism of interest. Conclusion We have developed a database, called diArk, to store, organize, and present the most relevant information about completed genome projects and EST/cDNA data from eukaryotes. Currently, diArk provides information about 415 eukaryotes, 823 sequencing projects, and 248 publications.
Project Success in IT Project Management
Siddiqui, Farhan Ahmed
2010-01-01
The rate of failed and challenged Information Technology (IT) projects is too high according to the CHAOS Studies by the Standish Group and the literature on project management (Standish Group, 2008). The CHAOS Studies define project success as meeting the triple constraints of scope, time, and cost. The criteria for project success need to be agreed by all parties before the start of the project and constantly reviewed as the project progresses. Assessing critical success factors is another ...
Vague project start makes project success of outsourced software development projects uncertain
Savolainen, Paula
2010-01-01
peer-reviewed A definition of a project success includes at least three criteria: 1) meeting planning goals, 2) customer benefits, and 3) supplier benefits. This study aims to point out the importance of the definition of the project start, the project start date, and what work should be included in the project effort in order to ensure the supplier's benefits. The ambiguity of the project start risks the profitability of the project and therefore makes project success at least from suppli...
Project management: a case of fixed price IS/IT projects. Analysis of projects by project scopes
Directory of Open Access Journals (Sweden)
Miroslav Kral
2012-10-01
Full Text Available The paper provides an overview of major issues of IS / IT projects. Attention will be focused on projects that are implemented under a contract for a specified amount of work and fixed price. The main purpose of the paper is to analyse the project parameters in terms of the types of projects, and to confirm, or refuse, a hypothesis related to this. There is some evidence from the portfolio of projects that have been implemented by the international companies providing IT services. Regarding the localisation, CEE region was selected for our research. The outputs of the paper should be a contribution to managing IS/IT projects in IT service delivery organizations and for the support of innovative thinking about project management generally.
Directory of Open Access Journals (Sweden)
Mowinckel Petter
2009-09-01
Full Text Available Abstract Background Chronic rheumatic diseases are painful conditions which are not entirely controllable and can place high emotional demands on individuals. Increasing evidence has shown that emotion regulation in terms of actively processing and expressing disease-related emotions are likely to promote positive adjustment in patients with chronic diseases. The Emotional Approach Coping Scale (EAC measures active attempts to acknowledge, understand, and express emotions. Although tested in other clinical samples, the EAC has not been validated for patients with rheumatic diseases. This study evaluated the data quality, internal consistency reliability, validity and responsiveness of the Norwegian version of the EAC for this group of patients. Methods 220 patients with different rheumatic diseases were included in a cross-sectional study in which data quality and internal consistency were assessed. Construct validity was assessed through comparisons with the Brief Approach/Avoidance Coping Questionnaire (BACQ and the General Health Questionnaire (GHQ-20. Responsiveness was tested in a longitudinal pretest-posttest study of two different coping interventions, the Vitality Training Program (VTP and a Self-Management Program (SMP. Results The EAC had low levels of missing data. Results from principal component analysis supported two subscales, Emotional Expression and Emotional Processing, which had high Cronbach's alphas of 0.90 and 0.92, respectively. The EAC had correlations with approach-oriented items in the BACQ in the range 0.17-0.50. The EAC Expression scale had a significant negative correlation with the GHQ-20 of -0.13. As hypothesized, participation in the VTP significantly improved EAC scores, indicating responsiveness to change. Conclusion The EAC is an acceptable and valid instrument for measuring emotional processing and expression in patients with rheumatic diseases. The EAC scales were responsive to change in an intervention
Bosch-Rekveldt, M.G.C.
2011-01-01
Engineering projects become increasingly more complex and project complexity is assumed to be one of the causes for projects being delivered late and over budget. However, what this project complexity actually comprised of was unclear. To improve the overall project performance, this study focuses
This page provides information about Local Individual Estuary Programs including links to their NEP homepages, social media, Comprehensive Conservation and Management Plans, and state of the bay reports.
Spent Nuclear Fuel project, project management plan
International Nuclear Information System (INIS)
Fuquay, B.J.
1995-01-01
The Hanford Spent Nuclear Fuel Project has been established to safely store spent nuclear fuel at the Hanford Site. This Project Management Plan sets forth the management basis for the Spent Nuclear Fuel Project. The plan applies to all fabrication and construction projects, operation of the Spent Nuclear Fuel Project facilities, and necessary engineering and management functions within the scope of the project
Managing projects using a project management approach
Directory of Open Access Journals (Sweden)
Marko D. Andrejić
2011-04-01
Full Text Available Modern management theory treats all complex tasks and duties like projects and make these projects possible to be managed by a particular organizational-management concept in order to achieve a goal effectively. A large number of jobs and tasks performed in the system of defense or for defense purposes have the characteristics of projects. Project management is both a skill and a science of monitoring human, material, financial, energy and other resources to achieve required objectives within the given limits: deadlines, time, budget, possibility of realization and the satisfaction of the interests of all project participants. Project management is a traditional area of applied (or functional management focused on managing complex and uncertain situations with defined goals. Introduction In conditions of rapid change and high uncertainty, only adaptive organizations survive, i. e. those that are able not only to react quickly to changes but also to proactively take advantage of changes. Development of project management The biggest influence on the development of the area had complex jobs within the engineering profession. In parallel with the traditional approach new approaches began to develop, while the traditional one still remained in use. Contrary to the traditional engineering approach, a dynamic model first developed in order to respond to demands for greater control of costs. Project management Project management is a skill and knowledge of human and material resources to achieve set objectives within prescribed limits: deadlines, time, budget, possibility of realization, and the satisfaction of all participants in the project. In order to realize a project effectively, it is necessary to manage it rationally. Planning and project management A project plan is a document that allows all team members insight on where to go, when to start and when to arrive, what is necessary to be done in order to achieve the project objectives and what
International Journal of Agriculture and Rural Development
African Journals Online (AJOL)
Journal Homepage Image. The International Journal of Agricultureand Rural Development (IJARD) is an International Journal designed to provide ... Forestry and Wildlife resources, Soil Science, Agricultural Engineering and Food Processing.
GUMICS4 Synthetic and Dynamic Simulations of the ECLAT Project
Facsko, G.; Palmroth, M. M.; Gordeev, E.; Hakkinen, L. V.; Honkonen, I. J.; Janhunen, P.; Sergeev, V. A.; Kauristie, K.; Milan, S. E.
2012-12-01
The European Commission funded the European Cluster Assimilation Techniques (ECLAT) project as a collaboration of five leader European universities and research institutes. A main contribution of the Finnish Meteorological Institute (FMI) is to provide a wide range of global MHD runs with the Grand Unified Magnetosphere Ionosphere Coupling simulation (GUMICS). The runs are divided in two categories: synthetic runs investigating the extent of solar wind drivers that can influence magnetospheric dynamics, as well as dynamic runs using measured solar wind data as input. Here we consider the first set of runs with synthetic solar wind input. The solar wind density, velocity and the interplanetary magnetic field had different magnitudes and orientations; furthermore two F10.7 flux values were selected for solar radiation minimum and maximum values. The solar wind parameter values were constant such that a constant stable solution was archived. All configurations were run several times with three different (-15°, 0°, +15°) tilt angles in the GSE X-Z plane. The Cray XT supercomputer of the FMI provides a unique opportunity in global magnetohydrodynamic simulation: running the GUMICS-4 based on one year real solar wind data. Solar wind magnetic field, density, temperature and velocity data based on Advanced Composition Explorer (ACE) and WIND measurements are downloaded from the OMNIWeb open database and a special input file is created for each Cluster orbit. All data gaps are replaced with linear interpolations between the last and first valid data values before and after the data gap. Minimum variance transformation is applied for the Interplanetary Magnetic Field data to clean and avoid the code of divergence. The Cluster orbits are divided into slices allowing parallel computation and each slice has an average tilt angle value. The file timestamps start one hour before the perigee to provide time for building up a magnetosphere in the simulation space. The real
Directory of Open Access Journals (Sweden)
Aurelio Lopez
2015-01-01
Full Text Available We report the characteristics of relapse, treatment response, and outcomes of 145 elderly patients with multiple myeloma in first relapse after front-line treatment with VMP or VTP. Reappearance of CRAB symptoms (113 patients and more aggressive forms of disease (32 patients were the most common patterns of relapse. After second-line therapy, 75 (51.7% patients achieved at partial response and 16 (11% complete response (CR. Overall survival was longer among patients receiving VMP as front-line induction (21.4 vs. 14.4 months, P=0.037, in patients achieving CR (28.3 vs. 14.8 months; P=0.04, and in patients without aggressive relapse (28.6 vs. 7.6 months; P=0.0007.
Lopez, Aurelio; Mateos, Maria-Victoria; Oriol, Albert; Valero, Marta; Martínez, Joaquín; Lorenzo, Jose Ignacio; Perez, Montserrat; Martinez, Rafael; de Paz, Raquel; Granell, Miguel; De Arriba, Felipe; Blanchard, M. Jesús; Peñalver, Francisco Javier; Bello, Jose Luis; Martin, Maria Luisa; Bargay, Joan; Blade, Joan; Lahuerta, Juan Jose; San Miguel, Jesús F.; de la Rubia, Javier
2015-01-01
We report the characteristics of relapse, treatment response, and outcomes of 145 elderly patients with multiple myeloma in first relapse after front-line treatment with VMP or VTP. Reappearance of CRAB symptoms (113 patients) and more aggressive forms of disease (32 patients) were the most common patterns of relapse. After second-line therapy, 75 (51.7%) patients achieved at partial response and 16 (11%) complete response (CR). Overall survival was longer among patients receiving VMP as front-line induction (21.4 vs. 14.4 months, P=0.037), in patients achieving CR (28.3 vs. 14.8 months; P=0.04), and in patients without aggressive relapse (28.6 vs. 7.6 months; P=0.0007). PMID:26500850
Beukers, Margot W
2011-02-01
Thirty-four project managers of life-science research projects were interviewed to investigate the characteristics of their projects, the challenges they faced and their training requirements. A set of ten discriminating parameters were identified based on four project categories: contract research, development, discovery and call-based projects--projects set up to address research questions defined in a call for proposals. The major challenges these project managers are faced with relate to project members, leadership without authority and a lack of commitment from the respective organization. Two-thirds of the project managers indicated that they would be interested in receiving additional training, mostly on people-oriented, soft skills. The training programs that are currently on offer, however, do not meet their needs. Copyright © 2010 Elsevier Ltd. All rights reserved.
Global Journal of Agricultural Sciences
African Journals Online (AJOL)
Journal Homepage Image. Global Journal of Agricultural Sciences is aimed at promoting research in all areas of Agricultural Sciences including Animal Production, Fisheries, Agronomy, Processing and Agricultural Mechanization. Related ...
Additional considerations for gastro-oesophageal reflux disease
African Journals Online (AJOL)
assisting patients, physicians and regulatory authorities. The new definition ... tract symptoms, but patients mainly present with heartburn and regurgitation. Various .... PubMed [homepage on the Internet]. ... Relationship between symptom load.
African Journals Online (AJOL)
damage or inflammation, like fibromyalgia, tension headaches .... This group includes the following examples: codeine, morphine, oxycodone ... insufficient evidence to support a preference of one opioid ..... [Homepage on internet]. Available ...
2012-08-20
... application electronically and select the ``Find Grant Opportunities'' link on the homepage. Download a copy... routine education, library, day care, health care, or early childhood development services are provided to...
Professionalism and Commercialism on Cosmetic Surgeons' Websites.
Park, Sung-Yeon; Park, SangHee
2017-07-01
This study analyzed the homepages of 250 cosmetic surgeons' websites by focusing on the representation of cosmetic surgery providers, cosmetic surgery recipients, and cosmetic surgery practice itself. Based on a literature review, some common elements of the webpages were preidentified as the indicators of professionalism or commercialism. Subsequently, each homepage was scrutinized for their presence and salience. Overall, cosmetic surgeons' websites were high in professionalism and low in commercialism in their representation of the service providers. In depicting the recipients, the websites were moderate in both professionalism and commercialism. The representation of practice was low in professionalism and moderate in commercialism. Implications of these findings for doctors, regulators, and consumer advocates are discussed and directions for future research are proposed.
Impact of Project Leadership Facets on Project Outcome
Directory of Open Access Journals (Sweden)
Arslan Ayub
2015-08-01
Full Text Available The study analyzes the role of project leadership facets on effective project outcome. Numerous such initiatives have already been taken on project outcome/performance in the context of apposite leadership styles or project management. However, the current study is unique in the milieu of project outcome that it introduces a new leadership approach, which throws light on the significance of variant leadership facets on project outcome. The study uses explanatory approach; primary data is collected from project management professionals working in different project organizations. The study uses structural equation model (SEM technique to test the hypothesis. The study found a positive relationship between project leadership facets and project outcome.
Journal of Ethiopian Medical Practice
African Journals Online (AJOL)
Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives. Journal Homepage Image. A biannual scientific journal published by the Ethiopian Society of General Medical Practice ...
Global Approaches to Extension Practice: A Journal of Agricultural ...
African Journals Online (AJOL)
Journal Homepage Image ... from all areas of Agricultural Extension: rural sociology, environmental extension, extension communication ... Adoption of improved oil palm processing technology in Umuahia north local government area of Abia ...
Project management in practice : Evaluating a case project through project management theories
Uusitalo, Jenni
2013-01-01
The purpose of this thesis was to evaluate a case project and to study whether it was carried out in a correct manner; meaning that did the case project follow the project management models. In addition, part of the study was to determine what could have been improved in the management of the case project. The case project was about creating and launching a communication channel based on a social media service, on a blog platform called Tumblr, for Team Finland in Spain network. The network p...
Skin Exposures & Effects in the Workplace
... YouTube NIOSH Homepage NIOSH A-Z Workplace Safety & Health Topics Publications and ... Dermatitis Overview It is estimated that more than 13 million workers in the United States are potentially exposed to ...
Nigerian Journal of Guidance and Counselling
African Journals Online (AJOL)
The Nigerian Journal of Guidance and Counselling. ... Journal Homepage Image ... by the Department of Counsellor Education, University of Ilorin, Ilorin, Nigeria. ... Awareness and use of Meseron therapy among clinical psychologists in ...
2011-01-31
... EPA's public docket visit the EPA Docket Center homepage at http://www.epa.gov/epahome/dockets.htm... Library, EPA West Building, Room 3334, located at 1301 Constitution Avenue, NW., Washington, DC. The...
From project management to project leadership
Braun, F.; Avital, M.
2010-01-01
It is virtually a truism that good leadership practices can help project managers with attaining the desired project outcome. However, a better understanding of which leadership practices enable project managers to be more effective warrants further investigation. Subsequently, in this study, we
Ace Project as a Project Management Tool
Cline, Melinda; Guynes, Carl S.; Simard, Karine
2010-01-01
The primary challenge of project management is to achieve the project goals and objectives while adhering to project constraints--usually scope, quality, time and budget. The secondary challenge is to optimize the allocation and integration of resources necessary to meet pre-defined objectives. Project management software provides an active…
Iyer, Gokul; Ledna, Catherine; Clarke, Leon; Edmonds, James; McJeon, Haewon; Kyle, Page; Williams, James H.
2018-03-01
In the version of this Article previously published, technical problems led to the wrong summary appearing on the homepage, and an incorrect Supplementary Information file being uploaded. Both errors have now been corrected.
Maintaining Indoor Environmental Quality (IEQ) during Construction and Renovation
... Safety Construction Safety and Health Emergency Preparedness for Business Occupational Respiratory Disease Surveillance (ORDS) Office Environment Storm and Flood Cleanup Tuberculosis Follow NIOSH Facebook Flickr Pinterest Twitter YouTube NIOSH Homepage NIOSH A- ...
Workplace Safety: Indoor Environmental Quality
... Safety Construction Safety and Health Emergency Preparedness for Business Occupational Respiratory Disease Surveillance (ORDS) Office Environment Storm and Flood Cleanup Tuberculosis Follow NIOSH Facebook Flickr Pinterest Twitter YouTube NIOSH Homepage NIOSH A- ...
2013-01-04
... EPA's public docket visit the EPA Docket Center homepage at http://www.epa.gov/epahome/dockets.htm... Library, EPA West Building, Room 3334, located at 1301 Constitution Avenue NW., Washington, DC. The Public...
International Nuclear Information System (INIS)
Feng Cunfang; Guan Wei; Wang Yinghai
2013-01-01
We investigate different types of projective (projective-anticipating, projective and projective-lag) synchronization in unidirectionally nonlinearly coupled time-delayed chaotic systems with variable time delays. Based on the Krasovskii–Lyapunov approach, we find both the existence and sufficient stability conditions, using a general class of time-delayed chaotic systems related to optical bistable or hybrid optical bistable devices. Our method has the advantage that it requires only one nonlinearly coupled term to achieve different types of projective synchronization in time-delayed chaotic systems with variable time delays. Compared with other existing works, our result provides an easy way to achieve projective-anticipating, projective and projective-lag synchronization. Numerical simulations of the Ikeda system are given to demonstrate the validity of the proposed method. (paper)
Project Success in Agile Development Software Projects
Farlik, John T.
2016-01-01
Project success has multiple definitions in the scholarly literature. Research has shown that some scholars and practitioners define project success as the completion of a project within schedule and within budget. Others consider a successful project as one in which the customer is satisfied with the product. This quantitative study was conducted…
An IS Project Management Course Project
Frank, Ronald L.
2010-01-01
Information Systems curricula should provide project management (PM) theory, current practice, and hands-on experience. The schedule usually does not allow time in Analysis and Design courses for development oriented project management instruction other than a short introduction. Similarly, networking courses usually don't put project management…
Evaluation of Project Achievements in VOMARE -project
Kokkarinen, Eeva
2011-01-01
The purpose of the thesis is to study the achievements of VOMARE –project from the Finnish Lifeboat Institutions perspective. The organisation is a roof organisation for voluntary maritime rescue operation in Finland. The Finnish Lifeboat Institution is a lead partner in VOMARE –project which is EU funded project and the aim of the project is to start voluntary rescue operations in Estonia. The theoretical part of the work is divided into two main categories; project management and planni...
Leading global projects for professional and accidental project leaders
Moran, Robert T
2008-01-01
This book is a must-read for anyone responsible for projects and initiatives that span functional and geographical divides. Authors Moran and Youngdahl bring extensive experience and learning from industry practice to present a clear and straightforward treatment of the leadership skills and knowledge required to lead projects that are global in nature. They have written the first book of its kind to address the three essential skills of global project leaders - strategic project management, project leadership, and cross-cultural leadership. The authors argue that global project leadership is an essential skill in our project-based world and that we are all either intentional or accidental project leaders. Intentional project leaders pursue formal project management education and even certification whereas accidental project leaders find themselves leading global projects and initiatives as a result of a special assignment or promotion. Moran and Youndahl have found that the vast majority of global projects ...
Energy efficient mini bars in hotel rooms; Energieffektive minibarer til hotelvaerelser
Energy Technology Data Exchange (ETDEWEB)
NONE
2005-12-15
The project 'Energy-efficient mini bars for hotel rooms' is carried out from February December 2005. The project is financed by Elfor's PSO funds and also by the participants in the project, HORESTA and Teknologisk Institut. Mini bars consume up to 10% of the total electricity costs of a hotel. Therefore, the energy consumption of mini bars has been brought into focus in this project. The existing mini bar market has been analysed and measurements have been carried out on the type of mini bars that are used most often. In that way, energy consumption, net volume, energy efficiency, energy labelling, noise level and cooling capacity have been determined. In the course of the project, mini bars from IndelB, Domestic and Vibocold have been tested. With regard to energy consumption, the test results showed large deviations from the consumption stated by the manufacturer. Only 1 of the 6 tested mini bars received an energy label B - the others were labelled with F or G. Therefore, there is a great potential for developing more energy efficient mini bars. A list covering the energy consumption, energy labelling, noise level etc. of the tested mini bars and a guide to new purchases can be found on HORESTA's homepage www.horesta.dk. (au)
Prioritising Project Scope Definition Elements in Public Building Projects
Directory of Open Access Journals (Sweden)
Mohammed K Fageha
2014-09-01
Full Text Available A complete definition of the scope of a project upfront during early stages ensures smooth and successful implementation during the project execution. This research identifies and prioritises project scope definition elements for public buildings in Saudi Arabia. Elements that could significantly contribute to complete project scope definition package at pre-project planning stage are identified and their interrelationship determined and prioritised. Using the Project Definition Rating Index (PDRI as a basis, the study uses analytical network process (ANP technique based on data obtained from project managers who have been involved in public sector projects in Saudi Arabia. Data collection and analysis was conducted in three steps. The first step involved identification of scope definition elements while the second involved an investigation into interrelationships among the elements. In the third step, ANP was used to determine the weight of the elements’ importance in terms of contribution to project scope definition completeness. Finally, Pareto analysis was used to prioritise and assess the distribution pattern of the elements. The outcome from this research is the prioritisation of project scope definition elements for public building projects in Saudi Arabia. The prioritised list developed indicates the importance of project scope definition elements. It should help project management teams identify elements to consider when evaluating project scope definition for completeness at the pre-project planning stage. Keywords: Project scope definition, pre-project planning, prioritising, public building projects, Saudi Arabia, Analytical Network Process (ANP
The application of project management in construction projects ...
African Journals Online (AJOL)
Project management is critical for successful project development. A crucial responsibility of the project manager is ensuring that the client is certified and the scope of work is of high quality, within the agreed budget and time frame. In some way, project financing is completed from the time of project conception. Indeed ...
... Foodborne, Waterborne, and Environmental Diseases Mycotic Diseases Branch Candidiasis Recommend on Facebook Tweet Share Compartir Photomicrograph of ... topics, visit the fungal diseases homepage. Types of Candidiasis Candida infections of the mouth, throat, and esophagus ...
... Submit Search The CDC Chronic Obstructive Pulmonary Disease (COPD) Note: Javascript is disabled or is not supported ... message, please visit this page: About CDC.gov . COPD Homepage Data and Statistics Fact Sheets Publications Publications ...
2010-04-14
... Docket Center homepage at http://www.epa.gov/epahome/dockets.htm . FOR FURTHER INFORMATION CONTACT: David... person viewing at the Air Docket in the Docket Center (EPA/DC), EPA West, EPA Headquarters Library, Room...
2010-04-02
... additional information about EPA's public docket visit the EPA Docket Center homepage at http://www.epa.gov... flooding and reopened in the EPA Headquarters Library, Infoterra Room (Room 3334), in the EPA West Building...
Perspectives on projects, project success and team work
Thompson, Karen
2015-01-01
This paper brings together perspectives on projects, project success and team work as a background to two graphical tools for considering project success and individual capabilities for working in a project team.
University of Virginia open-quotes virtualclose quotes reactor facility tours
International Nuclear Information System (INIS)
Krause, D.R.; Mulder, R.U.
1995-01-01
An electronic information and tour book has been constructed for the University of Virginia reactor (UVAR) facility. Utilizing the global Internet, the document resides on the University of Virginia World Wide Web (WWW or W) server within the UVAR Homepage at http://www.virginia. edu/∼reactor/. It is quickly accessible wherever an Internet connection exists. The UVAR Homepage files are accessed with the hypertext transfer protocol (http) prefix. The files are written in hypertext markup language (HTML), a very simple method of preparing ASCII text for W3 presentation. The HTML allows use of various hierarchies of headers, indentation, fonts, and the linking of words and/or pictures to other addresses-uniform resource locators. The linking of texts, pictures, sounds, and server addresses is known as hypermedia
JEWEL 2.0.0: directions for use
International Nuclear Information System (INIS)
Zapp, Korinna
2014-01-01
In this publication the first official release of the Jewel 2.0.0 code [The first version Jewel 1 (Zapp et al. in Eur Phys J C 60:617, 2009) could only treat elastic scattering explicitly and the code was never published, The code can be downloaded from the official Jewel homepage http://jewel.hepforge.org] is presented. Jewel is a Monte Carlo event generator simulating QCD jet evolution in heavy-ion collisions. It treats the interplay of QCD radiation and re-scattering in a medium with fully microscopic dynamics in a consistent perturbative framework with minimal assumptions. After a qualitative introduction into the physics of Jewel detailed information about the practical aspects of using the code is given. The code is available from the official Jewel homepage http://jewel.hepforge.org. (orig.)
JEWEL 2.0.0: directions for use
Energy Technology Data Exchange (ETDEWEB)
Zapp, Korinna [CERN, Theory Unit, Department of Physics, Geneva 23 (Switzerland)
2014-02-15
In this publication the first official release of the Jewel 2.0.0 code [The first version Jewel 1 (Zapp et al. in Eur Phys J C 60:617, 2009) could only treat elastic scattering explicitly and the code was never published, The code can be downloaded from the official Jewel homepage http://jewel.hepforge.org] is presented. Jewel is a Monte Carlo event generator simulating QCD jet evolution in heavy-ion collisions. It treats the interplay of QCD radiation and re-scattering in a medium with fully microscopic dynamics in a consistent perturbative framework with minimal assumptions. After a qualitative introduction into the physics of Jewel detailed information about the practical aspects of using the code is given. The code is available from the official Jewel homepage http://jewel.hepforge.org. (orig.)
Project Management Yinyang: Coupling project success and client satisfaction
Directory of Open Access Journals (Sweden)
Greg Stewart Usher
2017-06-01
Full Text Available Our research applies paradox theory to a project management construct to help project management researchers and practitioners understand the tensions that can exist between project success and client satisfaction. Our research highlights that although project success and client satisfaction are both present within a project management construct, they also belong to different functional systems. Project success and client satisfaction have different systemic-discourses and use different language games to convey information. These distinctions can create latent and sometimes salient tensions within the project management construct that project managers must understand, embrace, and work with. We have used a Grounded Theory (GT methodology to explore the lived experience of project managers, and from this have identified a phenomenon which we have termed project management yinyang. Project management yinyang is the state that exists when both project success and Client satisfaction are tightly coupled within the project management construct. Project management yinyang highlights that these two phenomena cannot be viewed as separate elements because the ‘seed’ of each exists within the other. And to truly achieve one, you must also achieve the other. Our findings indicate that in order to create project management yinyang the project manager must embrace a paradoxical yet holistic philosophy. They must understand the complementarity, interdependency, and structural coupling that exists between the positivist and interpretivist paradigms within the project management construct. They must understand how satisfaction (Yin and success (Yang are created through focus. Furthermore, they must understand how project management yinyang is separate from, but borne from, the convergence of the other two elements.
Quality Assurance Project Plan for Citizen Science Projects
The Quality Assurance Project Plan is necessary for every project that collects or uses environmental data. It documents the project planning process and serves as a blueprint for how your project will run.
Laëtitia Pedroso
2010-01-01
Before, you had to go on the TPG website to find a tram-route, use Google Maps to see an aerial photo of CERN, and look for CERN buildings on map.web.cern.ch. Now, that's ancient history, with a new Geographical Information System (GIS) Portal set up by the Design Office and Patrimony Service (GS/SEM/DOP). It's a one-stop-shop for all this information and much more. A screenshot of the GIS Portal. Over the past few days, you might have noticed the new interface called MAPSearch that pops up when you make a building search using the Building and Roads field on the CERN homepage. This is a simplified version of the new GIS web Portal, a project on which the GS Department's Design Office and Patrimony Service has been working since January 2010. "In today's informatics age, we need to respond ever more quickly to increasing numbers of specific user requests," explains Project Leader Youri Robert. This is more than just a new release of an old tool, it's a completely n...
