Innovative Stormwater Quality Tools by SARA for Holistic Watershed Master Planning
Thomas, S. M.; Su, Y. C.; Hummel, P. R.
2016-12-01
Stormwater management strategies such as Best Management Practices (BMP) and Low-Impact Development (LID) have increasingly gained attention in urban runoff control, becoming vital to holistic watershed master plans. These strategies can help address existing water quality impairments and support regulatory compliance, as well as guide planning and management of future development when substantial population growth and urbanization is projected to occur. However, past efforts have been limited to qualitative planning due to the lack of suitable tools to conduct quantitative assessment. The San Antonio River Authority (SARA), with the assistance of Lockwood, Andrews & Newnam, Inc. (LAN) and AQUA TERRA Consultants (a division of RESPEC), developed comprehensive hydrodynamic and water quality models using the Hydrological Simulation Program-FORTRAN (HSPF) for several urban watersheds in the San Antonio River Basin. These models enabled watershed management to look at water quality issues on a more refined temporal and spatial scale than the limited monitoring data. They also provided a means to locate and quantify potential water quality impairments and evaluate the effects of mitigation measures. To support the models, a suite of software tools were developed. including: 1) SARA Timeseries Utility Tool for managing and processing of large model timeseries files, 2) SARA Load Reduction Tool to determine load reductions needed to achieve screening levels for each modeled constituent on a sub-basin basis, and 3) SARA Enhanced BMP Tool to determine the optimal combination of BMP types and units needed to achieve the required load reductions. Using these SARA models and tools, water quality agencies and stormwater professionals can determine the optimal combinations of BMP/LID to accomplish their goals and save substantial stormwater infrastructure and management costs. The tools can also help regulators and permittees evaluate the feasibility of achieving compliance
Wood, M. A.; Oswalt, T. D.; SARA Collaboration
2000-12-01
We present an overview of the Research Experiences for Undergraduates (REU) Site Program hosted by the Southeastern Association for Research in Astronomy (SARA) for the past 6 years. SARA is a consortium of the six universities: Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia, Valdosta State University, and Clemson University. We host 10-11 student interns per year out of an application pool of ~150-200. Recruiting flyers are sent to the ~3400 undergraduate institutions in the United States, and we use a web-based application form and review process. We are a distributed REU Site, but come together for group meetings at the beginning and end of the summer program and stay in contact in between using email list manager software. Interns complete a research project working one-on-one with a faculty mentor, and each intern travels to observe at the SARA Observatory at Kitt Peak National Observatory. Interns give both oral and display presentations of their results at the final group meeting. In addition, all interns write a paper for publication in the IAPPP Communications, an international amateur-professional journal, and several present at professional meetings and in refereed publications. We include in the group meetings a ``how-to'' session on giving talks and posters, an Ethics Session, and a session on Women in Astronomy. This work was supported by the NSF Research Experiences for Undergraduates (REU) Site Program through grant AST 96169939 to The Florida Institute of Technology.
2012 SARA Students Technical Report
International Nuclear Information System (INIS)
Briccetti, Angelo; Lorei, Nathan; Yonkings, David; Lorio, David; Goorley, John T.; Sood, Avneet
2012-01-01
The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the students arriving at the start of
2012 SARA Students Technical Report
Energy Technology Data Exchange (ETDEWEB)
Briccetti, Angelo [Los Alamos National Laboratory; Lorei, Nathan [Los Alamos National Laboratory; Yonkings, David [Los Alamos National Laboratory; Lorio, David [Los Alamos National Laboratory; Goorley, John T. [Los Alamos National Laboratory; Sood, Avneet [Los Alamos National Laboratory
2012-07-30
The Service Academy Research Associates (SARA) program provides an opportunity for Midshipmen and Cadets from US Service Academies to participate in research at Los Alamos National Laboratory (LANL), Lawrence Livermore National Laboratory (LLNL), and Sandia National Laboratory for several weeks during the summer as part of their summer training assignments. During the summer of 2012, three Midshipmen were assigned to work with the XCP Division at LANL for approximately 5-6 weeks. As one of the nation's top national security science laboratories, LANL stretches across 36 square miles, has over 2,100 facilities, and employs over 9,000 individuals including a significant number of students and postdocs. LANL's mission is to 'apply science and technology to: ensure the safety, security, and reliability of the US nuclear deterrent, reduce global threats, and solve other emerging national security challenges.' While LANL officially operates under the US Department of Energy (DoE), fulfilling this mission requires mutual cooperation with the US Department of Defense (DoD) as well. LANL's high concentration of knowledge and experience provides interns a chance to perform research in many disciplines, and its connection with the DoD in both operation and personnel gives SARA students insight to career possibilities both during and after military service. SARA students have plenty of opportunity to enjoy hiking, camping, the Los Alamos YMCA, and many other outdoor activities in New Mexico while staying at the Buffalo Thunder Resort, located 20 miles east of the lab. XCP Division is the Computational Physics division of LANL's Weapons Department. Working with XCP Division requires individuals to be Q cleared by the DoE. This means it is significantly more convenient for SARA students to be assigned to XCP Division than their civilian counterparts as the DoD CNWDI clearance held by SARA students is easily transferred to the lab prior to the
Wood, M. A.
2003-12-01
The Southeastern Research for Astronomy (SARA) operates a 0.9-m telescope at Kitt Peak National Observatory (KPNO). The member institutions are Florida Institute of Technology, East Tennessee State University, Florida International University, The University of Georgia at Athens, Valdosta State University, and Clemson University. The NSF awarded the KPNO #1 0.9-m telescope to the SARA Consortium in 1990. We built a new facility and began routine on-site observations in 1995. We began routine remote observations in 1999 using VNC to export the telescope and CCD control screens, and a web-cam in the dome to provide critical visual feedback on the status of the telescope and dome. The mission of the SARA Consortium is to foster astronomical research and education in the Southeastern United States. Although only two of the member institutions have no graduate programs, all six have a strong emphasis on undergraduate research and education. By pooling our resources, we are able to operate a research-grade facility that none of the individual schools could manage by itself, and in the process we can offer our undergraduate students the opportunity to assist in our research projects as well as to complete their own independent research projects using a facility at a premier site. The SARA Consortium also hosts a NSF REU Summer Intern Program in Astronomy, in which we support 11-12 students that work one-on-one with a SARA faculty mentor. Most of these interns are selected from primarily undergraduate institutions, and have not had significant previous research experience. As part of the program, interns and mentors travel to KPNO for a 4-5 night observing run at the telescope. The SARA NSF REU Program is funded through NSF grant AST-0097616.
DeLucca named project director in Guatemala.
1984-01-01
Mike Delucca, a social marketing specialist since 1978, has been named director of a new contraceptive social marketing effort in Guatemala. The project is sponsored by Importadora de Productos Farmaceuticos (IPROFA), S.A., a group of private-sector community leaders who came together specifically to set up the project. IPROFA plan to being marketing 1 brand of oral contraceptive, condom, and foaming tablet in early 1985. Efforts will first be targeted at economically and socially disadvantaged fertile couples between the ages of 18-44 in large urban areas. By the end of 1985 marketing will begin in rural and small urban areas. DeLucca is on assignment IPROFA from Juarez and Associates, a marketing and research firm in Los Angeles. He was formerly with Development Associates of Arlington, Virginia, and served as project director for the social marketing project in El Salvador. He joined the Guatemala project in May 1984, overseeing prelaunch activities that included development of the marketing plan. After the product launch he will coordinate sales and follow-up marketing studies. The project is the result of a cooperative agreement between IPROFA and US Agency for International Development (USAID) signed in April 1982. full text
International Nuclear Information System (INIS)
Belmont, J.L.; Fruneau, M.; Martin, P.
1989-05-01
SARA was one of the first cyclotrons to operate with an ECR ion source. Experience since 1983 showed it would be useful to have two sources situated outside the cyclotron vault to manage continuous operation of the accelerator and development of new ions. A 18 m long injection line for FERROMAFIOS and MINIMAFIOS has been constructed. One of its principal features is a 11 m long electrostatic guide with periodic focusing. Transmission ratios from the source to the internal beam are close to 30%. Experiences involving time of flight measurements require short beam bunches; in order to reduce their duration, a phase selecting system will be installed in the centre of the injector of SARA. A RF voltage at four times the frequency of the dees will vertically deflect early orbits while particles close to the central phase will cross the deflector at zero voltage and will undergo normal acceleration
Interpreting the SARA and RCRA training requirements
International Nuclear Information System (INIS)
Moreland, W.M.; Wells, S.M.
1987-01-01
The Resource Conservation and Recovery Act (RCRA) and the Superfund Amendments and Reauthorization Act (SARA) promulgated by the EPA (RCRA) and the OSHA (SARA) require hazardous materials training for all individuals working with hazardous materials. Facilities that are involved in the generation, storage, treatment, transportation, or disposal/removal of hazardous materials/waste must comply with all relevant training regulations. Using the guidelines contained in the RCRA and SARA regulations, decisions must be made to determine: the type of regulatory requirement based on facility function (i.e., whether the facility is a RCRA or CERCLA facility). The type of training required for specific categories of workers (e.g. managers, supervisors, or general site workers). The level of training needed for each category of worker. This presentation outlines how the Environmental Compliance and Health Protection Technical Resources and Training Group, working with waste operations personnel, establishes specific training requirements
Subacute ruminal acidosis (SARA) in grazing Irish dairy cows.
O'Grady, Luke; Doherty, Michael L; Mulligan, Finbar J
2008-04-01
Subacute ruminal acidosis (SARA) is a significant production disease of dairy cattle. Previous concerns have been raised over the occurrence of SARA in pasture-fed dairy cattle and the potential consequences of laminitis and lameness. Highly digestible perennial rye grass contains high concentrations of rapidly fermentable carbohydrate and low concentrations of physical effective fibre that may result in SARA. This study conducted a point prevalence survey of rumen health status in grazing Irish dairy cattle fed predominantly perennial rye grass-based pasture. The survey assessed rumen fluid, animal health status, milk production data and pasture composition. A total of 144 cows between 80 and 150 days in milk were sampled on 12 farms. Eleven percent of cows were classified as affected with SARA (pH 5.8). The study showed that low rumen pH is prevalent in grazing Irish dairy cattle consuming perennial rye grass-based pasture and raises concerns regarding effective pasture utilisation and possible consequences for animal health.
System Analysis and Risk Assessment system (SARA) Version 4.0
International Nuclear Information System (INIS)
Sattison, M.B.; Russell, K.D.; Skinner, N.L.
1992-01-01
This NUREG is the tutorial for the System Analysis and Risk Assessment System (SARA) Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons are provided that walk the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis
The relationship between SARA fractions and crude oil stability
Directory of Open Access Journals (Sweden)
Siavash Ashoori
2017-03-01
Full Text Available Asphaltene precipitation and deposition are drastic issues in the petroleum industry. Monitoring the asphaltene stability in crude oil is still a serious problem and has been subject of many studies. To investigate crude oil stability by saturate, aromatic, resin and asphaltene (SARA analysis seven types of crudes with different components were used. The applied methods for SARA quantification are IP-143 and ASTM D893-69 and the colloidal instability index (CII is computed from the SARA values as well. In comparison between CII results, the values of oil compositions demonstrated that the stability of asphaltenes in crude oils is a phenomenon that is related to all these components and it cannot be associated only with one of them, individually.
Layering of life (Sara novel of Peter Sarić
Directory of Open Access Journals (Sweden)
Kostić Dragomir J.
2015-01-01
Full Text Available Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function, in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image layering of life, not a symbolic one, full of hope, faith, reliance, rather than a concrete, real life, that life which is transformed into a fear of life. Separate, poetical, part of the novel, is his main character, Sara. It is no coincidence that her name novel entitled. Because she is one of most beautiful characters in the newer Serbian prose. Speech about the Sara precedes speech about her book. The book is Sara, Sara's book! Possession of book is her main feature of the exterior. Sara comes out from the Book and disappears in the book. Self contained and independent, therefore doomed to conflict with the environment. Loyal to husband and family, loyal to the truth and for justice, she ,,not hurt anything and anyone, no one is standing in the way, to anyone not wroth, nor has anyone looked wrong.' At the same time, the strange beauty, beauty that could not fit into some sort of scheme, one particular image or idea of beauty that again and again renewed, changed, remaining distant, and unmet. Strange goodness, marvelous beauty, she suffered unusual way; her life was transformed into continuous abstinence, repression, in anxiety and fear. In a word: in martirizam! Finally, in order to safeguard children, sacrificed herself. Novel is a strong critique of society which is not able to recognize the beauty / goodness!.
Gene : CBRC-SARA-01-1996 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1996 Novel UN D UNKNOWN NU2C_ANTFO 0.004 26% gb|AAQ05281.1| NADH dehydrogenase subunit B [Metas...equoia glyptostroboides] 0.044 26% MILMLFLLGSSPRSLIHPRAILKTFPIVCCCLYAFCSLTSLILSLAVL
Directory of Open Access Journals (Sweden)
Jessica N Snowden
Full Text Available Infection is a frequent and serious complication following the treatment of hydrocephalus with CSF shunts, with limited therapeutic options because of biofilm formation along the catheter surface. Here we evaluated the possibility that the sarA regulatory locus engenders S. aureus more resistant to immune recognition in the central nervous system (CNS based on its reported ability to regulate biofilm formation. We utilized our established model of CNS catheter-associated infection, similar to CSF shunt infections seen in humans, to compare the kinetics of bacterial titers, cytokine production and inflammatory cell influx elicited by wild type S. aureus versus an isogenic sarA mutant. The sarA mutant was more rapidly cleared from infected catheters compared to its isogenic wild type strain. Consistent with this finding, several pro-inflammatory cytokines and chemokines, including IL-17, CXCL1, and IL-1β were significantly increased in the brain following infection with the sarA mutant versus wild type S. aureus, in agreement with the fact that the sarA mutant displayed impaired biofilm growth and favored a planktonic state. Neutrophil influx into the infected hemisphere was also increased in the animals infected with the sarA mutant compared to wild type bacteria. These changes were not attributable to extracellular protease activity, which is increased in the context of SarA mutation, since similar responses were observed between sarA and a sarA/protease mutant. Overall, these results demonstrate that sarA plays an important role in attenuating the inflammatory response during staphylococcal biofilm infection in the CNS via a mechanism that remains to be determined.
Teologi Politik Berbalu SARA Antara Ambisi dan Konspirasi
Directory of Open Access Journals (Sweden)
M. Sidi Ritau'din
2017-06-01
Full Text Available In a multi-cultural democracy based on Pancasila philosophy of independence, ethnic, religious, racial and intergroup issues it call (SARA are political indicators that can trigger conflict and division. If the player is ambitious and power-hungry, then he will not hesitate to do everything he can to gain power, even build a big conspiracy using SARA as a tool to divide the ummah, then he emerges as a unifier and presents programs prestigious sympathetic, there Imaging actions and slogans of the pro poor people, but essentially no more as political deceit, a false gift of hope, it familiar said (PHP that never realized, only reap the political advantage in the game of SARA, even not hesitate to shout thief when he Itself is a thieving thief based on greed and greed where the horizontal relations of fellow human beings deny the bond of faith as the foundation. Political conspiracy based on political interests and abuse of power, an action of political pathology that is not civilized that has become a trend of contemporary politics and globalization.
Rumen Microbiome Composition in Cattle during Grain-Induced Subacute Ruminal Acidosis (SARA)
DEFF Research Database (Denmark)
Danscher, Anne Mette; Derakshani, Hooman; Li, Shucong
2014-01-01
at the genus level. The rumen bacterial communities were altered in response to SARA (P=0.01). The proportion of several taxa was significantly higher in SARA samples, including S24-7, Erysipelotrichales. Lactobacillus, C lostridia, Moryella, Butyrivibrio, Olsenella, and C oprococcus. Microbiome profiling...
ESTETIKA TARIAN SARA DOUDA DALAM MASYARAKAT ADAT LOLI (SEBUAH PENDEKATAN LINGUISTIK KEBUDAYAAN
Directory of Open Access Journals (Sweden)
Sulistyastuti Sutomo
2015-01-01
Full Text Available Not only does art have self-fullfillment, but it also has axiological benefits both socially, culturally, religiously, and economiclally. So does Sara Douda dance. Sara Douda aesthetics is first contained in its whole dance movements. In addition, it can also be found in the whole dance equipments. Moreover, this dance aesthetics may also be contained in the verbal symbols in the speech forms prior to the dance performance. However, both verbal and non-verbal aesthetical forms are incorporated by the pieces of socio-cultural and religious values in the Loli community about their honoring their ancestors, having social harmony, and highly respecting each other among the community members. This study uses a cultural linguistic approach to find out and to review the aesthetics of Sara Douda dance. Seni memang memiliki kepenuhan dalam dirinya sendiri. Tetapi ia juga sekaligus punya faedah aksiologis, baik secara sosial, kultural, religius maupun secara ekonomis. Tarian Sara Douda pun demikian. Estetika Sara Douda pertama-tama ada dalam semua gerak tariannya. Juga dalam seluruh perlengkapan tarian tersebut. Bukan itu saja, estetika tarian ini juga ada dalam simbol-simbol verbal berupa tuturan menjelang tarian. Tetapi baik bentuk-bentuk estetisasi nonverbal maupun verbal, sama-sama disatukan oleh kepingan-kepingan nilai-nilai sosio-kultural dan religius masyarakat Loli tentang penghormatan kepada leluhur, tentang harmoni sosial, dan tentang penghargaan yang tinggi terhadap satu sama lain. Penelitian ini menggunakan pendekatan linguistik kebudayaan demi menemukan dan menelaah estetika dalam tarian Sara Douda
Completion of Launch Director Console Project and Other Support Work
Steinrock, Joshua G.
2018-01-01
There were four projects that I was a part of working on during the spring semester of 2018. This included the completion of the Launch Director Console (LDC) project and the completion and submission of a Concept of Operations (ConOps) document for the Record and Playback System (RPS) at the Launch Control Center (LCC), as well as supporting the implementation of a unit in RPS known as the CDP (Communication Data Processor). Also included was my support and mentorship of a High School robotics team that is sponsored by Kennedy Space Center. The LDC project is an innovative workstation to be used by the launch director for the future Space Launch System program. I worked on the fabrication and assembly of the final console. The ConOps on RPS is a technical document for which I produced supporting information and notes. All of this was done in the support of the IT Project Management Office (IT-F). The CDP is a subsystem that will eventually be installed in and operated by RPS.
System Analysis and Risk Assessment System (SARA), Version 4.0
International Nuclear Information System (INIS)
Russell, K.D.; Sattison, M.B.; Skinner, N.L.; Stewart, H.D.; Wood, S.T.
1992-02-01
This NUREG is the reference manual for the System Analysis and Risk Assessment (SARA) System Version 4.0, a microcomputer-based system used to analyze the safety issues of a family [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. The SARA data base contains PRA data for the dominant accident sequences of a family and descriptive information about the family including event trees, fault trees, and system model diagrams. The number of facility data bases that can be accessed is limited only by the amount of disk storage available. To simulate changes to family systems, SARA users change the failure rates of initiating and basic events and/or modify the structure of the cut sets that make up the event trees, fault trees, and systems. The user then evaluates the effects of these changes through the recalculation of the resultant accident sequence probabilities and importance measures. The results are displayed in tables and graphs
User's operating procedures. Volume 3: Projects directorate information programs
Haris, C. G.; Harris, D. K.
1985-01-01
A review of the user's operating procedures for the scout project automatic data system, called SPADS is presented. SPADS is the results of the past seven years of software development on a prime mini-computer. SPADS was developed as a single entry, multiple cross-reference data management and information retrieval system for the automation of Project office tasks, including engineering, financial, managerial, and clerical support. This volume, three of three, provides the instructions to operate the projects directorate information programs in data retrieval and file maintenance via the user friendly menu drivers.