Consumption patterns and demographic factors influence on fruit ...
African Journals Online (AJOL)
The consumption pattern variables (Table 3) of the different fruit juice classifications were ..... Elepu G, Nabisubi J, Sserunkuuma D. Segmentation of processed fruit juice consumers in urban .... Liquid fruit market report. [homepage on the ...
National Institutes of Health, Office of AIDS Research
... Search Term(s): Main Navigation for the Office of AIDS Research Homepage ABOUT OAR SCIENTIFIC AREAS STRATEGIC PLAN ... HIV/AIDS INFORMATION Welcome to the Office of AIDS Research. Welcome to the Office of AIDS Research ...
Rabies: What If I Receive Treatment Outside the United States?
... R S T U V W X Y Z # Rabies Note: Javascript is disabled or is not supported ... message, please visit this page: About CDC.gov . Rabies Homepage Exposure What materials can spread rabies? What ...
Rabies: Diagnosis in Animals and Humans
... R S T U V W X Y Z # Rabies Note: Javascript is disabled or is not supported ... message, please visit this page: About CDC.gov . Rabies Homepage Exposure What materials can spread rabies? What ...
Atopic dermatitis: tacrolimus vs. topical corticosteroid use
African Journals Online (AJOL)
Atopic dermatitis (AD) is an inflammatory skin disease that is characterised .... effective in the treatment of AD.5. Although ..... original steroid preparations,20 the cost-effectiveness of ... Topical corticosteroids [homepage on the Internet]. c2010.
2011-05-18
... assurance may be obtained or viewed at the following locations. (1) EPA Region 10 Library, Park Place.... (3) EPA Web site http://yosemite.epa.gov/r10/water.nsf/NPDES+Permits/Permits+Homepage . (4) ADEC...
DEFF Research Database (Denmark)
Pilkington, Alan; Chai, Kah-Hin; Le, Yang
2015-01-01
This paper identifies the true coverage of PM theory through a bibliometric analysis of the International Journal of Project Management from 1996-2012. We identify six persistent research themes: project time management, project risk management, programme management, large-scale project management......, project success/failure and practitioner development. These differ from those presented in review and editorial articles in the literature. In addition, topics missing from the PM BOK: knowledge management project-based organization and project portfolio management have become more popular topics...
Evaluation of the 2010 Toyota Prius Hybrid Synergy Drive System
Energy Technology Data Exchange (ETDEWEB)
Burress, Timothy A [ORNL; Campbell, Steven L [ORNL; Coomer, Chester [ORNL; Ayers, Curtis William [ORNL; Wereszczak, Andrew A [ORNL; Cunningham, Joseph Philip [ORNL; Marlino, Laura D [ORNL; Seiber, Larry Eugene [ORNL; Lin, Hua-Tay [ORNL
2011-03-01
Subsystems of the 2010 Toyota Prius hybrid electric vehicle (HEV) were studied and tested as part of an intensive benchmarking effort carried out to produce detailed information concerning the current state of nondomestic alternative vehicle technologies. Feedback provided by benchmarking efforts is particularly useful to partners of the Vehicle Technologies collaborative research program as it is essential in establishing reasonable yet challenging programmatic goals which facilitate development of competitive technologies. The competitive nature set forth by the Vehicle Technologies Program (VTP) not only promotes energy independence and economic stability, it also advocates the advancement of alternative vehicle technologies in an overall global perspective. These technologies greatly facilitate the potential to reduce dependency on depleting natural resources and mitigate harmful impacts of transportation upon the environment.
International Nuclear Information System (INIS)
Cowan, A.
1998-01-01
Project financing was defined ('where a lender to a specific project has recourse only to the cash flow and assets of that project for repayment and security respectively') and its attributes were described. Project financing was said to be particularly well suited to power, pipeline, mining, telecommunications, petro-chemicals, road construction, and oil and gas projects, i.e. large infrastructure projects that are difficult to fund on-balance sheet, where the risk profile of a project does not fit the corporation's risk appetite, or where higher leverage is required. Sources of project financing were identified. The need to analyze and mitigate risks, and being aware that lenders always take a conservative view and gravitate towards the lowest common denominator, were considered the key to success in obtaining project financing funds. TransAlta Corporation's project financing experiences were used to illustrate the potential of this source of financing
National Research Council Canada - National Science Library
Patton, Nanette; Shechet, Allan
2007-01-01
.... This article discusses conventional roles and responsibilities of the project sponsor and then discusses strategies a project manager can employ to define boundaries to reduce role confusion and promote partnership to facilitate project success.
International Nuclear Information System (INIS)
Song, Jin Ho; Kim, H. D.; Kim, J. H.; Hong, S. W.; Min, B. T.; Park, I. K.
2004-07-01
homepage and database for the TROI experiment were constructed to advertize the experiment internationally and to exchange the experimental data between Korea and France, respectively. Finally, a proposal for an international collaborative research was prepared with the aid of international specialists on the steam explosion research for the remaining unsolved issues. The agreement between the KAERI/KINS/CEA/IRSN will contribute to the steam explosion research and furthermore to the overall severe accident research. The TROI English homepage will advertize KAERI's technology worldwide to induce international collaborations. And, the second phase of the SERENA program is expected to be led by mainly Korea and France due to the preparation of a proposal for an international collaborative research
The CHPRC Columbia River Protection Project Quality Assurance Project Plan
International Nuclear Information System (INIS)
Fix, N.J.
2008-01-01
Pacific Northwest National Laboratory researchers are working on the CHPRC Columbia River Protection Project (hereafter referred to as the Columbia River Project). This is a follow-on project, funded by CH2M Hill Plateau Remediation Company, LLC (CHPRC), to the Fluor Hanford, Inc. Columbia River Protection Project. The work scope consists of a number of CHPRC funded, related projects that are managed under a master project (project number 55109). All contract releases associated with the Fluor Hanford Columbia River Project (Fluor Hanford, Inc. Contract 27647) and the CHPRC Columbia River Project (Contract 36402) will be collected under this master project. Each project within the master project is authorized by a CHPRC contract release that contains the project-specific statement of work. This Quality Assurance Project Plan provides the quality assurance requirements and processes that will be followed by the Columbia River Project staff
The CHPRC Columbia River Protection Project Quality Assurance Project Plan
Energy Technology Data Exchange (ETDEWEB)
Fix, N. J.
2008-11-30
Pacific Northwest National Laboratory researchers are working on the CHPRC Columbia River Protection Project (hereafter referred to as the Columbia River Project). This is a follow-on project, funded by CH2M Hill Plateau Remediation Company, LLC (CHPRC), to the Fluor Hanford, Inc. Columbia River Protection Project. The work scope consists of a number of CHPRC funded, related projects that are managed under a master project (project number 55109). All contract releases associated with the Fluor Hanford Columbia River Project (Fluor Hanford, Inc. Contract 27647) and the CHPRC Columbia River Project (Contract 36402) will be collected under this master project. Each project within the master project is authorized by a CHPRC contract release that contains the project-specific statement of work. This Quality Assurance Project Plan provides the quality assurance requirements and processes that will be followed by the Columbia River Project staff.
Navigation To and From a Page: Which Links Get Clicked From Where
Use Google Analytics navigation summary data to find out what page users most frequently click your Contact Us link from (Previous Page Path), or which links on your homepage are popular or unpopular (Next Page Path).
An assessment of organisational values, culture and performance in ...
African Journals Online (AJOL)
2012-09-13
Sep 13, 2012 ... De Sa A, MBChB, MCFP, Family Physician, University of Cape Town. Schlemmer ... may influence the patient-healthcare worker relationship. For example ..... Barrett Value Centre [homepage on the Internet]. c2012. Available ...
Vessel sewage discharges are regulated under Section 312 of the Clean Water Act, which is jointly implemented by the EPA and Coast Guard. This homepage links to information on marine sanitation devices and no discharge zones.
Disaster Distress Helpline: Wildfires
... on Facebook . Resources Helpline Brochure Helpline Wallet Card Disaster Kit Back To Top SAMHSA Quick Links + SAMHSA.gov Homepage Accessibility Privacy Disclaimer Viewers & Plugins FOIA Plain Language Site Map SAMHSA Archive Strategic Initiatives Health Financing Prevention ...
... on Facebook . Resources Helpline Brochure Helpline Wallet Card Disaster Kit Back To Top SAMHSA Quick Links + SAMHSA.gov Homepage Accessibility Privacy Disclaimer Viewers & Plugins FOIA Plain Language Site Map SAMHSA Archive Strategic Initiatives Health Financing Prevention ...
Project structure plan requirements for the deconstruction projects
International Nuclear Information System (INIS)
Petrasch, Peter; Schmitt, Christian; Stapf, Meike
2011-01-01
The deconstruction of nuclear facilities requires due to the particular conditions and the size of the project a special project planning. The authors analyze the possible requirements to be fulfilled by a project structure plan for nuclear facilities, including personnel resources, organization structure, budget questions, operation and project oriented measures, possibility of modifications and supplements. Further topics include controlling and project realization procedures, documentation, third party activities (authorities, consultants, surveyors), logistics and transport, and radiation protection issues. Several questions remain for plants-specific planning, including the integration of the plant personnel, administrative work, project management, economic and financial issues, radioactive waste management issues.
Adapting Project Management Practices to Research-Based Projects
Bahr, P.; Baker, T.; Corbin, B.; Keith, L.; Loerch, L.; Mullenax, C.; Myers, R.; Rhodes, B.; Skytland, N.
2007-01-01
From dealing with the inherent uncertainties in outcomes of scientific research to the lack of applicability of current NASA Procedural Requirements guidance documentation, research-based projects present challenges that require unique application of classical project management techniques. If additionally challenged by the creation of a new program transitioning from basic to applied research in a technical environment often unfamiliar with the cost and schedule constraints addressed by project management practices, such projects can find themselves struggling throughout their life cycles. Finally, supplying deliverables to a prime vehicle customer, also in the formative stage, adds further complexity to the development and management of research-based projects. The Biomedical Research and Countermeasures Projects Branch at NASA Johnson Space Center encompasses several diverse applied research-based or research-enabling projects within the newly-formed Human Research Program. This presentation will provide a brief overview of the organizational structure and environment in which these projects operate and how the projects coordinate to address and manage technical requirements. We will identify several of the challenges (cost, technical, schedule, and personnel) encountered by projects across the Branch, present case reports of actions taken and techniques implemented to deal with these challenges, and then close the session with an open forum discussion of remaining challenges and potential mitigations.
Organization of BSc and MSc projects in project families
DEFF Research Database (Denmark)
Ottosen, Lisbeth M.; Goltermann, Per; Jensen, Pernille Erland
2014-01-01
This work reports organization of student thesis projects in project families, with the benefit to both teaching and learning. The project organization went from student projects broadly distributed on topics related to different research issues and individual supervision to project families with...
DEFF Research Database (Denmark)
Geraldi, Joana; Söderlund, Jonas
2018-01-01
Project organising is a growing field of scholarly inquiry and management practice. In recent years, two important developments have influenced this field: (1) the study and practice of projects have extended their level of analysis from mainly focussing on individual projects to focussing on micro......, and of the explanations of project practices they could offer. To discuss avenues for future research on projects and project practice, this paper suggests the notion of project studies to better grasp the status of our field. We combine these two sets of ideas to analyse the status and future options for advancing...... project research: (1) levels of analysis; and (2) type of research. Analysing recent developments within project studies, we observe the emergence of what we refer to as type 3 research, which reconciles the need for theoretical development and engagement with practice. Type 3 research suggests pragmatic...
Jaspers, F.P.H.; Ende, van den J.C.M.; Borgh, van der W.; Yin, Jie
2008-01-01
Studies about how the organization of new product (and new service) development projects (NPD) projects influences project performance typically investigate this in Single-firm projects, i.e. projects with high ownership integration. However, NPD projects are often performed by two or more
Full Text Available ... Women For Women Homepage FDA Diabetes Information for Patients Page Last Updated: 02/16/2018 Note: If ... FDA Archive Combination Products Advisory Committees Regulatory Information Safety Emergency Preparedness International Programs News & Events Training & Continuing ...
Airway Clearance Techniques (ACTs)
Full Text Available ... Dr. William Skach Paul di Sant’Agnese Distinguished Scientific Achievement Award Quality Care Awards Richard C Talamo ... clinical trial that may be right for you. Search Trials CFF Homepage Cystic Fibrosis Foundation 4550 Montgomery ...
Carotid artery stenting versus no stenting assisting thrombectomy for acute ischaemic stroke
DEFF Research Database (Denmark)
Steglich-Arnholm, Henrik; Holtmannspötter, Markus; Gluud, Christian
2016-01-01
, company homepages, reference lists, conference proceedings, and the Science Citation Index cited reference search index will be conducted. Manufacturers of relevant interventional equipment, authors, colleagues, and researchers active in the field will be contacted. No language restrictions...
Combustion Research Facility | A Department of Energy Office of Science
Collaborative Research Facility Back to Sandia National Laboratory Homepage Combustion Research Search the CRF Combustion Chemistry Flame Chemistry Research.Combustion_Chemistry.Flame_Chemistry Theory and Modeling Theory and Modeling Combustion Kinetics High Pressure Chemistry Chemistry of Autoignition
Airway Clearance Techniques (ACTs)
Full Text Available ... CFF Homepage Menu Search What Is CF? X close ABOUT CYSTIC FIBROSIS Learn about cystic fibrosis, a ... for CF Sweat Test Life With CF X close Caring for a Child With CF Raising a ...
MedlinePlus FAQ: Disease or Condition Information
... on the Health Topics button on the MedlinePlus homepage. You can also find the Health Topics button ... MedlinePlus Connect for EHRs For Developers U.S. National Library of Medicine 8600 Rockville Pike, Bethesda, MD 20894 ...
Research Project Evaluation-Learnings from the PATHWAYS Project Experience.
Galas, Aleksander; Pilat, Aleksandra; Leonardi, Matilde; Tobiasz-Adamczyk, Beata
2018-05-25
Every research project faces challenges regarding how to achieve its goals in a timely and effective manner. The purpose of this paper is to present a project evaluation methodology gathered during the implementation of the Participation to Healthy Workplaces and Inclusive Strategies in the Work Sector (the EU PATHWAYS Project). The PATHWAYS project involved multiple countries and multi-cultural aspects of re/integrating chronically ill patients into labor markets in different countries. This paper describes key project's evaluation issues including: (1) purposes, (2) advisability, (3) tools, (4) implementation, and (5) possible benefits and presents the advantages of a continuous monitoring. Project evaluation tool to assess structure and resources, process, management and communication, achievements, and outcomes. The project used a mixed evaluation approach and included Strengths (S), Weaknesses (W), Opportunities (O), and Threats (SWOT) analysis. A methodology for longitudinal EU projects' evaluation is described. The evaluation process allowed to highlight strengths and weaknesses and highlighted good coordination and communication between project partners as well as some key issues such as: the need for a shared glossary covering areas investigated by the project, problematic issues related to the involvement of stakeholders from outside the project, and issues with timing. Numerical SWOT analysis showed improvement in project performance over time. The proportion of participating project partners in the evaluation varied from 100% to 83.3%. There is a need for the implementation of a structured evaluation process in multidisciplinary projects involving different stakeholders in diverse socio-environmental and political conditions. Based on the PATHWAYS experience, a clear monitoring methodology is suggested as essential in every multidisciplinary research projects.
International Nuclear Information System (INIS)
Alvarez, M.U.
1990-01-01
This paper presents the basic concepts and components of the project financing of large industrial facilities. Diagrams of a simple partnership structure and a simple leveraged lease structure are included. Finally, a Hypothetical Project is described with basic issues identified for discussion purposes. The topics of the paper include non-recourse financing, principal advantages and objectives, disadvantages, project financing participants and agreements, feasibility studies, organization of the project company, principal agreements in a project financing, insurance, and an examination of a hypothetical project
School Science Review, 1978
1978-01-01
Presents sixteen project notes developed by pupils of Chipping Norton School and Bristol Grammar School, in the United Kingdom. These Projects include eight biology A-level projects and eight Chemistry A-level projects. (HM)
Project Management and the Project Manager: A Strategy for ...
African Journals Online (AJOL)
International Journal of Development and Management Review ... collapse, project failure, project abandonment, project cost and time overruns, etc. ... component parts that constitute project management in the building construction industry.
König, H; Klose, K J
1999-04-01
The formulation of requirements is necessary to control the goals of a PACS project. Furthermore, in this way, the scope of functionality necessary to support radiological working processes becomes clear. Definitions of requirements and specification are formulated independently of systems according to the IEEE standard "Recommended Practice for Software Requirements Specifications". Definitions are given in the Request for Information, specifications in the Request for Proposal. Functional and non-functional requirements are distinguished. The solutions are rated with respect to scope, appropriateness and quality of implementation. A PACS checklist was created according to the methods described above. It is published on the homepage of the "Arbeitsgemeinschaft Informationstechnologie" (AGIT) within the "Deutsche Röntgengesellschaft" (DRG) (http://www.uni-marburg.de/mzr/agit). The checklist provides a discussion forum which should contribute to an agreement on accepted basic PACS functionalities.
International Nuclear Information System (INIS)
Koenig, H.; Klose, K.J.
1999-01-01
Problem: The formulation of requirements is necessary to control the goals of a PACS project. Furthermore, in this way, the scope of functionality necessary to support radiological working processes becomes clear. Method: Definitions of requirements and specification are formulated independently of systems according to the IEEE standard 'Recommended Practice for Software Requirements Specifications'. Definitions are given in the Request for Information, specifications in the Request for Proposal. Functional and non-functional requirements are distinguished. The solutions are rated with respect to scope, appropriateness and quality of implementation. Results: A PACS checklist was created according to the methods described above. It is published on the homepage of the 'Arbeitsgemeinschaft Informationstechnologie' (AGIT) within the 'Deutsche Roentgengesellschaft' (DRG) (http://www.uni-marburg.de/mzr.agit). Conclusion: The checklist provides a discussion forum which should contribute to an agreement on accepted basic PACS functionalities. (orig.) [de
Locale-Specific Categorization of IT Projects for Proper Project Management
Directory of Open Access Journals (Sweden)
Muhammad Nasir
2015-12-01
Full Text Available In this paper we aim to show that not only are the project management techniques important for small-scale projects, but following proper project management techniques is one of the most important requirements. However, there come slight variations in implementing project management techniques in small projects as compared with larger projects. Therefore, proper categorization of projects holds the key to success in many situations. Our paper will show that categorization of a project as small-scale or large-scale should always be locale specific. In this regards, we develop a criteria and evaluate how the projects are categorized as small-scale and large-scale in different parts of the world with focus on IT projects. This research concludes that some methods cannot be used for projects of different scales.
Palliative care content on cancer center websites.
Vater, Laura B; Rebesco, Gina; Schenker, Yael; Torke, Alexia M; Gramelspacher, Gregory
2018-03-01
Professional guidelines recommend that palliative care begin early in advanced cancer management, yet integration of palliative and cancer care remains suboptimal. Cancer centers may miss opportunities to provide palliative care information online. In this study, we described the palliative care content on cancer center websites. We conducted a systematic content analysis of 62 National Cancer Institute- (NCI) designated cancer center websites. We assessed the content of center homepages and analyzed search results using the terms palliative care, supportive care, and hospice. For palliative and supportive care webpages, we assessed services offered and language used to describe care. Two researchers analyzed all websites using a standardized coding manual. Kappa values ranged from 0.78 to 1. NCI-designated cancer center homepages presented information about cancer-directed therapy (61%) more frequently than palliative care (5%). Ten percent of cancer centers had no webpage with palliative care information for patients. Among centers with information for patients, the majority (96%) defined palliative or supportive care, but 30% did not discuss delivery of palliative care alongside curative treatment, and 14% did not mention provision of care early in the disease process. Cancer center homepages rarely mention palliative care services. While the majority of centers have webpages with palliative care content, they sometimes omit information about early use of care. Improving accessibility of palliative care information and increasing emphasis on early provision of services may improve integration of palliative and cancer care.
Airway Clearance Techniques (ACTs)
Full Text Available ... Main Content Skip to Footer CFF Homepage Menu Search What Is CF? X close ABOUT CYSTIC FIBROSIS ... Fibrosis Foundation is the world’s leader in the search for a cure for CF and supports a ...
Managing Projects for Change: Contextualised Project Management
Tynan, Belinda; Adlington, Rachael; Stewart, Cherry; Vale, Deborah; Sims, Rod; Shanahan, Peter
2010-01-01
This paper will detail three projects which focussed on enhancing online learning at a large Australian distance education University within a School of Business, School of Health and School of Education. Each project had special funding and took quite distinctive project management approaches, which reflect the desire to embed innovation and…
Improving Project Portfolio Management (PPM) for Improvement Projects
DEFF Research Database (Denmark)
Pries-Heje, Jan; Jakobsen, Peter M.; Korsaa, Morten
2017-01-01
Project Portfolio Management (PPM) focus on the integration and alignment of projects with the business operation in order to achieve most value and cost-efficiency for the investment in projects. PPM is often a challenge and especially so for improvement projects where PPM is considerably...... of evaluating a portfolio of improvement projects and combine this evaluation with the effect they have on the CMMI maturity level. Further, the paper demonstrates how the combination of a strong senior management requirement for improved maturity and the focus on getting the most value out of PPM made...
Project planning and project management of Baseball II-T
International Nuclear Information System (INIS)
Kozman, T.A.; Chargin, A.K.
1975-01-01
The details of the project planning and project management work done on the Baseball II-T experiment are reviewed. The LLL Baseball program is a plasma confinement experiment accomplished with a superconducting magnet in the shape of a baseball seam. Both project planning and project management made use of the Critical Path Management (CPM) computer code. The computer code, input, and results from the project planning and project management runs, and the cost and effectiveness of this method of systems planning are discussed
Energy Technology Data Exchange (ETDEWEB)
Burritt, James G.; Berkey, Edgar [Longenecker and Associates, Las Vegas, NV 89135 (United States)
2012-07-01
Managing complex projects requires a capable, effective project manager to be in place, who is assisted by a team of competent assistants in various relevant disciplines. This team of assistants is known as the Integrated Project Team (IPT). he IPT is composed of a multidisciplinary group of people who are collectively responsible for delivering a defined project outcome and who plan, execute, and implement over the entire life-cycle of a project, which can be a facility being constructed or a system being acquired. An ideal IPT includes empowered representatives from all functional areas involved with a project-such as engineering design, technology, manufacturing, test and evaluation, contracts, legal, logistics, and especially, the customer. Effective IPTs are an essential element of scope, cost, and schedule control for any complex, large construction project, whether funded by DOE or another organization. By recently assessing a number of major, on-going DOE waste management projects, the characteristics of high performing IPTs have been defined as well as the reasons for potential IPT failure. Project managers should use IPTs to plan and execute projects, but the IPTs must be properly constituted and the members capable and empowered. For them to be effective, the project manager must select the right team, and provide them with the training and guidance for them to be effective. IPT members must treat their IPT assignment as a primary duty, not some ancillary function. All team members must have an understanding of the factors associated with successful IPTs, and the reasons that some IPTs fail. Integrated Project Teams should be used by both government and industry. (authors)
Environmental Science: 49 Science Fair Projects. Science Fair Projects Series.
Bonnet, Robert L.; Keen, G. Daniel
This book contains 49 science fair projects designed for 6th to 9th grade students. Projects are organized by the topics of soil, ecology (projects in habitat and life cycles), pests and controls (projects in weeds and insects), recycling (projects in resources and conservation), waste products (projects in decomposition), microscopic organisms,…
2010-04-01
... being exempt from the definition of an online pharmacy by virtue of section 102(52)(B)(ii) of the Act... and clear manner on its homepage, or on a page directly linked thereto in which the hyperlink is also...
International Nuclear Information System (INIS)
Anon.
1990-01-01
This part specifies the activities and project tasks of each project broken down according to types of financing, listing the current projects Lw 1 through 3 funded by long-term provisions (budget), the current projects LB 1 and 2, LG 1 through 5, LK1, LM1, and LU 1 through 6 financed from special funds, and the planned projects ZG 1 through 4 and ZU 1, also financed from special funds. (DG) [de
Project Communication in Functions, Process and Project-Oriented Industiral Companies
Samáková, Jana; Koltnerová, Kristína; Rybanský, Rudolf
2012-12-01
The article is focused on the project communication management. Industrial enterprises, which use project management must constantly search the new ways for improving. One of the possibilities is the change of management from a functional oriented to the projectoriented or process-oriented. Process-oriented and project-oriented companies have better project communication management during the all project life cycle. Communication in the project is a very important factor. According to the arguments of several authors, one of the biggest problem is that threaten the success of the project is just the communication. In each project is an important pillar - and that is communication. Only on the base of communication can the project move forward and achieve the target.
Research Project Evaluation—Learnings from the PATHWAYS Project Experience
Directory of Open Access Journals (Sweden)
Aleksander Galas
2018-05-01
Full Text Available Background: Every research project faces challenges regarding how to achieve its goals in a timely and effective manner. The purpose of this paper is to present a project evaluation methodology gathered during the implementation of the Participation to Healthy Workplaces and Inclusive Strategies in the Work Sector (the EU PATHWAYS Project. The PATHWAYS project involved multiple countries and multi-cultural aspects of re/integrating chronically ill patients into labor markets in different countries. This paper describes key project’s evaluation issues including: (1 purposes, (2 advisability, (3 tools, (4 implementation, and (5 possible benefits and presents the advantages of a continuous monitoring. Methods: Project evaluation tool to assess structure and resources, process, management and communication, achievements, and outcomes. The project used a mixed evaluation approach and included Strengths (S, Weaknesses (W, Opportunities (O, and Threats (SWOT analysis. Results: A methodology for longitudinal EU projects’ evaluation is described. The evaluation process allowed to highlight strengths and weaknesses and highlighted good coordination and communication between project partners as well as some key issues such as: the need for a shared glossary covering areas investigated by the project, problematic issues related to the involvement of stakeholders from outside the project, and issues with timing. Numerical SWOT analysis showed improvement in project performance over time. The proportion of participating project partners in the evaluation varied from 100% to 83.3%. Conclusions: There is a need for the implementation of a structured evaluation process in multidisciplinary projects involving different stakeholders in diverse socio-environmental and political conditions. Based on the PATHWAYS experience, a clear monitoring methodology is suggested as essential in every multidisciplinary research projects.
BODIES OF KNOWLEDGE IN PROJECT MANAGEMENT AND PROJECT QUALITY MANAGEMENT
Tamara Gvozdenovic; Mirjana Miljanovic; Aleksandar Jegdic; Zeljko Crnogorcic
2008-01-01
One of the main trends is standardization of project management. Some of the most important bodies of knowledge in project management, which were created by professional associations for project management are given in this paper. The main of the project management, apart from minimization of time, resources and costs, is to finish the project in the required quality, i.e. it is very important during the whole process of project management to provide realizing the project without any deviatio...
BODIES OF KNOWLEDGE IN PROJECT MANAGEMENT AND PROJECT QUALITY MANAGEMENT
Directory of Open Access Journals (Sweden)
Tamara Gvozdenovic
2008-03-01
Full Text Available One of the main trends is standardization of project management. Some of the most important bodies of knowledge in project management, which were created by professional associations for project management are given in this paper. The main of the project management, apart from minimization of time, resources and costs, is to finish the project in the required quality, i.e. it is very important during the whole process of project management to provide realizing the project without any deviations from the previously set quality standards. Basic processes of project quality management are: quality planning, quality assurance and quality control.
40 CFR 258.41 - Project XL Bioreactor Landfill Projects.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Project XL Bioreactor Landfill... WASTES CRITERIA FOR MUNICIPAL SOLID WASTE LANDFILLS Design Criteria § 258.41 Project XL Bioreactor Landfill Projects. (a) Buncombe County, North Carolina Project XL Bioreactor Landfill Requirements...
DEFF Research Database (Denmark)
Svejvig, Per; Commisso, Trine Hald
2012-01-01
that the best practice knowledge has not permeated sufficiently to the practice. Furthermore, the appropriate application of information and communication technology (ICT) remains a big challenge, and finally project managers are not sufficiently trained in organizing and conducting virtual projects....... The overall implications for research and practice are to acknowledge virtual project management as very different to traditional project management and to address this difference.......Virtual projects are common with global competition, market development, and not least the financial crisis forcing organizations to reduce their costs drastically. Organizations therefore have to place high importance on ways to carry out virtual projects and consider appropriate practices...
Energy Technology Data Exchange (ETDEWEB)
1983-01-01
Papers were presented on the following: project evaluation; case studies - minerals; finance; applied finance; legal; manpower/industrial relations; and new technologies. Those papers on the coal industry were: mine planning for coal project development; the planning and management of a lignite exploration contract in Thailand; development of the West Cliff extended project; Ulan: a resource development; Saxonvale mine development a case study in project planning and project management; the role of marketing in the development of a new coal project; technical support for coal marketing; infrastructure development for the Ulan project; underground mine project developments; the bucketwheel excavator at Goonyella - a case study; tax aspects of mining development projects; cost of capital mining development projects; and trends in development project finance. 16 papers were abstracted separately.
DEFF Research Database (Denmark)
Tryggestad, Kjell; Justesen, Lise; Mouritsen, Jan
2013-01-01
Purpose – The purpose of this paper is to explore how animals can become stakeholders in interaction with project management technologies and what happens with project temporalities when new and surprising stakeholders become part of a project and a recognized matter of concern to be taken...... into account. Design/methodology/approach – The paper is based on a qualitative case study of a project in the building industry. The authors use actor-network theory (ANT) to analyze the emergence of animal stakeholders, stakes and temporalities. Findings – The study shows how project temporalities can...... multiply in interaction with project management technologies and how conventional linear conceptions of project time may be contested with the emergence of new non-human stakeholders and temporalities. Research limitations/implications – The study draws on ANT to show how animals can become stakeholders...
An Efficient, Green Chemical Synthesis of the Malaria Drug ...
African Journals Online (AJOL)
Results : A green-chemical synthesis of piperaquine is described that proceeds in 92 – 93 % overall yield. ... Keywords: ACTs, Dihydroartemisinin Piperaquine, Dihydroartemisinin, Green Chemistry, Malaria, ..... Mathers CD, Ezzati M, Lopez AD. ... Medicines Programme [Homepage on the Internet]. Geneva ... An Alternative.
DEFF Research Database (Denmark)
provides introductions to prominent ideas, social, political, and cultural critique and responses, all of contemporary relevance. In addition to providing the necessary basic and factual information, the book and its homepage suggest student assignments, topics for presentations and essays, and literature...
Full Text Available ... Diabetes Information on WebMD Order Free Women's Health Publications Women's Health Information on Twitter Information from Other ... YourDiabetesInfo.org American Diabetes Association Get Other FDA Publications for Women For Women Homepage FDA Diabetes Information ...
A comprehensive in vitro biological investigation of metal complexes ...
African Journals Online (AJOL)
Md. Mahabob Ullah Mazumder
... Journal of Medicine journal homepage: http://www.elsevier.com/locate/ajme .... two new complexes containing Fe (III) and Mo(VI) of two tridentate ONO donor · sets ligands. Der Chem Sin. .... Pharmaceuticals (Basel). 2014;7(4):453–463. 13.
Tropical Journal of Pharmaceutical Research
African Journals Online (AJOL)
Journal Homepage Image. We seek to encourage pharmaceutical and allied research of tropical and international relevance and to foster multidisciplinary research and collaboration among scientists, the pharmaceutical industry and the healthcare professionals. We publish articles in pharmaceutical sciences and related ...
77 FR 26231 - State of Tennessee; Underground Injection Control (UIC) Program Primacy
2012-05-03
... public docket, visit the EPA Docket Center homepage at http://www.epa.gov/epahome/dockets.htm of the.... Environmental Protection Agency, Region 4, Library, 9th Floor, 61 Forsyth Street SW., Atlanta, Georgia 30303. The Library is open from [[Page 26232
77 FR 25366 - Underground Storage Tank Program: Approved State Program for the State of Oregon
2012-04-30
... the EPA Region 10 Library, 1200 Sixth Avenue, Seattle, WA 98101, from 9 a.m. to 12 p.m. and 1 p.m. to... additional information about EPA's public docket, visit the EPA Docket Center homepage at http://www.epa.gov...
Understanding Applications of Project Planning and Scheduling in Construction Projects
AlNasseri, Hammad Abdullah
2015-01-01
Construction project life-cycle processes must be managed in a more effective and predictable way to meet project stakeholders’ needs. However, there is increasing concern about whether know-how effectively improves understanding of underlying theories of project management processes for construction organizations and their project managers. Project planning and scheduling are considered as key and challenging tools in controlling and monitoring project performance, but many worldwide constru...
Haugmark, Trond; Hagen, Kåre Birger; Provan, Sella Aarrestad; Bærheim, Elisebeth; Zangi, Heidi A
2018-06-04
People with fibromyalgia (FM) suffer from symptoms such as widespread pain, non-refreshing sleep, fatigue and reduced quality of life. Effects of pharmacological treatment are questionable and non-pharmacological treatments are recommended as first-line therapy. To date the majority of patients with FM in Norway are not offered any targeted treatment. The aim of this randomised controlled trial is to investigate the effects of a community-based multicomponent rehabilitation programme comprising an acceptance-based and mindfulness-based group intervention, the Vitality Training Programme (VTP), followed by tailored physical activity counselling. General practitioners refer potential participants to a rheumatologist in specialist healthcare for diagnostic clarification and assessment of comorbidities. Inclusion criteria are widespread pain/FM ≥3 months, age 20-50 and work participation (minimum part-time) within the last 2 years. The intervention group attends the VTP comprising 10 weekly 4 hour group sessions plus a booster session after 6 months. Thereafter, they receive 12 weeks of individually tailored physical exercise counselled by physiotherapists at community-based Healthy Life Centers. The control group follows treatment as usual. The primary outcome is Patient Global Impression of Change. Secondary outcomes include self-reported pain, fatigue and sleep quality, psychological distress, mindfulness, health-related quality of life, physical activity, work ability and exercise beliefs and habits. To achieve a power of 80% and allow for 10% dropout, 70 participants are needed in each arm. All analyses will be conducted on intention-to-treat bases and measured as differences between groups at 12 months follow-up. The study is approved and granted by the Norwegian South-Eastern Regional Health Authority (reference 2016015). Ethics approval was obtained from Regional Committee for Medical and Health Research Ethics (reference 2015/2447/REK sør-øst A
DEFF Research Database (Denmark)
Project Management Theory Meets Practice contains the proceedings from the 1st Danish Project Management Research Conference (DAPMARC 2015), held in Copenhagen, Denmark, on May 21st, 2015.......Project Management Theory Meets Practice contains the proceedings from the 1st Danish Project Management Research Conference (DAPMARC 2015), held in Copenhagen, Denmark, on May 21st, 2015....
DEFF Research Database (Denmark)
Munk-Madsen, Andreas; Andersen, Peter Bøgh
2006-01-01
project managers should not only be concerned with project plans, but also with project stories. In this paper we explore some basic principles for transforming project plans into appealing stories. We discuss what may happen to stories once they are released into public space. And we illustrate how......Plans and stories are two different ways of communicating about projects. Project plans are formalized descriptions, primarily supporting coordination. Project stories are accounts whose primary function is emotional appeal. Project stories influence the projects’ chances of success. Therefore...... the possibilities of telling favorable stories may have repercussions on the project planning....
Experiences of project developers around CDM projects in South Africa
International Nuclear Information System (INIS)
Thurner, Thomas W.; Varughese, Arun
2013-01-01
Project developers in South Africa are puzzled with the long process of evaluating and registering their CDM projects. In addition to other obstacles, we find that South African big businesses are rather reluctant to engage in any new business activities such as CDM projects and municipalities often lack the necessary flexibility. This offers opportunities for small-scale project developers who spot the opportunities and find creative solutions to overcome these difficulties. - Highlights: • First paper analysing the experience of small project developers in South Africa. • Project developers in South Africa are puzzled with the long process. • South African big businesses are reluctant to engage in CDM projects. • Small-scale project developers spot opportunities and find creative solutions to overcome difficulties. • Also, we saw learning processes of South African administration in support of CDM projects
MATCHING CONFIGURATIONS PROJECTS OF COOPERATIVE MILK COLLECTION PROJECT ENVIRONMENT
Directory of Open Access Journals (Sweden)
Анатолій Миколайович ТРИГУБА
2017-03-01
Full Text Available The condition analysis of dairy farming is done and the reasons for its degradation are revealed. The need of technologically integrated production systems projects, harvesting, and processing of milk are substantiated. A scientific methodology and the method of project design of milk provision cooperative coordination in the community of the project environment, which are based on systematic-evaluative approach and simulation are proposed. The criterion for the definition of rational parameters of objects configuration for milk provision cooperative projects in the community system is the maximum value of their product. The monetary functioning assessment of the configuration object of cooperative milk provision projects in the community is done. On the basis of the proposed method, we performed the coordination of project configuration of milk provision cooperative with the project environment of territory Zabolotsi community in Brody district of Lviv region.
Marmel, Elaine
2010-01-01
A comprehensive reference on the latest version of the leading enterprise project management software: Microsoft Project 2010. Microsoft Project allows users to manage business activities effectively by sharing project information, performing modeling and scenario analyses, standardizizing reporting processes, and more. This soup-to-nuts reference covers both the professional and standard versions of the latest iteration of Microsoft Project, as well as Project Server, so that you can efficiently manage your business projects. Veteran author Elaine Marmel begins with an overview of project man
DEFF Research Database (Denmark)
Munk-Madsen, Andreas
2005-01-01
"Project" is a key concept in IS management. The word is frequently used in textbooks and standards. Yet we seldom find a precise definition of the concept. This paper discusses how to define the concept of a project. The proposed definition covers both heavily formalized projects and informally...... organized, agile projects. Based on the proposed definition popular existing definitions are discussed....
Project Management Methods in Projects Co-financed by EU Funds
Kostalova, Jana; Tetrevova, Libena; Patak, Michal
2017-01-01
This paper deals with the management of projects co-financed by European Union funds (structural funds and the Cohesion Fund) in the Czech Republic (EU projects). The authors aimed to analyze and assess the scope of familiarity with basic project management methods and their application within the implementation of EU projects in the Czech Republic in the Programming Period 2007–2013. Based on a questionnaire survey of EU project organisers, the authors evaluate their attitudes to project man...
The impact of project marketing on the projects finality
Directory of Open Access Journals (Sweden)
Oxana SAVCIUC
2015-06-01
Full Text Available In the last years we assist at the level of the Republic of Moldova and also at international level at a trend to offer financial support with a special focus on project-based funding. Once with the appearance and development of the project concept, other related concepts are being developed such as project management or newly, we can also speak about the projects marketing. Until recently, the product marketing was intensely discussed; concepts such as services marketing appeared afterwards, but also the specific marketing for various branches, such as agromarketing, political marketing, etc. Given that fact that the projects are a product / service itself, at the moment, more and more often projects marketing is discussed.
Alagba, Tonye J.
Oil and gas drilling projects are the primary means by which oil companies recover large volumes of commercially available hydrocarbons from deep reservoirs. These types of projects are complex in nature, involving management of multiple stakeholder interfaces, multidisciplinary personnel, complex contractor relationships, and turbulent environmental and market conditions, necessitating the application of proven project management best practices and critical success factors (CSFs) to achieve success. Although there is some practitioner oriented literature on project management CSFs for drilling projects, none of these is based on empirical evidence, from research. In addition, the literature has reported alarming rates of oil and gas drilling project failure, which is attributable not to technical factors, but to failure of project management. The aim of this quantitative correlational study therefore, was to discover an empirically verified list of project management CSFs, which consistent application leads to successful implementation of oil and gas drilling projects. The study collected survey data online, from a random sample of 127 oil and gas drilling personnel who were members of LinkedIn's online community "Drilling Supervisors, Managers, and Engineers". The results of the study indicated that 10 project management factors are individually related to project success of oil and gas drilling projects. These 10 CSFs are namely; Project mission, Top management support, Project schedule/plan, Client consultation, Personnel, Technical tasks, Client acceptance, Monitoring and feedback, Communication, and Troubleshooting. In addition, the study found that the relationships between the 10 CSFs and drilling project success is unaffected by participant and project demographics---role of project personnel, and project location. The significance of these findings are both practical, and theoretical. Practically, application of an empirically verified CSFs list to oil
Williamson, David J.
2011-01-01
The specific problem addressed in this study was the low success rate of information technology (IT) projects in the U.S. Due to the abstract nature and inherent complexity of software development, IT projects are among the most complex projects encountered. Most existing schools of project management theory are based on the rational systems…
Statistical analysis on extreme wave height
Digital Repository Service at National Institute of Oceanography (India)
Teena, N.V.; SanilKumar, V.; Sudheesh, K.; Sajeev, R.
-294. • WAFO (2000) – A MATLAB toolbox for analysis of random waves and loads, Lund University, Sweden, homepage http://www.maths.lth.se/matstat/wafo/,2000. 15 Table 1: Statistical results of data and fitted distribution for cumulative distribution...
2014-04-01
cultural (Basham , 2013), with work and childcare common barriers to accessing care (Hoge, Castro, & Eaton, 2006). Because they are not on base...2007 update. Caliber Company . Retrieved from http://www.mwrbrandcentral.com/HOMEPAGE/Graphics/Research/whatweknow2007.pdf Boss, P. (1986). Family
African Journals Online (AJOL)
Journal Homepage Image. Global Journal of Humanities is aimed at promoting reasearch in all areas of Humanities including philosophy, languages, linguistics, literature, history, fine/applied arts, theater arts, architecture, etc. Visit the Global Journal Series website here: http://www.globaljournalseries.com/ ...
The equal accessibility to patient complaint measures
DEFF Research Database (Denmark)
Birkeland, Søren
advice offices exist to guide complainants and the Danish Ombudsman claimed the duty to also provide interpreter assistance yet with no obligation to generally offer foreigner complaint information. Currently only little homepage information is available in English. More research is needed on complainant...
Towards a medium-range coastal station fog forecasting system
CSIR Research Space (South Africa)
Landman, S
2013-09-01
Full Text Available -1 29th Annual conference of South African Society for Atmospheric Sciences (SASAS) 2013 http://sasas.ukzn.ac.za/homepage.aspx Towards a Medium-Range Coastal Station Fog Forecasting System Stephanie Landman*1, Estelle Marx1, Willem A. Landman2...
Problem Based Learning and Education for Sustainable Development
DEFF Research Database (Denmark)
Guerra, Aida
2012-01-01
systems were identified through literature review. Secondly, their homepages (from education vision to programmes’ curriculum) were analysed to identify the presence of PBL and ESD. The study presents a methodological approach with aim to identify trends in engineering education. Around fifty institutions...
Top stories of 2014 on IDRC.ca | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2014-12-09
Dec 9, 2014 ... From increasing access to nutritious food to boosting women's opportunities to lead safe and healthy lives, the most popular content featured on our homepage in 2014 showcases IDRC-funded research that has made a difference across the developing world.
2010-07-01
....17 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND... forms are available free of charge via the Internet by accessing the Copyright Office homepage at http... Section, United States Copyright Office, Library of Congress, 101 Independence Avenue, Washington, DC...
An alternative approach to spectrum base line estimation
International Nuclear Information System (INIS)
Bukvic, S.; Spasojevic, Dj.
2005-01-01
We present a new form of merit function which measures agreement between a large number of data and the model function with a particular choice of parameters. We demonstrate the efficiency of the proposed merit function on the common problem of finding the base line of a spectrum. When the base line is expected to be a horizontal straight line, the use of minimization algorithms is not necessary, i.e. the solution is achieved in a small number of steps. We discuss the advantages of the proposed merit function in general, when explicit use of a minimization algorithm is necessary. The hardcopy text is accompanied by an electronic archive, stored on the SAE homepage at http://www1.elsevier.com/homepage/saa/sab/content/lower.htm. The archive contains fully functional demo program with tutorial, examples and Visual Basic source code of the key subroutine
A Framework for Project Governance in Major Public IT projects
DEFF Research Database (Denmark)
Harboe, Peter Georg; Riis, Eva
2016-01-01
such a framework. It was developed from the literature on major and mega-projects, both public and private, that concern infrastructure, engineering and IT. The proposed framework for project governance comprises six major elements: governance structure, management approach, stakeholders, value, systems......The rising number of major public IT projects is mirrored by a growing research interest in the management of such projects. Both can benefit from a more complete understanding of project governance that should lead to a practical framework for project governance. The present paper proposes...... integration and complexity. Empirical research has identified a number of characteristics for these project governance elements. In the second part of the paper the framework was tested in a case study of the Danish smart card Rejsekort project. The framework was found to be robust, and that in this case...
A Framework for Project Governance in Major Public IT projects
DEFF Research Database (Denmark)
Riis, Eva; Harboe, Peter Georg
2016-01-01
integration and complexity. Empirical research has identified a number of characteristics for these project governance elements. In the second part of the paper the framework was tested in a case study of the Danish smart card Rejsekort project. The framework was found to be robust, and that in this case......The rising number of major public IT projects is mirrored by a growing research interest in the management of such projects. Both can benefit from a more complete understanding of project governance that should lead to a practical framework for project governance. The present paper proposes...... such a framework. It was developed from the literature on major and mega-projects, both public and private, that concern infrastructure, engineering and IT. The proposed framework for project governance comprises six major elements: governance structure, management approach, stakeholders, value, systems...
Trevino Project: a fast-track approach for a small construction project
International Nuclear Information System (INIS)
Schick, C.J.; Lynn, N.S.
1982-01-01
The approach to a construction project can vary according to the size, location, and degree of difficulty associated with the project. This paper deals with one approach that can be taken to a small construction project, the fast-track approach. A small construction project can be defined as a project having less than $20 million capital cost or a project with a low degree of difficulty. This approach is very applicable to in-situ leaching uranium projects, small precious metal operations, etc. The approach to the small project is that of fast-tracking the project in order to minimize the time over which capital expenditure occurs and also to reduce the indirect costs of field expense, construction supplies, construction equipment, etc. In order to fast-track a project it is necessary to do a very precise job on the preliminary phases of the project such as preliminary engineering, plant site location, environmental permits, etc. 2 figures, 2 tables
PROJECT - RESOURCE MANAGEMENT OF INNOVATIONS IN EDUCATION: ANTHROPOLOGICAL PROJECTION
Directory of Open Access Journals (Sweden)
Galina Aleksandrovna Ignat’eva
2015-08-01
Full Text Available The purpose of the research was to denote a way to solve the problem of education mana-gement ΄s insufficient efficiency considered from the point of view of education opportunities to influence on the formation of mechanisms for sustainable development of society as a whole and its educational component. The concept «project-resource management of innovation in education» regarded on the basis of the anthropological project-transforming paradigm. Conceptually-categorical context presented by conceptual cluster composed of coordinated concepts «project», «resource», «educational reality», «organizational-resource potential», «project commonality». In the theoretical part of the study on the basis of analysis of the normative and exploratory approaches to educational innovations organization and management it was established the search approach ΄s leading role in the methodological substantiation of project-resource management. The study have indicated that in the presence of variable models of innovation management in education, corresponding to various predictive models of continuing education post-industrial society, project-resource management is an universal mechanism for the transition from separate innovation΄s precedents to the an authentic reality of innovative education. In the technological part of the study the main concern was to submit the project-resource management by the management goal’s system, each of which includes the specific management actions, projected results and the organizational forms. The project-resource management ΄s professional – activity context of the study showed evolution of managerial positions: an effective performer – an effective leader – strategist, implemented during the transition from directly directive management to the project management and further to the project-resource management. Based on the findings identified the key factors of initiatively-problem projects
PACTEL OECD project planning (PACO). PACTEL OECD project planning
Energy Technology Data Exchange (ETDEWEB)
Kouhia, V.; Purhonen, H. [Lappeenranta University of Technology (Finland)
2004-07-01
OECD launched the SETH project to investigate issues relevant for accident prevention and management and to ensure the existence of integral thermal hydraulic test facilities. The facilities included in the SETH project are PKL from Germany and PANDA from Switzerland. At the early stages of the SETH project an idea was raised to exploit the PACTEL facility in a similar OECD project. Without any external funding the analytical work in the required extent would not be possible within Lappeenranta University of Technology, the party responsible of operating PACTEL. This fact directed the PACO project proposal to be conducted for the SAFIR programme. The aim of the PACO project is to prepare a project proposal to OECD of a PACTEL related project. To attain this objective some preliminary analyses have to be performed to ensure the relevancy of the proposed topic. The low power situation, i.e. midloop state was chosen to be the topic in the PACO studies and project planning basis. The plan is to use PACTEL to examine vertical steam generator behaviour during the midloop operation and the following loss of residual heat removal system transient. Such a possibility is acknowledged with special alterations to PACTEL. The APROS code version 5.04.07 was selected as a tool for the preanalyses. The virtual simulation of the chosen experimental situation would give a preconception on the phenomena to be expected and the progression of the transient. Originally the PACO project was planned to continue only for a few months, ending up with the project proposal to OECD during the summer time 2004. During the pre-calculation process it became obvious that the time expected was not enough to establish good pre-calculation results. The reasons for this relates to time used to learn and adapt the use of the chosen code, improvements and corrections in modelling as well as the code ability to manage the special conditions defined for the project topic. Another aspect on completing a
Project manager attributes influencing project success in the South ...
African Journals Online (AJOL)
success criteria for building projects in Ghana and concluded that the “current and ... qualifications, profession, leadership style and project team ... and expectations of project management competence between ... 1.d. Sense of teamwork ...
Markić, Lucija; Mandušić, Dubravka; Grbavac, Vitomir
2005-01-01
Microsoft Project je alat čije su prednosti u svakodnevnom radu nezamjenjive. Pomoću Microsoft Projecta omogućeno je upravljanje resursima, stvaranje izvještaja o projektima u vremenu, te analize različitih scenarija. Pojavljuje u tri verzije: Microsoft Project Professional, Microsoft Project Server i Microsoft Project Server Client Access Licenses. Upravo je trend da suvremeni poslovni ljudi zadatke povjeravaju Microsoft Projectu jer on znatno povećava produktivnost rada. Te prednos...
Project stakeholder management
Eskerod, Pernille
2013-01-01
Carrying out a project as planned is not a guarantee for success. Projects may fail because project management does not take the requirements, wishes and concerns of stakeholders sufficiently into account. Projects can only be successful though contributions from stakeholders. And in the end, it is the stakeholders that evaluate whether they find that the project is a success. To manage stakeholders effectively, you need to know your stakeholders, their behaviours and attitudes towards the project. In Project Stakeholder Management, the authors give guidance on how to adopt an analytical and s
DEFF Research Database (Denmark)
Svejvig, Per; Gerstrøm, Anna; Frederiksen, Signe Hedeboe
The Half Double mission: Project Half Double has a clear mission. We want to succeed in finding a project methodology that can increase the success rate of our projects while increasing the development speed of new products and services. We are convinced that by doing so we can strengthen...... the competitiveness of Denmark and play an important role in the battle for jobs and future welfare. The overall goal is to deliver “Projects in half the time with double the impact” where projects in half the time should be understood as half the time to impact (benefit realization, effect is achieved......) and not as half the time for project execution. The Half Double project journey: It all began in May 2013 when we asked ourselves: How do we create a new and radical project paradigm that can create successful projects? Today we are a movement of hundreds of passionate project people, and it grows larger...
Suralkar, Sunita; Joshi, Nilambari; Meshram, B B
2013-01-01
This paper describes about the need for Web project management, fundamentals of project management for web projects: what it is, why projects go wrong, and what's different about web projects. We also discuss Cost Estimation Techniques based on Size Metrics. Though Web project development is similar to traditional software development applications, the special characteristics of Web Application development requires adaption of many software engineering approaches or even development of comple...
Project Documentation as a Risk for Public Projects
Directory of Open Access Journals (Sweden)
Vladěna Štěpánková
2015-08-01
Full Text Available Purpose of the article: The paper presents the different methodologies used for creating documentation and focuses on public projects and their requirements for this documentation. Since documentation is also incorporated in the overall planning of the project and its duration is estimated using expert qualified estimate, can any change in this documentation lead to project delays, or increase its cost as a result of consuming administration, and therefore the documentation is seen as a risk, which may threaten the project as a public contract by which a company trying to achieve and obtains it, and generally any project. Methodology/methods: There are used methods of obtaining information in this paper. These are mainly structured interviews in combination with a brainstorming, furthermore also been used questionnaire for companies dealing with public procurement. As a data processing program was used MS Excel and basic statistical methods based on regression analysis. Scientific aim: The article deals with the construction market in the Czech Republic and examines the impact of changes in project documentation of public projects on their turnover. Findings: In this paper we summarize the advantages and disadvantages of having project documentation. In the case of public contracts and changes in legislation it is necessary to focus on creating documentation in advance, follow the new requirements and try to reach them in the shortest possible time. Conclusions: The paper concludes with recommendations on how to proceed, if these changes and how to reduce costs, which may cause the risk of documentation.
Energy Technology Data Exchange (ETDEWEB)
Smith, Rhett [Schweitzer Engineering Laboratories, Inc., Pullman, WA (United States); Campbell, Jack [CenterPoint Energy Houston Electric, TX (United States); Hadley, Mark [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2016-12-30
The Watchdog Project completed 100% of the project Statement of Project Objective (SOPO). The Watchdog project was a very aggressive project looking to accomplish commercialization of technology that had never been commercialized, as a result it took six years to complete not the original three that were planned. No additional federal funds were requested from the original proposal and SEL contributed the additional cost share required to complete the project. The result of the Watchdog Project is the world’s first industrial rated Software Defined Network (SDN) switch commercially available. This technology achieved the SOPOO and DOE Roadmap goals to have strong network access control, improve reliability and network performance, and give the asset owner the ability to minimize attack surface before and during an attack. The Watchdog project is an alliance between CenterPoint Energy Houston Electric, Pacific Northwest National Laboratories (PNNL), and Schweitzer Engineering Laboratories, Inc. (SEL). SEL is the world’s leader in microprocessor-based electronic equipment for protecting electric power systems. PNNL performs basic and applied research to deliver energy, environmental, and national security for our nation. CenterPoint Energy is the third largest publicly traded natural gas delivery company in the U.S and third largest combined electricity and natural gas delivery company. The Watchdog Project efforts were combined with the SDN Project efforts to produce the entire SDN system solution for the critical infrastructure. The Watchdog project addresses Topic Area of Interest 5: Secure Communications, for the DEFOA- 0000359 by protecting the control system local area network itself and the communications coming from and going to the electronic devices on the local network. Local area networks usually are not routed and have little or no filtering capabilities. Combine this with the fact control system protocols are designed with inherent trust the control
Influence of organizational and project cultures on project success
Directory of Open Access Journals (Sweden)
Berdykulova G. M.