Konflik SARA pada Pilkada DKI Jakarta di Grup WhatsApp dengan Anggota Multikultural
Directory of Open Access Journals (Sweden)
Tiara Kharisma
2017-12-01
Full Text Available Keanekaragaman SARA di Indonesia melahirkan masyarakat multikultural. Dalam kehidupannya, komunikasi antarbudaya tidak dapat dihindarkan. Salah satu medium dalam melakukan komunikasi antarbudaya adalah media sosial. Pada masyarakat multikultural isu SARA menjadi faktor utama penyebab terjadinya konflik. Di Pilkada DKI Jakarta 2017, isu SARA di grup WhatsApp marak menyebar termasuk anggota grup yang heterogen. Penelitian ini bertujuan untuk mengetahui pengelolaan konflik isu SARA pada Pilkada DKI Jakarta 2017 di grup WhatsApp dengan anggota multikultural. Penelitian ini menggunakan pendekatan kualitatif dengan teknik pengumpulan data melalui wawancara dan studi literatur. Dalam membahas penelitian ini, peneliti menggunakan kerangka teori manajemen konflik dari Martin, J. N. dan Nakayama. Hasil penelitian menunjukkan bahwa konflik terjadi karena ada anggota grup menyampaikan pesan bukan berangkat dari kesamaan anggota grup, yakni kepentingan dan tujuan awal dibentuknya grup. Pesan disebarkan dengan menganggap wujud pembelaan terhadap suatu agama. Ketika konflik terjadi, strategi pengelolaan konflik yang diterapkan adalah strategi mengompromikan (compromising dan menghindar (avoiding. Dalam grup terdapat anggota yang berperan sebagai cultural brokers.
System Analysis and Risk Assessment (SARA) system
International Nuclear Information System (INIS)
Krantz, E.A.; Russell, K.D.; Stewart, H.D.; Van Siclen, V.S.
1986-01-01
Utilization of Probabilistic Risk Assessment (PRA) related information in the day-to-day operation of plant systems has, in the past, been impracticable due to the size of the computers needed to run PRA codes. This paper discusses a microcomputer-based database system which can greatly enhance the capability of operators or regulators to incorporate PRA methodologies into their routine decision making. This system is called the System Analysis and Risk Assessment (SARA) system. SARA was developed by EG and G Idaho, Inc. at the Idaho National Engineering Laboratory to facilitate the study of frequency and consequence analyses of accident sequences from a large number of light water reactors (LWRs) in this country. This information is being amassed by several studies sponsored by the United States Nuclear Regulatory Commission (USNRC). To meet the need of portability and accessibility, and to perform the variety of calculations necessary, it was felt that a microcomputer-based system would be most suitable
Concurrent software system design supported by SARA at the age of one
Energy Technology Data Exchange (ETDEWEB)
Campos, I.M.; Estrin, G.
A multilevel modeling method suitable for the design of concurrent hardware or software systems is presented. The methodology is requirement driven and uses tools incorporated in a programming system called SARA (Systems ARchitect's Apprentice). Both top-down refinement and bottom-up abstraction are supported. The design of an asynchronous sender-receiver illustrates the key steps in going smoothly from programing in the large to programing in the small or actual code. The same methodology can be used to design hardware systems by applying different pragmatics from those proposed for software systems. SARA consists of a set of interactive tools implemented both at UCLA and also on the MIT-Multics system. Although SARA continues in long-term development, completed design tools are accessible for experimentation by authorized users at either location via the ARPANET. 9 figures, 2 tables.
Barriers to Implementing the ACGME Outcome Project: A Systematic Review of Program Director Surveys.
Malik, Mohammad U; Diaz Voss Varela, David A; Stewart, Charles M; Laeeq, Kulsoom; Yenokyan, Gayane; Francis, Howard W; Bhatti, Nasir I
2012-12-01
The Accreditation Council for Graduate Medical Education (ACGME) introduced the Outcome Project in July 2001 to improve the quality of resident education through competency-based learning. The purpose of this systematic review is to determine and explore the perceptions of program directors regarding challenges to implementing the ACGME Outcome Project. We used the PubMed and Web of Science databases and bibliographies for English-language articles published between January 1, 2001, and February 17, 2012. Studies were included if they described program directors' opinions on (1) barriers encountered when attempting to implement ACGME competency-based education, and (2) assessment methods that each residency program was using to implement competency-based education. Articles meeting the inclusion criteria were screened by 2 researchers. The grading criterion was created by the authors and used to assess the quality of each study. The survey-based data reported the opinions of 1076 program directors. Barriers that were encountered include: (1) lack of time; (2) lack of faculty support; (3) resistance of residents to the Outcome Project; (4) insufficient funding; (5) perceived low priority for the Outcome Project; (6) inadequate salary incentive; and (7) inadequate knowledge of the competencies. Of the 6 competencies, those pertaining to patient care and medical knowledge received the most responses from program directors and were given highest priority. The reviewed literature revealed that time and financial constraints were the most important barriers encountered when implementing the ACGME Outcome Project.
SARAS MEASUREMENT OF THE RADIO BACKGROUND AT LONG WAVELENGTHS
International Nuclear Information System (INIS)
Patra, Nipanjana; Subrahmanyan, Ravi; Sethi, Shiv; Shankar, N. Udaya; Raghunathan, A.
2015-01-01
SARAS is a correlation spectrometer connected to a frequency independent antenna that is purpose-designed for precision measurements of the radio background at long wavelengths. The design, calibration, and observing strategies admit solutions for the internal additive contributions to the radiometer response, and hence a separation of these contaminants from the antenna temperature. We present here a wideband measurement of the radio sky spectrum by SARAS that provides an accurate measurement of the absolute brightness and spectral index between 110 and 175 MHz. Accuracy in the measurement of absolute sky brightness is limited by systematic errors of magnitude 1.2%; errors in calibration and in the joint estimation of sky and system model parameters are relatively smaller. We use this wide-angle measurement of the sky brightness using the precision wide-band dipole antenna to provide an improved absolute calibration for the 150 MHz all-sky map of Landecker and Wielebinski: subtracting an offset of 21.4 K and scaling by a factor of 1.05 will reduce the overall offset error to 8 K (from 50 K) and scale error to 0.8% (from 5%). The SARAS measurement of the temperature spectral index is in the range −2.3 to −2.45 in the 110–175 MHz band and indicates that the region toward the Galactic bulge has a relatively flatter index
Directory of Open Access Journals (Sweden)
Mohammad Supriyadi
2015-12-01
Full Text Available Tulisan ini memberikan gambaran runtuhnya pengaruh isu primordialisme di ruang publik dan digantikan dengan kearifan konvensional. Penelitian ini mengambil aspek pengaruh isu SARA pada aspek rasionalitas pemilih. Penulis menemukan beberapa aspek yang mendukung kesimpulan penelitian, antara lain; bahwa isu SARA tidak terlalu direspek pemilih rasional. Pemilih rasional lebih melihat masalah yang ada dan mengevaluasi kinerja pemerintahan sebelumnya. Di lain pihak, emosi antusias terhadap isu etnisitas akan memantabkan pilihan politik terhadap pemilih etnis minoritas, sebagai bentuk penguatan komunitas. Dengan menggunakan pendekatan teori pilihan rasional (rational choice theory, penulis melihat bahwa komunikasi politik yang dibangun melalui isu SARA di ruang publik dalam kehidupan masyarakat modern, tidak lagi mampu memengaruhi pemilih rasional. Pemilih rasional (rational choice, menentukan pilihan berdasarkan pada keuntungan yang diperolehnya (maximizing benefit. Dalam faktor ini sikap pemilih lebih dipengaruhi karakteristik dan track record kandidat.
NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1488 ref|ZP_01187451.1| conserved hypothetical protein [Bacillus weihenstep...hanensis KBAB4] gb|EAR73176.1| conserved hypothetical protein [Bacillus weihenstephanensis KBAB4] ZP_01187451.1 0.78 25% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1089 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1089 ref|ZP_00518636.1| Major facilitator superfamily [Crocosphaera watson...ii WH 8501] gb|EAM48279.1| Major facilitator superfamily [Crocosphaera watsonii WH 8501] ZP_00518636.1 1.3 32% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...
New project director for Honduras.
1984-01-01
Miguel Machuca has been installed as project director for the Honduras Contraceptive Social Marketing Program (HCSMP). he was selected from a field of candidates with public and private sector experience in marketing, business management and program development. Machuca will direct the development of the social marketing program and work to establish a marketing function within ASHONPLAFA, the sponsoring organization for HCSMP. A major goal is to correct misinformation or lack of information about family planning methods among consumers and reatilers; for example, consumers worry about the side-effects of oral contraceptives (OCs) and many perceive subsidized products to be either experimental or discards. Easily understandable graphic package naterials are being prepared for OCs distributed through the program. Another goal is sales training. The project is scheduled to be launched in March 1984 with distribution of Perla, a standard dose OC. Radio spots and newspaper ads are being prepared to inform consumers that Perla can be purchased through pharmacies and small rural shops at the cost of US$.75/cycle. A low-dose OC, a condom and a vaginal tablet are scheduled to be added to the product line by December 1984. Market research on brand names, packaging and pricing of these products is currently being conducted. According the Machuca, his biggest challenge will be to maintain a balance between the need to comply with the policies and regulations of the various organizations involved with the HCSMP and the simultaneous need to promote and implement the entrepreneurial activities necessary to project goals.
NCBI nr-aa BLAST: CBRC-SARA-01-1419 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1419 ref|YP_101126.1| hypothetical protein BF3850 [Bacteroides fragili...s YCH46] dbj|BAD50592.1| hypothetical protein [Bacteroides fragilis YCH46] YP_101126.1 5e-09 92% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0522 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0522 ref|YP_001499570.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae... MTU5] gb|ABV85023.1| Peptidyl-tRNA hydrolase [Rickettsia massiliae MTU5] YP_001499570.1 4.7 36% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0900 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0900 ref|YP_898010.1| phosphatidylserine synthase [Francisella tularen...sis subsp. novicida U112] gb|ABK89256.1| phosphatidylserine synthase [Francisella tularensis subsp. novicida U112] YP_898010.1 3.0 27% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0144 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0144 ref|YP_438659.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailand...ensis E264] gb|ABC35120.1| alcohol dehydrogenase, zinc-containing [Burkholderia thailandensis E264] YP_438659.1 0.69 35% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1967 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1967 ref|ZP_00370594.1| Predicted DNA repair exonuclease [Campylobacter upsaliens...is RM3195] gb|EAL53370.1| Predicted DNA repair exonuclease [Campylobacter upsaliensis RM3195] ZP_00370594.1 0.047 31% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1753 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1753 ref|YP_001476411.1| amino acid permease-associated region [Serratia proteam...aculans 568] gb|ABV39283.1| amino acid permease-associated region [Serratia proteamaculans 568] YP_001476411.1 0.83 35% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1309 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1309 ref|YP_001125845.1| hypothetical protein GTNG_1736 [Geobacillus thermoden...itrificans NG80-2] gb|ABO67100.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] YP_001125845.1 0.47 23% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0488 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0488 ref|YP_064024.1| sulfate permease (SulP) [Desulfotalea psychrophi...la LSv54] emb|CAG35017.1| probable sulfate permease (SulP) [Desulfotalea psychrophila LSv54] YP_064024.1 6.1 37% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0771 ref|NP_001029253.1| progestin and adipoQ receptor family member V...II [Rattus norvegicus] gb|AAY67652.1| progestin membrane receptor alpha [Rattus norvegicus] NP_001029253.1 1e-167 82% ...
Directory of Open Access Journals (Sweden)
X. Y. Jiang
2014-08-01
Full Text Available The aim of this study was to evaluate protein expression patterns of liver in response to subacute ruminal acidosis (SARA induced by high-concentrate diet. Sixteen healthy mid-lactating goats were randomly divided into 2 groups and fed either a high-forage (HF diet or a high-concentrate (HC diet. The HC diet was expected to induce SARA. After ensuring the occurrence of SARA, liver samples were collected. Proteome analysis with differential in gel electrophoresis technology revealed that, 15 proteins were significantly modulated in liver in a comparison between HF and HC-fed goats. These proteins were found mainly associated with metabolism and energy transfer after identified by matrix-assisted laser desorption ionization/time of flight. The results indicated that glucose, lipid and protein catabolism could be enhanced when SARA occurred. It prompted that glucose, lipid and amine acid in the liver mainly participated in oxidation and energy supply when SARA occurred, which possibly consumed more precursors involved in milk protein and milk fat synthesis. These results suggest new candidate proteins that may contribute to a better understanding of the mechanisms that mediate liver adaptation to SARA.
NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0322 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0322 ref|ZP_01459778.1| conserved hypothetical protein [Stigmatella au...rantiaca DW4/3-1] gb|EAU69359.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1] ZP_01459778.1 5.2 34% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1608 ref|XP_513201.1| PREDICTED: cannabinoid receptor 2 (macrophage) i...soform 2 [Pan troglodytes] ref|XP_001166334.1| PREDICTED: cannabinoid receptor 2 (macrophage) isoform 1 [Pan troglodytes] XP_513201.1 1e-155 77% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0256 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0256 ref|ZP_00739965.1| Integral membrane protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO55770.1| Integral membrane protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00739965.1 1.3 24% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1099 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1099 ref|YP_001337495.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumonia...e MGH 78578] gb|ABR79228.1| hypothetical protein KPN_03841 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337495.1 0.93 29% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0771 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0771 ref|NP_001033642.1| progestin and adipoQ receptor family member V...II [Bos taurus] gb|AAI11285.1| Progestin and adipoQ receptor family member VII [Bos taurus] NP_001033642.1 1e-180 87% ...
Maximilien Brice
2010-01-01
Signature of MoU between CERN and Australian Collaboration for Accelerator Science (ACAS); Roger Rassool, ACAS Director; Mark Boland, ACAS Deputy Director; Jean-Pierre Delahaye, CLIC Project Leader; in the presence of Rolf Heuer, Director-General and Emmanuel Tsesmelis, Adviser for Australia
NCBI nr-aa BLAST: CBRC-SARA-01-1273 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1273 ref|ZP_00367235.1| competence locus E (comE3), putative [Campylob...acter coli RM2228] gb|EAL57139.1| competence locus E (comE3), putative [Campylobacter coli RM2228] ZP_00367235.1 0.001 28% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1804 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1804 ref|ZP_00743402.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO52327.1| Sensory box/GGDEF family protein [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00743402.1 0.20 36% ...
Severe accident recriticality analyses (SARA)
Energy Technology Data Exchange (ETDEWEB)
Frid, W. E-mail: wiktor.frid@ski.se; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H
2001-11-01
Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s{sup -1} injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g{sup -1}, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s{sup -1}. In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated
Severe accident recriticality analyses (SARA)
International Nuclear Information System (INIS)
Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Nilsson, L.; Puska, E.K.; Sjoevall, H.
2001-01-01
Recriticality in a BWR during reflooding of an overheated partly degraded core, i.e. with relocated control rods, has been studied for a total loss of electric power accident scenario. In order to assess the impact of recriticality on reactor safety, including accident management strategies, the following issues have been investigated in the SARA project: (1) the energy deposition in the fuel during super-prompt power burst; (2) the quasi steady-state reactor power following the initial power burst; and (3) containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality--both super-prompt power bursts and quasi steady-state power generation--for the range of parameters studied, i.e. with core uncovering and heat-up to maximum core temperatures of approximately 1800 K, and water flow rates of 45-2000 kg s -1 injected into the downcomer. Since recriticality takes place in a small fraction of the core, the power densities are high, which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal g -1 , was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding rate of 2000 kg s -1 . In most cases, however, the predicted energy deposition was smaller, below the regulatory limits for fuel failure, but close to or above recently observed thresholds for fragmentation and dispersion of high burn-up fuel. The highest calculated quasi steady
NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1746 ref|NP_001100989.1| non imprinted in Prader-Willi/Angelman syndro...me 1 homolog [Rattus norvegicus] gb|EDL86455.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) (predicted) [Rattus norvegicus] NP_001100989.1 1e-113 80% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1578 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1578 ref|NP_001077100.1| cOR52N9 olfactory receptor family 52 subfamily N-like [Canis lupus... familiaris] gb|ABO36681.1| 52N9 olfactory receptor protein [Canis lupus familiaris] NP_001077100.1 1e-146 78% ...
Reactivity of Athabasca residue and of its SARA fractions during residue hydroconversion
Energy Technology Data Exchange (ETDEWEB)
Verstraete, J.; Danial-Fortain, P.; Gauthier, T.; Merdrignac, I. [IFP-Lyon, Vermaison (France); Budzinski, H. [Bordeaux Univ. (France). ISM-LPTC, UMR CNRS
2009-07-01
Residue conversion processes are becoming increasingly important because of the declining market for residual fuel oil and a greater demand for middle distillates. Ebullated-bed hydroconversion is a commercially proven technology for converting heavy feedstocks with high amounts of impurities. The process enables the conversion of atmospheric or vacuum residues at temperatures up to 440 degrees C, and at liquid hourly space velocity (LHSV) conditions in the range of 0.15 to 0.5 per hour. A 540 degrees C conversion of up to 80 weight per cent can be achieved under these conditions. This paper reported on a research study conducted at IFP Lyon in which the residue hydroconversion in a large-scale ebullated bed bench unit was investigated to determine the impact of operating conditions and feed properties on yield and product qualities. Hydrogen was added to the feed in the bench units to keep a high hydrogen partial pressure and favour the catalytic hydroconversion reactions. In a typical test, the reactor was fed with 50 g of feedstock and 0.45 g of crushed equilibrium industrial NiMo catalyst, pressurized hydrogen and quickly heated at the reaction temperature. This paper also discussed the conversion of Athabasca bitumen residue in the large-scale pilot plant and also in the small scale batch reactor. The effect of operating temperature and space velocity was examined. The reactivity of the saturates, aromatics, resins and asphaltenes (SARA) fractions of the bitumen was studied separately in order to better understand the conversion mechanisms and reactivities. The Athabasca bitumen feed and SARA fractions were also analyzed in terms of standard petroleum analysis, SARA fractionation, elemental analysis, size exclusion chromatography (SEC) and 13C NMR. Hydroconversion experiments were conducted in the batch unit at different reaction temperatures and reaction times. A comparison of small-scale batch results with those obtained with the continuous large-scale bench
Calculations for the design and modification of the 2 cyclotrons of S.A.R.A
International Nuclear Information System (INIS)
Albrand, P.S.; Belmont, J.L.; Ripouteau, F.
1983-09-01
S.A.R.A. is a heavy ion accelerator constituted by 2 cyclotrons. The second cyclotron (post-accelerator) was entirely calculated at the I.S.N. The pole tips of the first cyclotron which is much older, have recently been modified. An almost identical procedure was used for the calculation of each element of the post-accelerator of S.A.R.A. and also for the modifications to the first cyclotron
Zhao, Bryan M; Hoffmann, F Michael
2006-09-01
Overexpression of the inhibitory Smad, Smad7, is used frequently to implicate the Smad pathway in cellular responses to transforming growth factor beta (TGF-beta) signaling; however, Smad7 regulates several other proteins, including Cdc42, p38MAPK, and beta-catenin. We report an alternative approach for more specifically disrupting Smad-dependent signaling using a peptide aptamer, Trx-SARA, which comprises a rigid scaffold, the Escherichia coli thioredoxin A protein (Trx), displaying a constrained 56-amino acid Smad-binding motif from the Smad anchor for receptor activation (SARA) protein. Trx-SARA bound specifically to Smad2 and Smad3 and inhibited both TGF-beta-induced reporter gene expression and epithelial-to-mesenchymal transition in NMuMG murine mammary epithelial cells. In contrast to Smad7, Trx-SARA had no effect on the Smad2 or 3 phosphorylation levels induced by TGF-beta1. Trx-SARA was primarily localized to the nucleus and perturbed the normal cytoplasmic localization of Smad2 and 3 to a nuclear localization in the absence of TGF-beta1, consistent with reduced Smad nuclear export. The key mode of action of Trx-SARA was to reduce the level of Smad2 and Smad3 in complex with Smad4 after TGF-beta1 stimulation, a mechanism of action consistent with the preferential binding of SARA to monomeric Smad protein and Trx-SARA-mediated disruption of active Smad complexes.