2017-10-01
Full Text Available the article is dedicated to studying the influence of organizational and project cultures on effective project management of the company by knowledge systematization and the comparative analysis of world companies’ practice that allowed to reveal the main factors and criteria of projects success and negative influence of organizational culture on the project; key aspects of corporate culture and cultural integration under the conditions of globalization.
How digital design shapes political participation: A natural experiment with social information.
Hale, Scott A; John, Peter; Margetts, Helen; Yasseri, Taha
2018-01-01
Political behaviour increasingly takes place on digital platforms, where people are presented with a range of social information-real-time feedback about the behaviour of peers and reference groups-which can stimulate (or depress) participation. This social information is hypothesized to impact the distribution of political activity, stimulating participation in mobilizations that are increasing in popularity, and depressing participation in those that appear to be less popular, leading to a non-normal distribution. Changes to these platforms can generate natural experiments allowing for an estimate of the impact of different kinds of social information on participation. This paper tests the hypothesis that social information shapes the distribution of political mobilizations by examining the introduction of trending information to the homepage of the UK government petition platform. The introduction of the trending feature did not increase the overall number of signatures per day, but the distribution of signatures across petitions changed significantly-the most popular petitions gained more signatures at the expense of those with fewer signatories. We further find significant differences between petitions trending at different ranks on the homepage. This evidence suggests that the ubiquity of trending information on digital platforms is introducing instability into political markets, as has been shown for cultural markets. As well as highlighting the importance of digital design in shaping political behaviour, the findings suggest that a non-negligible group of individuals visit the homepage of the site looking for petitions to sign, without having decided the issues they wish to support in advance. These 'aimless petitioners' are particularly susceptible to changes in social information.
Pac-Rim LNG project : final project report specifications
International Nuclear Information System (INIS)
1996-01-01
PAC-RIM LNG Inc. has submitted a proposal to the British Columbia Environmental Assessment Office, to develop a liquefied natural gas project which would purchase pipeline quality natural gas from sources in northeast British Columbia and Alberta and transport it via a dedicated pipeline system to a LNG processing plant on tidewater on the Pacific coast. The project would include storage and processing facilities and a marine loading terminal. This document sets out the final project report specifications prepared by the Project Committee on the basis of input received from the public, First Nations and federal, provincial and local governments
Does Lean & Agile Project Management Help Coping with Project Complexity?
Jalali Sohi, A.; Hertogh, M.J.C.M.; Bosch-Rekveldt, M.G.C.; Blom, R.; Serpell, A.; Ferrada, X.
2016-01-01
Still, projects in the construction sector are delivered with time delays and cost overruns. One of the reasons for poor performance was assigned to project complexity. A combination of lean construction and agile project management are hypothesized as a possible solution to cope with project
Industrialization of polymer solar cells - phase 1
Energy Technology Data Exchange (ETDEWEB)
Lauritzen, H.; Krebs, F.C. [Technical Univ. of Denmark. DTU Energy Conversion, DTU Risoe Campus, Roskilde (Denmark); Andersen, Rasmus B. [Mekoprint A/S, Stoevrimg (Denmark); Bork, J.; Bentzen, B.
2012-03-15
A three-phased project with the objective to industrialize DTU's basic polymer solar cell technology was started in the summer of 2009. The technology comprises a specific design of the polymer solar cell and a corresponding roll-to-roll manufacturing process. This basic technology is referred to as ProcessOne in the open literature. The present report relates to the project's phase 1.The key tasks in phase 1 are to stream-line DTU's tech-nology for the industrial utilization, to demonstrate production according to this stream-lined technology at Mekoprint A/S and finally to fertilize the market for polymer solar cells by demonstrating their use in appli-cations that harmonize with their present maturity level. The main focus in the stream-lining of DTU's technology has been to demonstrate a convincing rate of reduction for the production cost, and thereby make a competitive price plausible. This has been materialized as a learning curve showing that the polymer technology presently develops considerably faster than the silicon technology. The polymer solar cells will, under the assumption that both technologies follow a projection of the learning curve, gain a cost-leading position within a reasonable time. A production cost of 5 Euro/Wp has already been demonstrated in DTU's pilot plant, and a road map for the further decrease to 1 Euro/Wp is drawn. This target is expected to be reached in 2013 in the ongoing phase 2 of the project. Another activity essential for the industrialization has been the launch of specialized materials, equipment and services required for the processing of DTU's polymer solar cells. Relevant products and services are made available for sale on DTU's homepage, www.energyconversion.dtu.dk. A production line for polymer solar cells has been established at Mekoprint. For this a retrofit solution was chosen where the core of an existing screen-printing line was dismantled and fitted to a slot-die printing head manufactured in DTU's workshop
Nakagawa, Yoshiaki; Tomita, Naoko; Irisa, Kaoru; Yoshihara, Hiroyuki; Nakagawa, Yoshinobu
2013-01-01
Introduction of Electronic Medical Record (EMR) into a hospital was started from 1999 in Japan. Then, most of all EMR company said that EMR improved efficacy of the management of the hospital. National Hospital Organization (NHO) has been promoting the project and introduced EMR since 2004. NHO has 143 hospitals, 51 hospitals offer acute-phase medical care services, the other 92 hospitals offer medical services mainly for chronic patients. We conducted three kinds of investigations, questionnaire survey, checking the homepage information of the hospitals and analyzing the financial statements of each NHO hospital. In this financial analysis, we applied new indicators which have been developed based on personnel costs. In 2011, there are 44 hospitals which have introduced EMR. In our result, the hospital with EMR performed more investment of equipment/capital than personnel expenses. So, there is no advantage of EMR on the financial efficacy.
Applying Product Configuration Systems in Engineering Companies
DEFF Research Database (Denmark)
Ladeby, Klaes Rohde
This Ph.D. thesis looks into the application of configuration systems in engineering companies, and how configuration systems can be used to support business processes in engineering companies. Often the motivation stated by researchers and practitioners is, that a configuration project...... and sustain competitive advantage” (Teece, Pisano, & Shuen, 1997, pp.509) This question has puzzled academics and preoccupied managers for the last century. Yet, it seems there is still no consensus regarding the meaning of strategy, and how strategy works. Type in the word “strategy” on Amazon.co.uk and 76......,133 books apply. Type it in on Google scholar and 8,580,000 homepages apply3. Obviously, strategy is an important subject. However, the subject also seems to be difficult to perceive. Although this thesis is not about strategy, or strategizing, I would like to pursue the definition of strategy one step...
CERN. Geneva
2003-01-01
This lecture will focus on the following issues: - The current state of the art in Project Management, especially the integration of Project Management with general management activities, and the integrated view of resources allocation. - Overview of the project life cycle, the phases and the deliverables - Necessity and limits of planning in a research environment - Organizational aspects of the projects the roles of the stakeholders - How to get the resources when they are needed - Risk Management in Projects - Earned value - How to keep a project on track (schedule and budget) - Management of the suppliers - Closing of the project
Jonasson, Haukur Ingi
2013-01-01
How relevant is ethics to project management? The book - which aims to demystify the field of ethics for project managers and managers in general - takes both a critical and a practical look at project management in terms of success criteria, and ethical opportunities and risks. The goal is to help the reader to use ethical theory to further identify opportunities and risks within their projects and thereby to advance more directly along the path of mature and sustainable managerial practice.
Integrated project support environments the ASPECT project
Brown, Alan W
1991-01-01
A major part of software engineering developments involve the use of computing tools which facilitate the management, maintenance, security, and building of long-scale software engineer projects. Consequently, there have been a proliferation of CASE tools and IPSES. This book looks at IPSES in general and the ASPECT project in particular, providing design and implementation details, as well as locating ASPECT in IPSE developments.Survey of integrated project support environments for more efficient software engineering**Description of a large scale IPSE--ASPECT**Evaluation of formal methods in
75 FR 9589 - Agency Information Collection Extension
2010-03-03
.... Respondents to this information collection request are typically the general public to include private... Energy homepage. DOE Directives, Regulations, and Standards Portal, http://www.directives.doe.gov/forms..., Director, Office of Procurement and Assistance Management, Department of Energy. [FR Doc. 2010-4371 Filed 3...
International Journal of Modern Anthropology
African Journals Online (AJOL)
Journal Homepage Image. Some recent rigorous studies in anthropological research begin to provide new conclusions against some classic questionable considerations and /or show increasing tendency to do some syntheses of multidisciplinary data. The revelation of these two events marks the birth of a modern ...
77 FR 9620 - Public Availability of FY 2011 Service Contract Inventories
2012-02-17
...: Office of Procurement and Property Management, Departmental Management, Department of Agriculture. ACTION..., 2010 by the Office of Management and Budget's Office of Federal Procurement Policy (OFPP). OFPP's... inventory on the Office of Procurement and Property Management homepage at the following link: http://www.dm...
Original Researc Original Research
African Journals Online (AJOL)
RAGHAVENDRA
2009-09-17
Sep 17, 2009 ... Science, Technology and Arts Research J. Sci. Technol. ... Journal Homepage: http://www.starjou .... identify genetic variation is indispensable to effective ... breeding experiments and genetic conservation of the ... home garden plot in Benin City situated at Dentistry ..... which is used in forensic science.
Semantics-based publication management using RSS and FOAF
Mika, Peter; Klein, Michel; Serban, Radu
2005-01-01
Listing references to scientific publications on personal or group homepages is a common practice. Doing this in a consistent and structured manner either requires a lot of discipline or a centralized database. Scientific publication, however, is a distributed activity by nature. We present a
Internet Resources for Reference: General Business and Company Information.
Mai, Brent Alan
1997-01-01
Outlines a few of the thousands of Internet sites that are helpful in obtaining general business information and company-specific information, including company directories and homepages, telephone directories, Chambers of Commerce, marketing and advertising, agribusiness, government, cost of living, business schools, and nonprofit business.…
Circumcision weeks: making circumcision part of routine training ...
African Journals Online (AJOL)
2010-07-26
Jul 26, 2010 ... The average age of the patients was 20, and generally, they elected to have medical circumcision ... Senior Family Physician, Pretoria West Hospital, Department of Family Medicine, University of Pretoria ... inverse relationship between prostate cancer and male ..... [homepage on the Internet]. c2010.
Gute Inhalte produzieren und Rahmen schaffen
DEFF Research Database (Denmark)
Pogner, Karl-Heinz
2004-01-01
für den Dialog genutzt werden. Bei der Nutzung digita-ler Kommunikationsformen dominiert die E-Mail. Andere Medien wie Homepages oder TV/Film werden, je nachdem, ob sie der internen oder der externen Kommunikation dienen, als unterschied-lich bedeutsam gewertet. Bei den Mitarbeiterqualifikationen...
DEFF Research Database (Denmark)
Palm, Henrik; Teixidor, Jordi
2015-01-01
searched the homepages of the national heath authorities and national orthopedic societies in West Europe and found 11 national or regional (in case of no national) guidelines including any type of proximal femoral fracture surgery. RESULTS: Pathway consensus is outspread (internal fixation for un...
DEFF Research Database (Denmark)
Kirsch, Reinhard; Balling, N.; Fuchs, Sven
über die Eignung einer Lokation für die geothermische Nutzung. Sie ersetzen nicht die detaillierte geologisch/geophysikalische Untersuchung der Lokation, wie sie in den weiteren Planungsschritten erforderlich ist. Ein schneller Zugang zu den Projektergebnissen ist über die Homepage von GEUS (www...
Sokoto Journal of Veterinary Sciences
African Journals Online (AJOL)
Journal Homepage Image. The Journal publishes original research articles related to veterinary sciences, including livestock health and production, diseases of wild life and fish, preventive veterinary medicine and zoonoses among others. Case reports, review articles and editorials are also accepted. Other sites related to ...
PSB goes personal: The failure of personalised PSB web pages
DEFF Research Database (Denmark)
Sørensen, Jannick Kirk
2013-01-01
Between 2006 and 2011, a number of European public service broadcasting (PSB) organisations offered their website users the opportunity to create their own PSB homepage. The web customisation was conceived by the editors as a response to developments in commercial web services, particularly social...
77 FR 8818 - Publication of FY 2011 Service Contract Inventory
2012-02-15
...'s guidance is available at: http://www.whitehouse.gov/sites/defualt/files/omb/procuremetn/memo... the inventory on the Bureau's Open Government homepage at the following link: http://www.consumerfinance.gov/open/ , specifically at http://www.consumerfinance.gov/wp-content/uploads/2012/01/Appendix-C...
Neues Suchportal mit Aquabrowser in der Vorarlberger Landesbibliothek
Rädler, Karl
2011-01-01
The regional library of Vorarlberg implements AquaBrowser from Serials Solutions of Bowker Company. From the user's view the search engine should be integrated with the homepage to a homogeneous search portal. Beginning with deficits of traditional OPACs the decision for AquaBrowser is explained.
1980-01-01
The ASEAN Population Expert Group met in Manila and was followed by a meeting of the ASEAN heads of population programs, during the period November 5-10, 1979. Heads of population programs from Indonesia, Malaysia, Singapore, Thailand, and the Philippines attended. The meetings were held to review progress-to-date on phase 1 projects and to consider the development of an expanded population program. 5 projects funded by UNFPA are reviewed in tabular form with the project, the sponsoring country, date of implementation, data analysis, and date of completion. Suggestions were made for improving and extending these projects and it was also suggested that all projects being developed and proposed should include a section on use of research. 7 new projects were proposed as phase 2 projects. The 1st, sponsored by Malaysia, deals with women in development; project 2, lead by Thailand, will investigate population movement and its effect on development; project 3, led by the Philippines, will develop and strengthen national population information systems and networks in ASEAN countries; project 4, led by Indonesia, is directed towards institutional development and exchanges of personnel; project 5, led by the Philippines, will examine population and development dynamics and the man/resources balance; project 6, led by Thailand, will develop ASEAN social indicators; and project 7, led by Indonesia and Malaysia, will make a comprehensive analysis of existing medical/health care and family planning systems. It was recommended that an executive director of the proposed ASEAN population coordination unit should be appointed to expedite the recommendations of the meeting related to preparation and submission of phase 2 project proposals.
DEFF Research Database (Denmark)
Svejvig, Per; Ehlers, Michael; Adland, Karoline Thorp
activities carried out within the framework of the projects. The formal part of Project Half Double was initiated in June 2015. We started out by developing, refining and testing the Half Double methodology on seven pilot projects in the first phase of the project, which will end June 2016. The current......Project Half Double has a clear mission to succeed in finding a project methodology that can increase the success rate of our projects while increasing the speed at which we generate new ideas and develop new products and services. Chaos and complexity should be seen as a basic condition...... and as an opportunity rather than a threat and a risk. We are convinced that by doing so, we can strengthen Denmark’s competitiveness and play an important role in the battle for jobs and future welfare. The overall goal is to deliver “projects in half the time with double the impact”, where projects in half the time...
Integrated project risk management of nuclear power projects
International Nuclear Information System (INIS)
Wang Xiaohui; Xu Yuanhui
2001-01-01
The concept and the features of risks in nuclear power projects are introduced, and in terms of nuclear power projects' own features, the Nuclear Power Project Integrated Risk Management Model is presented. The identification, estimation, evaluation, response plan development, control of risks and the theoretical basis of risk management are discussed. The model has feedback and control functions in order to control and manage the risks dynamically
REPNET: project scheduling and workflow optimization for Construction Projects
Directory of Open Access Journals (Sweden)
Marco Alvise Bragadin
2013-10-01
Full Text Available Project planning and control are core processes for construction management. In practice project planning is achieved by network - based techniques like Precedence Diagramming Method (PDM.Indeed many researchers and practitioners claims that networking techniques as such do not provide a suitable model for construction projects. Construction process modeling should incorporate for specific features of resource flows through project activities. So an improved resource scheduling method for construction is developed, called REPNET, based on a precedence network plotted on a resource–space chart and presented with a flow-line chart. The heuristics of REPNET are used to carry out resource timing while optimizing processes flows and resource usage. The method has been tested on a sample project.
Directory of Open Access Journals (Sweden)
Zubović Jovan
2004-01-01
Full Text Available This paper looks at the difficulties of managing modem capital projects and endeavors to reduce the complexities to simpler and more understandable terms. It examines the project environment, defines project management and discusses points of difference from traditional management. In the second part of the paper are presented fundamentals for project success for different types of projects.
Competency model for the project managers of technical projects
Duncan, William R.
1992-05-01
Traditional job description techniques were developed to support compensation decisions for hourly wage earners in a manufacturing environment. Their resultant focus on activities performed on the job works well in this environment where the ability to perform the activity adequately is objectively verifiable by testing and observation. Although many organizations have adapted these techniques for salaried employees and service environments, the focus on activities performed has never been satisfactory. For example, stating that a project manager `prepares regular project status reports' tells us little about what to look for in a potential project manager or how to determine if a practicing project manager is ready for additional responsibilities. The concept of a `competency model' has been developed within the last decade to address this shortcoming. Competency models focus on what skills are needed to perform the tasks defined by the job description. For example, a project manager must be able to communicate well both orally and in writing in order to `prepare regular project status reports.'
PROJECT SCOPE MANAGEMENT PROCESS
Directory of Open Access Journals (Sweden)
Yana Derenskaya
2018-01-01
Full Text Available The purpose of the article is to define the essence of project scope management process, its components, as well as to develop an algorithm of project scope management in terms of pharmaceutical production. Methodology. To carry out the study, available information sources on standards of project management in whole and elements of project scope management in particular are analysed. Methods of system and structural analysis, logical generalization are used to study the totality of subprocesses of project scope management, input and output documents, and to provide each of them. Methods of network planning are used to construct a precedence diagram of project scope management process. Results of the research showed that components of the project scope management are managing the scope of the project product and managing the content of project work. It is the second component is investigated in the presented work as a subject of research. Accordingly, it is defined that project scope management process is to substantiate and bring to the realization the necessary amount of work that ensures the successful implementation of the project (achievement of its goal and objectives of individual project participants. It is also determined that the process of managing the project scope takes into account the planning, definition of the project scope, creation of the structure of project work, confirmation of the scope and management of the project scope. Participants of these subprocesses are: customer, investor, and other project participants – external organizations (contractors of the project; project review committee; project manager and project team. It is revealed that the key element of planning the project scope is the formation of the structure of design work, the justification of the number of works, and the sequence of their implementation. It is recommended to use the following sequence of stages for creating the structure of project work
Project risk management: A review of an institutional project life cycle
Directory of Open Access Journals (Sweden)
Wanjiru Gachie
2017-11-01
Full Text Available This article is a desktop analysis of project risk management involving a project management institutional restructuring. The pragmatic nature of this research allows for the literature review and the document analysis to be integrated and presented as both a descriptive and analytical research. The analysis demonstrates that the project committee did not proactively manage project risk. The restructuring was a change management project, entailing the implementation of many organisational changes, such as restructuring, lay-off of some part of the administrative workforce, adoption of new technology, provision of new approaches to well-established procedures, and implementation of new performance initiative, the process which should have been managed with an effective integrated risk strategy and plan. Analysis of the restructuring project risk management exhibits little evidence of a systematic (computer based or manual record that should have provided policies, procedures, and structures for managing risk. The article concludes that the restructuring risk process was inadequate and it could not have ensured a successful project. An analysis of the restructuring project risk monitoring and control exhibits a reactive rather than proactive application of risk management procedures. The analysis further indicates that the committee failed to make use of the various project risk management processes, standards, and guidelines. Based on the conclusions, the article recommends that project risk planning, strategy, control, and monitoring should be put in place for future institutional projects. The project management team should also put in place procedures for primary stakeholders engagements, identify and address their nature of interest and power in future risk management projects
Lynch, Margaret M.
2013-01-01
This study explores the meaning project managers (PMs) make of their project environment, how they lead their teams and have incorporate complexity into their project management approach. The exploration of the PM's developmental level and meaning making offers a different angle on the project management and leadership literature. The study…
Overlapping Boundaries of the Project Time Management and Project Risk Management
Directory of Open Access Journals (Sweden)
Marius PODEAN
2010-01-01
Full Text Available Based on utility function, milestones during project and/or the end of projects or programme may be categorized in what are called soft-deadline and hard-deadline. In contrast with the soft-end projects, the hard-end projects posses a decrease of utility function with a vertical asymptote character around the deadline for project completion. In extreme situations, the utility function itself may fall under zero (projects may generate losses to both constructor and customer. Existing risk analysis methodologies observe risks from monetary terms. The typical risks are correlated with an increase in final project costs. In order to estimate harddeadline milestones and/or end of projects or programme is critical to employ the time dimension rather than the typical cost-based risk analysis. Here, we comprehensively describe a structured methodology that focuses on minimizing and mitigating project specific delay risks. The method may supplement existing cost-based risk analysis in projects. We aim to elegantly combine moderation techniques to reveal the intrinsic risk of the projects. In addition to the technical risks, the moderation techniques are able to bring evidence of risks as the team efficacy, diverse un-correlations or miss-understanding about the roles of the team members in the team – most of the project soft risk. Described methodology encourages the common understanding of risks for participants, crystallizing the essence of what can go wrong in complex situations and where the opportunities can be unlocked.
DEFF Research Database (Denmark)
Frøkjær, E.; Hornbæk, K.; Høegh, Rune Thaarup
2006-01-01
This paper provides experience from activities in the USE project. The USE project is a research project that aims at bridging the gap between usability evaluation and user interface design. It is conducted from 2005 to 2008 in collaboration between researchers from Aalborg University and Copenha......This paper provides experience from activities in the USE project. The USE project is a research project that aims at bridging the gap between usability evaluation and user interface design. It is conducted from 2005 to 2008 in collaboration between researchers from Aalborg University...... and Copenhagen University, and developers and managers working in software development organizations....
African Journals Online (AJOL)
Journal Homepage Image. The journal has a multidisciplinary focus. It is not intended ... Influence of Parenting Styles on Psychological Well-Being and School Adjustment of Secondary School Adolescents in Bayelsa State, Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.
Promoting Japan and South Korea’s Role in East Asian Security
2010-02-01
activity. 29 The Spratly Islands are currently claimed by China, Taiwan, Vietnam, Malaysia , Brunei, and the Philippines30 while the Paracel Islands...The National Diet of Japan, The Constitution of Japan, November 3, 1946, linked from the House of Councillors Homepage, http://www.sangiin.go.jp/eng
Journal of Student Affairs in Africa
African Journals Online (AJOL)
... Advanced Search · Current Issue · Archives. Journal Homepage Image. The Journal of Student Affairs in Africa (JSAA) is an independent, peer-reviewed, multi-disciplinary, open-access academic journal that publishes scholarly research and reflective discussions about the theory and practice of student affairs in Africa.
Journal of Science and Sustainable Development
African Journals Online (AJOL)
Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives. Journal Homepage Image. Annually, Uganda Martyrs University's School of Postgraduate Studies and Research produces the Journal of Science and Sustainable Development (JSSD) (ISSN: 2070-1748). The goal of the Journal is to ...
What is beautiful is useful: visual appeal and expected information quality
van der Geest, Thea; van Dongelen, Raymond
2009-01-01
Would users, when having a first glance on websites, expect that visually appealing websites contain better information than websites that are less appealing? And if they looked longer, would that change their judgment? We created two versions for 12 homepages of websites, one with low visual
Research Article Special Issue
African Journals Online (AJOL)
pc
2018-05-01
May 1, 2018 ... using unified (data + system) stack seems to be the target for attacks. ... maintain two stack pointers to manage the dual stack operation. ... memory and allocated memory from the processor and operating system. ..... Workshop on architectural support for security and anti-virus (WASSA) Homepage archive,.
NWS Water Resource Services Branch Division
the NWS homepage NWS Water Resources Program OS Home News Organization Search Search Home About Us Water Resources Policy Flood Loss Data AHPS Program Office (OHD) AHPS Software Development Hydrology Lab AHPS Toolbox Flood Safety Service Hydrology Program Turn Around Don't Drown! High Water Mark Signs
Accessing antiretroviral therapy for children: Caregivers' voices
African Journals Online (AJOL)
Margaret (Maggie) Williams
ScienceDirect journal homepage: http://ees.elsevier.com/hsag/default.asp ... inability of their caregivers to travel the distance requisite to accessing ... and describe the experiences of caregivers accessing ART for .... In this study credibility was facilitated by the researchers ensuring that .... educational assets to assist them.
Characteristics of patients presenting with complications of abortion ...
African Journals Online (AJOL)
2012-05-25
May 25, 2012 ... They are also more likely to avoid paying the physician's fee, ... Most of the patients were aware of contraception, but usage, which mainly constituted emergency contraception, was .... relationships that may have inappropriately influenced them ... Federation of America [homepage on the Internet]. c2013.
Doing Web history with the Internet Archive : Screencast documentaries
Rogers, R.
2017-01-01
Among the conceptual and methodological opportunities afforded by the Internet Archive, and more specifically, the WayBack Machine, is the capacity to capture and “play back” the history a web page, most notably a website's homepage. These playbacks could be construed as “website histories”,
Journal of Applied Sciences and Environmental Management
African Journals Online (AJOL)
Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives. Journal Homepage Image. The journal publishes original research findings and occasional interpretative reviews on the toxic effects in plants, animals or humans of natural or synthetic chemical occurring in the human environment.
Journal of the Obafemi Awolowo University Medical Student's ...
African Journals Online (AJOL)
Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives. Journal Homepage Image. IFEMED Journal is the official publication of Obafemi Awolowo University Medical Students' Association, Ile-Ife , Nigeria . The Journal Club periodically publishes articles on medical and medically related topics ...
African Journals Online (AJOL)
Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives. Journal Homepage Image. Chemsearch Journal is a peer – reviewed journal that publishes original research work, scientific papers and technical reports in all the field of Chemistry (pure science, agriculture, environmental science, ...
Professional nurses' understanding of clinical judgement: A ...
African Journals Online (AJOL)
Anna C. van Graan
explorative and descriptive qualitative design was followed in this study to reach ... tent analysis principles were applied during data analysis. ... journal homepage: http://ees.elsevier.com/hsag/default.asp .... perspective of professional nurses within a specific contex- ... method was appropriate and effective to collect a large.
37 CFR 370.2 - Notice of use of sound recordings under statutory license.
2010-07-01
... BOARD, LIBRARY OF CONGRESS NOTICE AND RECORDKEEPING REQUIREMENTS FOR STATUTORY LICENSES NOTICE AND... gain access to the online Web site or homepage of the Service, or where information may be posted under... obtained from the Copyright Office or to: Library of Congress, Copyright Office, Licensing Division, 101...