NCBI nr-aa BLAST: CBRC-SARA-01-1488 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1488 ref|YP_001474562.1| DNA internalization-related competence protei...n ComEC/Rec2 [Shewanella sediminis HAW-EB3] gb|ABV37434.1| DNA internalization-related competence protein ComEC/Rec2 [Shewanella sediminis HAW-EB3] YP_001474562.1 1.7 33% ...
SarA is a negative regulator of Staphylococcus epidermidis biofilm formation
DEFF Research Database (Denmark)
Martin, Christer; Heinze, C.; Busch, M.
2012-01-01
Biofilm formation is essential for Staphylococcus epidermidis pathogenicity in implant-associated infections. Nonetheless, large proportions of invasive S. epidermidis isolates fail to show accumulative biofilm growth in vitro. We here tested the hypothesis that this apparent paradox is related...... virulence. Genetic analysis revealed that inactivation of sarA induced biofilm formation via over-expression of the giant 1 MDa extracellular matrix binding protein (Embp), serving as an intercellular adhesin. In addition to Embp, increased extracellular DNA (eDNA) release significantly contributed...... to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from up-regulation of metalloprotease SepA, leading to boosted processing of major autolysin AtlE, in turn inducing augmented autolysis and release of chromosomal DNA. Hence, this study identifies sarA as a negative...
NCBI nr-aa BLAST: CBRC-SARA-01-0756 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0756 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 1e-66 52% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1400 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1400 gb|AAW70053.1| MRGX2 [Homo sapiens] gb|AAW70054.1| MRGX2 [Homo sapiens...] gb|AAW70055.1| MRGX2 [Homo sapiens] gb|AAW70070.1| MRGX2 [Homo sapiens] gb|AAW70083.1| MRGX2 [Homo sapiens] AAW70053.1 4e-34 52% ...
NCBI nr-aa BLAST: CBRC-SARA-01-0472 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0472 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-164 89% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1206 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1206 sp|Q8NH41|OR4KF_HUMAN Olfactory receptor 4K15 dbj|BAC05798.1| sev...en transmembrane helix receptor [Homo sapiens] gb|EAW66492.1| olfactory receptor, family 4, subfamily K, member 15 [Homo sapiens] Q8NH41 1e-40 85% ...
Severe Accident Recriticality Analyses (SARA)
Energy Technology Data Exchange (ETDEWEB)
Frid, W. [Swedish Nuclear Power Inspectorate, Stockholm (Sweden); Hoejerup, F. [Risoe National Lab. (Denmark); Lindholm, I.; Miettinen, J.; Puska, E.K. [VTT Energy, Helsinki (Finland); Nilsson, Lars [Studsvik Eco and Safety AB, Nykoeping (Sweden); Sjoevall, H. [Teoliisuuden Voima Oy (Finland)
1999-11-01
Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B{sub 4}C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding
Severe Accident Recriticality Analyses (SARA)
International Nuclear Information System (INIS)
Frid, W.; Hoejerup, F.; Lindholm, I.; Miettinen, J.; Puska, E.K.; Nilsson, Lars; Sjoevall, H.
1999-11-01
Recriticality in a BWR has been studied for a total loss of electric power accident scenario. In a BWR, the B 4 C control rods would melt and relocate from the core before the fuel during core uncovery and heat-up. If electric power returns during this time-window unborated water from ECCS systems will start to reflood the partly control rod free core. Recriticality might take place for which the only mitigating mechanisms are the Doppler effect and void formation. In order to assess the impact of recriticality on reactor safety, including accident management measures, the following issues have been investigated in the SARA project: 1. the energy deposition in the fuel during super-prompt power burst, 2. the quasi steady-state reactor power following the initial power burst and 3. containment response to elevated quasi steady-state reactor power. The approach was to use three computer codes and to further develop and adapt them for the task. The codes were SIMULATE-3K, APROS and RECRIT. Recriticality analyses were carried out for a number of selected reflooding transients for the Oskarshamn 3 plant in Sweden with SIMULATE-3K and for the Olkiluoto 1 plant in Finland with all three codes. The core state initial and boundary conditions prior to recriticality have been studied with the severe accident codes SCDAP/RELAP5, MELCOR and MAAP4. The results of the analyses show that all three codes predict recriticality - both superprompt power bursts and quasi steady-state power generation - for the studied range of parameters, i. e. with core uncovery and heat-up to maximum core temperatures around 1800 K and water flow rates of 45 kg/s to 2000 kg/s injected into the downcomer. Since the recriticality takes place in a small fraction of the core the power densities are high which results in large energy deposition in the fuel during power burst in some accident scenarios. The highest value, 418 cal/g, was obtained with SIMULATE-3K for an Oskarshamn 3 case with reflooding
Directory of Open Access Journals (Sweden)
Jorge A. Orrego-Ruiz
2014-06-01
Full Text Available In this work, prediction models of Saturates, Aromatics, Resins and Asphaltenes fractions (SARA from thirty-seven vacuum residues of representative Colombian crudes and eighteen fractions of molecular distillation process were obtained. Mid-Infrared (MIR Attenuated Total Reflection (ATR spectroscopy in combination with partial least squares (PLS regression analysis was used to estimate accurately SARA analysis in these kind of samples. Calibration coefficients of prediction models were for saturates, aromatics, resins and asphaltenes fractions, 0.99, 0.96, 0.97 and 0.99, respectively. This methodology permits to control the molecular distillation process since small differences in chemical composition can be detected. Total time elapsed to give the SARA analysis per sample is 10 minutes.
NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1746 ref|NP_653200.2| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Homo sapiens] sp|Q7RTP0|NIPA1_HUMAN Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 tpg|...DAA01477.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 1 [Homo sapiens] NP_653200.2 1e-113 81% ...
The Remote Observatories of the Southeastern Association for Research in Astronomy (SARA)
Keel, William C.; Oswalt, Terry; Mack, Peter; Henson, Gary; Hillwig, Todd; Batcheldor, Daniel; Berrington, Robert; De Pree, Chris; Hartmann, Dieter; Leake, Martha; Licandro, Javier; Murphy, Brian; Webb, James; Wood, Matt A.
2017-01-01
We describe the remote facilities operated by the Southeastern Association for Research in Astronomy (SARA) , a consortium of colleges and universities in the US partnered with Lowell Observatory, the Chilean National Telescope Allocation Committee, and the Instituto de Astrofísica de Canarias. SARA observatories comprise a 0.96 m telescope at Kitt Peak, Arizona; one of 0.6 m aperture on Cerro Tololo, Chile; and the 1 m Jacobus Kapteyn Telescope at the Roque de los Muchachos, La Palma, Spain. All are operated using standard VNC or Radmin protocols communicating with on-site PCs. Remote operation offers considerable flexibility in scheduling, allowing long-term observational cadences difficult to achieve with classical observing at remote facilities, as well as obvious travel savings. Multiple observers at different locations can share a telescope for training, educational use, or collaborative research programs. Each telescope has a CCD system for optical imaging, using thermoelectric cooling to avoid the need for frequent local service, and a second CCD for offset guiding. The Arizona and Chile telescopes also have fiber-fed echelle spectrographs. Switching between imaging and spectroscopy is very rapid, so a night can easily accommodate mixed observing modes. We present some sample observational programs. For the benefit of other groups organizing similar consortia, we describe the operating structure and principles of SARA, as well as some lessons learned from almost 20 years of remote operations.
Directory of Open Access Journals (Sweden)
Fredy Alberto Reyes
2012-06-01
Full Text Available En este artículo presentamos un método basado en cromatografía líquida en columna para cuantificar la composición química de los cementos asfálticos fabricados en Colombia, sometidos al medio ambiente, mediante la determinación de las fracciones SARA. El método fue aplicado sobre películas de asfalto 60/70 y 80/100 para determinar los cambios en la composición química del material luego de ser expuesto durante 12 meses a las condiciones de intemperie de la ciudad de Bogotá; los ensayos de SARA fueron efectuados para el asfalto original a 1, 3, 6, 9 y 12 meses respectivamente. Los fraccionamientos SARA evidenciaron que el envejecimiento produjo una disminución de la fracción de aromáticos y un incremento en la de asfaltenos respecto al asfalto no envejecido. La disminución de los compuestos aromáticos y de resinas pudo ser responsable del endurecimiento observado en los asfaltos, que presentaron una consistencia dura y quebradiza, lo que está de acuerdo con la obtención de índices coloidales elevados. El método empleado permitió establecer correlaciones entre la composición química del asfalto y sus propiedades mecánicas.Neste artigo apresentamos um método baseado em cromatografia líquida em coluna para quantificar a composição química dos cimentos asfálticos fabricados em Colômbia, submetidos ao médio ambiente, mediante a determinação das frações SARA. O método foi aplicado sobre películas de asfalto 60/70 e 80/100 para determinar as mudanças na composição química do material depois de ser exposto durante 12 meses às condições de intempérie da cidade de Bogotá; os ensaios de SARA foram efetuados para o asfalto original a 1, 3, 6, 9 e 12 meses respectivamente. Os fraccionamentos SARA evidenciaram que o envelhecimento produziu uma diminuição da fração de aromáticos e um incremento na de asfaltenos com respeito ao asfalto não envelhecido. A diminuição dos compostos aromáticos e de resinas p
Towns, Dale; Hannon, Judith; Hendry, Julia; Barnes, Janet; Goldman, Mindy
2011-09-01
The first case describing the SARAH (SARA) antigen occurred in 1990, in an Australian blood donor. Hemolytic disease of the fetus and newborn (HDFN) due to anti-SARA has not been previously described. We report a case of HDFN in a multiparous female. The pregnancy was unremarkable except that she was involved in a seemingly minor motor vehicle accident at 25 weeks' gestation. Routine prenatal antibody screening was negative throughout the pregnancy. She presented at 37 weeks' gestation because of decreased fetal movements. Labor was induced and a 2702-g infant male was delivered. The infant's hemoglobin was 49 g/L and the bilirubin was 153 µmol/L. Blood samples from the parents and infant were referred to Canadian Blood Services National Immunohematology Reference Laboratory and subsequently to the Australian Red Cross Red Cell Reference Service. The father's and infant's red blood cells were confirmed to be SARA positive, and the mother's plasma contained anti-SARA. The infant was successfully treated with a double-volume exchange transfusion. This is the first example of HDFN associated with this antibody. © 2011 American Association of Blood Banks.
Directory of Open Access Journals (Sweden)
P. Balamurugan
2017-07-01
Full Text Available Staphylococcus aureus is a widely acknowledged Gram-positive pathogen for forming biofilm and virulence gene expressions by quorum sensing (QS, a cell to cell communication process. The quorum regulator SarA of S. aureus up-regulates the expression of many virulence factors including biofilm formation to mediate pathogenesis and evasion of the host immune system in the late phases of growth. Thus, inhibiting the production or blocking SarA protein might influence the down-regulation of biofilm and virulence factors. In this context, here we have synthesized 2-[(Methylaminomethyl]phenol, which was specifically targeted toward the quorum regulator SarA through in silico approach in our previous study. The molecule has been evaluated in vitro to validate its antibiofilm activity against clinical S. aureus strains. In addition, antivirulence properties of the inhibitor were confirmed with the observation of a significant reduction in the expression of representative virulence genes like fnbA, hla and hld that are governed under S. aureus QS. Interestingly, the SarA targeted inhibitor showed negligible antimicrobial activity and markedly reduced the minimum inhibitory concentration of conventional antibiotics when used in combination making it a more attractive lead for further clinical tests.
Indicators of induced subacute ruminal acidosis (SARA) in Danish Holstein cows
DEFF Research Database (Denmark)
Danscher, Anne Mette; Li, Shucong; Andersen, Pia H.
2015-01-01
BACKGROUND: The prevalence of subacute ruminal acidosis (SARA) in dairy cows is high with large impact on economy and welfare. Its current field diagnosis is based on point ruminal pH measurements by oral probe or rumenocentesis. These techniques are invasive and inaccurate, and better markers fo...
Transferring generic SARA/OSHA training to US Department of Energy facilities
International Nuclear Information System (INIS)
White, A.; McKinley, T.
1989-01-01
The Technical Resources and Training Section staff at Oak Ridge National Laboratory have developed three extensive training programs for hazardous waste treatment, storage, and disposal facility workers a required by SARA/OSHA, 29 CFR 1910.120. The ORNL program is widely recognized as one of the best in the DOE system. ORNL and ORAU, who manages the Training Resources and Data Exchange (TRADE) network for DOE, entered into as cooperative relationship to respond to the many requests from DOE contractors for copies of the ORNL training materials. This discussion will describe the ORNL program and the process of turning it into a series of generic tools which can be used by additional DOE facilities to meet the training requirements established by SARA/OSHA, 20 CFR 1910.120. The speakers will describe how the materials are being used by DOE facilities as well as plans for additional resources to be developed through TRADE. 5 refs
NCBI nr-aa BLAST: CBRC-SARA-01-1597 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1597 sp|Q9XT58|ADRB3_SHEEP Beta-3 adrenergic receptor (Beta-3 adrenoce...ptor) (Beta-3 adrenoreceptor) gb|AAG31165.1|AF314202_1 beta 3 adrenergic receptor [Ovis aries] gb|AAG31167.1|AF314204_1 beta 3 adrene...rgic receptor [Ovis aries] gb|ABB71185.1| beta 3 adrenergic reecptor [Ovis aries] Q9XT58 1e-140 75% ...
SARAS 2 Constraints on Global 21 cm Signals from the Epoch of Reionization
Singh, Saurabh; Subrahmanyan, Ravi; Udaya Shankar, N.; Sathyanarayana Rao, Mayuri; Fialkov, Anastasia; Cohen, Aviad; Barkana, Rennan; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.
2018-05-01
Spectral distortions in the cosmic microwave background over the 40–200 MHz band are imprinted by neutral hydrogen in the intergalactic medium prior to the end of reionization. This signal, produced in the redshift range z = 6–34 at the rest-frame wavelength of 21 cm, has not been detected yet; and a poor understanding of high-redshift astrophysics results in a large uncertainty in the expected spectrum. The SARAS 2 radiometer was purposely designed to detect the sky-averaged 21 cm signal. The instrument, deployed at the Timbaktu Collective (Southern India) in 2017 April–June, collected 63 hr of science data, which were examined for the presence of the cosmological 21 cm signal. In our previous work, the first-light data from the SARAS 2 radiometer were analyzed with Bayesian likelihood-ratio tests using 264 plausible astrophysical scenarios. In this paper we reexamine the data using an improved analysis based on the frequentist approach and forward-modeling. We show that SARAS 2 data reject 20 models, out of which 15 are rejected at a significance >5σ. All the rejected models share the scenario of inefficient heating of the primordial gas by the first population of X-ray sources, along with rapid reionization. Joint Astronomy Program, Indian Institute of Science, Bangalore 560012, India.
NCBI nr-aa BLAST: CBRC-SARA-01-0195 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0195 ref|NP_036916.1| cannabinoid receptor 1 (brain) [Rattus norvegicu...s] sp|P20272|CNR1_RAT Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) emb|CAA39332.1| CB1 cann...abinoid receptor [Rattus norvegicus] gb|AAA99067.1| neuronal cannabinoid receptor gb|EDL98589.1| cann...abinoid receptor 1 (brain) [Rattus norvegicus] prf||1613453A cannabinoid receptor NP_036916.1 0.0 97% ...
International Nuclear Information System (INIS)
Harris, Eleanor; Abdel-Wahab, May; Spangler, Ann E.; Lawton, Colleen A.; Amdur, Robert J.
2009-01-01
Purpose: To survey the radiation oncology residency program directors on the topics of departmental and institutional support systems, residency program structure, Accreditation Council for Graduate Medical Education (ACGME) requirements, and challenges as program director. Methods: A survey was developed and distributed by the leadership of the Association of Directors of Radiation Oncology Programs to all radiation oncology program directors. Summary statistics, medians, and ranges were collated from responses. Results: Radiation oncology program directors had implemented all current required aspects of the ACGME Outcome Project into their training curriculum. Didactic curricula were similar across programs nationally, but research requirements and resources varied widely. Program directors responded that implementation of the ACGME Outcome Project and the external review process were among their greatest challenges. Protected time was the top priority for program directors. Conclusions: The Association of Directors of Radiation Oncology Programs recommends that all radiation oncology program directors have protected time and an administrative stipend to support their important administrative and educational role. Departments and institutions should provide adequate and equitable resources to the program directors and residents to meet increasingly demanding training program requirements.
NCBI nr-aa BLAST: CBRC-SARA-01-1750 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1750 gb|ABR53744.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascar...iensis] gb|ABR53745.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensi...s] gb|ABR53746.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53747.1| op...sin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR5374...8.1| opsin 1 short-wavelength senstive protein [Daubentonia madagascariensis] gb|ABR53749.1| opsin 1 short-w
DEFF Research Database (Denmark)
Plaizier, Jan C.; Li, Shucong; Danscher, Anne Mette
2017-01-01
The effects of a grain-based subacute ruminal acidosis (SARA) challenge on bacteria in the rumen and feces of lactating dairy cows were determined. Six lactating, rumen-cannulated Danish Holstein cows were used in a cross-over study with two periods. Periods included two cows on a control diet...... and two cows on a SARA challenge. The control diet was a total mixed ration containing 45.5% dry matter (DM), 43.8% DM neutral detergent fiber, and 19.6% DM starch. The SARA challenge was conducted by gradually substituting the control diet with pellets containing 50% wheat and 50% barley over 3 days...... to reach a diet containing 55.6% DM, 31.3% DM neutral detergent fiber, and 31.8% DM starch, which was fed for four more days. Rumen fluid samples were collected at day 7 and 10 of experimental periods. Feces samples were collected on days 8 and 10 of these periods. Extracted DNA from the rumen and feces...
Directory of Open Access Journals (Sweden)
Grit Grigoleit
2011-03-01
Full Text Available Auch bei steigender Erwerbsbeteiligung von Frauen ist der deutsche Arbeitsmarkt von einer weitverbreitenden Chancenungleichheit gekennzeichnet. Die Lebenswirklichkeiten von Migrant/-innen und ihre Einbindung in die vergeschlechtlichten Prozesse am Arbeitsmarkt wurden bislang nicht systematisch erfasst. An diesem Punkt setzt Sara John an, indem sie theoretische Konzeptionen zur Vergeschlechtlichung und zur Ethnisierung auf dem Arbeitsmarkt zusammenführt. In einem multidisziplinären Ansatz werden die zahlreichen Verschränkungen um das Phänomen ‚ethnisierte Arbeit‘ aufgegriffen, die vor dem Hintergrund der Debatte um Deutschland als Einwanderungsland zunehmend an Bedeutung und Brisanz gewinnen.Although women’s labor force participation is rising, the German job market is characterized by a widespread lack of equal opportunities. Thus far, the everyday realities of migrants and their integration into the gendered processes on the job market have not been collected systematically. This is where Sara John begins her study by combining theoretical conceptions about gendering and ethnicizing on the job market. In a multidisciplinary approach, several entanglements surrounding the phenomenon ‘ethnicized labor’ are taken into account. These entanglements keep gaining importance and topicality against the backdrop of Germany as a country of immigration.
Nguyen, Hung D.; Steele, Gynelle C.