Conjoint utility analysis of technical maturity and project progress of construction project
Directory of Open Access Journals (Sweden)
Ma Wei
2016-01-01
Full Text Available In this paper, taking construction project as the research object, the relationship between the project maturity index calculated by the construction project technical risks with different fine degree and the project progress index is studied, and the equilibrium relationship between the Party A’s utility curve and the Party B’s cost curve of using project maturity index and project progress index as the research variables is analyzed. The results show that, when the construction project technical risk division is more precise, the conjoint utility of the project's technical maturity index and the project progress is higher, and the project’s Party A and Party B two sides are closer to the optimal equilibrium. This shows that the construction project technical risk must be finely divided, and managed and controlled respectively, which will help to improve the conjoint utility of the project Party A and Party B two sides.
Final Project Report Project 10749-4.2.2.1 2007-2009
Energy Technology Data Exchange (ETDEWEB)
Zacher, Alan H.; Holladay, Johnathan E.; Frye, J. G.; Brown, Heather M.; Santosa, Daniel M.; Oberg, Aaron A.
2009-05-11
This is the final report for the DOE Project 10749-4.2.2.1 for the FY2007 - FY2009 period. This report is non-proprietary, and will be submitted to DOE as a final project report. The report covers activities under the DOE Project inside CRADA 269 (Project 53231) as well as project activites outside of that CRADA (Project 56662). This is the final report that is summarized from the non-proprietary quarterlies submitted to DOE over the past 2.5 years, which in turn are summaries from the proprietary technical reporting to UOP.
International Nuclear Information System (INIS)
1994-02-01
The Department of Energy (DOE) established the Office of Technology Development (EM-50) (OTD) as an element of Environmental Restoration and Waste Management (EM) in November, 1989. OTD has begun to search out, develop, test and demonstrate technologies that can now or in the future be applied to the enormous remediation problem now facing the DOE and the United States public in general. Technology demonstration projects have been designed to attack a separate problem as defined by DOE. The Heavy Metals Contaminated Soil Project was conceived to test and demonstrate off-the-shelf technologies (dominantly from the mining industry) that can be brought to bear on the problem of radionuclide and heavy metal contamination in soils and sediments. The Resource Recovery Project is tasked with identifying, developing, testing, and evaluating new and innovative technologies for the remediation of metal contaminated surface and groundwater. An innovative twist on this project is the stated goal of recovering the metals, formerly disposed of as a waste, for reuse and resale, thereby transforming them into a usable resource. Finally, the Dynamic Underground Stripping Project was developed to demonstrate and remediate underground spills of hydrocarbons from formations that are (1) too deep for excavation, and/or (2) require in-situ remediation efforts of long duration. This project has already been shown effective in reducing the time for remediation by conventional methods from an estimated 200 years at the Lawrence Livermore National Laboratory (LLNL) to less than one year. The savings in time and dollars from this technology alone can be immeasurable
Young, Trevor L
2016-01-01
Successful Project Management, 5th edition, is an essential guide for anyone who wants to improve the success rate of their projects. It will help managers to maintain a balance between the demands of the customer, the project, the team and the organization. Covering the more technical aspects of a project from start to completion it contains practised and tested techniques, covering project conception and start-up, how to manage stake holders, effective risk management, project planning and launch and execution. Also including a brand new glossary of key terms, it provides help with evaluating your project as well as practical checklists and templates to ensure success for any ambitious project manager. With over one million copies sold, the hugely popular Creating Success series covers a wide variety of topic, with the latest editions including new chapters such as Tough Conversations and Treating People Right. This indispensable business skills collection is suited to a variety of roles, from someone look...
Reflexive project management in high-abition projects
Loeber, Anne; Vermeulen, T.
2016-01-01
Purpose
The Aristotelian notion of phronèsis inspired innovative work in the realm of project management as well as in literature on sustainability and societal transformations. We argue that both literatures may benefit from a dialogue between the two, especially in view of outlining project
Project brief of pre-contract in project management
International Nuclear Information System (INIS)
Mohd Jamil Hashim; Mohd Azmi Sidid Omar; Abdul Rahman Norazumin; Zakaria Dris; Abdul Murad Abu Bakar; Alwi Othman
2010-01-01
Project brief is a comprehensive document used in translating the user needs and requirement for the project implementation. This document is important for the designer as a main guidance towards establishing project details. Research shown that problem usually arises from not well-defined scope and needs by the user. With lack of information the designer tend to assume and interprets wrong translation. Other issues arise from project management are time, cost, budgetary, lack of communication and establishing quality management. Some ideas of improvement were gain by doing cross reference with JKR quality system management, workshop and brainstorming. It shows that an improvement of data collection system has to be integrating with some basic format details, drawings and declaration forms to be established. (author)
DEFF Research Database (Denmark)
Pedersen, Keld
2016-01-01
for initiation. Most of the research on project selection is normative, suggesting new methods, but available empirical studies indicate that many methods are seldom used in practice. This paper addresses the issue by providing increased understanding of IT project selection practice, thereby facilitating...... the development of methods that better fit current practice. The study is based on naturalistic decision-making theory and interviews with experienced project portfolio managers who, when selecting projects, primarily rely on political skills, experience and personal networks rather than on formal IT project......-selection methods, and these findings point to new areas for developing new methodological support for IT project selection....
The role of project planning in project management
Klitsenko, A. I.; Клиценко, А. И.
2013-01-01
This article describes the importance of the process of project planning. The author gives irrefutable arguments concerning crucial role of project planning. This article presents the definition, objects and the main goal of project planning. The purpose of this article is to review such objects of project planning as project scope, risk and human resources. Данная статья описывает важность процесса проектного планирования. Автор дает неопровержимые доводы, касающиеся решающей роли проектн...
ASP project. Dissolved oxygen issues in ASP project
Directory of Open Access Journals (Sweden)
M.Y. Bondar
2018-03-01
Full Text Available The article presents the latest results of studies about the effect of dissolved oxygen on the efficiency of the ASP flooding project implemented by Salym Petroleum Development N.V.. Pilot project on experimental injection of anionic surfactant solutions, soda and polymer into the reservoir for enhanced oil recovery (ASP project has been implemented since 2016. The stability of one of the components of the ASP polymer is strongly dependent on the presence of iron, stiffness cations and dissolved oxygen in the water. Since the polymer is used for injection at two stages of the project, which are essential and the longest, at the design stage of ASP project a whole complex of polymer protection had been established against negative factors, in particular from the influence of oxygen, which causes not only oxygen corrosion but also irreversible destruction polymer chains. In the paper, studies on the stability of polymer solutions are described, an analysis of viscosity loss with time in the presence of iron and oxygen for polymer solutions is carried out. The choice of chemical deoxygenation method for the control of dissolved oxygen is substantiated. The program of laboratory studies of the ASP project and the analytical instruments used are described. The technological scheme of the ASP process is presented, and recommendations for the implementation of the technology are given.
Projective geometry and projective metrics
Busemann, Herbert
2005-01-01
The basic results and methods of projective and non-Euclidean geometry are indispensable for the geometer, and this book--different in content, methods, and point of view from traditional texts--attempts to emphasize that fact. Results of special theorems are discussed in detail only when they are needed to develop a feeling for the subject or when they illustrate a general method. On the other hand, an unusual amount of space is devoted to the discussion of the fundamental concepts of distance, motion, area, and perpendicularity.Topics include the projective plane, polarities and conic sectio
Projective measure without projective Baire
DEFF Research Database (Denmark)
Schrittesser, David; Friedman, Sy David
We prove that it is consistent (relative to a Mahlo cardinal) that all projective sets of reals are Lebesgue measurable, but there is a ∆13 set without the Baire property. The complexity of the set which provides a counterexample to the Baire property is optimal.......We prove that it is consistent (relative to a Mahlo cardinal) that all projective sets of reals are Lebesgue measurable, but there is a ∆13 set without the Baire property. The complexity of the set which provides a counterexample to the Baire property is optimal....
Project Planning and Implementation: Lessons Learned From the AQBMP Project
National Research Council Canada - National Science Library
1997-01-01
...). This NSRP report is funded as an addendum to the Air Quality Best Management Practices (AQBMP) project (N1 -944). The AQBMP project was completed using an intensive project planning process using a variety of quality management tools...
One project's waste is another project's resource
International Nuclear Information System (INIS)
Short, J.
1997-01-01
The author describes the efforts being made toward pollution prevention within the DOE complex, as a way to reduce overall project costs, in addition to decreasing the amount of waste to be handled. Pollution prevention is a concept which is trying to be ingrained into project planning. Part of the program involves the concept that ultimately the responsibility for waste comes back to the generator. Parts of the program involve efforts to reuse materials and equipment on new projects, to recycle wastes to generate offsetting revenue, and to increase awareness, accountability and incentives so as to stimulate action on this plan. Summaries of examples are presented in tables
Ambidextrous Leadership and Sustainability-Based Project Performance: The Role of Project Culture
Directory of Open Access Journals (Sweden)
Junwei Zheng
2017-12-01
Full Text Available Most studies in the project management field emphasized the effects of leaders or managers, but these effects have rarely been examined at the project level. To cover this research gap, this study applies organizational ambidexterity theory to examine the effects among ambidextrous leadership, ambidextrous culture and sustainability-based project performance. Using a valid sample of 217 project leaders and members from Chinese construction projects, the method of multiple linear regression was adopted to assess the direct relationship among ambidextrous leadership, ambidextrous culture and project performance. Moreover, the bootstrapping technique through structural equation modeling, has been used to analyze the mediating effect of ambidextrous culture. Additionally, the sample data was divided into different groups according to the median value of the variables to conduct the ANOVA and to assess the within-group differences. The results indicated a positive and direct relationship that ambidextrous leadership has on project performance and ambidextrous culture. In addition, there was also a mediating impact of ambidextrous leadership on project performance via ambidextrous culture. Thus, ambidextrous leadership combined with transformational leadership as well as transactional leadership likely has a stronger positive impact on project performance through fostering the adaptive culture and consistent culture. Our findings contribute to an in-depth understanding of the role of the leader and culture for project outcomes. The project-based organization in construction projects could train project leaders’ ambidextrous leadership behavior to facilitate the formation of an ambidextrous culture and to increase project performance. Moreover, this study enriches the existing literature on leadership and project management by highlighting the important path of ambidextrous leadership and ambidextrous culture on the performance at the project level
Managing complex, high risk projects a guide to basic and advanced project management
Marle, Franck
2016-01-01
Maximizing reader insights into project management and handling complexity-driven risks, this book explores propagation effects, non-linear consequences, loops, and the emergence of positive properties that may occur over the course of a project. This book presents an introduction to project management and analysis of traditional project management approaches and their limits regarding complexity. It also includes overviews of recent research works about project complexity modelling and management as well as project complexity-driven issues. Moreover, the authors propose their own new approaches, new methodologies and new tools which may be used by project managers and/or researchers and/or students in the management of their projects. These new elements include project complexity definitions and frameworks, multi-criteria approaches for project complexity measurement, advanced methodologies for project management (propagation studies to anticipate potential behaviour of the project, and clustering approaches...
Managing a project's legacy: implications for organizations and project management
Cooper, Lynne P.; Hecht, Michael H.; Majchrzak, Ann
2003-01-01
Organizations that rely on projects to implement their products must find effective mechanisms for propagating lessons learned on one project throughout the organization. A broad view of what constitutes a project's 'legacy' is presented that includes not just the design products and leftover parts, but new processes, relationships, technology, skills, planning data, and performance metrics. Based on research evaluating knowledge reuse in innovative contexts, this paper presents an approach to project legacy management that focuses on collecting and using legacy knowledge to promote organizational learning and effective reuse, while addressing factors of post-project responsibility, information obsolescence, and the importance of ancillary contextual information. .
The Environmental Management Project Manager's Handbook for improved project definition
International Nuclear Information System (INIS)
1995-02-01
The United States Department of Energy (DOE) is committed to providing high quality products that satisfy customer needs and are the associated with this goal, DOE personnel must possess the knowledge, skills, and abilities to ensure successful job performance. In addition, there must be recognition that the greatest obstacle to proper project performance is inadequate project definition. Without strong project definition, DOE environmental management efforts are vulnerable to fragmented solutions, duplication of effort, and wastes resources. The primary means of ensuring environmental management projects meet cost and schedule milestones is through a structured and graded approach to project definition, which is the focus of this handbook
Lessons Learned from Client Projects in an Undergraduate Project Management Course
Pollard, Carol E.
2012-01-01
This work proposes that a subtle combination of three learning methods offering "just in time" project management knowledge, coupled with hands-on project management experience can be particularly effective in producing project management students with employable skills. Students were required to apply formal project management knowledge to gain…
Project management. A discipline which contributes to project success
International Nuclear Information System (INIS)
Hoch, G.
2008-01-01
The presentation covers the following topics: description of the Project - a contract was signed between KNPP and European Consortium Kozloduy (ECK) consisting of Framatome ANP GmbH as Leader (63%), Framatome ANP S.A.S. (17%), Atomenergoexport (20%) ; Project management in the modernization of NPP Kozloduy units 5 and 6; Project management process within AREVA NP GmbH; current status
Muir, Nancy C
2010-01-01
A friendly reference guide to Microsoft Project, the leading enterprise project management software. As project management software, Microsoft Project allows you to oversee your business activities effectively. You can manage resources, share project info, perform modeling and scenario analysis, and standardize reporting processes. This easy-to-understand guide is completely updated to cover the latest changes and newest enhancements to Project 2010 and shows you how to get Project 2010 to work for you. After an introduction to basic project management concepts, you'll discover the mechanics o
Next Generation Nuclear Plant Project Preliminary Project Management Plan
International Nuclear Information System (INIS)
Dennis J. Harrell
2006-01-01
This draft preliminary project management plan presents the conceptual framework for the Next Generation Nuclear Plant (NGNP) Project, consistent with the authorization in the Energy Policy Act of 2005. In developing this plan, the Idaho National Laboratory has considered three fundamental project planning options that are summarized in the following section. Each of these planning options is literally compliant with the Energy Policy Act of 2005, but each emphasizes different approaches to technology development risks, design, licensing and construction risks, and to the extent of commercialization support provided to the industry. The primary focus of this draft preliminary project management plan is to identify those activities important to Critical Decision-1, at which point a decision on proceeding with the NGNP Project can be made. The conceptual project framework described herein is necessary to establish the scope and priorities for the technology development activities. The framework includes: A reference NGNP prototype concept based on what is judged to be the lowest risk technology development that would achieve the needed commercial functional requirements to provide an economically competitive nuclear heat source and hydrogen production capability. A high-level schedule logic for design, construction, licensing, and acceptance testing. This schedule logic also includes an operational shakedown period that provides proof-of-principle to establish the basis for commercialization decisions by end-users. An assessment of current technology development plans to support Critical Decision-1 and overall project progress. The most important technical and programmatic uncertainties (risks) are evaluated, and potential mitigation strategies are identified so that the technology development plans may be modified as required to support ongoing project development. A rough-order-of-magnitude cost evaluation that provides an initial basis for budget planning. This
African Journals Online (AJOL)
home
2014-02-16
Feb 16, 2014 ... ISSN: 2226-7522(Print) and 2305-3327 (Online). Science, Technology and Arts Research Journal. Sci. Technol. Arts Res. J., Jan-March 2014, 3(1): 132-135. Journal Homepage: http://www.starjournal.org/. Antibacterial Activity of Three Parmotrema Species from Western Ghats of. Karnataka against Clinical ...
African Journals Online (AJOL)
Journal Homepage Image. Zimbabwe Veterinary Journal contains original and review papers on all aspects of animal health in Zimbabwe and SADC countries, including articles by non-veterinarians. This journal did not publish any issues between 2002 and 2015 but has been revived and and it actively accepting papers ...
South African Gastroenterology Review
African Journals Online (AJOL)
Journal Homepage Image. The South African Gastroenterology Reviewis written by specialists in the field. Its aim is to publish articles pertinent to the practising Gastroenterologist in South Africa. It is distributed to a broad spectrum of clinicians who have an interest in clinical gastroenterology and hepatology. Other websites ...
Smithsonian Marine Station (SMS) at Fort Pierce
share current Smithsonian research on the plants and animals of the Indian River Lagoon and marine Smithsonian Marine Station at Fort Pierce Website Search Box Search Field: SMS Website Search Twitter SMS Home ⺠Welcome to the Smithsonian Marine Station Homepage slideshow Who We Are... The
African Journals Online (AJOL)
Journal Homepage Image. Ergonomics SA (esa) provides a medium for publication of material relevant to occupational conditions and needs in Southern Africa at a time of change unparalleled in history. To this end the journal accepts articles in the following categories: research papers, review articles, conceptual theories, ...
Delivering an Alternative Medicine Resource to the User's Desktop via World Wide Web.
Li, Jie; Wu, Gang; Marks, Ellen; Fan, Weiyu
1998-01-01
Discusses the design and implementation of a World Wide Web-based alternative medicine virtual resource. This homepage integrates regional, national, and international resources and delivers library services to the user's desktop. Goals, structure, and organizational schemes of the system are detailed, and design issues for building such a…
The use of EORTC measures in daily clinical practice—A synopsis of a newly developed manual
DEFF Research Database (Denmark)
Wintner, Lisa M; Sztankay, Monika; Aaronson, Neil
2016-01-01
possible and to encourage readers and end-users of EORTC measures to contribute to further needed high-quality research. The manual will be accessible on the EORTC Quality of Life Group website's homepage and will be periodically updated to take into account any new knowledge due to medical, technical...
African Journals Online (AJOL)
Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives. Journal Homepage Image. Agrosearch aims to create an effective medium for dissemination of information on research findings in all areas of agriculture, food sciences and development. The journal publishes original articles and short ...
2013-07-24
... Headquarters Library, Room Number 3334 in the EPA West Building, located at 1301 Constitution Ave. NW... homepage at http://www.epa.gov/epahome/dockets.htm . For additional instructions on submitting comments, go... Library, Room Number 3334 in the EPA West Building, located at 1301 Constitution Ave. NW., Washington, DC...
2010-12-22
..., Environmental Protection Agency in the EPA Headquarters Library, Room Number 3334 in the EPA West Building... EPA's public docket, visit the EPA Docket Center homepage at http://www.epa.gov/epahome/dockets.htm... Air and Radiation Docket and Information Center is in the EPA Headquarters Library, Room Number 3334...
2013-11-21
...-0694, Environmental Protection Agency in the EPA Headquarters Library, Room Number 3334 in the WJC West... homepage at http://www.epa.gov/epahome/dockets.htm . For additional instructions on submitting comments, go... Library, Room Number 3334 in the WJC West Building, located at 1301 Constitution Ave. NW., Washington, DC...
From Project Management to Process Management - Effectively Organising Transdisciplinary Projects
Moschitz, Heidrun
2013-01-01
In transdisciplinary projects, the roles of researchers change. In addition to being a source of knowledge, they are required to engage in knowledge exchange processes. This results in an alteration at project level: researchers need to creatively manage projects as group processes.
Marlim project finance; 'Project finance' de Marlim
Energy Technology Data Exchange (ETDEWEB)
D' Almeida, Albino Lopes [PETROBRAS, Rio de Janeiro, RJ (Brazil)
2004-07-01
Project Finance is often used worldwide to raise the funds to develop big projects, particularly in the area of power and infra-structure. It is designed to support a singular project and a specific purpose company is created to obtain the financing. The debt payment is secured by the enterprise's cash flow, avoiding real guarantee requirements. The lenders receive the future revenues and the property of the assets to be built. The risks are mitigated by agreements exhaustively negotiated among the parties. One of the most important Project Finances performed in Brazil is the Marlim Project, structured in order to complete the development of the Marlim oil field. This is the biggest Brazilian oil field, producing more than 500,000 barrels a day, almost 35% of the national production. This paper presents the general concepts related to this type of financing and general information about the project, including its structuring, negotiation and closing. The total commitment reaches US$ 1.5 billion obtained in both domestic and international markets through equity, bridge loan, bonds and commercial papers. Its whole life is 10 years, using 2 special purpose companies in its configuration. (author)
DEFF Research Database (Denmark)
Rolstadås, Asbjørn; Pinto, Jeffrey K.; Falster, Peter
2015-01-01
To add value to project performance and help obtain project success, a new framework for decision making in projects is defined. It introduces the project decision chain inspired by the supply chain thinking in the manufacturing sector and uses three types of decisions: authorization, selection......, and plan decision. A primitive decision element is defined where all the three decision types can be accommodated. Each task in the primitive element can in itself contain subtasks that in turn will comprise new primitive elements. The primitive elements are nested together in a project decision chain....
Project management with dynamic scheduling baseline scheduling, risk analysis and project control
Vanhoucke, Mario
2013-01-01
The topic of this book is known as dynamic scheduling, and is used to refer to three dimensions of project management and scheduling: the construction of a baseline schedule and the analysis of a project schedule's risk as preparation of the project control phase during project progress. This dynamic scheduling point of view implicitly assumes that the usability of a project's baseline schedule is rather limited and only acts as a point of reference in the project life cycle.
Pilot Project: analysis, development and projection
Tapia Abril, Verónica Emilia; Chérrez Rodas, Karina; García Pesántez, Gabriela Rosana; Maldonado Marchán, María Elisa; Bustamante Montesdeoca, José Luis
2014-01-01
Since the introduction of ICT in architecture and teaching, pedagogies of education have faced their learning paradigms change. Institutes of higher education have folded to this motion and have undergone a process of change by implementing multimedia elements in their subjects. Through the pilot project educational videos that aim to meet the highest standards of educational videos described by Van Dam have been developed. The project expects to generate educational videos for different depa...
Adaptation of Agile Project Management Methodology for Project Team
Directory of Open Access Journals (Sweden)
Rasnacis Arturs
2015-12-01
Full Text Available A project management methodology that defines basic processes, tools, techniques, methods, resources and procedures used to manage a project is necessary for effective and successful IT project management. Each company needs to define its own methodology or adapt some of the existing ones. The purpose of the research is to evaluate the possibilities of adapting IT project development methodology according to the company, company employee characteristics and their mutual relations. The adaptation process will be illustrated with a case study at an IT company in Latvia where the developed methodology is based on Agile Scrum, one of the most widespread Agile methods.
International Nuclear Information System (INIS)
Anon.
1979-01-01
An engineering project office was established during the fall of 1976 to manage and coordinate all of the activities of the Electron Beam Fusion Project. The goal of the project is to develop the Electron Beam Fusion Accelerator (EBFA) and its supporting systems, and integrate these systems into the new Electron Beam Fusion Facility (EBFF). Supporting systems for EBFA include a control/monitor system, a data acquistion/automatic data processing system, the liquid transfer systems, the insulating gas transfer systems, etc. Engineers and technicians were assigned to the project office to carry out the engineering design, initiate procurement, monitor the fabrication, perform the assembly and to assist the pulsed power research group in the activation of the EBFA
Traditional Project Management and the Visual Workplace Environment to Improve Project Success
Fichera, Christopher E.
2016-01-01
A majority of large IT projects fail to meet scheduled deadlines, are over budget and do not satisfy the end user. Many projects fail in spite of utilizing traditional project management techniques. Research of project management has not identified the use of a visual workspace as a feature affecting or influencing the success of a project during…
The project manager's desk reference: project planning, schedulding, evaluation, control, systems
National Research Council Canada - National Science Library
Lewis, James P
2007-01-01
In this Third Edition of The Project Manager's Desk Reference, top project management consultant James Lewis arms you with today's most comprehensive and understandable project management resources...
DEFF Research Database (Denmark)
Rasmussen, Troels A.; Merritt, Timothy R.
2017-01-01
CNC cutting machines have become essential tools for designers and architects enabling rapid prototyping, model-building and production of high quality components. Designers often cut from new materials, discarding the irregularly shaped remains. We introduce ProjecTables, a visual augmented...... reality system for interactive packing of model parts onto sheet materials. ProjecTables enables designers to (re)use scrap materials for CNC cutting that would have been previously thrown away, at the same time supporting aesthetic choices related to wood grain, avoiding surface blemishes, and other...... relevant material properties. We conducted evaluations of ProjecTables with design students from Aarhus School of Architecture, demonstrating that participants could quickly and easily place and orient model parts reducing material waste. Contextual interviews and ideation sessions led to a deeper...
DEFF Research Database (Denmark)
Demissew, Sebsebe; Brochmann, Christian; Kelbessa, Ensermu
2011-01-01
The account reviews and analyses the scietific projects derived from activities in connection with the Ethiopian Flora Project, including the [Ethiopian] Monocot Project, the Afro-alpine "Sky-island" project, the Vegetation and Ecological Conditions of Plantations Project, the Fire Ecology Projec...
International Nuclear Information System (INIS)
Perthuis, Ch. de
2005-06-01
The project mechanism complete the quotas systems concerning the carbon dioxide emissions market. The author explains and discusses these mechanisms and provides a panorama of the existing and developing projects. More specially she brings information on the mechanism of clean developments and renewable energies, the coordinated mechanisms, the agricultural projects, the financing of the projects and the exchange systeme of the New south Wales. (A.L.B.)
International Nuclear Information System (INIS)
Nagamiya, Shoji
2004-01-01
From Japanese fiscal year JFY01, which started on April 1, 2001, a new accelerator project to provide high-intensity proton beams proceeded into its construction phase. This project, which is now called the Japan Proton Accelerator Research Complex (J-PARC) project, is conducted under a cooperation of two institutions, KEK and Japan Atomic Energy Research Institution. We set a goal to achieve 1 MW proton beams at 3 GeV and 0.75 MW beams at 50 GeV. The project will be completed within six years, with the anticipated first beams in the spring of 2007. In this article I will describe (a) the project itself, (b) sciences to be pursued at this new accelerator complex and (c) the present status and future plans of the project
How to Grow Project Scientists: A Systematic Approach to Developing Project Scientists
Kea, Howard
2011-01-01
The Project Manager is one of the key individuals that can determine the success or failure of a project. NASA is fully committed to the training and development of Project Managers across the agency to ensure that highly capable individuals are equipped with the competencies and experience to successfully lead a project. An equally critical position is that of the Project Scientist. The Project Scientist provides the scientific leadership necessary for the scientific success of a project by insuring that the mission meets or exceeds the scientific requirements. Traditionally, NASA Goddard project scientists were appointed and approved by the Center Science Director based on their knowledge, experience, and other qualifications. However the process to obtain the necessary knowledge, skills and abilities was not documented or done in a systematic way. NASA Goddard's current Science Director, Nicholas White saw the need to create a pipeline for developing new projects scientists, and appointed a team to develop a process for training potential project scientists. The team members were Dr. Harley Thronson, Chair, Dr. Howard Kea, Mr. Mark Goldman, DACUM facilitator and the late Dr. Michael VanSteenberg. The DACUM process, an occupational analysis and evaluation system, was used to produce a picture of the project scientist's duties, tasks, knowledge, and skills. The output resulted in a 3-Day introductory course detailing all the required knowledge, skills and abilities a scientist must develop over time to be qualified for selections as a Project Scientist.
Something of value Governance of Projects in the Project-Based Organisation
DEFF Research Database (Denmark)
Riis, Eva
2013-01-01
The paper presents a conceptual framework for studying Governance of Projects and issues of value in the project-based organisation. Attempts at exploring and conceptualising the issues in the current literature are reviewed. Issues pertinent to gaining value by Governance of Projects have mainly...... for a better understanding of Governance of Projects and value contribution. The findings presented here form the conceptual foundation for subsequent empirical studies of value by Governance of Projects....... been explored from the perspective of economic theory. Models found in the literature are not typically concerned with value for the implementing organisation as a whole; their scope is limited to the time just after project completion. No valid, empirically-based models of value creation by Governance...
Underestimation of Project Costs
Jones, Harry W.
2015-01-01
Large projects almost always exceed their budgets. Estimating cost is difficult and estimated costs are usually too low. Three different reasons are suggested: bad luck, overoptimism, and deliberate underestimation. Project management can usually point to project difficulty and complexity, technical uncertainty, stakeholder conflicts, scope changes, unforeseen events, and other not really unpredictable bad luck. Project planning is usually over-optimistic, so the likelihood and impact of bad luck is systematically underestimated. Project plans reflect optimism and hope for success in a supposedly unique new effort rather than rational expectations based on historical data. Past project problems are claimed to be irrelevant because "This time it's different." Some bad luck is inevitable and reasonable optimism is understandable, but deliberate deception must be condemned. In a competitive environment, project planners and advocates often deliberately underestimate costs to help gain project approval and funding. Project benefits, cost savings, and probability of success are exaggerated and key risks ignored. Project advocates have incentives to distort information and conceal difficulties from project approvers. One naively suggested cure is more openness, honesty, and group adherence to shared overall goals. A more realistic alternative is threatening overrun projects with cancellation. Neither approach seems to solve the problem. A better method to avoid the delusions of over-optimism and the deceptions of biased advocacy is to base the project cost estimate on the actual costs of a large group of similar projects. Over optimism and deception can continue beyond the planning phase and into project execution. Hard milestones based on verified tests and demonstrations can provide a reality check.
Directory of Open Access Journals (Sweden)
Halyna V. Lutsenko
2015-02-01
Full Text Available The peculiarities of modern world experience of implementation of project-based learning in engineering education have been considered. The potential role and place of projects in learning activity have been analyzed. The methodology of organization of project-based activity of engineering students when studying the project management methodology and computer systems of project management has been proposed. The requirements to documentation and actual results of students' projects have been described in detail. The requirements to computer-aided systems of project management developed by using Microsoft Project in the scope of diary scheduling and resources planning have been formulated.
Influence of Selected Stakeholders of Construction Investment Projects on the Course of Project
Bizon-Górecka, Jadwiga; Górecki, Jarosław
2017-10-01
The article presents an entity perspective of the construction investment projects. In a course of the project there are stakeholders who have an indirect influence (e.g. decision-makers in the selection of projects) or a direct influence (e.g. members of the project team). An intuitive opinion about a significant influence of project stakeholders on the project’s course encouraged the authors to undertake a research in this area. The article illustrates the initial phases of the construction project life cycle in a perspective of the entities and, in particular, a role of different stakeholders in making decisions that affect a course of the project. An analysis of the structure of the construction project life cycle makes a substantial involvement of various subjects in the initial phases of the project, i.e. in an initial phase and during a creation of the structures. A key point is to underline the factors of decision-making by the participants of the construction process. It was indicated that the stakeholders have a different impact on the course of the project. In large projects, which have many stakeholders, their role in the implementation of the investment project can vary, depending on the life cycle of the project. They can have positive or negative impacts on achieving the project objectives. The paper presents the results of 100 surveys made among participants of the building processes, executors of the construction projects in the Kuyavian-Pomeranian region. The study was conducted in December 2016 and January 2017. It revealed what is the impact of individual stakeholders of the construction projects on the course of the project. A special attention was paid to a complex relationship between objectives of the project and stakeholders’ goals. A great care to the smallest possible number of risks, which may arise from the different objectives of the project and its stakeholders’ goals, should be focused on the augmentation of correlation of
Project Leadership and Quality Performance of Construction Projects
Directory of Open Access Journals (Sweden)
SPG Buba
2017-05-01
Full Text Available Background: The construction industry in Nigeria, is pigeonholed by poor quality of construction products as a result of the inherent corruption in the country. Lack of purposeful leadership and inappropriate choice of leadership styles in the industry have been attributed to project failure. Abandoned and failed projects are more predominant in the public sector which litters every corner of the country. Objectives: The objective of this paper is to assess the impact of leadership styles on quality performance criteria of public projects in Nigeria. Methodology: A total of 43 questionnaires were distributed to 3 key groups of respondents (Quantity Surveyors, Builders, and Architects who are project managers in Nigeria. Descriptive and Inferential statistics were used to analyse the data using the Statistical Package for Social Sciences (SPSS. Likert Scale was used to measure the independent variables (leadership style: facilitative, coaching, delegating and directing; and the level of achievement of projects based on the dependent variables (quality and function performance criteria which are: achieving highest aesthetic quality; and functional building that fits its purpose. Findings: The study revealed that Directing is the major leadership style used by project managers in Nigeria. Amongst the leadership styles which has the most impact on quality performance indicators is also directing which has the most relative influence on achieving highest aesthetic quality and functional building that fits its purpose. Conclusion/Recommendation/Way forward: The underlying relationship between Directing leadership styles and the performance criteria of achieving highest aesthetic quality and functional building that fits its purpose will be beneficial to the Nigerian construction environment.
ORGANIZATIONAL PROJECT MANAGEMENT MATURITY
Directory of Open Access Journals (Sweden)
Yana Derenskaya
2017-11-01
Full Text Available The present article is aimed at developing a set of recommendations for achieving a higher level of organizational project maturity at a given enterprise. Methodology. For the purposes of the current research, the available information sources on the components of project management system are analysed; the essence of “organizational maturity” and the existing models of organizational maturity are studied. The method of systemic and structural analysis, as well as the method of logical generalization, are employed in order to study the existing models of organizational maturity, to describe levels of organizational maturity, and finally to develop a set of methodological recommendations for achieving a higher level of organizational project maturity at a given enterprise. The results of the research showed that the core elements of project management system are methodological, organizational, programtechnical, and motivational components. Project management encompasses a wide range of issues connected with organizational structure, project team, communication management, project participants, etc. However, the fundamental basis for developing project management concept within a given enterprise starts with defining its level of organizational maturity. The present paper describes various models of organizational maturity (staged, continuous, petal-shaped and their common types (H. Кеrzner Organizational Maturity Model, Berkeley PM Maturity Model, Organizational Project Management Maturity Model, Portfolio, Program & Project Management Maturity Model. The analysis of available theoretic works showed that the notion “organizational project maturity” refers to the capability of an enterprise to select projects and manage them with the intention of achieving its strategic goals in the most effective way. Importantly, the level of maturity can be improved by means of formalizing the acquired knowledge, regulating project-related activities
Impact evaluation in multicultural educational projects : case: ADAPTYKES project
Kuusisto, Miika
2014-01-01
The objective of this thesis was to examine the common evaluation concepts of the European Union’s funded projects. Such concepts inter alia are effectiveness, impacts and sustainability. The aim was to study how these are realized in multicultural educational case–project in a context, where the project is funded by the European Commission’s Leonardo DaVinci Programme. Thesis introduces two evaluation approaches, which are Logical Framework Approach and Realistic evaluation model. The fi...
Role of quality assurance vs project manager's responsibility for waste projects
International Nuclear Information System (INIS)
Solecki, J.
1989-01-01
This paper takes a project manager's perspective and discusses the role of the quality assurance organization in the development, implementation and interface related to the QA program for waste projects. The author describes the role which the QA program plays in allowing project management to assure that the project manager knows what is placed in the repository and the characteristics of the surrounding environment meet closure requirements
78 FR 35648 - Public Availability of FY 2012 Service Contract Inventories
2013-06-13
... inventory on the OPM homepage at the following link: http://www.opm.gov/about-us/doing-business-with-opm/contracting-opportunities/#url=Business-Opportunities . FOR FURTHER INFORMATION CONTACT: William Curto at (202) 606-1584 or by mail at U.S. Office of Personnel Management, 1900 E Street NW., Washington, DC 20415...
Ranking related entities: components and analyses
Bron, M.; Balog, K.; de Rijke, M.
2010-01-01
Related entity finding is the task of returning a ranked list of homepages of relevant entities of a specified type that need to engage in a given relationship with a given source entity. We propose a framework for addressing this task and perform a detailed analysis of four core components;
African Journals Online (AJOL)
Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives. Journal Homepage Image. The aim of the Nigerian Hospital Practice Journal is to aid in enhancing the advancement of medicine globally by acting as a medium for disseminating information on current clinical and drug practices in ...
Institutional Repositories: Faculty Deposits, Marketing, and the Reform of Scholarly Communication
Jantz, Ronald C.; Wilson, Myoung C.
2008-01-01
This study explores faculty deposits in institutional repositories (IR) within selected disciplines and identifies the diverse navigational paths to IR sites from library Web site homepages. The statistical relationship between the development of an IR and the presence of a Web site dedicated to the reform of traditional scholarly communication is…
The Importance of Prior Probabilities for Entry Page Search
Kraaij, W.; Westerveld, T.H.W.; Hiemstra, Djoerd
An important class of searches on the world-wide-web has the goal to find an entry page (homepage) of an organisation. Entry page search is quite different from Ad Hoc search. Indeed a plain Ad Hoc system performs disappointingly. We explored three non-content features of web pages: page length,
Satellite eye for Galathea 3. Annual report 2007
DEFF Research Database (Denmark)
Hasager, Charlotte Bay; Sørensen, Peter Brøgger; Pedersen, Leif Toudal
with a short text was published each week at the homepage www.satelliteeye.dk . During 2007 the Satellite Eye team jointly with Nature & science prepared an educational film ‘Satellite Eye – Galathea 3 fra rummet’. This work is funded by The Danish Ministry of Education, Tips- og Lottopuljen. The film...
Quality of life in families with peanut/egg/hazelnut allergy
DEFF Research Database (Denmark)
Stensgaard, Anette
2013-01-01
). The siblings receive an age-adjusted questionnaire. The parents to children from 8 years and above also receive a Parent Form. Mothers and fathers receive separate questionnaires. The patients and their relatives are invited by letter with a link to the homepage www.datafabrikken.dk and a code for each family...
77 FR 4891 - Technical Corrections to Commission Regulations
2012-02-01
... 20426. 12. From the Commission's homepage on the Internet, this information is available in the Commission's document management system, eLibrary. The full text of this document is available on eLibrary in...Library, type the docket number excluding the last three digits of this document in the docket number...
78 FR 14951 - State of Washington; Underground Injection Control (UIC) Program Revision
2013-03-08
... EPA Docket Center homepage at http://www.epa.gov/epahome/dockets.htm or the SUPPLEMENTARY INFORMATION... Agency, Region 10, Library, 10th Floor, 1200 Sixth Avenue, Seattle, WA 98101. The Library is open from 9... telephone number for the Library is (206) 553-1289. (2) Washington Department of Ecology, Water Quality...
Physics To Go: an Outreach Digital Library
Lee, Edward V.
2006-12-01
Physics to Go, part of the NSF-funded ComPADRE digital library, is a collection of websites for informal physics learning. This talk will present Physics To Go’s homepage features, show how these features are created, how resources are identified, and how Physics To Go complements other physics outreach websites.
Ballard, Terry
2008-01-01
Every year, more and more reference sources go from print to online, from the stacks to the library's homepage. The librarians at Quinnipiac University's Arnold Bernhard Library in Hamden, Connecticut, realized that these subscriptions are more than the occasional web offering to supplement the library's mission. They have become an important…
U.S. Department of Health & Human Services — The BioProject database provides an organizational framework to access information about research projects with links to data that have been or will be deposited...
Mihalache Anita; Salagean Liana
2010-01-01
Project management is a technique that can aid in the planning, scheduling, and monitoring of complex projects characterized by numerous, non repetitive jobs called activities. Examples of projects that would use project management include: - developing a mass rapid – transit system for a metropolitan area; - organizing the relocation of a corporate headquarters; - planning the production of a concert, film, or play; - developing and marketing a new automobile; - constructing a high – rise of...
Energy Technology Data Exchange (ETDEWEB)
Harris, R
1978-08-01
Conventional cost/benefit or project analysis has generally not taken into account circumstances in which the project under consideration is large enough that its introduction to the economy would have significant general equilibrium effects. In this paper, rules are examined that would indicate whether such large projects should be accepted or rejected. The rules utilize information yielded by before-project and after-project equilibrium prices and production data. Rules are developed for the undistorted ''first-best'' case, the case in which the fixed costs of the project are covered by distortionary taxation, and for the case of projects producing public goods. 34 references.
Project management best practices: forging win-win partnerships and mitigating power project risk
International Nuclear Information System (INIS)
Trowsdale, R.
2006-01-01
This paper discusses aspects of project management to mitigate power project risk. end-to-end project development involves development phase, permitting phase, implementation phase, and operational phase. Each phase involves a number of different elements. In renewable energy project good management requires maintaining project discipline and schedule throughout all phases. Project success requires commercial competitiveness, fuel availability, power sales contracts, stake holder support, permitting, effective execution, construction and good technical performance
Harvard Project Physics Newsletter 10. The Project Physics Course, Text.
Harvard Univ., Cambridge, MA. Harvard Project Physics.
A short description of the availability of Harvard Project Physics course components is given as is a discussion of the growth of the use of Project Physics in schools, including some enrollment data and survey results. Locations of the 1970 and 1971 Summer Institutes are listed. Adaptations of Project Physics course outside the United States are…
Space Projects: Improvements Needed in Selecting Future Projects for Private Financing
1990-01-01
The Office of Management and Budget (OMB) and NASA jointly selected seven projects for commercialization to reduce NASA's fiscal year 1990 budget request and to help achieve the goal of increasing private sector involvement in space. However, the efforts to privately finance these seven projects did not increase the commercial sector's involvement in space to the extent desired. The General Accounting Office (GAO) determined that the projects selected were not a fair test of the potential of increasing commercial investment in space at an acceptable cost to the government, primarily because the projects were not properly screened. That is, neither their suitability for commercialization nor the economic consequences of seeking private financing for them were adequately evaluated before selection. Evaluations and market tests done after selection showed that most of the projects were not viable candidates for private financing. GAO concluded that projects should not be removed from NASA's budget for commercial development until after careful screening has been done to determine whether adequate commercial demand exists, development risks are commercially acceptable and private financing is found or judged to be highly likely, and the cost effectiveness of such a decision is acceptable. Premature removal of projects from NASA's budget ultimately can cause project delays and increased costs when unsuccessful commercialization candidates must be returned to the budget. NASA also needs to ensure appropriate comparisons of government and private financing options for future commercialization projects.
A new approach to cost effective projects: High performance project teams
International Nuclear Information System (INIS)
Chambers, N.C.
1994-01-01
In low oil price environment in which environmental conditions are more challenging, reservoir characteristics less favourable and political risk increasing, successful projects are required in such cases. The present paper deals with the visionary process of establishing high performance project teams. According to the author, such project teams embody dynamic recognition of holism. Holism is achieved as an output from the process of establishing the drivers and enablers for success on a project. They are given birth during the unfolding of the operators development plans and contracting strategy. The paper discusses the main drivers of project teams comprising purpose and performance goals, selection, common approach, commitment and accountability, and financial alignment
A new approach to cost effective projects: High performance project teams
Energy Technology Data Exchange (ETDEWEB)
Chambers, N.C. [Brown and Root Energy Services (United Kingdom)
1994-12-31
In low oil price environment in which environmental conditions are more challenging, reservoir characteristics less favourable and political risk increasing, successful projects are required in such cases. The present paper deals with the visionary process of establishing high performance project teams. According to the author, such project teams embody dynamic recognition of holism. Holism is achieved as an output from the process of establishing the drivers and enablers for success on a project. They are given birth during the unfolding of the operators development plans and contracting strategy. The paper discusses the main drivers of project teams comprising purpose and performance goals, selection, common approach, commitment and accountability, and financial alignment
Project Finance and Projects in the Energy Sector in Developing Countries
ERMELA KRIPA; HALIT XHAFA
2013-01-01
The purpose of this study is to show the importance of using project finance in infrastructure investments in developing countries. The paper will be focused only on one infrastructure sector, which is energy. Structurally, power project finance has involved largely buildown-transfer (BOT) project structures and long-term contracts. The projects largely reflect a rational allocation of risks among public and private participants. Private sponsors and lenders generally assume risks for complet...
Northcraft, Terry G.
2017-01-01
This qualitative study examined the effect the level of project management maturity a banking IT project sponsor has on project success. Project management maturity is gauged by the amount of modern project management training, knowledge and organizational skills an individual or organization has and applies to their project lifecycle experiences.…
International Nuclear Information System (INIS)
Adamson, M. G.
1997-01-01
The re-baseline of the Expedited Technology Demonstration Project (Revised Mixed Waste Facility Project) is designated as Project Baseline Revision 4.0. The last approved baseline was identified as Project Baseline Revision 3.0 and was issued in October 1996. Project Baseline Revision 4.0 does not depart from the formal DOE guidance followed by, and contained in, Revision 3.0. This revised baseline document describes the MSO and Final Forms testing activities that will occur during FY98, the final year of the ETD Project. The cost estimate for work during FY98 continues to be $2.OM as published in Revision 3.0. However, the funds will be all CENRTC rather than the OPEX/CENTRC split previously anticipated. LLNL has waived overhead charges on ETD Project CENRTC funds since the beginning of project activities. By requesting the $2.OM as all CENTRC a more aggressive approach to staffing and testing can be taken. Due to a cost under- run condition during FY97 procurements were made and work was accomplished, with the knowledge of DOE, in the Feed Preparation and Final Forms areas that were not in the scope of Revision 3.0. Feed preparation activities for FY98 have been expanded to include the drum opening station/enclosure previously deleted
Projects as value constellations
DEFF Research Database (Denmark)
Laursen, Markus
Creating value has been outlined as very central to projects applying the organizational perspective to projects. It has been suggested that value is created in value constellations or project networks, where actors work together to create value. However, research on the value creation process...... in value constellations is scarce, and through an exploratory study of two project networks in a cultural setting we investigate how value is created in value constellations. We outline how each project may be a distinct type of value constellation, one project creates value for the partners of the network...... as a consortium, and the project creates value primarily for others as a facilitator....
DEFF Research Database (Denmark)
Kuhn, Johan M.; Malchow-Møller, Nikolaj; Sørensen, Anders
In this note a short introduction to the project “Employment Effects of Entrepreneurs” is presented. First, we describe the purpose of the project; second, we present the background; third, we briefly describe the three papers that constitute the output of the project, and fourth, we discuss two ...... important qualifications for the understanding of the contributions and results established in the project.......In this note a short introduction to the project “Employment Effects of Entrepreneurs” is presented. First, we describe the purpose of the project; second, we present the background; third, we briefly describe the three papers that constitute the output of the project, and fourth, we discuss two...
Forecast Inaccuracies in Power Plant Projects From Project Managers' Perspectives
Sanabria, Orlando
Guided by organizational theory, this phenomenological study explored the factors affecting forecast preparation and inaccuracies during the construction of fossil fuel-fired power plants in the United States. Forecast inaccuracies can create financial stress and uncertain profits during the project construction phase. A combination of purposeful and snowball sampling supported the selection of participants. Twenty project managers with over 15 years of experience in power generation and project experience across the United States were interviewed within a 2-month period. From the inductive codification and descriptive analysis, 5 themes emerged: (a) project monitoring, (b) cost control, (c) management review frequency, (d) factors to achieve a precise forecast, and (e) factors causing forecast inaccuracies. The findings of the study showed the factors necessary to achieve a precise forecast includes a detailed project schedule, accurate labor cost estimates, monthly project reviews and risk assessment, and proper utilization of accounting systems to monitor costs. The primary factors reported as causing forecast inaccuracies were cost overruns by subcontractors, scope gaps, labor cost and availability of labor, and equipment and material cost. Results of this study could improve planning accuracy and the effective use of resources during construction of power plants. The study results could contribute to social change by providing a framework to project managers to lessen forecast inaccuracies, and promote construction of power plants that will generate employment opportunities and economic development.
Risks management in project planning
Stankevičiūtė, Roberta
2017-01-01
Project management consists of two very important aspects – managing the right project and managing the project right. To know that you are managing the right project you need to ensure that your project is based on an actual requirement and that your project goal is relevant and beneficial. And professional project planning assists in managing project the right way. The project planning process is very time consuming and is one of the most important parts of the project management process. T...
FME Senior Project Managers: A Juggling Act of Multiple Projects | Poster
By Peggy Pearl, Contributing Writer It was not until the 1950s that organizations in the United States began to apply project management tools and techniques to complex construction and engineering projects (http://en.m.wikipedia.org/wiki/Project_life_cycle).
Jr., R. F. Miles
1995-01-01
Project risk management is primarily concerned with performance, reliability, cost, and schedule. Environmental risk management is primarily concerned with human health and ecological hazards and likelihoods. This paper discusses project risk management and compares it to environmental risk management, both with respect to goals and implementation. The approach of the Jet Propulsion Laboratory to risk management is presented as an example of a project risk management approach that is an extension to NASA NHB 7120.5: Management of Major System Programs and Projects.
International Nuclear Information System (INIS)
Clark, J.; Limbrick, A.
1996-01-01
This paper identifies and reviews the issues to be addressed and the procedures to be followed during the mobilisation of projects using LFG as an energy source. Knowledge of the procedures involved in project mobilisation, their sequence and probable timescales, is essential for efficient project management. It is assumed that the majority of projects will be situated on existing, licensed landfill sites and, in addition to complying with the relevant conditions of the waste management licence and original planning consent, any proposed developments on the site will require a separate planning consent. Experience in the UK indicates that obtaining planning permission rarely constitutes a barrier to the development of schemes for the utilisation of LFG. Even so, an appreciation of the applicable environmental and planning legislation is essential as this will enable the developer to recognise the main concerns of the relevant planning authority at an early stage of the project, resulting in the preparation of an informed and well-structured application for planning permission. For a LFG utilisation scheme on an existing landfill site, the need to carry out an environmental assessment (EA) as part of the application for planning permission will, in vitually all cases, be discretionary. Even if not deemed necessary by the planning authority, an EA is a useful tool at the planning application stage, to identify and address potential problems and to support discussions with bodies such as the Environment Agency, from whom consents or authorisations may be required. Carrying out an EA can thus provide for more cost-effective project development and enhanced environmental protection. Typically, the principal contractual arrangements, such as the purchase of gas or the sale of electricity, will have been established before the project mobilisation phase. However, there are many other contractural arrangements that must be established, and consents and permits that may be
Project network-oriented materials management policy for complex projects
DEFF Research Database (Denmark)
Dixit, Vijaya; Srivastava, Rajiv K; Chaudhuri, Atanu
2015-01-01
This work devises a materials management policy integrated with project network characteristics of complex projects. It proposes a relative quantitative measure, overall criticality (OC), for prioritisation of items based on penalty incurred due to their non-availability. In complex projects...... managerial tacit knowledge which provides them enough flexibility to provide information in real form. Computed OC values can be used for items prioritisation and as shortage cost coefficient in inventory models. The revised materials management policy was applied to a shipbuilding project. OC values were......, practicing managers find it difficult to measure OC of items because of the subjective factors and intractable nature of penalties involved. However, using their experience, they can linguistically identify the antecedents and relate them to consequent OC. This work adopts Fuzzy Set Theory to capture...
DEFF Research Database (Denmark)
Pemsel, Sofia; Wiewiora, Anna
This research investigates the development of project competence, and particularly, three related dynamic capabilities (shifting, adapting, leveraging) that contribute to project competence development. In doing so, we make use of the emerging literature on knowledge governance and theorize how...... of dynamic capability building promoting project competence development....
Organizations, projects and culture
J. van Cleeff; Pieter van Nispen tot Pannerden
2016-01-01
Purpose: to explore and demonstrate the effects of organizational culture on projects, in particular project culture and project management style. Methodology/approach: descriptive and explorative; through students’ groups. Findings: the cultural relationship between organizations, their projects
The Impact of Project Management Maturity upon IT/IS Project Management Outcomes
Carcillo, Anthony Joseph, Jr.
2013-01-01
Although it is assumed that increasing the institutionalization (or maturity) of project management in an organization leads to greater project success, the literature has diverse views. The purpose of this mixed methods study was to examine the correlation between project management maturity and IT/IS project outcomes. The sample consisted of two…
Photovoltaic demonstration projects
Energy Technology Data Exchange (ETDEWEB)
Kaut, W [Commission of the European Communities, Brussels (Belgium); Gillett, W B; Hacker, R J [Halcrow Gilbert Associates Ltd., Swindon (GB)
1992-12-31
This publication, comprising the proceedings of the fifth contractor`s meeting organized by the Commission of the European Communities, Directorate-General for Energy, provides an overview of the photovoltaic demonstration projects which have been supported in the framework of the energy demonstration programme since 1983. It includes reports by each of the contractors who submitted proposals in 1987 and 1988, describing progress within their projects. Projects accepted from earlier calls for proposals and not yet completed were reviewed by a rapporteur and are discussed in the summary section. The results of the performance monitoring of all projects and the lessons drawn from the practical experience of the projects are also presented in the summaries and conclusions. Contractors whose projects were submitted in 1989 were also present at the meeting and contributed to the reported discussions. This proceeding is divided into four sessions (General, Housing, technical presentations, other applications) and 24 papers are offered.
Knowledge Management in a Project Environment: Organisational CT and Project Influences
Polyaninova, Taya
2011-01-01
During a project implementation various forms of information and experience are generated within the organization. If this accumulated knowledge is not recorded and shared amongst other projects, this knowledge will be lost and no longer be available to assist future projects. This may lead to increased future projects costs as resources, time and money will be wasted on redefining the knowledge that once existed within the company. By not capturing and redeploying this knowledge, the quality...
RODOS User's Group: Final project report. Contract number: F14P- CT98-0075
International Nuclear Information System (INIS)
Sinkko, K.; Ammann, M.
2001-03-01
Prior to 1998, the development of RODOS, a decision support system designed for the management of nuclear emergencies, had been carried out almost entirely by research scientists and engineers. The end-users/operators had little or no input into this development. To redress this situation, the RODOS Users Group (RUG) was established in 1998 under a Concerted Action Contract between the European Commission and STUK. The main objectives of this group were to encourage the emergency management community to use such a system, to provide a forum for end-users to share their experience in the use of such systems and to provide feedback from the end-users to the model and system developers in regard to operational problems and required improvements. The contract, which commenced on 1st September 1998, was for a period of two years. During this period, RUG established a www homepage, planned and performed two nuclear accident exercises and held four meetings. Technically the Web page operated very well. State-of-the-art Internet technology provided an efficient communication channel at low cost. The membership of the RUG was, however, too low to maintain a lively and ongoing discussion in parallel with the RODOS project Web page. This experience would suggest that it might have been better to have operated a Web page for RUG on the RODOS project Web-site rather than an independent RUG Web-site. Exercises based on fixed accident scenarios proved to be an appropriate means of highlighting issues that needed to be discussed between users and developers and to stimulate and motivate the end-users to maintain and further develop the system. Such exercises also promoted further activity in the field of emergency management. The organisation and administration of realistic exercises are time consuming, laborious and expensive. It is therefore very important that the maximum benefit is achieved from such exercises. The use of analytical evaluation methods could be better employed
Using Project Complexity Determinations to Establish Required Levels of Project Rigor
Energy Technology Data Exchange (ETDEWEB)
Andrews, Thomas D.