2017-01-01
This report is intended to help NASA program and project managers incorporate Small Business Innovation Research (SBIR) technologies into NASA Aeronautics Research Mission Directorate (ARMD) projects. Other Government and commercial project managers interested in ARMD funding opportunities through NASA's SBIR program will find this report useful as well.
Layering of life (Sara novel of Peter Sarić)
Kostić, Dragomir J.
2015-01-01
Novel Sara of Petar Sarić consists of two parts; in it are processed or present two wars, two major wars in the region of Montenegro and Herzegovina, the First and Second World War. However, it is more novel about divisions within the family and the man himself, (and infamous assault of godfather Luka on Sarah also and his murder are in that function), in the first part; and on the divisions among the people, in general, in the second part of the novel. The second part is, in fact, the image ...
NCBI nr-aa BLAST: CBRC-SARA-01-1608 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1608 ref|NP_001832.1| cannabinoid receptor 2 (macrophage) [Homo sapien...s] sp|P34972|CNR2_HUMAN Cannabinoid receptor 2 (CB2) (CB-2) (CX5) emb|CAA52376.1| CB2 (peripheral) cannabino...id receptor [Homo sapiens] emb|CAD22548.1| peripheral cannabinoid receptor CB2 [Homo sapiens] emb|CAD22549.1| peripheral cann...abinoid receptor CB2 [Homo sapiens] gb|AAO92299.1| cannabinoid r...eceptor 2 [Homo sapiens] emb|CAI14799.1| cannabinoid receptor 2 (macrophage) [Homo sapiens] emb|CAJ42137.1| cann
Directory of Open Access Journals (Sweden)
Tirshem Kumar Kaushik
2015-05-01
Full Text Available Saras Cranes Grus antigone are endangered birds of open wetlands with highly worrying depletion trends being witnessed related with disappearance of marshy and shallow perennial, expansive wetlands throughout northern India. Alongside, massive hunting in 18th, 19th and 20th centuries and even today is another serious cause for their worrisome deterioration. Also, destruction of nests, eggs, fledglings and adults by aboriginals indeliberately or deliberately is causing these cranes to perish sooner than latter, completely. Now, Saras Cranes are found in limited number and domain as four populations in the entire world including India, China, Burma, South East Asia and northern Australia. The population of Indian Saras Crane is pitiably restricted to Etawa and Mainpuri districts of Uttar Pradesh. Stray birds of this species are restricted to Kanha National Park in Madhya Pradesh and in some parts of Gujarat and Assam. It is interesting to note that few pairs have been seen in Faridabad and Palwal districts in southern Haryana, India. These need to be protected and conserved.
Sara Wasson and Emily Alder, Gothic Science Fiction 1980-2010
Beaulé, Sophie
2014-01-01
With their collection of essays Gothic Science Fiction 1980-2010, Sara Wasson and Emily Alder illustrate the richness of gothic tropes in contemporary forms, from novels and movies to card games. More than cliché, melodrama, or gore, the “gothick” (to borrow Adam Roberts’s term, xi) allows for the hybridity in contemporary production, especially in science fiction, that the collected articles examine. The book is divided into three parts, “Redefining Genres”, “Biopower and Capital”, and “Gend...
The Workplace Literacy System Project (WLS). Final Performance Report.
Poulton, Bruce R.
The Workplace Literacy System Project (WLS) prepared interactive CD-ROM discs containing about 50 hours of instruction and drill in basic skills presented within the context of the textile/apparel manufacturing industry. The project was conducted at a Sara Lee knit products plant in North Carolina. During the project, literacy task analyses were…
Directory of Open Access Journals (Sweden)
Abdullah K. Shehabat
2016-09-01
Full Text Available This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at their own homes and assert the potentials of their femininity despite their endings. Empowered by the powers of reading, strong will and meticulous work, the protagonists were able to realize their own material independence and achieve their lifelong ambitions. However, through Firdaus' and Sara's journeys of breaking their silence, they were subject to different patterns of self-annihilation. While Firdaus was sentenced to death for killing a pimp, Sara embraced living under the hegemony of an authoritarian husband.
Digital Repository Service at National Institute of Oceanography (India)
Panampunnayil, S.U.
on the third segment of the mandibular palp and by the modification of the exopod of the third pleopod of the male. G. sarae is distinguished from the other species by the shape and armature of the telson...
A simple blowdown code for SUPER-SARA loop conditions
International Nuclear Information System (INIS)
Fritz, G.
1981-01-01
The Super Sara test programme (SSTP) is aimed to study in pile the fuel and cluster behaviour under two types of accident conditions: - the ''Large break loss of coolant'' condition (LB-Loca), - the ''Severe fuel damage'' (SFD) in a boildown caused by a small break. BIVOL was developed for the LB-Loca situation. This code is made for a loop where essentially two volumes define the thermohydraulics during the blowdown. In the SUPERSARA loop these two volumes are represented by the hot leg and cold leg pipings together with the respective upper and lower plenum of the test section
NCBI nr-aa BLAST: CBRC-SARA-01-1691 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1691 ref|NP_000854.1| 5-hydroxytryptamine (serotonin) receptor 1B [Hom...o sapiens] ref|NP_001009102.1| 5-hydroxytryptamine (serotonin) receptor 1B [Pan troglodytes] sp|P28222|5HT1B...HT-1B) (Serotonin receptor 1B) (5-HT1B) gb|AAA58675.1| serotonin 1Db receptor gb|AAA36029.1| serotonin recep...tor gb|AAA36030.1| 5-hyroxytryptamine 1D receptor dbj|BAA01763.1| serotonin 1B receptor [Homo sapiens] gb|AAA60316.1| serotonin... 1D receptor emb|CAB51537.1| 5-hydroxytryptamine (serotonin) r
NCBI nr-aa BLAST: CBRC-SARA-01-1942 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1942 ref|NP_000669.1| alpha-1D-adrenergic receptor [Homo sapiens] sp|P...25100|ADA1D_HUMAN Alpha-1D adrenergic receptor (Alpha 1D-adrenoceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic... receptor) (Alpha adrenergic receptor 1a) gb|AAB60351.1| adrenergic alpha-1a receptor protein gb|AAB59487.1| alpha 1a/d adre...nergic receptor dbj|BAA06222.1| alpha1A/D adrenergic rec...eptor [Homo sapiens] emb|CAH70478.1| adrenergic, alpha-1D-, receptor [Homo sapiens] emb|CAC00601.2| adrenergic
Nuclear spectroscopy of exotic nuclei with the SARA/IGISOL facility
International Nuclear Information System (INIS)
Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Aerje, J.; Aeystoe, J.; Jauho, P.; Barneoud, D.; Genevey, J.; Gizon, A.
1995-01-01
Some recent decay studies of neutron-rich and proton-rich nuclei are presented for nuclear structure investigations far off the valley of stability. The experiments, carried out at SARA, are based either on charged particle-induced fission of 238 U or on HI-induced fusion-evaporation reactions in combination with the IGISOL technique. The basic principle of this latter is recalled together with its advantages and limitations. The spectroscopic results obtained in three different regions of the chart of nuclei are sketched. (authors). 30 refs., 7 figs
Nguyen, Hung D.; Steele, Gynelle C.
2016-01-01
This report is intended to help NASA program and project managers incorporate Small Business Innovation Research/Small Business Technology Transfer (SBIR)/(STTR) technologies into NASA Aeronautics Research Mission Directorate (ARMD) projects. Other Government and commercial projects managers can also find this useful.
Michel Blanc
2012-01-01
27 February 2012 - Director of the Health Directorate at the Research DG European Commission R. Draghia-Akli in the ATLAS visitor centre with ATLAS Former Collaboration Spokesperson P. Jenni and Head of CERN EU Projects Office S. Stavrev; in the LHC superconducting magnet test hall with E. Todesco; and signing the guest book with CERN Director-General R. Heuer.
International Nuclear Information System (INIS)
Sattison, M.B.; Russell, K.D.; Skinner, N.L.
1994-07-01
The Systems Analysis Programs for Hands-on Integrated Reliability Evaluations (SAPHIRE) refers to a set of several microcomputer programs that were developed to create and analyze probabilistic risk assessments (PRAs) primarily for nuclear power plants. This volume is the tutorial manual for the Systems Analysis and Risk Assessment (SARA) System Version 5.0, a microcomputer-based system used to analyze the safety issues of a open-quotes familyclose quotes [i.e., a power plant, a manufacturing facility, any facility on which a probabilistic risk assessment (PRA) might be performed]. A series of lessons is provided that guides the user through some basic steps common to most analyses performed with SARA. The example problems presented in the lessons build on one another, and in combination, lead the user through all aspects of SARA sensitivity analysis capabilities
The technical status of the supersara project at its termination
International Nuclear Information System (INIS)
Markovina, A.; Randles, J.
1987-01-01
On March 10th 1983 the Council of Ministers of the European Community adopted the decision to abandon the SuperSARA project. In the frame of this decision, the Management of the SuperSARA project formulated the guidelines to close the project, which included the preparation of the present final report. This report presents the final status of the project, which means that it reflects the situation in March 1983, with a few updates introduced shortly afterwards in conformity with the safety requirements which were being revised at that time. The aim of this report is to give a general description of activities which were carried on to implement the experimental programme and to illustrate some important achievements reached in specific areas. In addition, it is also intended to provide the access key to the documentation which was produced in the past years, so as to make the most significant technical material easily available for any possible future use
NCBI nr-aa BLAST: CBRC-SARA-01-0948 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-0948 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens
NCBI nr-aa BLAST: CBRC-SARA-01-1066 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1066 ref|NP_473371.1| MAS-related GPR, member X2 [Homo sapiens] sp|Q96...LB1|MRGX2_HUMAN Mas-related G-protein coupled receptor member X2 gb|AAK91805.1| G protein-coupled receptor [Homo sapiens...] dbj|BAB89339.1| putative G-protein coupled receptor [Homo sapiens] dbj|BAC06030.1| seven trans...membrane helix receptor [Homo sapiens] gb|AAH63450.1| MAS-related GPR, member X2 [Homo sapiens...] gb|AAW70056.1| MRGX2 [Homo sapiens] gb|AAW70057.1| MRGX2 [Homo sapiens] gb|AAW70058.1| MRGX2 [Homo sapiens
NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ... ...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed
Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow
Fletcher, Jack M.; Morris, Robin D.
2014-01-01
Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow's long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the…
Summer Principals'/Directors' Orientation Training Module.
Mata, Robert L.; Garcia, Richard L.
Intended to provide current or potential project principals/directors with the basic knowledge, skills, abilities, and sensitivities needed to manage a summer migrant school project in the local educational setting, this module provides instruction in the project management areas of planning, preparation, control, and termination. The module…
Nguyen, Hung D.; Steele, Gynelle C.
2016-01-01
This report is intended to help NASA program and project managers incorporate Glenn ResearchCenter Small Business Innovation Research/Small Business Technology Transfer (SBIR)/(STTR)technologies into NASA Science Mission Directorate (SMD) programs/projects. Other Government and commercial project managers can also find this useful.
Social humanoid robot SARA: development of the wrist mechanism
Penčić, M.; Rackov, M.; Čavić, M.; Kiss, I.; Cioată, V. G.
2018-01-01
This paper presents the development of a wrist mechanism for humanoid robots. The research was conducted within the project which develops social humanoid robot Sara - a mobile anthropomorphic platform for researching the social behaviour of robots. There are two basic ways for the realization of humanoid wrist. The first one is based on biologically inspired structures that have variable stiffness, and the second one on low backlash mechanisms that have high stiffness. Our solution is low backlash differential mechanism that requires small actuators. Based on the kinematic-dynamic requirements, a dynamic model of the robot wrist is formed. A dynamic simulation for several hand positions was performed and the driving torques of the wrist mechanism were determined. The realized wrist has 2 DOFs and enables movements in the direction of flexion/extension 115°, ulnar/radial deviation ±45° and the combination of these two movements. It consists of a differential mechanism with three spur bevel gears, two of which are driving and identical, while the last one is the driven gear to which the robot hand is attached. Power transmission and motion from the actuator to the input links of the differential mechanism is realized with two parallel placed identical gear mechanisms. The wrist mechanism has high carrying capacity and reliability, high efficiency, a compact design and low backlash that provides high positioning accuracy and repeatability of movements, which is essential for motion control.
Measuring the socio-economic impacts of agroforestry projects in the Philippines
Evan Mercer; Belita Vega; Hermie Francisco; Robin Maille
1994-01-01
Conventional wisdom suggests that agroforestry projects can provide both ecological and economic benefits. Most agroforestry project evaluations, however, have failed to adequately assess the soci0-economic impacts. For example, a review of 108 agroforestry project impact evaluations by Sara Scherr of IFPRJ reported that only 8% assessed economic costs or benefits, 5%...
Directory of Open Access Journals (Sweden)
Iserhard, C. A.
2010-01-01
Full Text Available This work presents new records and extends the geographic distribution of Heliconius sara apseudes in theAtlantic Forest of the state of Rio Grande do Sul. Five new records were taken along butterfly inventories carried outbetween 2005 and 2010 in distinct phytophysiognomies at Rio Grande do Sul northeast region: Swamp Forest, AtlanticForest stricto sensu and Araucaria Moist Forest. The fact that all registers occurred in well preserved habitats of the AtlanticForest emphasizes the need of conservation of this biome in Rio Grande do Sul.
Nguyen, Hung D.; Steele, Gynelle C.
2017-01-01
This report is intended to help NASA program and project managers incorporate Small Business Innovation Research Small Business Technology Transfer (SBIR/STTR) technologies into NASA Human Exploration and Operations Mission Directorate (HEOMD) projects. Other Government and commercial projects managers can also find this useful. Space Transportation; Life Support and Habitation Systems; Extra-Vehicular Activity; High EfficiencySpace Power; Human Exploration and Operations Mission,
Directory of Open Access Journals (Sweden)
John M Morrison
2012-03-01
Full Text Available The modulation of mRNA turnover is gaining recognition as a mechanism by which Staphylococcus aureus regulates gene expression, but the factors that orchestrate alterations in transcript degradation are poorly understood. In that regard, we previously found that 138 mRNA species, including the virulence factors protein A (spa and collagen binding protein (cna, are stabilized in a sarA-dependent manner during exponential phase growth, suggesting that SarA protein may directly or indirectly effect the RNA turnover properties of these transcripts. Herein, we expanded our characterization of the effects of sarA on mRNA turnover during late exponential and stationary phases of growth. Results revealed that the locus affects the RNA degradation properties of cells during both growth phases. Further, using gel mobility shift assays and RIP-ChIP, it was found that SarA protein is capable of binding mRNA species that it stabilizes both in vitro and within bacterial cells. Taken together, these results suggest that SarA post-transcriptionally regulates S. aureus gene expression in a manner that involves binding to and consequently altering the mRNA turnover properties of target transcripts.
Venkataraman, Rohini; Yusuf, Kamran
2017-01-01
Hemolytic disease of newborn (HDN) is a condition that develops in a fetus, when the IgG molecules produced by the mother pass through the placenta and attack the fetal red blood cells. HDN can occur due to Rh and ABO incompatibilities between the mother and the fetus as well as due to other allo-immune antibodies belonging to Kell (K and k), Duffy (Fya), Kidd (Jka and Jkb), and MNS (M, N, S, and s) systems. Role of intravenous immunoglobulin in management of HDN is not clear.SARA red blood cell antigen, first discovered in 1990 is a low frequency antigen. We report, a multiparous female whose pregnancy was complicated by HDN due to anti-SARA antibodies requiring both exchange transfusion and intravenous immunoglobulin. The response was sustained after intravenous immunoglobulin (IVIG) rather than after exchange transfusion.
Reading, Laterality, and the Brain: Early Contributions on Reading Disabilities by Sara S. Sparrow
Fletcher, Jack M.; Morris, Robin D.
2014-01-01
Although best known for work with children and adults with intellectual disabilities and autism spectrum disorders, training in speech pathology and a doctorate in clinical psychology and neuropsychology was the foundation for Sara Sparrow’s long-term interest in reading disabilities. Her first papers were on dyslexia and laterality, and the maturational lag theory of developmental dyslexia proposed with Paul Satz, her mentor. The research program that emerged from this work had a wide impact...
International Nuclear Information System (INIS)
Younger, F.C.
1986-08-01
A design and fabrication effort for a beam director is documented. The conceptual design provides for the beam to pass first through a bending and focusing system (or ''achromat''), through a second achromat, through an air-to-vacuum interface (the ''beam window''), and finally through the vernier steering system. Following an initial concept study for a beam director, a prototype permanent magnet 30 0 beam-bending achromat and prototype vernier steering magnet were designed and built. In volume II, copies are included of the funding instruments, requests for quotations, purchase orders, a complete set of as-built drawings, magnetic measurement reports, the concept design report, and the final report on the design and fabrication project
Goldrick-Rab, Sara; Kelly, Andrew P.
2016-01-01
In this article, "Education Next" talks with Sara Goldrick-Rab and Andrew Kelly. President Obama's proposal for tuition-free community college, seems to have laid down a marker for the Democratic Party. Vermont senator Bernie Sanders is touting his plan for free four-year public college on the primary trail; Massachusetts senator…
Sara, a patient with borderline personality structure: A "crisis" management
Directory of Open Access Journals (Sweden)
Paola Marinelli
2015-05-01
Full Text Available In this article the author examines some significant passages of his treatment of a patient with borderline personality structure, with the intention of giving a formative contribution to the delicate issue of the search for congruence between theory and clinic operations. This reflection is therefore an opportunity to integrate these aspects. The individualization of the therapeutic relationship in the theoretical framework of group analysis allowed the emotional investment in the person of the therapist, which is useful in the construction of a meaningful relationship on the human, emotional and cognitive plane; a space within which it has become increasingly possible for Sara, share and process emotions, re-build, contact parts of the self frustrated and disappointed, perceive less and less the void and become less vulnerable, being able to pull over to the original trauma.
Worthen, Helena Harlow
2012-01-01
The January 2012 issue of "Mind, Culture, and Activity" published the Invited Presidential Address "Rethinking Remedial Education and the Academic-Vocational Divide," given by Mike Rose at the 2011 meeting of the American Educational Research Association in New Orleans, along with responses and commentary by Sara Goldrick-Rab, Kris Gutierrez, and…
Directory of Open Access Journals (Sweden)
Diego O Andrey
Full Text Available Staphylococcus aureus is an important pathogen manifesting virulence through diverse disease forms, ranging from acute skin infections to life-threatening bacteremia or systemic toxic shock syndromes. In the latter case, the prototypical superantigen is TSST-1 (Toxic Shock Syndrome Toxin 1, encoded by tst(H, and carried on a mobile genetic element that is not present in all S. aureus strains. Transcriptional regulation of tst is only partially understood. In this study, we dissected the role of sarA, sarS (sarH1, RNAIII, rot, and the alternative stress sigma factor sigB (σB. By examining tst promoter regulation predominantly in the context of its native sequence within the SaPI1 pathogenicity island of strain RN4282, we discovered that σB emerged as a particularly important tst regulator. We did not detect a consensus σB site within the tst promoter, and thus the effect of σB is likely indirect. We found that σB strongly repressed the expression of the toxin via at least two distinct regulatory pathways dependent upon sarA and agr. Furthermore rot, a member of SarA family, was shown to repress tst expression when overexpressed, although its deletion had no consistent measurable effect. We could not find any detectable effect of sarS, either by deletion or overexpression, suggesting that this regulator plays a minimal role in TSST-1 expression except when combined with disruption of sarA. Collectively, our results extend our understanding of complex multifactorial regulation of tst, revealing several layers of negative regulation. In addition to environmental stimuli thought to impact TSST-1 production, these findings support a model whereby sporadic mutation in a few key negative regulators can profoundly affect and enhance TSST-1 expression.