2015-10-01
This presentation discusses the project complexity determination process that was developed by National Security Technologies, LLC, for the U.S. Department of Energy, National Nuclear Security Administration Nevada Field Office for implementation at the Nevada National Security Site (NNSS). The complexity determination process was developed to address the diversity of NNSS project types, size, and complexity; to fill the need for one procedure but with provision for tailoring the level of rigor to the project type, size, and complexity; and to provide consistent, repeatable, effective application of project management processes across the enterprise; and to achieve higher levels of efficiency in project delivery. These needs are illustrated by the wide diversity of NNSS projects: Defense Experimentation, Global Security, weapons tests, military training areas, sensor development and testing, training in realistic environments, intelligence community support, sensor development, environmental restoration/waste management, and disposal of radioactive waste, among others.
Project time boxing and milestones as drivers for open design projects
DEFF Research Database (Denmark)
Tollestrup, Christian H. T.
2015-01-01
is very positive and that the structure, strict enforcement and rolling project management responsibility in a group work setting really helps them drive the project forward with high motivation. The main challenge lies in the balance between loading the teams with too many challenges and just providing......The Curriculums and programs in Problem Based Learning (PBL) utilizes the project-format in a team based setting for rehearsing the competencies of applying the design-oriented skills and knowledge learned in courses and workshops. If the project period is self-organised, there is a tendency......, because of the facilitated format where ‘disturbances’ are eliminated. If successful the state of creative flow is achieved. So how can we create a sense of urgency in longer project periods, not just workshop format, that would help a team of design students to engage and drive the project from the start...
DEFF Research Database (Denmark)
Illerup, J. B.; Birr-Pedersen, K.; Mikkelsen, M. H
Models for projection of SO2-, NOx-, NMVOC- and NH3-emissions to the atmosphere have been developed and the Danish emissions have been projected until 2010 from a basis scenario including all implemented and planned measures. The projections of the four pollutants indicate that it may be difficult...
Heintz, John Linke; Lousberg, L.; Wamelink, J.W.F.; Saari, A.; Huovinen, P.
2016-01-01
In this paper we introduce the concept of Designing Project Management. On the basis of our earlier work, we suggest that there is still a gap between what is known from recent project management literature and what project managers can structurally help in the effectiveness of their work. Assuming
Changing project finance climate; Project finance wo meguru kankyo henka
Energy Technology Data Exchange (ETDEWEB)
Madono, S. [The Export-Import Bank of Japan, Tokyo (Japan)
1998-03-01
Development of conditions under which project financing (PF) functions is described. PF, a method with which funds are procured for a project on the security of the assets of and the cash flow involving the project, established its position as a popular financial means. Into the 1990, however, PF underwent a complete change, when it came to be actively employed as a means for the procurement of money for what is called `infrastructure building project for invigorating the private sector` in the developing countries. PF has now come to be utilized for the financing of projects in various fields besides the field of resources exploitation. In particular, PF is now utilized in schemes such as BOT (build, operate, transfer) in public enterprises, for instance, electric power utilities in developing countries. The gravest problem found in the private sector invigorating type PF is that the sponsor, operator, exporter, and lender on their respective levels are experiencing rising risks because of intensified competition in the presence of a great number of projects. Such risks involve the exchange rate, the completion of work, and the relations between the borrower and operator. 2 figs.
Ranking the Project Management Success Factors for Construction Project in South India
Aneesha, K.; Haridharan, M. K.
2017-07-01
In Today’s construction industry, to achieve a greater advantage over the firms, success of each project and efficiency is required. Effective Project Management overcomes these types of challenges. This study identifies the success factors which are important for project management in construction project success. From the literature review, 26 factors were found to be critical. Project managers, construction managers, civil engineers, contractors and site engineers were the respondents. After analyzing the data in SPSS software, the dominant factors from the regression analysis are top management support, competent project team, abilities to solve problems, realistic cost and time estimates, information/communication, competency of the project manager are the 6 factors out of 12 in 26 factors. Effective communication between stakeholders got highest priority and client involvement, good leadership, clarity of project goals got second priority. Informal communication gives better results compared to formal communications like written formats. To remove communication barrier with the stakeholders, informal communication like speaking face-to-face with the language this fits for the stakeholders.
Project plan remove special nuclear material from PFP project plutonium finishing plant
International Nuclear Information System (INIS)
BARTLETT, W.D.
1999-01-01
This plan presents the overall objectives, description, justification and planning for the Plutonium Finishing Plant (PFP) Remove Special Nuclear Material (SNM) Materials. The intent of this plan is to describe how this project will be managed and integrated with other facility stabilization and deactivation activities. This plan supplements the overall integrated plan presented in the Plutonium Finishing Plant Integrated Project Management Plan (IPMP), HNF-3617, Rev. 0. This project plan is the top-level definitive project management document for PFP Remove SNM Materials project. It specifies the technical, schedule, requirements and the cost baselines to manage the execution of the Remove SNM Materials project. Any deviations to the document must be authorized through the appropriate change control process
Revue de Médecine et de Pharmacie
African Journals Online (AJOL)
Journal Homepage Image. La Revue de Médecine et de Pharmacie is a semestrial publication of the Faculty of Medicine and Pharmaceutical Sciences of the University of Douala. It is destined to the university scientific community, physicians and other researchers in all countries who wish to make known the results of their ...
7 CFR 1714.5 - Determination of interest rates on municipal rate loans.
2010-01-01
... 7 Agriculture 11 2010-01-01 2010-01-01 false Determination of interest rates on municipal rate... General § 1714.5 Determination of interest rates on municipal rate loans. (a) RUS will post on the RUS website, Electric Program HomePage, a schedule of interest rates for municipal rate loans at the beginning...
2000 Annual report NATO/CCMS Pilot Study, Clean Products and Processes (Phase I)
DEFF Research Database (Denmark)
Wenzel, Henrik; Molin, Christine; Hauschild, Michael Zwicky
2001-01-01
The NATO/Committee on the Challenges of Modern Society third Pilot Study meeting on Clean Products and Processes was held in Copenhagen, Denmark on May 7-12, 2000. This meeting maintained the momentum generated during the of the first two years of the pilot study, focusing on progress made on sev...... homepage....
75 FR 17309 - Idaho: Incorporation by Reference of Approved State Hazardous Waste Management Program
2010-04-06
... Center homepage at http://www.epa.gov/epahome/dockets.htm . Docket: All documents in the docket are... EPA Region 10 Library, 1200 Sixth Avenue, Seattle, Washington 98101. This Docket Facility is open from 9 a.m. to noon, and 1 to 4 p.m. Monday through Friday, excluding legal holidays. The library...
Fast Flux Test Facility, Sodium Storage Facility project-specific project management plan
International Nuclear Information System (INIS)
Shank, D.R.
1994-01-01
This Project-Specific Project Management Plan describes the project management methods and controls used by the WHC Projects Department to manage Project 03-F-031. The Sodium Storage Facility provides for storage of the 260,000 gallons of sodium presently in the FFTF Plant. The facility will accept the molten sodium transferred from the FFTF sodium systems, and store the sodium in a solid state under an inert cover gas until such time as a Sodium Reaction Facility is available for final disposal of the sodium
Fast Flux Test Facility, Sodium Storage Facility project-specific project management plan
Energy Technology Data Exchange (ETDEWEB)
Shank, D.R.
1994-12-29
This Project-Specific Project Management Plan describes the project management methods and controls used by the WHC Projects Department to manage Project 03-F-031. The Sodium Storage Facility provides for storage of the 260,000 gallons of sodium presently in the FFTF Plant. The facility will accept the molten sodium transferred from the FFTF sodium systems, and store the sodium in a solid state under an inert cover gas until such time as a Sodium Reaction Facility is available for final disposal of the sodium.
Pedrini, D. T.; Pedrini, Bonnie C.
Sigmund Freud and his associates did much clinical work with the dynamic of projection, especially with regard to paranoid symptoms and syndromes. Much experimental work has also been done with projection. Sears evaluated the results of some of those studies. Murstein and Pryer sub-classified projection and reviewed typical studies. The…
Project Communications Management
José C. Santiago-Guevara; Mauricio Rojas-Contreras; Luis A. Esteban-Villamizar
2013-01-01
This article presents a review in relation to the object of study: Communications Management as an important factor in the management of projects. The review includes the most relevant and most renowned authors in the field of project management, focusing on telecommunications projects, which lets you define a communications management model.
Teaching supply chain management through global projects with global project teams
Kopczak, L.R.; Fransoo, J.C.
2000-01-01
In this article, we describe the Global Project Coordination Course, a course in which project teams composed of three students from each of two overseas universities execute company-sponsored projects dealing with global supply chain management issues. The $75,000 to $100,00 contributed in total by
International Nuclear Information System (INIS)
Shibuya, E.H.
1989-01-01
The OMEGA - Observation of Multiple particle production, Exotic Interactions and Gamma-ray Air Shower-project is presented. The project try to associate photosensitive detectors from experiences of hadronic interactions with electronic detectors used by experiences that investigate extensive atmospheric showers. (M.C.K.)
Project Hanford management contract quality improvement project management plan; TOPICAL
International Nuclear Information System (INIS)
ADAMS, D.E.
1999-01-01
On July 13, 1998, the U.S. Department of Energy, Richland Operations Office (DOE-RL) Manager transmitted a letter to Fluor Daniel Hanford, Inc. (FDH) describing several DOE-RL identified failed opportunities for FDH to improve the Quality Assurance (QA) Program and its implementation. In addition, DOE-RL identified specific Quality Program performance deficiencies. FDH was requested to establish a periodic reporting mechanism for the corrective action program. In a July 17, 1998 response to DOE-RL, FDH agreed with the DOE concerns and committed to perform a comprehensive review of the Project Hanford Management Contract (PHMC) QA Program during July and August, 1998. As a result, the Project Hanford Management Contract Quality Improvement Plan (QIP) (FDH-3508) was issued on October 21, 1998. The plan identified corrective actions based upon the results of an in-depth Quality Program Assessment. Immediately following the scheduled October 22, 1998, DOE Office of Enforcement and Investigation (EH-10) Enforcement Conference, FDH initiated efforts to effectively implement the QIP corrective actions. A Quality Improvement Project (QI Project) leadership team was assembled to prepare a Project Management Plan for this project. The management plan was specifically designed to engage a core team and the support of representatives from FDH and the major subcontractors (MSCs) to implement the QIP initiatives; identify, correct, and provide feedback as to the root cause for deficiency; and close out the corrective actions. The QI Project will manage and communicate progress of the process
Pries, Kim H
2010-01-01
Scrum, which was originally invented solely for software development, can now be applied to all types of projects. This book shows project managers how to implement Scrum by explaining the artifacts, rituals, and roles used. The text provides Scrum planning methods to control project scope and schedule as well as Scrum tracking methods to focus teams on improving throughput and streamlining communications. The authors show how to combine traditional project methods with Scrum and how to adapt the familiar work breakdown structure to create Scrum backlogs and sprints. They also demonstrate how
Momentum projection and relativistic boost of solitons: Coherent states and projection
International Nuclear Information System (INIS)
Luebeck, E.G.; Birse, M.C.; Henley, E.M.; Wilets, L.
1986-01-01
We present a method for calculating center-of-mass corrections to hadron properties in soliton models and we apply the method to the soliton bag model. A coherent state is used to provide a quantum wave function corresponding to the mean-field approximation. This state is projected onto a zero-momentum eigenstate. States of nonzero momentum can be constructed from this with a Lorentz boost operator. Hence center-of-mass corrections can be made in a properly relativistic way. The energy of the projected zero-momentum state is the hadron mass with spurious center-of-mass energy removed. We apply a variational principle to our projected state and use three ''virial theorems'' to test our approximate solution. We also study projection of general one-mode states. Projection reduces the nucleon energy by up to 25%. Variation after projection gives a further reduction of less than 20%. Somewhat larger reductions in the energy are found for meson states
2001-01-01
As business environments become increasingly competitive, companies seek more comprehensive solutions to the delivery of their projects. "Project Delivery System: Fourth Edition" describes the process-driven project delivery systems which incorporates the best practices from Total Quality and is aligned with the Project Management Institute and ISO Quality Standards is the means by which projects are consistently and efficiently planned, executed and completed to the satisfaction of clients and customers.
Project management case studies
Kerzner, Harold R
2013-01-01
A new edition of the most popular book of project management case studies, expanded to include more than 100 cases plus a ""super case"" on the Iridium Project Case studies are an important part of project management education and training. This Fourth Edition of Harold Kerzner''s Project Management Case Studies features a number of new cases covering value measurement in project management. Also included is the well-received ""super case,"" which covers all aspects of project management and may be used as a capstone for a course. This new edition:Contains 100-plus case studies drawn from re
Your Project Management Coach Best Practices for Managing Projects in the Real World
Biafore, Bonnie
2012-01-01
A pragmatic approach to project management Many projects fail to deliver on time or on budget, or even to deliver a workable product that satisfies the customer. While good project management goes a long way towards ensuring success, managers often fail to follow the plans they implement. This unique guide helps you understand and successfully handle project management, once and for all. Covering practical ways to solve problems you'll typically face when managing actual projects, this pragmatic book takes you through a full project management lifecycle. You'll find ample tips, tricks, and bes
DEFF Research Database (Denmark)
Lund Pedersen, Carsten; Ritter, Thomas; Andersen, Torben Juul
This paper proposes the adoption of a project-based view to analyze strategy formation and strategic renewal over time. Projects are resource-committing, empirically-tracable investments, and as such, particularly suitable for the analysis of different manifestations of intended strategies as well...... as post-hoc manifestations of deviant, even rebellious, actions taken in opposition to the initial strategy announcement. The paper presents an analytical framework (a 5x2 matrix) of ten different project categories that together allows researchers to investigate how strategic renewal is realized through...... the enactment of different types of project initiatives throughout the organization. The developed framework is validated by two field studies that outline the robustness of the proposed matrix. In addition to the demonstration of the advantages of the framework, we discuss the limitations of the strategy-as-projects...
Project quality assurance plant: Sodium storage facility, project F-031
International Nuclear Information System (INIS)
Shultz, J.W.; Shank, D.R.
1994-11-01
The Sodium Storage Facility Project Quality Assurance Plan delineates the quality assurance requirements for construction of a new facility, modifications to the sodium storage tanks, and tie-ins to the FFTF Plant. This plan provides direction for the types of verifications necessary to satisfy the functional requirements within the project scope and applicable regulatory requirements determined in the Project Functional Design Criteria (FDC), WHC-SD-FF-FDC-009
Bi-project management in engineering complex industrial construction projects
Velde, Robert R. van der; Donk, Dirk Pieter van
2000-01-01
Engineering large industrial construction projects is usually a complex task with several co-operating actors. This paper investigates such projects, characterised by two main actors: the owner of the installation (the client organisation) responsible for the engineering of the production process,
Chivatá Cárdenas, Ibsen; Voordijk, Johannes T.; Dewulf, Geert
2017-01-01
A new project governance model for infrastructure projects is described in this paper. This model contains causal mechanisms that relate a number of project governance variables to project performance. Our proposed model includes relevant variables for measuring project governance in construction
2011-01-01
Background Project management is widely used to deliver projects on time, within budget and of defined quality. However, there is little published information describing its use in managing health and medical research projects. We used project management in the Alcohol and Pregnancy Project (2006-2008) http://www.ichr.uwa.edu.au/alcoholandpregnancy and in this paper report researchers' opinions on project management and whether it made a difference to the project. Methods A national interdisciplinary group of 20 researchers, one of whom was the project manager, formed the Steering Committee for the project. We used project management to ensure project outputs and outcomes were achieved and all aspects of the project were planned, implemented, monitored and controlled. Sixteen of the researchers were asked to complete a self administered questionnaire for a post-project review. Results The project was delivered according to the project protocol within the allocated budget and time frame. Fifteen researchers (93.8%) completed a questionnaire. They reported that project management increased the effectiveness of the project, communication, teamwork, and application of the interdisciplinary group of researchers' expertise. They would recommend this type of project management for future projects. Conclusions Our post-project review showed that researchers comprehensively endorsed project management in the Alcohol and Pregnancy Project and agreed that project management had contributed substantially to the research. In future, we will project manage new projects and conduct post-project reviews. The results will be used to encourage continuous learning and continuous improvement of project management, and provide greater transparency and accountability of health and medical research. The use of project management can benefit both management and scientific outcomes of health and medical research projects. PMID:21635721
The Impact of Project Organizational Culture on the Performance of Construction Projects
Directory of Open Access Journals (Sweden)
Luong Hai Nguyen
2017-05-01
Full Text Available Cultural influence has recently received significant attention from academics due to its vital role in the success or failure of a project. In the construction industry, several empirical investigations have examined the influence of culture on project management. The aim of this study is to determine the impact of project organizational culture on the performance of construction projects. A total of 199 completed construction projects in Vietnam with specific data gathering through questionnaires were analyzed. The findings reveal that contractor commitment to contract agreements is the most significant cultural factor affecting project performance. Goal alignment and reliance, contractor commitment, and worker orientation (i.e., commitment to workers contribute to improved overall performance and participant satisfaction. Contractor commitment and cooperative orientation enhance labor productivity, whereas goal alignment and trust and contractor commitment ensure learning performance (i.e., learning from experience. The findings of this study may assist construction professionals in implementing practices that can contribute to the sustainability and success of construction projects.
Project of the Year Submittal SY-101 Surface Level Rise Remediation Project
International Nuclear Information System (INIS)
BAUER, R.E.
2001-01-01
CH2M HILL Hanford Group is pleased to nominate the SY-101 Surface Level Rise Remediation Project (SLRRP) for the Project Management Institute's consideration as International Project of the Year for 2001. We selected this project as being our best recent example of effective project management, having achieved and exceeded our client's expectations in resolving urgent safety issues related to the storage of high level nuclear waste. In reflection, we consider the SY-101 SLRRP to be a prime example of safe and effective project delivery. The pages that follow present the tools and techniques employed to manage this complex and technically challenging project. Our objective in submitting this nomination is twofold--to share the lessons we have learned with other organizations, and to honor the men and women who contributed to this endeavor. It was by their diligent effort that the successes we relate here were accomplished 10 months ahead of schedule and one million dollars below the authorized budget
International Nuclear Information System (INIS)
Delahaye, J.P.
2010-01-01
There is large number of ambitious accelerator projects with promising performances in the near (and short term) future which aims at exploring energy and/or luminosity frontiers and Complementary aspects of various particles species. High Energy Physics requirements are extremely demanding with challenging parameters: entering into the new territories of the tera-scale data, high Energy or/and High (Integrated) Luminosity, high performance, high availability, long lifetime, luminosity leveling etc.. New projects are more and more challenging: larger, more powerful, more expensive, technology above present standard. Innovative ideas and breakthrough on novel technologies are key for HEP adventure. Aggressive R and D is imperative on beam and Technology related, on cost and power consumption mitigation.. There is ambitious Test Facilities to address feasibility. More and more time and (M and P) resources are required from first ideas to project proposal: it is of prime importance to launch R and D early, explore all possible options of schemes and technologies (anticipating future Physics requests), make realistic status and schedule estimates (preserve credibility and make reasonable plans). Global Collaboration is mandatory from the R and D phase to the construction and operation in order to make best use of limited resources and available expertise as inspired from successful collaborations on Detectors. The global strategy of new accelerator projects in truly world-wide collaboration aims at: - defining all various Projects and Technology options worth exploring, - taking advantage of global teams made of world-wide experts, and of synergies to address common issues (generic R and D) of various projects, - preparing together plethora of project proposals to cover Physics Landscape (ready for window opportunity), - developing Collaborative/Competition (Experts in Collaboration, Technology and Projects options in Competition), - Joining resources on (few) selected
Directory of Open Access Journals (Sweden)
Alejandra Suarez
2014-02-01
Full Text Available Freedom Project trains prisoners in nonviolent communication and meditation. Two complementary studies of its effects are reported in this article. The first study is correlational; we found decreased recidivism rates among prisoners trained by Freedom Project compared with recidivism rates in Washington state. The second study compared trained prisoners with a matched-pair control group and found improvement in self-reported anger, self-compassion, and certain forms of mindfulness among the trained group. Ratings of role-plays simulating difficult interactions show increased social skills among the group trained by Freedom Project than in the matched controls.
Project Finance: Basic Components
Alfieri Li Ojeda, Jaime
2015-01-01
The natural speed of the contemporary world demands large investment projects which require specialized financial techniques such as Project Finance, defined as a fund to finance investment projects of great magnitude. Every Project Finance involves a wide range of elements such as promoters, government, contractors andsuppliers, among others, that will ensure project success. La rapidez del mundo contemporáneo exige que los grandes proyectos de inversión requieran de técnicas financieras ...
Managing externally financed projects: the Integrated Primary Health Care Project in Bolivia.
Homedes, N
2001-12-01
Bolivia is one of the poorest countries in Latin America. Health indicators are very poor, communicable diseases are prevalent and, coupled with malnutrition, remain the major killers of children under 5 years old. The Integrated Primary Health Care Project (PROISS) was a US$39 million project executed by the Ministry of Health (MOH), 50% financed by the World Bank and aimed at improving primary health care in the four largest Bolivian municipalities. The implementation of the project started in 1990 and ended in 1997. During implementation it went through three distinct phases: Phase 1 (1990-94) was a period characterized by conflict and confusion; Phase 2 (1995-mid-1996) documented major improvements in coverage and service quality; and Phase 3 (mid-1996-97) witnessed the decline of the project. This paper explores the factors that contributed to the success and the decline of the project, draws lessons for project managers and international agencies involved in the definition and implementation of social sector projects, and discusses the unlikelihood that externally financed projects can have a sustainable impact on the development of the health sector of recipient countries.
MANAGING MULTICULTURAL PROJECT TEAMS
Directory of Open Access Journals (Sweden)
Cezar SCARLAT
2014-06-01
Full Text Available The article is based on literature review and authors’ own recent experience in managing multicultural project teams, in international environment. This comparative study considers two groups of projects: technical assistance (TA projects versus information technology (IT projects. The aim is to explore the size and structure of the project teams – according to the team formation and its lifecycle, and to identify some distinctive attributes of the project teams – both similarities and differences between the above mentioned types of projects. Distinct focus of the research is on the multiculturalism of the project teams: how the cultural background of the team members influences the team performance and team management. Besides the results of the study are the managerial implications: how the team managers could soften the cultural clash, and avoid inter-cultural misunderstandings and even conflicts – in order to get a better performance. Some practical examples are provided as well.
Earned value project management
Fleming, Quentin W
2010-01-01
Organizations that follow the principles of good Earned Value Management (EVM) create an environment that allows teams to successfully operate and thrive ? even in the face of challenges that could negatively impact their projects. Earned Value Project Management (EVPM) is a methodology used to measure and communicate the real physical progress of a project taking into account the work completed, the time taken and the costs incurred to complete that work. As a result, EVPM allows more educated and effective management decision-making, which helps evaluate and control project risk by measuring project progress in monetary terms. In the first two editions of Earned Value Project Management, Quentin W. Fleming and Joel M. Koppelman provided guidance for project management practitioners already familiar with EVPM, was well as those who were new to the use of this technique. The third edition expanded the information available on of EVPM for medium and smaller projects while still being relevant for larger projec...
Clustering ERP implementation project activities: a foundation for project size definition
Janssens, G.; Kusters, R.J.; Heemstra, F.J.; Sadiq, A.; Reichert, M.; Schultz, K.; Trienekens, J.J.M.; Moller, C.; Kusters, R.J.
2007-01-01
The size of an ERP project can be a useful measurement for predicting the effort needed to complete an ERP implementation project. Because this measurement does not exist, research is needed to find a set of variables which can define the size of an ERP implementation project. This paper shows 21
Scheduling for decommissioning projects
International Nuclear Information System (INIS)
Podmajersky, O.E.
1987-01-01
This paper describes the Project Scheduling system being employed by the Decommissioning Operations Contractor at the Shippingport Station Decommissioning Project (SSDP). Results from the planning system show that the project continues to achieve its cost and schedule goals. An integrated cost and schedule control system (C/SCS) which uses the concept of earned value for measurement of performance was instituted in accordance with DOE orders. The schedule and cost variances generated by the C/SCS system are used to confirm management's assessment of project status. This paper describes the types of schedules and tools used on the SSDP project to plan and monitor the work, and identifies factors that are unique to a decommissioning project that make scheduling critical to the achievement of the project's goals. 1 fig
Managing Distributed Software Projects
DEFF Research Database (Denmark)
Persson, John Stouby
Increasingly, software projects are becoming geographically distributed, with limited face-toface interaction between participants. These projects face particular challenges that need careful managerial attention. This PhD study reports on how we can understand and support the management...... of distributed software projects, based on a literature study and a case study. The main emphasis of the literature study was on how to support the management of distributed software projects, but also contributed to an understanding of these projects. The main emphasis of the case study was on how to understand...... the management of distributed software projects, but also contributed to supporting the management of these projects. The literature study integrates what we know about risks and risk-resolution techniques, into a framework for managing risks in distributed contexts. This framework was developed iteratively...
Innovations in project activities
Directory of Open Access Journals (Sweden)
Serbskaya O.V.
2016-11-01
Full Text Available this article considers the ways of project management, models of project management: classical model and the model of flexible designing Agile, pays more attention to the process of project management using Agile model and to the problems of using the project management models in modern conditions.
Ganzel, Candy; Stuglik, Jan
2003-01-01
At a suburban Indiana elementary school, the Project Approach serves as the basis of the curriculum in all Kindergarten classrooms. The four classes of 5- and 6-year-old children at this school chose to study llamas. This article discusses how the project evolved, describes the three phases of the project, and provides teachers' reflections on the…
Power supply projects a collection of innovative and practical design projects
Maplin
1996-01-01
Using circuit diagrams, PCB layouts, parts lists and clear construction and installation details, this book provides everything someone with a basic knowledge of electronics needs to know in order to put that knowledge into practice.This latest collection of Maplin projects are a variety of power supply projects, the necessary components for which are readily available from the Maplin catalogue or any of their high street shops. Projects include, laboratory power supply projects for which there are a wide range of applications for the hobbyist, from servicing portable audio and video equipment
Energy Technology Data Exchange (ETDEWEB)
Goto, Y. (Ministry of International Trade and Industry, Tokyo (Japan))
1992-10-05
Significance of using 'super' for naming a project of technological development is discussed. Functions of naming are classified into (1) recognition, (2) display and (3) sales-promotion, whereby mechanism of naming of merchandise that is developed through the technique of 3 is considered. Further, the mechanism of naming is discussed in relation to marketing. It is pointed out that naming of merchandise is determined on the basis of (1) concept of planned goods and (2) marketing-mixes composed of goods, price, sales-roots and sales-promotion. The same mechanism works also in a project for technological development. Technical trends are caught and projects are targetted by taking supposed regimes into account, thereby the most suitable mix is formed. The mix in the technological development is assumed to be composed of purpose, specification, regime and sales-promotion. Two examples of the governmental projects by Ministry of International Trade and Industry, 'the big regime for research and development on industrial technologies' and 'the regime for development of the fundamental technologies in the next generation' are introduced and the significance of their naming is described. 2 tabs.