Construct Validity and Reliability of the SARA Gait and Posture Sub-scale in Early Onset Ataxia
Directory of Open Access Journals (Sweden)
Tjitske F. Lawerman
2017-12-01
Full Text Available Aim: In children, gait and posture assessment provides a crucial marker for the early characterization, surveillance and treatment evaluation of early onset ataxia (EOA. For reliable data entry of studies targeting at gait and posture improvement, uniform quantitative biomarkers are necessary. Until now, the pediatric test construct of gait and posture scores of the Scale for Assessment and Rating of Ataxia sub-scale (SARA is still unclear. In the present study, we aimed to validate the construct validity and reliability of the pediatric (SARAGAIT/POSTURE sub-scale.Methods: We included 28 EOA patients [15.5 (6–34 years; median (range]. For inter-observer reliability, we determined the ICC on EOA SARAGAIT/POSTURE sub-scores by three independent pediatric neurologists. For convergent validity, we associated SARAGAIT/POSTURE sub-scores with: (1 Ataxic gait Severity Measurement by Klockgether (ASMK; dynamic balance, (2 Pediatric Balance Scale (PBS; static balance, (3 Gross Motor Function Classification Scale -extended and revised version (GMFCS-E&R, (4 SARA-kinetic scores (SARAKINETIC; kinetic function of the upper and lower limbs, (5 Archimedes Spiral (AS; kinetic function of the upper limbs, and (6 total SARA scores (SARATOTAL; i.e., summed SARAGAIT/POSTURE, SARAKINETIC, and SARASPEECH sub-scores. For discriminant validity, we investigated whether EOA co-morbidity factors (myopathy and myoclonus could influence SARAGAIT/POSTURE sub-scores.Results: The inter-observer agreement (ICC on EOA SARAGAIT/POSTURE sub-scores was high (0.97. SARAGAIT/POSTURE was strongly correlated with the other ataxia and functional scales [ASMK (rs = -0.819; p < 0.001; PBS (rs = -0.943; p < 0.001; GMFCS-E&R (rs = -0.862; p < 0.001; SARAKINETIC (rs = 0.726; p < 0.001; AS (rs = 0.609; p = 0.002; and SARATOTAL (rs = 0.935; p < 0.001]. Comorbid myopathy influenced SARAGAIT/POSTURE scores by concurrent muscle weakness, whereas comorbid myoclonus predominantly influenced
International Nuclear Information System (INIS)
Bouldjedri, A.
1992-06-01
This work is concerned with the study of exotic nuclei located on both sides of the stability-line and known as neutron rich and neutron deficient respectively. For the former, produced by alpha particle-induced fission, an on-line isotope separation with an ion guide (IGISOL) has been developed and submitted to several off-line and on-line optimization tests showing capacity to spectroscopic studies. In the case of neutron deficient nuclei near the magicity Z=82, 182 Tl(3s) has been identified and its decaying modes and those of 183 Tl ground state, studied, using the on-line separator ISOLDE. On the other hand, the β decay of 172,175 Ir produced in 32 S induced reaction is studied using a helium jet system on the SARA accelerator. Existence of isomers is derived from half-lives measurements
SAPHIRE technical reference manual: IRRAS/SARA Version 4.0
International Nuclear Information System (INIS)
Russell, K.D.; Atwood, C.L.; Sattison, M.B.; Rasmuson, D.M.
1993-01-01
This report provides information on the principles used in the construction and operation of Version 4.0 of the Integrated Reliability and Risk Analysis System (IRRAS) and the System Analysis and Risk Assessment (SARA) system. It summarizes the fundamental mathematical concepts of sets and logic, fault trees, and probability. The report then describes the algorithms that these programs use to construct a fault tree and to obtain the minimal cut sets. It gives the formulas used to obtain the probability of the top event from the minimal cut sets, and the formulas for probabilities that are appropriate under various assumptions concerning repairability and mission time. It defines the measures of basic event importance that these programs can calculate. The report gives an overview of uncertainty analysis using simple Monte Carlo sampling or Latin Hypercube sampling, and states the algorithms used by these programs to generate random basic event probabilities from various distributions. Further references are given, and a detailed example of the reduction and quantification of a simple fault tree is provided in an appendix
Singh, Saurabh; Subrahmanyan, Ravi; Shankar, N. Udaya; Rao, Mayuri Sathyanarayana; Girish, B. S.; Raghunathan, A.; Somashekar, R.; Srivani, K. S.
2018-04-01
The global 21-cm signal from Cosmic Dawn (CD) and the Epoch of Reionization (EoR), at redshifts z ˜ 6-30, probes the nature of first sources of radiation as well as physics of the Inter-Galactic Medium (IGM). Given that the signal is predicted to be extremely weak, of wide fractional bandwidth, and lies in a frequency range that is dominated by Galactic and Extragalactic foregrounds as well as Radio Frequency Interference, detection of the signal is a daunting task. Critical to the experiment is the manner in which the sky signal is represented through the instrument. It is of utmost importance to design a system whose spectral bandpass and additive spurious signals can be well calibrated and any calibration residual does not mimic the signal. Shaped Antenna measurement of the background RAdio Spectrum (SARAS) is an ongoing experiment that aims to detect the global 21-cm signal. Here we present the design philosophy of the SARAS 2 system and discuss its performance and limitations based on laboratory and field measurements. Laboratory tests with the antenna replaced with a variety of terminations, including a network model for the antenna impedance, show that the gain calibration and modeling of internal additive signals leave no residuals with Fourier amplitudes exceeding 2 mK, or residual Gaussians of 25 MHz width with amplitudes exceeding 2 mK. Thus, even accounting for reflection and radiation efficiency losses in the antenna, the SARAS 2 system is capable of detection of complex 21-cm profiles at the level predicted by currently favoured models for thermal baryon evolution.
Escribiendo el silencio: la contemplación poética de Sara Pujol
Directory of Open Access Journals (Sweden)
Gala, Candelas
2005-06-01
Full Text Available Reading Sara Pujol Russell's El fuego tiende su aire (1999 and Intacto asombro de la luz del silencio (2001, is entering into a poetic world whose content and form are both innovative and complex. This poetry invites the reader into a state of meditative contemplation that seeks correspondences among different elements in reality as the key to access a superior type of knowledge. Pujol's writing moves in the fringes between voice and silence, art and nature, meaning and nothingness, identity and difference, it seeks to surpass its own verbal texture while only in that texture does it find articulation and only through it does transcendence becones accessible. The focus of the present reading centers on the point where Pujol's language seeks to transcend the disjunction between sign and surrounding, the point where synthesis is fusion about to dissolve.La lectura de El fuego tiende su aire (1999 e Intacto asombro en la luz del silencio (2001 de Sara Pujol Russell, supone la entrada en un discurso poético innovador y complejo tanto en contenido como en forma. Esta poesía invita a una contemplación meditativa que busca las correspondencias entre los diversos elementos de la realidad como clave para acceder a un conocimiento superior. Su escritura se mueve en los bordes entre la voz y el silencio, el arte y la naturaleza, el sentido y el vacío, la identidad y la diferencia, buscando trascender lo que está más allá de su misma urdimbre verbal pero que sólo en ella se configura, y sólo desde ella se puede acceder. En el movimiento de esta escritura por superar la disyunción entre signo y entorno, en esa síntesis a punto de disolverse, es donde se enfoca la lectura en este ensayo.
Hospital management's linchpin: the medical director.
Cohn, R E
1988-01-01
The practice of medicine has become increasingly complex in this era of diagnosis-related groups (DRGs) and other direct government involvement in health care; complex and seemingly inappropriate legal decisions; liability chaos; and increasing competition from peers, entrepreneurs, and other health care organizations. In this new environment, an old player, the medical director (vice president of medical affairs) has been given new visibility and increased responsibilities to help physicians live with and overcome these environmental factors. In showing how the medical director can be of assistance in putting these factors into perspective, it is helpful to take a look at some aspects of the history of medicine, analyze the education process for physicians, point out where the profession began to be driven off course, and identify some of the overall problems of the profession and of the health care field. It is my intent here to project the position of medical director as a vital, frequently missing, link in the attempt to maximize communications, understanding, and achievement in health care organizations.
2011-01-28
... DEPARTMENT OF HOMELAND SECURITY [Docket No. DHS-2010-0084] National Protection and Programs... Protection Stakeholder Input Project--Generic Clearance AGENCY: National Protection and Programs Directorate.... SUMMARY: The Department of Homeland Security (DHS), National Protection and Programs Directorate (NPPD...
Os suínos da raça Bísara – oportunidades e desafios
Carvalho, Marieta
2015-01-01
A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza1. A carne de porco é um dos alimentos mais consumidos mundialmente, representando em 2012: 43,3% em todo o mundo2, 45,9% na União Europeia1 e 39,8 % em Portugal da carne total consumida3. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da raça Bísara, enumer...
Director ownership, outside directors and commitment to corporate social responsibility
Directory of Open Access Journals (Sweden)
Chen Ying
2011-01-01
Full Text Available This paper examines the effects of director ownership and the proportion of outside directors on firms’ commitment to corporate social responsibility (CSR. Using a sample of 453 Hong Kong listed companies for 2005, we find that there is a non-linear relationship between the level of director ownership and firms’ engagement in CSR behavior. Commitment to CSR first increases as the proportion of director ownership increases up to 50% and then decreases as that proportion of ownership grows higher. Further, the proportion of outside directors on the board exhibits a positive relationship with the level of CSR commitment. These results provide explanations for firms’ commitment to CSR from the corporate governance perspective.
Nuclear spectroscopy of exotic nuclei with the Sara/Igisol facility
International Nuclear Information System (INIS)
Beraud, R.; Emsallem, A.; Astier, A.; Duffait, R.; Le Coz, Y.; Redon, N.; Barneoud, D.; Genevey, J.; Gizon, A.
1994-11-01
The authors review their recent studies on alpha and beta decay of exotic nuclei performed with the on-line mass separator at the Igisol/Sara facility in Grenoble. The experiments using charged particle induced fission have given new information on production cross section and properties of n-rich nuclei with A=110-130 whereas by means of heavy ion induced fusion evaporation reactions the authors have investigated two regions close to the proton drip line around A=180 and A=130. This paper gives first a brief description of the Igisol technique and shows its application in case of two different production modes: charged particle-induced fission and heavy ion -induced fusion-evaporation reactions. The systematic study of the low-lying levels in n-rich Ru isotopes has allowed to show an axial symmetry breaking, whereas complementary investigations are necessary to clarify the case of 180 Tl decay. A number of new spectroscopic data such as new isotopes identification have been gained in the region of light rare earth nuclei. (N.T.)
The Director-General visits the ATLAS construction site at Point 1
Patrice Loiez
1998-01-01
Photo 05 : Claude Guitton (left), Project Manager for the EDF/Knight Piesold joint venture responsible for design and site supervision for LHC civil engineering at Point 1 takes the Director-General Chris Llewellyn Smith and LHC Project Leader Lyn Evans on a tour of the site.
76 FR 72009 - Sunshine Act Notice-December 8, 2011 Board of Directors Meeting
2011-11-21
.... 2. Insurance Project--Middle East and Africa. 3. Finance Project--Maghreb and North Africa. 4... Closed Session of the October 27, 2011 Board of Directors Meeting. 6. Pending Major Projects. Written summaries of the projects to be presented will be posted on OPIC's Web site on or about November 17, 2011...
Director`s series on proliferation
Energy Technology Data Exchange (ETDEWEB)
Bailey, K.C.; Price, M.E. [eds.
1994-12-27
The Director`s Series on Proliferation is an occasional publication of essays on the topics of nuclear, chemical, biological, and missile proliferation. The seven papers presented in this issue cover the following topics: Should the Treaty on the Nonproliferation of Nuclear Weapons (NPT) be amended?; NPT extension - Legal and procedural issues; An Indonesian view of NPT review conference issues; The treaty of Tlatelolco and the NPT - Tools for peace and development; Perspectives on cut-off, weapons dismantlement, and security assurances; Belarus and NPT challenges; A perspective on the chemical weapons convention - Lessons learned from the preparatory commission.
Godwin, Allison; Potvin, Geoff
2017-01-01
This manuscript reports a longitudinal case study of how one woman, Sara, who had previously considered dropping out of high school, authored strong mathematics and science identities and purposefully exhibited agency through her experiences in high school science. These experiences empowered her to choose an engineering major in college; however,…
OSG Director reports on grid progress
Pordes, Ruth
2006-01-01
"In this Q&A from the Open Science Grid (OSG), executive director Ruth Prodes provides a brief history of the OSG, an overview of current projects and partners, and a glimpse at future plans, including how the recent $30 million award from the ODE's office of Science and the NSF will be employed. She also shares her thoughts of SC, saying the personal contacts are the best part."(4,5 pages)
Reading Sara Pujol Russell’s Poetry of Contemplation and Connection
Directory of Open Access Journals (Sweden)
Anita M. Hart
2012-06-01
Full Text Available Sara Pujol Russell’s poetry captures a process of expanding consciousness and personal renewal. Through contemplation and attention to nature, the poet-speaker in her works generates a sense of connection that moves her beyond daily concerns. Pujol’s poetry is both metaphysical and also different in that it resists easy classification and is not representative of mainstream trends. This essay approaches the distinctiveness of Pujol’s work by studying selected poems from her third book of poetry in Spanish, Para decir sí a la carencia, sí a la naranja, al azafrán en el pan (2004 ‘To Say Yes to Lack, Yes to the Orange, to the Saffron in the Bread.’ Incorporating philosopher María Zambrano’s thoughts on contemplation, it shows Pujol’s poet-speaker establishing a connection with nature and spirit, experiencing a heightened consciousness, and searching for expression. The poetic language is characterized by vision, intimacy, enigma, and contradiction. In its subjective, intuitive way, Pujol’s work reveals the poet-speaker’s winding path of discovery and challenges the reader to look closely inside and outside in engaging life’s mysteries.
Bankston White, Cheri; Birmingham, Jackie
2015-01-01
Purpose and Objectives: Case management directors are in a dynamic position to affect the transition of care of patients across the continuum, work with all levels of providers, and support the financial well-being of a hospital. Most importantly, they can drive good patient outcomes. Although the position is critical on many different levels, there is little to help guide a new director in attending to all the “moving parts” of such a complex role. This is Part 2 of a two-part article written for case management directors, particularly new ones. Part 1 covered the first 4 of 7 tracks: (1) Staffing and Human Resources, (2) Compliance and Accreditation, (3) Discharge Planning and (4) Utilization Review and Revenue Cycle. Part 2 addresses (5) Internal Departmental Relationships (Organizational), (6) External Relationships (Community Agency), and (7) Quality and Program Outcomes. This article attempts to answer the following questions: Are case management directors prepared for an expanded role that affects departments and organizations outside of their own?How does a case management director manage the transition of care of patients while managing required relationships outside the department?How does the director manage program outcomes in such a complex department? Primary Practice Setting: The information is most meaningful to those case management directors who work in either stand-alone hospitals or integrated health systems and have frontline case managers (CMs) reporting to them. Findings/Conclusions: Part 1 found that case management directors would benefit from further research and documentation of “best practices” related to their role, particularly in the areas of leadership and management. The same conclusion applies to Part 2, which addresses the director's responsibilities outside her immediate department. Leadership and management skills apply as well to building strong, productive relationships across a broad spectrum of external organizations
Abdullah K. Shehabat
2016-01-01
This paper explains how the two protagonists, Firdaus and Sara, successfully paved their own ways in search of self-liberation despite the authoritarian patriarchy and institutionalized religions that plagued them. El Saadawi's Woman at Point Zero and Yezierska’s Bread Givers represent the fruitful struggle these protagonists experienced as they come to forge an identity and be themselves. The paper argues that the protagonists manage to free themselves, establish their own spiritual homes at...
International Nuclear Information System (INIS)
Islam, Ananna; Cho, Yunju; Yim, Un Hyuk; Shim, Won Joon; Kim, Young Hwan; Kim, Sunghwan
2013-01-01
Highlights: • Weathered oils from the Hebei Spirit oil spill and photo degraded oils are compared. • We investigate changes of polar species at the molecular level by 15T FT-ICR MS. • Significant reduction of sulfur class compounds in saturates fraction is observed. • The relative abundance of protonated compounds (presumably basic nitrogen compounds) increase after degradation. • Changes of polar compounds occurred by natural and photo degradation are similar. -- Abstract: Two sets of oil samples, one obtained from different weathering stages of the M/V Hebei Spirit oil spill site and the other prepared by an in vitro photo-degradation experiment, were analyzed and compared at the molecular level by atmospheric pressure photo-ionization coupled with Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS). For a more detailed comparison at the molecular level, the oil samples were separated into saturate, aromatic, resin, and asphaltene (SARA) fractions before MS analysis. Gravimetric analysis of the SARA fractions revealed a decreased weight percentage of the aromatic fraction and an increased resin fraction in both sets of samples. Molecular-level investigations of the SARA fractions showed a significant reduction in the S 1 class in the saturate fraction and increase of S 1 O 1 class compounds with high DBE values in resin fraction. Levels of N 1 and N 1 O 1 class compounds resulting in protonated ions (presumably basic nitrogen compounds) increased after degradation compared to compounds generating molecular ions (presumably non-basic nitrogen compounds). This study revealed changes occurring in heteroatom polar species of crude oils such as sulfur and nitrogen containing compounds that have not been easily detected with conventional GC based techniques
DEFF Research Database (Denmark)
Christner, Martin; Heinze, Constanze; Busch, Michael
2012-01-01
to biofilm formation in mutant 1585ΔsarA. Increased eDNA amounts indirectly resulted from upregulation of metalloprotease SepA, leading to boosted processing of autolysin AtlE, in turn inducing augmented autolysis and release of eDNA. Hence, this study identifies sarA as a negative regulator of Embp‐ and e...
Director's Discretionary Research and Development Program: Annual Report, Fiscal Year 2006
Energy Technology Data Exchange (ETDEWEB)
2007-03-01
The Director's Discretionary Research and Development Program, Annual Report Fiscal Year 2006 is an annual management report that summarizes research projects funded by the DDRD program. The NREL DDRD program comprises projects that strengthen NREL's four technical competencies: Integrated Systems, Renewable Electricity, Renewable Fuels, and Strategic Analysis.
Magnetic heat pump flow director
Howard, Frank S. (Inventor)
1995-01-01
A fluid flow director is disclosed. The director comprises a handle body and combed-teeth extending from one side of the body. The body can be formed of a clear plastic such as acrylic. The director can be used with heat exchangers such as a magnetic heat pump and can minimize the undesired mixing of fluid flows. The types of heat exchangers can encompass both heat pumps and refrigerators. The director can adjust the fluid flow of liquid or gas along desired flow directions. A method of applying the flow director within a magnetic heat pump application is also disclosed where the comb-teeth portions of the director are inserted into the fluid flow paths of the heat pump.
TRADE instructional materials for SARA/OSHA training. Volume 2, Managers and supervisors training
Energy Technology Data Exchange (ETDEWEB)
1989-03-01
This document provides instructional materials for an eight-hour training course for managers and supervisors of hazardous waste sites. It is one of three volumes of course materials TRADE is preparing to help DOE contractor training staff comply with 29 CFR 1910.120, the Occupational Health and Safety Administration (OSHA) rule that implements Title I of the Superfund Amendments and Reauthorization Act (SARA) of 1986. OSHA`s final rule for hazardous waste operators was published in the Federal Register of March 6, 1989 (54 FR 9294). Combined with the materials in Volumes I and III and with appropriate site-specific information, these materials will help DOE contractors to meet the requirements of 1910.120 (e) that ``on-site management and supervisors directly responsible for, or who supervise employees engaged in, hazardous waste operations`` receive the same initial training as that of the employees they supervise and at least eight additional hours of specialized training in managing hazardous waste operations.
Nguyen, Hung D.; Steele, Gynelle C.; Morris, Jessica R.
2015-01-01
This document is intended to enable the more effective transition of NASA Glenn Research Center (GRC) SBIR technologies funded by the Small Business Innovation Research (SBIR) program as well as its companion, the Small Business Technology Transfer (STTR) program into NASA Aeronautics Research Mission Directorate (ARMD) projects. Primarily, it is intended to help NASA program and project managers find useful technologies that have undergone extensive research and development (RRD), through Phase II of the SBIR program; however, it can also assist non-NASA agencies and commercial companies in this process. aviation safety, unmanned aircraft, ground and flight test technique, low emissions, quiet performance, rotorcraft
2013-01-22
... Bureau of Land Management (BLM) is publishing this notice to explain why the BLM Director is rejecting... Director's Response to the Alaska Governor's Appeal of the BLM Alaska State Director's Governor's... the BLM Alaska State Director. The State Director determined the Governor's Finding was outside the...
2013-11-14
... Bureau of Land Management (BLM) is publishing this notice to explain why the BLM Director is denying the...] BLM Director's Response to the Idaho Governor's Appeal of the BLM Idaho State Director's Governor's... (Finding) to the BLM Idaho State Director (State Director). The State Director determined the Governor's...
Journeys to the Self: Using Movie Directors in the Classroom
Alvarez, Jose Luis; Miller, Paddy; Levy, Jan; Svejenova, Silviya
2004-01-01
This article suggests that temporary (project based) filmmaking organizations, and film directors as their leaders, lend themselves to examining a plethora of leadership issues, from social sources of power to competencies in network organizations. It advances for classroom discussion and teaching the cases of Almodovar and Coppola as examples of…
The JSC Engineering Directorate Product Peer Review Process
Jenks, Kenneth C.
2009-01-01
The JSC Engineering Directorate has developed a Product Peer Review process in support of NASA policies for project management and systems engineering. The process complies with the requirements of NPR 7120.5, NPR 7123.1 and NPR 7150.2 and follows the guidance in NASA/SP-2007-6105. This presentation will give an overview of the process followed by a brief demonstration of an actual peer review, with audience participation.
Maximilien Brice
2010-01-01
CERN-HI-1010244 37: in the SM18 hall: Ms Jasmina Sopova, Communication Officer J. Sopova; Director, Division of Basic & Engineering Sciences M. Nalecz, Assistant Director-General for the Natural Sciences G. Kalonji; Former CERN Director-General H. Schopper, CERN Head of Education R. Landua; UNESCO Director-General I. Bokova; CERN Adviser M. Bona; CERN Director for Research and Scientific Computing S. Bertolucci and UNESCO Office in Geneva Director Luis M. Tiburcio.
Defining and Selecting Independent Directors
Directory of Open Access Journals (Sweden)
Eric Pichet
2017-10-01
Full Text Available Drawing from the Enlightened Shareholder Theory that the author first developed in 2011, this theoretical paper with practical and normative ambitions achieves a better definition of independent director, while improving the understanding of the roles he fulfils on boards of directors. The first part defines constructs like firms, Governance system and Corporate governance, offering a clear distinction between the latter two concepts before explaining the four main missions of a board. The second part defines the ideal independent director by outlining the objective qualities that are necessary and adding those subjective aspects that have turned this into a veritable profession. The third part defines the ideal process for selecting independent directors, based on nominating committees that should themselves be independent. It also includes ways of assessing directors who are currently in function, as well as modalities for renewing their mandates. The paper’s conclusion presents the Paradox of the Independent Director.
Professor V. Weisskopf, CERN Director General (1961-1965)
1962-01-01
Well known theoretical physicist Victor Weisskopf has died aged 93. Born in Austria, he later worked with Schrodinger in Berlin before emigrating to the US in 1937, where he joined the Manhattan project in 1944, and was witness to the Trinity Test in July 1945. In 1946 he became professor of physics at MIT. He took leave of absence to be Director General of CERN, the European Organization for Nuclear Physics, from 1961-1965.
DEFF Research Database (Denmark)
Ringe, Wolf-Georg
2013-01-01
This paper re-evaluates the corporate governance concept of ‘board independence’ against the disappointing experiences during the 2007-08 financial crisis. Independent or outside directors had long been seen as an essential tool to improve the monitoring role of the board. Yet the crisis revealed...... that they did not prevent firms' excessive risk taking; further, these directors sometimes showed serious deficits in understanding the business they were supposed to control, and remained passive in addressing structural problems. A closer look reveals that under the surface of seemingly unanimous consensus...
The acquisition and supervision system of S.A.R.A.'s (Accelerator system Rhone-Alpes) parameters
International Nuclear Information System (INIS)
Iazzourene, F.
1982-01-01
The acquisition and supervision system of SARA's (Systeme Accelerateur Rhone-Alpes) parameters is built up. The basic hardware consists of: - A PDP 11/10 computer with a 64 K bytes memory capacity. The system and load device is a floppy disk of 28 megabytes capacity. - A CAMAC crate including a data logger with 224 input channels, a terminal driver (JTY21) and three modules designed for reading out a few digital data, for instance polarities of power supplies. The software provides three distinct programs: AKITS, which uses 3 commands, detects and signals functioning defects in the CAMAC modules used. AKIDO which uses 11 commands, is the acquisition and organization program of the accelerator's functioning parameters. AKISUR is the supervision program of the functioning parameter's stability, within a fixed gap, during the accelerator running [fr
Instructional materials for SARA/OSHA training. Volume 1, General site working training
Energy Technology Data Exchange (ETDEWEB)
Copenhaver, E.D.; White, D.A.; Wells, S.M. [Oak Ridge National Lab., TN (United States)
1988-04-01
This proposed 24 hour ORNL SARA/OSHA training curriculum emphasizes health and safety concerns in hazardous waste operations as well as methods of worker protection. Consistent with guidelines for hazardous waste site activities developed jointly by National Institute for Occupational Safety and Health, Occupational Safety and Health Administration, US Coast Guard, and the Envirorunental Protection Agency, the program material will address Basic Training for General Site Workers to include: ORNL Site Safety Documentation, Safe Work Practices, Nature of Anticipated Hazards, Handling Emergencies and Self-Rescue, Employee Rights and Responsibilities, Demonstration of Use, Care, and Limitations of Personal Protective, Clothing and Equipment, and Demonstration of Monitoring Equipment and Sampling Techniques. The basic training courses includes major fundamentals of industrial hygiene presented to the workers in a format that encourages them to assume responsibility for their own safety and health protection. Basic course development has focused on the special needs of ORNL facilities. Because ORNL generates chemical wastes, radioactive wastes, and mixed wastes, we have added significant modules on radiation protection in general, as well as modules on radiation toxicology and on radiation protective clothing and equipment.
International Nuclear Information System (INIS)
Blanc, R.; Bouriant, M.; Richaud, J.P.
1997-01-01
The target preparation group supplied a large number of samples to nuclear physicists for experiments using SARA and also other accelerators throughout the world. Particular preparation and projects include: 208 Pb, 116 Cd, 6 LiF, 123 Sb, In and Ta targets, strippers for SARA and GANIL, optical silicone disks for POLDER and GRAAL experiments, active participations for the AMS project and finally filament preparation for the GENEPI project. (authors)
IAEA Director General to Visit Iran
International Nuclear Information System (INIS)
2012-01-01
Full text: The Director General of the IAEA, Yukiya Amano, will travel to Tehran this Sunday, 20 May 2012, to discuss issues of mutual interest with high Iranian officials. In the course of his one-day working visit, on Monday 21 May 2012 the Director General will meet the Secretary of Iran's Supreme National Security Council, His Excellency Saeed Jalili, and other senior representatives of the Iranian government. Herman Nackaerts, Deputy Director General for Safeguards, and Rafael Mariano Grossi, Assistant Director General for Policy, will accompany the Director General. (IAEA)
Feminism and Faith: Exploring Christian Spaces in the Writing of Sara Maitland and Michèle Roberts
Directory of Open Access Journals (Sweden)
Arina LUNGU-CIRSTEA
2011-03-01
Full Text Available En 1983, les féministes britanniques Sara Maitland et Jo Garcia ont publié Walking on the Water (London : Virago, une collection d’essais, de récits, de poèmes et de photos produits par des femmes sur le thème de la spiritualité. Les contributrices ont été en particulier invitées à explorer la relation entre leur identité féministe et leurs croyances religieuses. Le ton de ces contributions varie fortement, allant de l’envie passionnée de concilier les objectifs du féminisme avec le christianisme à un rejet total de l’Eglise comme institution patriarcale suprême. Cet article met en dialogue des récits diamétralement opposés du rapport entre christianisme et féminisme en s’intéressante plus particulièrement à deux des contributrices, Sara Maitland (1950 - et Michèle Roberts (1949 - . Ces deux écrivaines, qui se sont activement impliquées dans les mouvements féministes des années 1970, ont toutes deux lutté pour se réconcilier avec leur héritage chrétien. Néanmoins, alors que Maitland tente essentiellement de revisiter le christianisme en y incorporant les points essentiels d’une idéologie féministe, Roberts sent le besoin impérieux de se défaire de son identité religieuse afin de devenir indépendante ; en effet, dans son autobiographie Paper Houses (2007 elle décrit son éducation catholique comme “autoritaire et misogyne” (16. Cet article explore les façons dont l’identité spirituelle se construit dans le jeu complexe des interactions entre féminisme et foi. Il se propose, dans une perspective comparatiste, d’analyser d’une part le recueil de nouvelles de Sara Maitland intitulé A Book of Spells, et d’autre part, le roman acclamé de Michèle Roberts, Daughters of the House. Dans ces écrits, Maitland et Roberts ont un objectif commun qui est de renégocier la place des femmes dans l’histoire chrétienne dont elles reconnaissent – il est vrai à partir de perspectives diff
16 CFR 1000.26 - Directorate for Epidemiology.
2010-01-01
... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Directorate for Epidemiology. 1000.26... AND FUNCTIONS § 1000.26 Directorate for Epidemiology. The Directorate for Epidemiology, managed by the Associate Executive Director for Epidemiology, is responsible for the collection and analysis of data on...
12 CFR 7.2010 - Directors' responsibilities.
2010-01-01
... refer to OCC published guidance for additional information regarding responsibilities of directors. ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Directors' responsibilities. 7.2010 Section 7... OPERATIONS Corporate Practices § 7.2010 Directors' responsibilities. The business and affairs of the bank...
Memoria de la guerra civil española. Entre el sol y la tormenta de Sara Berenguer
Directory of Open Access Journals (Sweden)
Helena López
2013-07-01
Full Text Available En este artículo pretendo analizar dos cuestiones en relación con las memorias de guerra de la militante anarquista Sara Berenguer. En primer lugar, quiero atender a las estrategias discursivas (clase, género, sexualidad de construcción de la subjetividad en este texto. Además, me interesa indagar cómo estos discursos se interseccionan con la posición espacio-temporal (tiempo de la memoria y tiempo-espacio del exilio del sujeto autobiográfico. Mi objetivo principal es proponer una problematización de los conceptos de “memoria colectiva” y de “experiencia femenina” y reivindicar, por lo tanto, la relevancia tanto teórica como política de análisis críticos basados en narrativas personales.
78 FR 8389 - Natural Gas Pipelines; Project Cost and Annual Limits
2013-02-06
... Director of the Office of Energy Projects. The cost limits for calendar year 2013, as published in Table I.... ACTION: Final rule. SUMMARY: Pursuant to the authority delegated by 18 CFR 375.308(x)(1), the Director of the Office of Energy Projects (OEP) computes and publishes the project cost and annual limits for...
Institutional directors and board compensation: Spanish evidence
Directory of Open Access Journals (Sweden)
Felix López-Iturriaga
2015-07-01
Full Text Available We address the influence of directors who represent institutional investors in three aspects of board compensation policies: level of compensation, composition, and performance sensitivity. We differentiate pressure-sensitive directors (i.e., with business links and pressure-resistant directors (i.e., without business links. Our results show that pressure-resistant directors decrease total board compensation and its fixed proportion, whereas they increase the variable proportion of total remuneration and the pay-for-performance sensitivity. By contrast, pressure-sensitive directors offer the opposite results. These findings are consistent with the view that institutional investors are not a homogeneous group and that pressure-resistant directors fulfill a more thorough monitoring role.
A dinâmica dos mercados associados ao suínos de raça Bísara na Terra Fria Transmonta
Carvalho, Marieta
2014-01-01
A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050, com especial relevância para a de origem do porco (FAO, 2014). Este trabalho visa estudar: · A dinâmica dos mercados associados aos suínos da raça Bísara: animais, carne e fumeiro de Vinhais. · Os circuitos de comercialização, os preços ao criador de suínos de animais vivos, da carne e fumeiro de Vinhais. A metodologia utilizada baseou-se na análise descritiva, referente aos de 2013 e 2014, dos ...
Análise SWOT global da exploração dos suínos da raça Bísara
Carvalho, Marieta
2015-01-01
A procura mundial de produtos de origem animal aumentará cerca de 70% em 2050. Estima-se que mil milhões de pobres dependam dos animais para a sua alimentação e criação de riqueza (FAO, 2014). A raça Bísara, são suínos autóctones portugueses do tronco Celta em risco de extinção. Apesar do seu reduzido efetivo representa para as populações locais um elevado peso económico e social. Este trabalho tem como objetivo, fazer uma caracterização atual da suinicultura, com base nos suínos da ra...
30 CFR 736.14 - Director's decision.
2010-07-01
... Director shall publish the decision in the Federal Register, including a statement of the basis and purpose... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Director's decision. 736.14 Section 736.14... Director's decision. (a) After considering all relevant information received under § 736.12 of this part...
Institutional Planning: What Role for Directors of Student Admissions and Financial Aid?
Haines, John R.
1976-01-01
According to the director of Higher Education Management Services for the New York State Education Department, the offices of admissions and student financial aid have long been excluded from the institutional planning process. In an era of projected enrollment declines and increased competition, these offices need to assume a critical new role.…
Termination of exploitation of V 1 NPP - BIDSF projects
International Nuclear Information System (INIS)
Pnackova, L.
2004-01-01
In this paper the interview with engineer Peter Hlbocky, director of division of the Project of decommissioning of V 1 Nuclear Power Plant in Jaslovske Bohunice is presented. Project Manager Unit (PMU) was formed on the basis of directive of the General Director of the Slovenske elektrarne, a.s. The Director of the Division of decommissioning of the V 1 NPP and at the same time the Main manager of the PMU is engineer Peter Hlbocky. On this project participate 19 employees of the Slovenske elektrarne, a. s. (SE), 6 abroad employees of the consortium IBERINCO, 15 employees of the VUEZ and 25 abroad employees on the detached place of work in the Spain and France
30 CFR 282.11 - Director's authority.
2010-07-01
... CONTINENTAL SHELF FOR MINERALS OTHER THAN OIL, GAS, AND SULPHUR Jurisdiction and Responsibilities of Director § 282.11 Director's authority. (a) In the exercise of jurisdiction under § 282.10, the Director is... of two or more OCS mineral leases or portions of two or more OCS mineral leases into a single mining...
JSC Director's Discretionary Fund 1992 Annual Report
Jenkins, Lyle (Compiler)
1993-01-01
Annual report of the Johnson Space Center Director's Discretionary Fund documenting effective use of resources. The $1,694,000 funding for FY92 was distributed among 27 projects. The projects are an overall aid to the NASA mission, as well as providing development opportunities for the science and engineering staff with eventual spinoff to commercial uses. Projects described include space-based medical research such as the use of stable isotopes of deuterium and oxygen to measure crew energy use and techniques for noninvasive motion sickness medication. Recycling essentials for space crew support is conducted in the Regenerative Life Support and the Hybrid Regenerative Water Recovery test beds. Two-phase fluid flow simulated under low-gravity conditions, hypervelocity particle impact on open mesh bumpers, and microcalorimetry to measure the long-term hydrazine/material compatibility were investigated. A patent application was made on a shape-memory-alloy release nut. Computer estimate of crew accommodations for advanced concepts was demonstrated. Training techniques were evaluated using multimedia and virtual environment. Upgrades of an electronic still camera provide high resolution images from orbit are presented.
CEA nuclear energy Directorate - Activity report 2012
International Nuclear Information System (INIS)
2013-01-01
After an overview of the activities of the Directorate at the international level, of its scientific activities, and of the consideration given to quality, and a presentation of the transverse program on advanced materials, this report proposes presentations of activities in different domains: future nuclear industrial systems (reactors of 4. generation, back-end of the future cycle, sustainable management of nuclear materials, fundamental scientific and technological research), optimization of the present industrial nuclear activity (reactors of 2. and 3. generation, front-end and back-end of the fuel cycle), the main tools for nuclear development (numerical simulation, the Jules Horowitz reactor), valorisation, economic support of Haute-Marne and Meuse territories (the Syndiese project), nuclear dismantling and decontamination (dismantling projects, projects and works in Fontenay-aux-Roses, Grenoble and Saclay, waste and material flow management, nuclear service facilities, transports). It also presents the activities of some specific CEA centres like Marcoule (R and D in fuel cycle), Cadarache (future energies) and Saclay (nuclear sciences and simulation of reactors and fuel cycle)
The Director-General’s speech to the personnel
2008-01-01
At the LHCFest the Director-General of CERN gave a speech to thank all the CERN personnel, users and contractors’ staff for their outstanding contributions to the LHC project. Good evening. A few hours ago, I was here on this stage to welcome 1500 VIPs to the official inauguration of the LHC. I am delighted to be back in the same hall now to welcome you, the VIPs of the LHC. Such an exceptional accelerator and such ground-breaking experiments and computing infrastructure could never have been built without the relentless efforts of people of courage and determination. From this point of view, you are the VIPs of the LHC project. It was important that CERN should involve you in the inauguration of the LHC by organising this celebration tonight. We have been obliged to restrict the number of participants to 3000 as the safety rules prevented us from inviting more. Nevertheless, many more thousands of people have been involved in the project, either directly or indirectly. ...
Photovoltaic demonstration projects 2
Energy Technology Data Exchange (ETDEWEB)
Gillett, W B; Hacker, R J [Halcrow (William) and Partners, Swindon (UK); Kaut, W [eds.
1989-01-01
This book, the proceedings of the third Photovoltaic Contractors' Meeting organised by the Commission of the European Communities, Directorate-General for Energy provides an overview of the photovoltaic demonstration projects which have been supported by the Energy Directorate of the Commission of the European Communities since 1983. It includes reports by each of the contractors who submitted proposals in 1983, 1984 and 1985, describing progress with their projects. The different technologies which are being demonstrated concern the modules, the cabling of the array, structure design, storage strategy and power conditioning. The various applications include powering of houses, villages, recreation centres, water desalination, communications, dairy farms, water pumping and warning systems. (author).
IT governance guidelines for directors
Calder, Alan
2005-01-01
This important new book – 'IT Governance: Guidelines for Directors' provides directors, executives, managers and professional advisers with clear, pragmatic guidelines for ensuring that IT and the business work together for the same strategic objectives.
La difesa della donna ebrea: Sara Copio Sullam e Debora Ascarelli
Directory of Open Access Journals (Sweden)
Umberto Fortis
2014-04-01
Full Text Available Sara Copio Sullam and Debora Ascarelli, the best-known Jewish women poets of the age of the Italian ghetto, have often been studied with a focus on the distinctive features of their writing: the former as a translator of sacred texts, the latter as the author of original verses, sometimes written as a risposta per le rime (reply through rhymes or in defence of her orthodoxy. They share, however, a common theme, which has often been neglected: the defence of the Jewish woman, which is overt in some of Copio’s sonnets and prose, whereas it has not yet been properly pointed out in some of Ascarelli’s verses. This paper aims at bringing this theme to the fore not only in Copio, through a rereading of some passages of her Manifesto, but also in Debora Ascarelli, through an analysis of her few original verses. These hendecasyllables certainly reflect the Petrarchan and classicistic atmosphere of the late 16th century in Rome, but they are far from the mainstream modes of women’s poetry of the age. They allow us, therefore, to highlight, besides the differences, the similarities between the two poetesses; their commitment, in the late 16th and early 17th century, to the intellectual and moral defence of the Jewish woman, in a context of general depreciation of women, but also in the background of the claim to the “nobility and excellence of women”.