The IT project manager competencies that impact project success – A qualitative research
Directory of Open Access Journals (Sweden)
Cíntia Cristina Silva de Araújo
2015-07-01
Full Text Available Since there is a lack of studies about the relationship of IT project manager competencies and project success, this paper will address the following research question: Which competencies should IT project managers develop in order to achieve success in IT projects? To answer this question, we conducted a qualitative research with an exploratory approach. To collect data, twelve (12 in-depth interviews were done with Brazilian project managers from different companies from several business sectors. The analysis results pointed out that for our respondents the most needed category of competencies are team management, business domain knowledge, communication, project management and people skills. As other authors have affirmed, technical skills were considered to be less relevant to project success than interpersonal and intrapersonal competencies.
International Nuclear Information System (INIS)
Knebel, J.U.; Fellmoser, F.; Lefhalm, C.; Mack, K.; Pettan, C.; Piecha, H.; Konys, J.; Adelhelm, C.; Glasbrenner, H.; Muscher, H.; Novotny, J.; Voss, Z.; Wedemeyer, O.; Mueller, G.; Heinzel, A.; Schumacher, G.; Huber, R.; Zimmermann, F.; Groetzbach, G.; Dorr, B.; Carteciano, L.N.
2000-01-01
Within the Hermann von Helmholtz-Gemeinschaft Deutscher Forschungszentren (HGF) an HGF-Strategy Fund Project entitled 'Innovative Technologies to Reduce Radiotoxicity' is funded since October 1999. The objectives of this HGF-Strategy Fund Project is the development of new methods and technologies to design and manufacture thin-walled and highly thermally-loaded surfaces which are cooled by a corrosive heavy liquid metal (lead-bismuth eutectic). The result of this project will be the basic scientific-technical tool which allows the conception and the design of a European Demonstrator of an ADS system (cf. 32.23.05). The work performed at Forschungszentrum Karlsruhe is embedded in a broad European research and development programme on ADS systems. The project is divided in three sub-projects: Sub-Project 1: Thermalhydraulic Investigations, Sub-Project 2: Material Specific Investigations, Sub-Project 3: Oxygen Control System. This progress report gives a general description of the project and its envisaged objectives. As a selection of the results achieved, first, FLUTAN calculations for the COULI beam window design and, second, the oxygen control system for the KArlsruhe Lead LAboratory KALLA are described in detail. Finally, the design and status of KALLA is given. (orig.)
Directory of Open Access Journals (Sweden)
2007-01-01
Full Text Available Many software and IT projects fail in completing theirs objectives because different causes of which the management of the projects has a high weight. In order to have successfully projects, lessons learned have to be used, historical data to be collected and metrics and indicators have to be computed and used to compare them with past projects and avoid failure to happen. This paper presents some metrics that can be used for the IT project management.
DEFF Research Database (Denmark)
Borch, Ole; Kirkegaard, B.; Knudsen, Morten
1998-01-01
for information exchange in the traditional project environment is performed. A group of teachers and a student group using small project examples test the method. The first test group used a prototype for testing and found the new activity synchronization difficult to adapt, so the method was finally adjusted...... to be very precises and with success used on the second test group. Distributed project work is coming pretty soon and with little improvement in server tools, projects in different topics with a large and inhomogeneous profile of users are realistic.......Project work has been used for many years at Aalborg University to improve learning of theory and methods given in courses. In a closed environment where the students are forming a group in a single room, the interaction behaviour is more or less given from the natural life. Group work...
Bioenergy/Biotechnology projects
Energy Technology Data Exchange (ETDEWEB)
Napper, Stan [Louisiana Tech Univ., Ruston, LA (United States); Palmer, James [Louisiana Tech Univ., Ruston, LA (United States); Wilson, Chester [Louisiana Tech Univ., Ruston, LA (United States); Guilbeau, Eric [Louisiana Tech Univ., Ruston, LA (United States); Allouche, Erez [Louisiana Tech Univ., Ruston, LA (United States)
2012-06-30
This report describes the progress of five different projects. The first is an enzyme immobilization study of cellulase to reduce costs of the cellulosic ethanol process. High reusability and use of substrates applicable to large scale production were focus areas for this study. The second project was the development of nanostructured catalysts for conversion of syngas to diesel. Cobalt nanowire catalyst was used in Fischer-Tropsch synthesis. The third project describes work on developing a microfluidic calorimeter to measure reaction rates of enzymes. The fourth project uses inorganic polymer binders that have the advantage of a lower carbon footprint than Portland cement while also providing excellent performance in elevated temperature, high corrosion resistance, high compressive and tensile strengths, and rapid strength gains. The fifth project investigates the potential of turbines in drop structures (such as sewer lines in tall buildings) to recover energy.
Das Internet als Medium für Demokratisierung und Verständnisbildung - Beispiel Bosnien-Herzegowina
Directory of Open Access Journals (Sweden)
Michael Reimann
2002-10-01
Full Text Available "Politik und Internet" ist ein weites Feld für praktische Anwendungsversuche wie für wissenschaftliche Begleitforschung geworden. Der Artikel untersucht, inwieweit Informations- und Kommunikationstechnologien (IKT im allgemeinen und das "World Wide Web" im besonderen in einem vom Krieg zerrissenen Land wie Bosnien-Herzegowina im Sinne von "peacebuilding" für Demokratisierung und Verständigung zwischen den (ehemaligen Konfliktparteien eingesetzt werden können. Aus Ansätzen der Friedens- und Konfliktforschung, sowie der Informationswissenschaft werden dazu Kriterien abgeleitet, die für einen adäquaten Einsatz des Internets erfüllt sein sollten, bzw. aus denen abgeleitet werden kann, wie Internetangebote gestaltet sein sollten, damit sie entsprechend wirken können. Im empirischen Teil wird zunächst die Problematik des "Allgemeinen Zugangs" zum Internet in Bosnien-Herzegowina dargestellt, indem Daten zur Telekommunikationsinfrastruktur und zur Verbreitung und Nutzung des Internets gegeben und Projekte zur Verbesserung der Situation vorgestellt werden. Im weiteren werden die entwickelten Kriterien an ausgewählte IKT-Projekte und Internet-Homepages nationaler und internationaler Institutionen und Organisationen angelegt, die an Demokratisierung und Verständnisbildung beteiligt sind. Als Beispiel für "bad practice" wird die Homepage des "Office of the High Representative" der Vereinten Nationen dargestellt, da diese Website fast ausschliesslich in englischer Sprache gehalten und somit für bosnische Bürger nahezu unzugänglich ist. Als Beispiele für "good practice" - zumindest in bezug auf bestimmte Kriterien - können die Homepages der bosnischen Zentralbank, der "Mine Action Centers", sowie der OSZE Mission in Bosnien-Herzegowina gelten. Das im Bereich Bildung angesiedelte Projekt "D@dalos" deckt so gut wie alle entwickelten Kriterien ab; es ist konfliktlösungsorientiert und kann somit als ein echtes "Demokratisierungsprojekt" gelten
Biomass for renewable energy, fuels, and chemicals
National Research Council Canada - National Science Library
Klass, Donald L
1998-01-01
... from the publisher. Permissions may be sought directly from Elsevier's Science and Technology Rights Department in Oxford, UK. Phone: (44) 1865 843830, Fax: (44) 1865 853333, e-mail: permissions@elsevier.co.uk. You may also complete your request on-line via the Elsevier homepage http://www.elsevier.com by selecting "Customer Support" and then "...
VizieR Online Data Catalog: GalIMF version 1.0.0 (Yan+, 2017)
Yan, Z.; Jerabkova, T.; Kroupa, P.
2017-08-01
GalIMF stands for the Galaxy-wide Initial Mass Function. It is a Python 3 module that allows users to compute galaxy-wide initial stellar mass functions based on locally derived empirical constraints following the IGIMF theory. See the GalIMF homepage https://sites.google.com/view/galimf/home for more information. (1 data file).
Diagnosing a red eye: an allergy or an infection?
African Journals Online (AJOL)
This is a subjective foreign body sensation and ... blood vessels that cover the ocular surface, as well as cellular. Abstract ... 57(1):29-33. Open Access article distributed under the terms of the .... with itching of the eyes being the most apparent feature.2,4. Associated .... Red eye. Medscape [homepage on the Internet. c2015.
Editorial Prof Lundgren's significant contribution to SAJAA and its ...
African Journals Online (AJOL)
low- to middle-income countries,8 and as such, is considered a core component of health.6. Unfortunately, Africa and the ... 40% of global surgery occurs in poor- to middle-income countries.2 As anaesthetists in Africa, we need to focus ... sciences and related medical fields. ASSAf [homepage on the Internet]. 2014. c2015.
Rashidah Begum; Wong, Sook Jean
This paper studies the extent of Internet connectivity and usage among Southeast Asian libraries and how many of them are using the Internet to provide electronic information resources and services through their homepages. It also presents a case study of the Universiti Sains Malaysia (USM) Library's strategy in promoting the use of the Internet…
Die Universitätsbibliothek für Schüler - Angebote der UB Würzburg
Hämmer, Viola; Südekum, Karl
2011-01-01
Mit Einführungsveranstaltungen für Schüler, individueller Beratung bei der Recherche und einem eigenen Bereich auf der Homepage unterstützt die Universitätsbibliothek Würzburg Schüler bei ihren ersten wissenschaftlichen Arbeiten. Damit soll auch eine Brücke geschlagen werden zwischen den Bildungsinstitutionen Schule und Hochschule.
Wang, Jianrong; Gao, Vera
2004-01-01
This study examines sixty academic libraries' Web sites and finds that 80 percent of them do not have a technical services' homepage. Data reveal that institution's status might be a factor in whether a library has such a page. Further content analysis suggests there is an appropriate and useful public service role that technical services…
Statistical Techniques for Project Control
Badiru, Adedeji B
2012-01-01
A project can be simple or complex. In each case, proven project management processes must be followed. In all cases of project management implementation, control must be exercised in order to assure that project objectives are achieved. Statistical Techniques for Project Control seamlessly integrates qualitative and quantitative tools and techniques for project control. It fills the void that exists in the application of statistical techniques to project control. The book begins by defining the fundamentals of project management then explores how to temper quantitative analysis with qualitati
Project Management Communication 2.0
DEFF Research Database (Denmark)
Berggreen, Line; Kampf, Constance Elizabeth
2015-01-01
How can we understand project management communication practices for developing effective practices in professional and technical communication? In this article we explore an approach to project management that focuses on projects as having a technical documentation structure with content...... that is developed through social or interpersonal communication practices. Looking at the broader picture of project management which besides the implementation phase also includes conception, planning and closure, we see a project management framework that brings together both technical and social aspects...... of project communication. To understand how this works, we interviewed project managers about their understanding and strategy in communicating about the projects they lead. Findings demonstrate that more experienced project managers have a more nuanced understanding of project communication as both...
Four Approaches to Project Evaluation
DEFF Research Database (Denmark)
Laursen, Markus; Svejvig, Per; Rode, Anna Le Gerstrøm
. Each of the framework’s four approaches provides a distinct evaluation that sheds light on some issues while leaving others unattended. Following these lines, the paper calls for more multi-faceted project evaluations. Introducing a framework that can help analyze existing evaluations and structure......There are many theoretical and practical reasons for evaluating projects – including explorative arguments focusing on expanding descriptive knowledge on project work as well as normative arguments focusing on improving prescriptive models of project performance. Despite the need for project...... management methodologies that work and combat project failure, and research methods that can assess effective project management and methodologies, as well as empirical research on the actuality of projects as practice, evaluation research on projects including project management and methodologies is scarce...
Salt Repository Project: FY 85 technical project plan
International Nuclear Information System (INIS)
1985-07-01
The FY 85 technical plan for the Salt Repository Project is briefly presented. The objectives of the project in relation to the Civilian Radioactive Waste Management Program are discussed, and the technical activities directed toward accomplishing these objectives are detailed. A budget is presented for each of the Level 2 work breakdown structure tasks (Systems, Waste Package, Site, Repository, Regulatory and Institutional, Exploratory Shaft, Test Facilities, Land Acquisition, and Project Management) in the various sections. An overall description, current status, and planned activities are presented for each of the subtasks which make up the above-mentioned Level 2 tasks. A strategy diagram and a master schedule are included and each of the milestones is also listed chronologically in the sections
MORE. Management of Requirements in NPP modernisation projects - Project report 2005
International Nuclear Information System (INIS)
Thunem, A.P.J.; Fredriksen, R.; Thunem, H.P.J.; Ventae, O.; Valkonen, J.; Holmberg, J.E.
2006-04-01
The overall objective of the project MORE is to improve the means for managing the large amounts of evolving requirements in Nordic NPP modernisation projects. In accordance to this objective, the activity will facilitate the industrial utilisation of the research results from the project TACO. On the basis of experiences in the Nordic countries, the overall aim of the TACO project has been to identify the best practices and most important criteria for ensuring effective communication in relation to requirements elicitation and analysis, understandability of requirements to all parties, and traceability of requirements. The project resulted in the development of a traceability model for handling requirements from their origins and through their final shapes. Particular emphasis for the MORE project in 2005 was put on utilising a prototype of a tool (TRACE) intended to support an adopted approach to dependable requirements engineering, suitable for modelling and handling large amounts of requirements related to all stages of the systems development process and not only those traditionally including requirements at high-level stages. (au)
MORE. Management of Requirements in NPP modernisation projects - Project report 2005
Energy Technology Data Exchange (ETDEWEB)
Thunem, A.P.J.; Fredriksen, R.; Thunem, H.P.J. [IFE (Norway); Ventae, O.; Valkonen, J.; Holmberg, J.E. [VTT Technical Research Centre of Finland (Finland)
2006-04-15
The overall objective of the project MORE is to improve the means for managing the large amounts of evolving requirements in Nordic NPP modernisation projects. In accordance to this objective, the activity will facilitate the industrial utilisation of the research results from the project TACO. On the basis of experiences in the Nordic countries, the overall aim of the TACO project has been to identify the best practices and most important criteria for ensuring effective communication in relation to requirements elicitation and analysis, understandability of requirements to all parties, and traceability of requirements. The project resulted in the development of a traceability model for handling requirements from their origins and through their final shapes. Particular emphasis for the MORE project in 2005 was put on utilising a prototype of a tool (TRACE) intended to support an adopted approach to dependable requirements engineering, suitable for modelling and handling large amounts of requirements related to all stages of the systems development process and not only those traditionally including requirements at high-level stages. (au)
Flat-plate solar array project. Volume 8: Project analysis and integration
Mcguire, P.; Henry, P.
1986-01-01
Project Analysis and Integration (PA&I) performed planning and integration activities to support management of the various Flat-Plate Solar Array (FSA) Project R&D activities. Technical and economic goals were established by PA&I for each R&D task within the project to coordinate the thrust toward the National Photovoltaic Program goals. A sophisticated computer modeling capability was developed to assess technical progress toward meeting the economic goals. These models included a manufacturing facility simulation, a photovoltaic power station simulation and a decision aid model incorporating uncertainty. This family of analysis tools was used to track the progress of the technology and to explore the effects of alternative technical paths. Numerous studies conducted by PA&I signaled the achievement of milestones or were the foundation of major FSA project and national program decisions. The most important PA&I activities during the project history are summarized. The PA&I planning function is discussed and how it relates to project direction and important analytical models developed by PA&I for its analytical and assessment activities are reviewed.
Methodologies of Project Management
Directory of Open Access Journals (Sweden)
Wojciech Macek
2011-07-01
Full Text Available This paper presents comparison of three most popular project management standardsbelonging to a wider group of models (for example, PMBOK, Prince 2, CMMI, ISO 10006,BS 6079, IPMA Competence Baseline, European Commission Project Cycle ManagementGuidelines. The author discusses methods of project management according to PMBoK,Prince 2 and ISO 10006, some chosen criteria and fields of knowledge, such as generalregulations of standards, project range management, resources management, and processesconnected with risk, systems of project quality management.
International Nuclear Information System (INIS)
Doman, J.W.; Vlahakis, J.
1992-01-01
Management of projects under the control of the Office of Civilian Radioactive Waste Management within the Department of Energy is subject to overview by a variety of internal and external entities. This paper reports that effective project management often requires balancing of conflicting directions and conflicting agendas of the different entities in order to proceed with implementation of the Monitored Retrievable Storage project
The Canada Goose Project: A First Project with Children under 3
Brewer, Ruth A.
2010-01-01
This project report describes how five children (an infant, three toddlers, and a preschooler) enrolled at a private day care home engaged in their first journey into project work through a study of Canada geese living on a nearby body of water. Prior to the experience described in this paper, the author had used the Project Approach only with…
Project-based fieldwork: perspectives of graduate entry students and project sponsors.
Fortune, Tracy; McKinstry, Carol
2012-08-01
This article builds on an earlier viewpoint regarding the need for project-focussed fieldwork. It presents the findings of an evaluative study into the value of project placements undertaken by final year graduate entry master's students as part of a capstone subject. The authors argue that provision of project placements enable impending graduates to develop and implement macro level strategies to develop prevention, resource and service development skills often required of contemporary occupational therapy practitioners. A qualitative approach is adopted. Student cohorts from 2005 and 2006 completed open-ended, written questionnaires, and agency project sponsors were interviewed to obtain their perspectives of the project placement experience. Despite some concern that project placements might be undertaken at the expense of 'clinical' placements these findings reveal that projects managed by students were perceived by services to add great value enabling them to advance important priorities. Students and sponsors highlighted a range of positive learning outcomes, including the ability to work collaboratively with supervisors and develop advanced communication skills and political acumen. The success of such placements depends on supportive supervision from academic staff. CONCLUSIONS AND SIGNIFICANCE OF THE STUDY: The findings promote project placements as a highly authentic aspect of work integrated learning enabling learners to draw together a range of attributes that support the ability to manage complex issues that have occupational relevance at a macro level. In addition, such experiences help learners to develop agency and political acumen both increasingly important capabilities for the contemporary workplace. © 2012 The Authors Australian Occupational Therapy Journal © 2012 Occupational Therapy Australia.
Trappl, R.; Nijholt, Antinus; Stuk, M.; Zwiers, Jakob
2002-01-01
In this paper we discuss our virtual reality project Gulliver. This project is part of a more comprehensive project conceived by two artists, Matjaž Štuk and Alena Hudcovicová, called “Gulliver’s Museum of Living Art��?. Our part of the project involves a virtual reality version of Swift’s Gulliver
Rutherford, Sandra; Coffman, Margaret
2004-01-01
For several decades, science teachers have used bottles for classroom projects designed to teach students about biology. Bottle projects do not have to just focus on biology, however. These projects can also be used to engage students in Earth science topics. This article describes the Earth System Science Project, which was adapted and developed…
Energy Technology Data Exchange (ETDEWEB)
Greisinger, T.W. [IBM Global Utility and Energy Services Industry, Oak Brook, IL (United States); Moehl, W. [IBM Deutschland, Mainz (Germany). Vertriebsbereich Versorgungsunternehmen
2000-04-03
The Internet and related technologies belong into the daily life of supply and energy industry especially in the business to business sector. But the installation of a colourful homepage is not enough if one wants to remain competitive in the deregulated markets. The strategic implementation of e-business not only in relation to customers but also to optimisation of internal processes is a major success factor. The present article sheds light into these aspects and shows which enterprises especially in the USA have made e-business become a reality. (orig.) [German] Das Internet und verwandte Technologien gehoeren auch in der Versorgungs- und Energiewirtschaft laengst zum Alltag, vor allem im Geschaeftskundenbereich. Mit der Einrichtung einer bunten Homepage ist aber es laengst nicht mehr getan, will man in den deregulierten Maerkten wettbewerbsfaehig bleiben. Der strategische Einsatz von e-business zur Verbesserung von Kundenbeziehungen, aber auch zur Optimierung interner Prozesse ist vielmehr ein entscheidender Erfolgsfaktor geworden. Die Verfasser erlaeutern diese Gesichtspunkte und zeigen auf, welche Unternehmen vor allem in den USA bereits e-business zur Realitaet gemacht haben. (orig.)
Interactions of the NAEG information support project with other projects
International Nuclear Information System (INIS)
Pfuderer, H.A.
1976-01-01
In the past year the Information Support Project to the Nevada Applied Ecology Group has interacted with many other research projects on the transuranics and other radionuclides. Group interactions through symposiums, workshops, and responding to search requests have proven to be mutually beneficial. The NAEG Information Support Project will draw on the information resources of the Oak Ridge National Laboratory to produce a bibliography of the radionuclides (other than the transuranics) of interest to the Nevada Test Site
Fungal genome resources at NCBI
Robbertse, B.; Tatusova, T.
2011-01-01
The National Center for Biotechnology Information (NCBI) is well known for the nucleotide sequence archive, GenBank and sequence analysis tool BLAST. However, NCBI integrates many types of biomolecular data from variety of sources and makes it available to the scientific community as interactive web resources as well as organized releases of bulk data. These tools are available to explore and compare fungal genomes. Searching all databases with Fungi [organism] at http://www.ncbi.nlm.nih.gov/ is the quickest way to find resources of interest with fungal entries. Some tools though are resources specific and can be indirectly accessed from a particular database in the Entrez system. These include graphical viewers and comparative analysis tools such as TaxPlot, TaxMap and UniGene DDD (found via UniGene Homepage). Gene and BioProject pages also serve as portals to external data such as community annotation websites, BioGrid and UniProt. There are many different ways of accessing genomic data at NCBI. Depending on the focus and goal of research projects or the level of interest, a user would select a particular route for accessing genomic databases and resources. This review article describes methods of accessing fungal genome data and provides examples that illustrate the use of analysis tools. PMID:22737589
Preliminary Project Execution Plan for the Remote-Handled Low-Level Waste Disposal Project
Energy Technology Data Exchange (ETDEWEB)
David Duncan
2011-05-01
This preliminary project execution plan (PEP) defines U.S. Department of Energy (DOE) project objectives, roles and responsibilities of project participants, project organization, and controls to effectively manage acquisition of capital funds for construction of a proposed remote-handled low-level waste (LLW) disposal facility at the Idaho National Laboratory (INL). The plan addresses the policies, requirements, and critical decision (CD) responsibilities identified in DOE Order 413.3B, 'Program and Project Management for the Acquisition of Capital Assets.' This plan is intended to be a 'living document' that will be periodically updated as the project progresses through the CD process to construction and turnover for operation.
Preliminary Project Execution Plan for the Remote-Handled Low-Level Waste Disposal Project
International Nuclear Information System (INIS)
Duncan, David
2011-01-01
This preliminary project execution plan (PEP) defines U.S. Department of Energy (DOE) project objectives, roles and responsibilities of project participants, project organization, and controls to effectively manage acquisition of capital funds for construction of a proposed remote-handled low-level waste (LLW) disposal facility at the Idaho National Laboratory (INL). The plan addresses the policies, requirements, and critical decision (CD) responsibilities identified in DOE Order 413.3B, 'Program and Project Management for the Acquisition of Capital Assets.' This plan is intended to be a 'living document' that will be periodically updated as the project progresses through the CD process to construction and turnover for operation.
The Human Genome Diversity Project
Energy Technology Data Exchange (ETDEWEB)
Cavalli-Sforza, L. [Stanford Univ., CA (United States)
1994-12-31
The Human Genome Diversity Project (HGD Project) is an international anthropology project that seeks to study the genetic richness of the entire human species. This kind of genetic information can add a unique thread to the tapestry knowledge of humanity. Culture, environment, history, and other factors are often more important, but humanity`s genetic heritage, when analyzed with recent technology, brings another type of evidence for understanding species` past and present. The Project will deepen the understanding of this genetic richness and show both humanity`s diversity and its deep and underlying unity. The HGD Project is still largely in its planning stages, seeking the best ways to reach its goals. The continuing discussions of the Project, throughout the world, should improve the plans for the Project and their implementation. The Project is as global as humanity itself; its implementation will require the kinds of partnerships among different nations and cultures that make the involvement of UNESCO and other international organizations particularly appropriate. The author will briefly discuss the Project`s history, describe the Project, set out the core principles of the Project, and demonstrate how the Project will help combat the scourge of racism.
MORE: Management of requirements in NPP modernisation projects. Project report 2007
International Nuclear Information System (INIS)
Fredriksen, R.; Katta, V.; Raspotnig, C.; Valkonen, J.
2008-03-01
This report documents the work and related activities of the MORE project in the period January 1 - December 31 in 2007. The focus of this report is on improvements of the former project results, to identify and apply a couple of case studies from NPP projects, and activities in order to initiate and implement the industrial take-up and utilisation of the research results in real modernisation projects. The report also provides a brief description of the extended industrial network and disseminations of the results in Nordic and NKS related events such as seminars and workshops. (au)
MORE: Management of requirements in NPP modernisation projects. Project report 2007
Energy Technology Data Exchange (ETDEWEB)
Fredriksen, R.; Katta, V.; Raspotnig, C. [Institutt for energiteknikk (IFE) (Norway); Valkonen, J. [Technical Research Centre of Finland (VTT) (Finland)
2008-03-15
This report documents the work and related activities of the MORE project in the period January 1 - December 31 in 2007. The focus of this report is on improvements of the former project results, to identify and apply a couple of case studies from NPP projects, and activities in order to initiate and implement the industrial take-up and utilisation of the research results in real modernisation projects. The report also provides a brief description of the extended industrial network and disseminations of the results in Nordic and NKS related events such as seminars and workshops. (au)
Scaffolding Project-Based Learning with the Project Management Body of Knowledge (PMBOK[R])
van Rooij, Shahron Williams
2009-01-01
This paper reports the results of a study of the extent to which processes and procedures from the discipline of project management can scaffold online project-based learning in a graduate-level instructional technology course, by facilitating intra-team interaction, enhancing project outcomes and promoting a positive project team experience. With…
McLeod, Keri
2007-01-01
This article describes the 100 People Project and how the author integrates the project in her class. The 100 People Project is a nonprofit organization based in New York City. The organization poses the question: If there were only 100 people in the world, what would the world look like? Through the project, students were taught about ethics in…
PROJECT MANAGEMENT AND RELATIONSHIP MARKETING: INTERSECTIONS FOR STAKEHOLDER MANAGEMENT IN PROJECTS
Directory of Open Access Journals (Sweden)
Ronielton Rezende Oliveira
2017-06-01
Full Text Available Projects development is essential for organizations. Among the factors originated in projects that influence performance is quality. This variable must be managed to meet the expectations of the stakeholders and this can only be achieved through effective monitoring and control. It can be seen that relationship marketing is relevant to the competitive reality of contemporary organizations. With the purpose of contributing to organizational studies, this theoretical essay proposes to approach project management in relationship marketing. In the context of integrated management, it is discussed how management action can be applied to engage and involve stakeholders in projects, in order to create value and achieve the expectations sustained by the execution of the projects. Based on the reflection, the quality of relationship management is pointed out as a construct of higher order, composed of at least two dimensions: trust and satisfaction.
How Agile Methods Conquers General Project Management - The Project Half Double Initiative
DEFF Research Database (Denmark)
Tordrup Heeager, Lise; Svejvig, Per; Schlichter, Bjarne Rerup
2016-01-01
Increased complexity in projects has forced new project management initiatives. In software development several agile methods have emerged and methods such as Scrum are today highly implemented in practice. General project management practice has been inspired by agile software development...
Innovative Project Activities in Science [From the NSTA Study of Innovative Project Activities
Science Teacher, 1975
1975-01-01
Describes four projects chosen as innovative project activities in science which exhibited identification of unique or novel problems and creative approaches to their solutions. Projects included a study of fish in Lake Erie, a goat raising project, an analysis of terrestrial plant ecology and soil composition, and a study of marine and wetlands…