The Director's Work on Himself
DEFF Research Database (Denmark)
Kuhlmann, Annelis
2008-01-01
A reading of Stanislavsky's major works about the actor's work on himself from the viewpoint of the director's work on himself.......A reading of Stanislavsky's major works about the actor's work on himself from the viewpoint of the director's work on himself....
Ground Breaking for the CERN Neutrinos to Gran Sasso Project
2000-01-01
At 11:45 on 12 October, the Director General dug the first earth for the CERN Neutrinos to Gran Sasso Project. Left to right: Professor A. Bettini, Director of the Gran Sasso laboratory, Mme M.-G. Philippe, sous-prefet of Gex, and L. Maiani, Director General of CERN.
16 CFR 1000.29 - Directorate for Engineering Sciences.
2010-01-01
... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Directorate for Engineering Sciences. 1000... ORGANIZATION AND FUNCTIONS § 1000.29 Directorate for Engineering Sciences. The Directorate for Engineering Sciences, which is managed by the Associate Executive Director for Engineering Sciences, is responsible for...
Wang, Pao-Lien
1992-01-01
This report describes the fabrication, design of flow director, fluid flow direction analysis and testing of flow director of a magnetic heat pump. The objectives of the project are: (1) to fabricate a demonstration magnetic heat pump prototype with flow directors installed; and (2) analysis and testing of flow director and to make sure working fluid loops flow through correct directions with minor mixing. The prototype was fabricated and tested at the Development Testing Laboratory of Kennedy Space Center. The magnetic heat pump uses rear earth metal plates rotate in and out of a magnetic field in a clear plastic housing with water flowing through the rotor plates to provide temperature lift. Obtaining the proper water flow direction has been a problem. Flow directors were installed as flow barriers between separating point of two parallel loops. Function of flow directors were proven to be excellent both analytically and experimentally.
16 CFR 1000.27 - Directorate for Health Sciences.
2010-01-01
... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Directorate for Health Sciences. 1000.27... AND FUNCTIONS § 1000.27 Directorate for Health Sciences. The Directorate for Health Sciences is managed by the Associate Executive Director for Health Sciences and is responsible for reviewing and...
Bennett, Sophia Elizabeth
2017-01-01
from left to right in 53__MA27642: Scuola di Alta Formazione al Management Project manager R. Movva; Agnelli Foundation Director A. Gavosto; Agnelli Foundation Head of Innovation A. Griva; Scuola di Alta Formazione al Management Director S. Pettochi; Agnelli Foundation Vice Chairman, and Fiat Chrysler Automobiles Chairman J. Elkann; CERN Director-General F. Gianotti; Director for International Relations C. Warakaulle; Management Liaison for the Italian Republic, Engineering Department Head R. Losito; Knowledge Transfer Group Leader G. Anelli. Signature of the Framework agreement between the Scuola di Alta Formazione al Management, represented by Director S. Petocchi and CERN, represented by Director-General F. Gianotti, witnessed by Agnelli Foundation Vice Chairman J. Elkann.
Three directors for one strategy
2009-01-01
Following the interview with the Director General, Rolf-Dieter Heuer, the Bulletin continues its series of interviews with the members of CERN’s new Management team. This week, the Bulletin interviewed the three Directors, who presented their strategies for their respective sectors as a new era begins for CERN.
Numerical studies of the heat-up-phase of Super-Sara 'severe fuel damage'. Boildown tests
International Nuclear Information System (INIS)
Eifler, W.; Shepherd, I.M.
1983-01-01
Calculations to investigate the heat-up phase of the Super-Sara 'severe fuel damage' test matrix have been performed using a simple computer code which models a typical pin. In particular the effect of the exothermic zirconium water reaction on the transient is considered. It is shown that it is possible to achieve the desired objectives of all the tests by a test procedure involving a constant power level a simple flow history. This flow history consists of an initial inlet flow, that has the water saturated at outlet. It is then linearly decreased in a time of the order of 200 seconds to a steady lower value. The clad temperature ramp rate is defined by the power and the peak clad temperature by the ratio of the power of the final steady inlet flow rate. If the final inlet flow rate for a particular power is below a certain critical value then the clad will reach melting temperature. The sensitivity of the results are discussed and a sample calculation is made for each test in the matrix
International Nuclear Information System (INIS)
Dorado Delgado, Jennifer; Burbano Criollo, Juan Carlos; Molina Tabares, Jose Manuel; Carvajal Escobar, Yesid; Aristizabal, Hector Fabio
2006-01-01
In this study, space and time variability of monthly and annual rainfall was analyzed for the downstream influence zone of a Colombian supply-regulation reservoir, Sara-Brut, located on the Cauca valley department. Monthly precipitation data from 18 gauge stations and for a 29-year record (1975-2003) were used. These data were processed by means of time series completion, consistency analyses and sample statistics computations. Theoretical probabilistic distribution models such as Gumbel, normal, lognormal and wake by, and other empirical distributions such as Weibull and Landwehr were applied in order to fit the historical precipitation data set. The fit standard error (FSE) was used to test the goodness of fit of the theoretical distribution models and to choose the best of this probabilistic function. The wake by approach showed the best goodness of fit in 89% of the total gauges taken into account. Time variability was analyzed by means of wake by estimated values of monthly and annual precipitation associated with return periods of 1,052, 1,25, 2, 10, 20 and 50 years. Precipitation space variability is presents by means of ArcGis v8.3 and using krigging as interpolation method. In general terms the results obtained from this study show significant distribution variability in precipitation over the whole area, and particularity, the formation of dry and humid nucleus over the northeastern strip and microclimates at the southwestern and central zone of the study area were observed, depending on the season of year. The mentioned distribution pattern is likely caused by the influence of pacific wind streams, which come from the Andean western mountain range. It is expected that the results from this work be helpful for future planning and hydrologic project design
How to Grow Project Scientists: A Systematic Approach to Developing Project Scientists
Kea, Howard
2011-01-01
The Project Manager is one of the key individuals that can determine the success or failure of a project. NASA is fully committed to the training and development of Project Managers across the agency to ensure that highly capable individuals are equipped with the competencies and experience to successfully lead a project. An equally critical position is that of the Project Scientist. The Project Scientist provides the scientific leadership necessary for the scientific success of a project by insuring that the mission meets or exceeds the scientific requirements. Traditionally, NASA Goddard project scientists were appointed and approved by the Center Science Director based on their knowledge, experience, and other qualifications. However the process to obtain the necessary knowledge, skills and abilities was not documented or done in a systematic way. NASA Goddard's current Science Director, Nicholas White saw the need to create a pipeline for developing new projects scientists, and appointed a team to develop a process for training potential project scientists. The team members were Dr. Harley Thronson, Chair, Dr. Howard Kea, Mr. Mark Goldman, DACUM facilitator and the late Dr. Michael VanSteenberg. The DACUM process, an occupational analysis and evaluation system, was used to produce a picture of the project scientist's duties, tasks, knowledge, and skills. The output resulted in a 3-Day introductory course detailing all the required knowledge, skills and abilities a scientist must develop over time to be qualified for selections as a Project Scientist.
Integration of Leadership Styles of School Director
Pavlovic, Nebojsa; Oljaca, Milka; Kostovic, Svetlana
2012-01-01
Management style can be defined as a special behavior of directors in the work process that affects the performance in an organization, in this case-school. Management style has two related meanings: first is behavior of directors to employees, second is directors' approach in school regarding management, participation of employees in decision…
Strengthening the management of ESA - the Inter-Directorate Reform of Corporate and Risk Management
Feustel-Büechl, Jörg; Arend, Harald; Derio, Eric; Infante, Giovanni; Kreiner, Gerhard; Phaler, Jesse; Tabbert, Michael
2007-02-01
ESA has undertaken the Inter-Directorate Reform of Corporate and Risk Management to strengthen the Agency's internal operations. The reform was completed at the end of 2006, encompassing five dedicated projects on Risk Management, Agency-Wide Controlling System, Project Plan and Integrated Project Review, General Budget Structure and Charging Policy, and Corporate Information Systems. It has contributed to improved management of the Agency's internal operations by engaging all internal stakeholders in a common objective, introducing improvements to planning and management methods, elaborating consolidated information structures and tools, contributing to enhanced transparency and accountability, and by providing qualified new policies, processes and tools.
International Nuclear Information System (INIS)
Ollivier, T.
1986-01-01
In order to study new exotic nuclei far from stability we built a fast separation system by coupling a helium jet with the medium-current source of the mass separator. First the tests were made in Lyon and then the system used on line with the heavy ion accelerator SARA, in Grenoble. We obtained efficiency greater than 1% for each element and a better chemical independence. This allowed us to perform experiments on rare-earth region near N=82, with fusion-evaporation reactions after an investigation of various ranges of beam energies. The first results allow to identify two new isotopes, 143 Tb (12s) and 138 Eu (12s). The decay schemes obtained are analysed in the frame of existing models [fr
Council appoints CERN’s next Director General
Maximilien Brice
2007-01-01
On 14 December 2007, CERN Council appointed Professor Rolf-Dieter Heuer to succeed Dr Robert Aymar as CERN Director General. Professor Heuer will serve a five-year term, taking office on 1 January 2009. From Left to right: Dr Robert Aymar, current CERN Director General, Professor Torsten Åkesson, President of CERN Council, and Professor Rolf-Dieter Heuer, CERN's next Director General.
Object Oriented Programming in Director
Directory of Open Access Journals (Sweden)
Marian DARDALA
2006-01-01
Full Text Available Director is one of the most popular authoring software. As software for developing multimedia applications, Director is an object oriented programming environment. A very important issue to develop multimedia applications is the designing of their own classes. This paper presents the particular aspects concerning the available facilities offered by Lingo to design classes and to generate objects.
CERN loses two former Directors-General
2002-01-01
Victor Weisskopf, a giant of modern physics and Director General of CERN from 1961-65, died on 21 April. The previous month, Willibald Jentschke, Director General from 1971-75 and founder of the DESY Laboratory in Hamburg, passed away.
Ristić, Vladica; Maksin, Marija; Nenković-Riznić, Marina; Basarić, Jelena
2018-01-15
The process of making decisions on sustainable development and construction begins in spatial and urban planning when defining the suitability of using land for sustainable construction in a protected area (PA) and its immediate and regional surroundings. The aim of this research is to propose and assess a model for evaluating land-use suitability for sustainable construction in a PA and its surroundings. The methodological approach of Multi-Criteria Decision Analysis was used in the formation of this model and adapted for the research; it was combined with the adapted Analytical hierarchy process and the Delphi process, and supported by a geographical information system (GIS) within the framework of ESRI ArcGIS software - Spatial analyst. The model is applied to the case study of Sara mountain National Park in Kosovo. The result of the model is a "map of integrated assessment of land-use suitability for sustainable construction in a PA for the natural factor". Copyright © 2017 Elsevier Ltd. All rights reserved.
INTERFIRM COOPERATION AND INFORMATION SHARING THROUGH INTERLOCKING DIRECTORATES
Directory of Open Access Journals (Sweden)
Mohammed Belal UDDIN
2012-01-01
Full Text Available When firms engage in cooperative efforts, interfirm relations get particular interest to be studied. A direct interlock occurs when an executive or director of one firm sits on the board of another firm, and an indirect interlock occurs when two firms have directors or executives who sit on the board of a third firm. The three commonly used theoretical models such as social network theory, learning theory, and theory of strategic choice are more relevant for the formation and management of interlocking directorates. Uncertainty, resource scarcity, mutual trust, dependency, etc. influence the formation of interlocking directorates. Consequently, interlocking directorates allow sharing of information and overall cooperation between partners through learning, collaboration, networking, and effective relationship, etc. Proper management of interlocking directorates requires communication and collaboration among partners that enhance exchange of knowledge and cooperation.
30 CFR 282.10 - Jurisdiction and responsibilities of Director.
2010-07-01
... part and are under the jurisdiction of the Director: Exploration, testing, and mining operations... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Jurisdiction and responsibilities of Director... Jurisdiction and Responsibilities of Director § 282.10 Jurisdiction and responsibilities of Director. Subject...
Boards: Independent and Committed Directors?
Christophe Volonté
2011-01-01
Regulators, proxy advisors and shareholders are regularly calling for independent directors. However, at the same time, independent directors commonly engage in numerous outside activities potentially reducing their time and commitment with the particular firm. Using Tobin's Q as an approximation of market valuation and controlling for endogeneity, our empirical analysis reveals that neither is independence positively related to firm performance nor are outside activities negatively related t...
Nguyen, Hung D.; Steele, Gynelle C.
2016-01-01
This report is intended to help NASA program and project managers incorporate Glenn Research Center Small Business Innovation Research/Small Business Technology Transfer (SBIR)/(STTR) technologies into NASA Human Exploration and Operations Mission Directorate (HEOMD) programs and projects. Other Government and commercial project managers can also find this useful. Introduction Incorporating Small Business Innovation Research (SBIR)-developed technology into NASA projects is important, especially given the Agency's limited resources for technology development. The SBIR program's original intention was for technologies that had completed Phase II to be ready for integration into NASA programs, however, in many cases there is a gap between Technology Readiness Levels (TRLs) 5 and 6 that needs to be closed. After SBIR Phase II projects are completed, the technology is evaluated against various parameters and a TRL rating is assigned. Most programs tend to adopt more mature technologies-at least TRL 6 to reduce the risk to the mission rather than adopt TRLs between 3 and 5 because those technologies are perceived as too risky. The gap between TRLs 5 and 6 is often called the "Valley of Death" (Figure 1), and historically it has been difficult to close because of a lack of funding support from programs. Several papers have already suggested remedies on how to close the gap (Refs. 1 to 4).
Gender Quotas on Board of Directors
DEFF Research Database (Denmark)
Smith, Nina
2013-01-01
Beside arguments of fairness and equal opportunities, it is often argued that gender diversity on boards of directors may improve firm performance, but the empirical results are mixed and often negative. Based on the available research, gender quotas on boards of directors cannot be justified...
What every library director should know
Curzon, Susan Carol
2014-01-01
What Every Library Director Should Know is the insider's view of vital actions, behaviors and strategies to succeed in every type of library. The content is based both on the author's direct experience after a long career in several types of libraries but also on the direct observation of other managers. Inset into the book are pearls of wisdom from other directors, managers and observers who are answering the question, "what is the one piece of management wisdom that you would give to anyone who wishes to become a library director?" This book will help to get you there by explaining and illus
Message from the Director General Final costs to completion of LHC
Luciano Maiani
2001-01-01
In March this year a review of the costs for the LHC machine was started, which was completed by the end of August. This was a bottom-up review with each group concerned making a projection of the cost to completion of the project. Figures presented were worryingly high. In conjunction, the responses from industries to the calls for tender for essential machine components, especially the superconducting magnet assembly, were also higher than originally anticipated. A summary of this situation was presented to the Finance Committee last week and then to the Committee of Council. After the meetings a summary was prepared by the chairman of Committee of Council which I reprint below. CHAIRMAN'S SUMMARY In the 248th Meeting of the Committee of Council, the Director-General presented a preliminary estimate of the cost to completion of the LHC Project, approved in 1994 and scheduled for commissioning and operation in 2006. Repeating that the project is well advanced and technically sound, the figures presented, s...
VMware vCloud director cookbook
Langenhan, Daniel
2013-01-01
VMware vCloud Director Cookbook will adopt a Cookbook-based approach. Packed with illustrations and programming examples, this book explains the simple as well as the complex recipes in an easy-to-understand language.""VMware vCloud Director Cookbook"" is aimed at system administrators and technical architects moving from a virtualized environment to cloud environments. Familiarity with cloud computing platforms and some knowledge of virtualization and managing cloud environments is expected.
Energy and Environment Directorate Status Report March 2006
International Nuclear Information System (INIS)
Long, J S
2006-01-01
The Energy and Environment Directorate (E and ED) is one of 13 directorates at Lawrence Livermore National Laboratory (LLNL), which is operated by the University of California (UC) for the U.S. Department of Energy's National Nuclear Security Administration (NNSA). We operate in the context of a national security laboratory and focus on meeting major national needs, especially from a long-term perspective. In the LLNL context, E and ED is a hybrid ''program'' and ''discipline'' directorate, combining the program development responsibilities in the national energy and environment arenas to the benefit of the entire Laboratory and also serving as the Laboratory's science base of atmospheric, earth, environmental, and energy science. This Status Report is part of the annual evaluation process required by the Department of Energy (DOE) as part of its contract with UC. The annual review typically will focus on about one third of the activities and programs of a directorate, so that the entire organization is evaluated over a three-year window. This year's review is focused on the basic science foundations for the directorate and two major program areas in the directorate, with an update from a third program. The programs for review are: (1) Earth System Science and Engineering; (2) Nuclear Systems Science and Engineering; and (3) NARAC/IMAAC update. Major questions to be addressed during this review include: (1) Are the programmatic directions appropriate? How can they be improved? (2) What actions can E and ED take to ensure success? How well poised for success are the current staff and facilities? What additions are needed? (3) What recommendations can be made to the Director and the University? This Status Report provides background information on the entire directorate including the parts of the directorate that are the focus of this year's review by the Energy and Environment Directorate Review Committee, to be held March 6-9, 2006. The following sections describe
12 CFR 918.2 - Annual directors' compensation policy.
2010-01-01
... § 918.3. At a minimum, such policy shall address the activities or functions for which attendance is... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Annual directors' compensation policy. 918.2... HOME LOAN BANKS BANK DIRECTOR COMPENSATION AND EXPENSES § 918.2 Annual directors' compensation policy...
Health Risks Faced by Public School Band Directors
Woolery, Danielle N.; Woolery, Jesse A.
2013-01-01
Public school band directors face many work-related hazards in their grueling, yet rewarding job. As a school year progresses, directors are expected to work long hours, while trying to balance professional and personal responsibilities. A band director whose career spans multiple decades can potentially face a number of serious medical problems.…
Identifying influential directors in the United States corporate governance network
Huang, Xuqing; Vodenska, Irena; Wang, Fengzhong; Havlin, Shlomo; Stanley, H. Eugene
2011-10-01
The influence of directors has been one of the most engaging topics recently, but surprisingly little research has been done to quantitatively evaluate the influence and power of directors. We analyze the structure of the US corporate governance network for the 11-year period 1996-2006 based on director data from the Investor Responsibility Research Center director database, and we develop a centrality measure named the influence factor to estimate the influence of directors quantitatively. The US corporate governance network is a network of directors with nodes representing directors and links between two directors representing their service on common company boards. We assume that information flows in the network through information-sharing processes among linked directors. The influence factor assigned to a director is based on the level of information that a director obtains from the entire network. We find that, contrary to commonly accepted belief that directors of large companies, measured by market capitalization, are the most powerful, in some instances, the directors who are influential do not necessarily serve on boards of large companies. By applying our influence factor method to identify the influential people contained in the lists created by popular magazines such as Fortune, Networking World, and Treasury and Risk Management, we find that the influence factor method is consistently either the best or one of the two best methods in identifying powerful people compared to other general centrality measures that are used to denote the significance of a node in complex network theory.
Identifying influential directors in the United States corporate governance network.
Huang, Xuqing; Vodenska, Irena; Wang, Fengzhong; Havlin, Shlomo; Stanley, H Eugene
2011-10-01
The influence of directors has been one of the most engaging topics recently, but surprisingly little research has been done to quantitatively evaluate the influence and power of directors. We analyze the structure of the US corporate governance network for the 11-year period 1996-2006 based on director data from the Investor Responsibility Research Center director database, and we develop a centrality measure named the influence factor to estimate the influence of directors quantitatively. The US corporate governance network is a network of directors with nodes representing directors and links between two directors representing their service on common company boards. We assume that information flows in the network through information-sharing processes among linked directors. The influence factor assigned to a director is based on the level of information that a director obtains from the entire network. We find that, contrary to commonly accepted belief that directors of large companies, measured by market capitalization, are the most powerful, in some instances, the directors who are influential do not necessarily serve on boards of large companies. By applying our influence factor method to identify the influential people contained in the lists created by popular magazines such as Fortune, Networking World, and Treasury and Risk Management, we find that the influence factor method is consistently either the best or one of the two best methods in identifying powerful people compared to other general centrality measures that are used to denote the significance of a node in complex network theory.
An Annotated List of New Social Studies Projects.
Knight, Merle M., Comp.
The curriculum materials developed by 34 projects are described in this directory. The discussions are organized by discipline: Anthropology, Economics, Geography, History, Political Science, Social Psychology, Sociology, and General and Interdisciplinary. Each individual project note includes: project name, director, address, and a summary of the…
SOME CONSIDERATIONS REGARDING THE REVOCATION OF THE COMPANY DIRECTOR
Directory of Open Access Journals (Sweden)
Cristina Cojocaru
2013-11-01
Full Text Available In principle, in Romania, according to current regulations, the director of a company can not address the court against the decision of the general meeting of shareholders through which he/she was revoked from his/her position, regardless of the reasons for the revocation. However, if the director is also the shareholder of that company, he/she may appeal the decision of the general meeting of shareholders, for other reasons than the revocation itself. This is the case even if, by that decision of the general meeting of shareholders it has been decided, inter alia, the revocation of the director. Also, the laws of Romania stipulate that the revoked director has the possibility to claim in court damages if he/she fulfilled correctly the duties as director of the company. At the same time, the article looks at the concept of director, his/her relations with the company and the revocation of the director as general concept.
The long-term benefits of director stock ownership
Directory of Open Access Journals (Sweden)
Brian Bolton
2009-11-01
Full Text Available In October 2009, the United States Treasury Department and Congress considered new regulations requiring executives and directors to receive much of their compensation in the form of long-term stock. One concern with this is that it may have negative consequences by entrenching managers and directors over the long term. This study compares the potential benefits of long-term director ownership with the potential costs of entrenchment. Using the dollar amount of stock owned by independent directors, the results suggest that the incentive effect dominates any costs related to entrenchment: firms with greater stock ownership outperform other firms, regardless of the degree of managerial entrenchment that may be present. The implication for policy-makers is that providing directors with incentives through stock ownership can be a very effective corporate governance mechanism.
7 CFR 2.95 - Director, Office of Ethics.
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Director, Office of Ethics. 2.95 Section 2.95... Administration § 2.95 Director, Office of Ethics. The Director, Office of Ethics, shall be the USDA Alternate Agency Ethics Official, pursuant to 5 CFR 2638.202, and shall exercise the authority reserved to the...
30 CFR 732.11 - Review by the Director.
2010-07-01
... proposed State program, the Director shall publish in the Federal Register and in a newspaper of general... determined by the Director and published in the Federal Register notice required by paragraph (a). (2) When... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Review by the Director. 732.11 Section 732.11...
Predictors of Choral Directors' Voice Handicap
Schwartz, Sandra
2013-01-01
Vocal demands of teaching are considerable and these challenges are greater for choral directors who depend on the voice as a musical and instructive instrument. The purpose of this study was to (1) examine choral directors' vocal condition using a modified Voice Handicap Index (VHI), and (2) determine the extent to which the major variables…
Tim de Zeeuw to Become the Next Director General of ESO
2007-01-01
The ESO Council has just appointed Tim de Zeeuw, 50, as the next Director General of ESO, effective as of 1 September 2007, when the current Director General, Catherine Cesarsky will complete her mandate. ESO PR Photo 02/07 ESO PR Photo 03/07 Professor Tim de Zeeuw "ESO is Europe's flagship organisation for ground-based astronomy," said, Richard Wade, President of the ESO Council. "The ESO Council is very pleased that Professor de Zeeuw has accepted the task as its next Director General. He has played a key role over the last few years in developing a strategic vision for ESO, and I have every confidence that he will now lead the organisation in the realisation of that exciting vision." Tim de Zeeuw has an excellent record, both as a highly respected scientist and as a leader of an internationally recognised science institute in the Netherlands. He is Scientific Director of the Leiden Observatory, a research institute in the College of Mathematics and Natural Sciences of Leiden University. Tim de Zeeuw also has considerable experience as regards science policy issues. Catherine Cesarsky, ESO's current Director General commented: "Over the recent years, ESO has developed considerably with more activities and new member states, and with its ambitious project portfolio, ESO is clearly facing an exciting future. I shall be delighted to pass the baton to Tim de Zeeuw, who as a recent Council member is very familiar with our Organisation." "It is a great honour and an exciting challenge to lead this world-class organisation in the years to come in support of one of the most dynamic areas of science today," said de Zeeuw. "I look forward to overseeing the continued upgrading of the Very Large Telescope with the second-generation instrumentation and the completion of the ALMA project, and in particular to help developing the future European Extremely Large Telescope." Tim de Zeeuw's main research interests embrace the formation, structure and dynamics of galaxies
Miner Gearin, Kimberly J; Thrash, Allison M Rick; Frauendienst, Renee; Myhre, Julie; Gyllstrom, M Elizabeth; Riley, William J; Schroeder, Janelle
2012-11-01
Studies have reported a relationship between the organization of public health services and variability in public health practice at the local and state levels. A national research agenda has prioritized practice-based research to understand pathways that lead to this variation and examine the impact of these differences on outcomes. To measure the extent to which Minnesota local health directors report having key authorities and examine the relationship between organizational structure and authority of local health directors. : Multimodal. Minnesota local health departments. Directors of Minnesota local health departments. Director authorities. Most Minnesota local health directors reported having 6 key authorities related to budget preparation and modification and interaction with local elected officials (n = 51, 71%). Twelve directors (16%) reported that they have 4 or fewer of the 6 authorities. The authority most commonly reported as lacking was the authority to initiate communication with locally elected officials (n = 15, 21%). The percentage of directors who reported having all 6 authorities was higher among those in stand-alone departments (82%) than those in combined organizations (50%). This descriptive study illustrates that emerging practice-based research networks can successfully collaborate on small-scale research projects with immediate application for systems development. Study findings are being used by local public health officials to help articulate their role, aid in succession planning, and inform elected officials, who need to consider the public health implications of potential changes to local public health governance and organization. More studies are needed to refine measurement of authority and structure.
J. B. Adams Acting Director-General
1960-01-01
After the tragic death of Prof. C. J. Bakker, the Council of CERN held an emergency meeting on May 3, 1960. Following this session, Mr. F. de Rose, President of the Council of the European Organization for Nuclear Research, announced the appointment of Mr. J. B. Adams, Director of the PS division to the post of acting Director-General.
Nguyen, Hung D.; Steele, Gynelle C.
2015-01-01
This report is intended to help NASA program and project managers incorporate Small Business Innovation Research/Small Business Technology Transfer (SBIR/STTR) technologies that have gone through Phase II of the SBIR program into NASA Science Mission Directorate (SMD) programs. Other Government and commercial project managers can also find this information useful.
School directors and management in education
Directory of Open Access Journals (Sweden)
Srdić Vesna M.
2015-01-01
Full Text Available The main features of school management and organization comprise planning, decision making, management, leadership and communication. Research suggests that successful school management requires not only advanced managerial but also leadership skills, with highly developed social skills as the main competence. In a complex social system, good leadership becomes a fundamental component of a successful organization or institution. Although leadership has for a long time been of interest for theoreticians and practitioners alike, there are still numerous questions waiting to be answered in the area of management and leadership in education. According to the Law on the Basis of Educational System, the person who can be named a school director must posses appropriate education, competences, license and experience in education. Legal requirements allow the provision of effective training, but the fact that personal disposition can be both an advantage and an obstacle for acquiring necessary items of knowledge and skills, points to the necessity of including selection into the standard procedure for the election of a director. Democratization and decentralization of the educational system presupposes a series of structural, systemic and functional changes which reflect on school management and the role played by the director. This paper considers responsibilities and competences of directors, both in legislation and in school practice and addresses the question whether a school director is a manager or a leader, and what are the possibilities for the provision of professional resources for school management.
Management evolution in the LSST project
Sweeney, Donald; Claver, Charles; Jacoby, Suzanne; Kantor, Jeffrey; Krabbendam, Victor; Kurita, Nadine
2010-07-01
The Large Synoptic Survey Telescope (LSST) project has evolved from just a few staff members in 2003 to about 100 in 2010; the affiliation of four founding institutions has grown to 32 universities, government laboratories, and industry. The public private collaboration aims to complete the estimated $450 M observatory in the 2017 timeframe. During the design phase of the project from 2003 to the present the management structure has been remarkably stable. At the same time, the funding levels, staffing levels and scientific community participation have grown dramatically. The LSSTC has introduced project controls and tools required to manage the LSST's complex funding model, technical structure and distributed work force. Project controls have been configured to comply with the requirements of federal funding agencies. Some of these tools for risk management, configuration control and resource-loaded schedule have been effective and others have not. Technical tasks associated with building the LSST are distributed into three subsystems: Telescope & Site, Camera, and Data Management. Each sub-system has its own experienced Project Manager and System Scientist. Delegation of authority is enabling and effective; it encourages a strong sense of ownership within the project. At the project level, subsystem management follows the principle that there is one Board of Directors, Director, and Project Manager who have overall authority.
U.S. Senate confirms new USGS director
Showstack, Randy
Shortly before adjourning in October, the U.S. Senate confirmed Charles Groat as the new director of the U.S. Geological Survey. Interior Secretary Bruce Babbitt is expected to swear him in shortly as the agency's 13th director. Groat takes over from Thomas Casadevall, who has served as acting director since Gordon Eaton resigned in September 1997.Groat, an AGU member, has more than 25 years of experience in the Earth science fields, including energy and minerals resource assessment, groundwater occurrence and protection, geomorphic processes and landform evolution in desert areas, and coastal studies.
Dr. Francis Collins Is New NIH Director
... Ph.D., a physician and geneticist, is the new Director of the National Institutes of Health (NIH), part of the U.S. Department of Health and Human Services. President Barack Obama nominated Dr. Collins, who served as Director of ...
PLAY DIRECTING AND DIRECTORS: AN EVOLUTIONARY ...
African Journals Online (AJOL)
While the theatre director can be seen as the `god of the theatre', he/she can also be seen as a priest and a carrier who must coordinate human and material resources a master and a messenger. Drawing from the above, this paper traces the evolution of play directing and the theatre director in different theatres of the world ...
Robert Aymar, Director-General of CERN
Patrice Loïez
2003-01-01
Robert Aymar, photographed in 2003 before taking his position as Director-General at CERN, succeeding Luciano Maiani in 2004. At this time, Aymar was director of the International Thermonuclear Experimental Reactor (ITER) although he had already been involved with developments at CERN, chairing the External Review Committee, set up in 2001 in response to the increased cost of the LHC.
Continuous director-field transformation of nematic tactoids
Prinsen, P.; Schoot, van der P.P.A.M.
2004-01-01
We theoretically investigate the director field inside spindle-shaped nematic droplets, known as tactoids. Tactoids typically form in dispersions of rod-like colloidal particles. By optimising the bulk elastic and surface energies, we find that the director field crosses over smoothly from a
Weerts to lead Physical Sciences and Engineering directorate | Argonne
Physical Sciences and Engineering directorate By Lynn Tefft Hoff * August 10, 2015 Tweet EmailPrint Hendrik Engineering (PSE) directorate at the U.S. Department of Energy's Argonne National Laboratory. Weerts has , chemistry, materials science and nanotechnology. Weerts joined Argonne in 2005 as director of Argonne's High
Maximilien Brice
2011-01-01
4th July 2011 - Russian Deputy Director-General Director of Directorate for Scientific and Technical Complex ROSATOM V. Pershukov in the ATLAS underground experimental area with Adviser T. Kurtyka, ATLAS Technical Coordinator M. Nessi and ATLAS Russian users.
Child Care Information Exchange, 1987
1987-01-01
Presents child care center directors with a variety of relevant management ideas from business and the child care field. They include translating employee body language; leadership myths; on-the-job teacher training; undesirable bosses; wasting employee talent; voicing disagreement; employee anger; encouraging creativity; and coping with late…
Valorización del arte en los textos periodísticos de Clarice Lispector y Sara Gallardo (1967-1973
Directory of Open Access Journals (Sweden)
Guillermina Feudal
2017-12-01
Full Text Available En el contexto regional de democratización en el acceso a los bienes culturales, un aspecto nuclear de la producción periodística de Clarice Lispector y Sara Gallardo revela una sintonía común en el comentario y apropiación de recursos estéticos de las vanguardias “de los sesenta”. La apelación al arte como referencia para evaluar la vida cotidiana constituye una decisión comunicacional que funciona, desde el planteo formal y temático, como eje de las intervenciones críticas que ellas operan en el periodismo. El artículo analiza y compara la fundamentación de las elecciones artísticas de las autoras, así como los universos de discusión en los que desarrollan la contienda estética y debaten sobre los alcances de las nuevas modalidades de interacción cultural.
Board Directors and Corporate Social Responsibility
Mariana Nedelcu (Bunea)
2014-01-01
The boards of directors and corporate social responsibility (CSR) have been the subject of much study and debate in the corporate governance circles over the two last decades. With issues ranging from poor corporate reporting to excessive executive compensation often splashed in the headlines, the role of boards comes into the media limelight as never before. Boards of directors are also becoming increasingly aware of corporate social responsibility issues.
Directory of Open Access Journals (Sweden)
Sly Newton Mutiro
2015-03-01
Full Text Available Good governance has been and is a growing phenomenon for many business organisations regardless of size, profit margins and purpose for existence. The South African Metropolitan municipality Metropolitan Municipality is one such organisation that has adopted good governance models to business practices. The challenge was how to effectively and efficiently implement governance issues around projects and business organisations. A number of people, committees and institutions have developed different governance frameworks that can be adopted by organisations as a guide to good governance. This research is based on King III guide to good governance. The objective was to establish the perceptions of the corporate services directorate in the South African Metropolitan municipality municipality on King III good governance compliance by interviewing some employees orally and through a questionnaire. The responses were captured and analysed using IMB SPSS software. Problems were identified in governance training and understanding in general. Another major finding was poor communication internally and externally. To overcome these shortfall recommendations were made. Communication models, communication plan, governance models and training were recommended. The major challenges facing the South African Metropolitan municipality Metropolitan Municipality are poor effective governance communication and lack of governance training.
Timely loss recognition and termination of unprofitable projects
Directory of Open Access Journals (Sweden)
Anup Srivastava
2015-09-01
Full Text Available Ideally, firms should discontinue projects that become unprofitable. Managers, however, continue to operate such projects because of their limited employment horizons and empire-building motivations (Jensen, 1986; Ball, 2001. Prior studies suggest that timely loss recognition in accounting earnings enables lenders, shareholders, and boards of directors to identify unprofitable projects; thereby, enabling them to force managers to discontinue such projects before large value erosion occurs. However, this conjecture has not been tested empirically. Consistent with this notion, we find that timely loss recognition increases the likelihood of timely closures of unprofitable projects. Moreover, managers, by announcing late discontinuations of such projects, reveal their inability to select good projects and/or to contain losses, when projects turn unprofitable. Accordingly, thereafter, the fund providers and board of directors are likely to demand improved timeliness of loss recognition and stringent scrutiny of firms’ capital expenditure plans. Consistently, we find that firms that announce large discontinuation losses reduce capital expenditures and improve timeliness of loss recognition in subsequent years. Our study provides evidence that timely loss reporting affects “real” economic decisions and creates economic benefits.
Female Institutional Directors on Boards and Firm Value
Pucheta Martínez, María Consuelo; Bel Oms, Inmaculada; Olcina Sempere, Gustau
2016-01-01
The aim of this research is to examine what impact female institutional directors on boards have on corporate performance. Previous research shows that institutional female directors cannot be considered as a homogeneous group since they represent investors who may or may not maintain business relations with the companies on whose corporate boards they sit. Thus, it is not only the effect of female institutional directors as a whole on firm value that has been analysed, but also the impact of...
Board Directors and Corporate Social Responsibility
Directory of Open Access Journals (Sweden)
Mariana Nedelcu (Bunea
2014-08-01
Full Text Available The boards of directors and corporate social responsibility (CSR have been the subject of much study and debate in the corporate governance circles over the two last decades. With issues ranging from poor corporate reporting to excessive executive compensation often splashed in the headlines, the role of boards comes into the media limelight as never before. Boards of directors are also becoming increasingly aware of corporate social responsibility issues.
Director Turnover: An Australian Academic Development Study
Fraser, Kym; Ryan, Yoni
2012-01-01
Although it can be argued that directors of central academic development units (ADUs) are critical to the implementation of university teaching and learning strategies, it would appear there is a high director turnover rate. While research in the USA, the UK, and Australia illustrates that ADUs are frequently closed or restructured, that research…
Auditor’s Risk Assessment of Independent Directors in Nigeria
Directory of Open Access Journals (Sweden)
Salau Abdulmalik
2017-01-01
Full Text Available The objective of this study is to investigate the external auditor’s risk assessment of independent directors in Nigeria. The study utilized data from 94 non-financial listed companies on the Nigerian Stock Exchange for the periods 2008-2013. The study used cross-sectional time-series feasible generalized least square regression, which account for heteroscedasticity and autocorrelation to test the influence independent non-executive director on auditor pricing decision in Nigeria. Our result indicates that the proportion of independent non-executive director has a positive relationship with audit fees, suggesting that this class of directors is priced high by the Nigerian auditors. These findings have both policy and practical implication on corporate governance. For instance, future regulatory reforms could consider collaborative board model instead of the insistence on more independent director presence in the boardroom.
El Consejero Dominical y el Gobierno Corporativo / Institutional Directors and Corporate Governance
Chiva Ortells, Carlos
2017-01-01
The aim of this research is to study the role of institutional directors in corporate governance. For this purpose, we have analysed the impact that these directors have on CEO compensation and on corporate social responsibility disclosure. Moreover, institutional directors have been classified into two groups: pressure-resistant institutional directors and pressure-sensitive institutional directors. The results show that institutional directors, as a whole, and pressure-resistant institution...
Administrative behavior of directors in hospitals: the Israeli case.
Stern, Z; Schmid, H; Nirel, N
1994-01-01
This article presents research findings on the behavior of directors in hospitals in Israel. According to the findings, hospital directors devote most of their time to internal organization processes and less time to the management of the external organizational environment. The findings also reveal that the orientation of these directors is toward centralization of authority and concentration of the decision-making process.
Alternative Perspectives on Independence of Directors
Brennan, Niamh; McDermott, Michael
2004-01-01
This paper examines the issue of independence of boards of directors and non-executive directors of companies listed on the Irish Stock Exchange. Based on information published in annual reports, the study found that most Irish listed companies were complying with the Combined Code’s recommendations for a balanced board structure, albeit with only 60 per cent having majority-independent boards. The study found a lack of consistency in interpreting the definition of “independence”, a lack of d...
Leadership styles of hospital pharmacy directors.
Parrett, E E; Hurd, P D; Northcraft, G; McGhan, W F; Bootman, J L
1985-05-01
The leadership styles of hospital pharmacy directors and the association between leadership style, participative management, and innovative pharmaceutical services were studied using a mail questionnaire. The questionnaire was sent to 570 randomly selected hospital pharmacy directors. Included were a validated instrument that measures task-oriented versus relationship-oriented leadership behavior and other questions about participation of staff members, innovative services, and respondents' personal characteristics. The response rate was 69%. The majority of respondents perceived their leadership as highly relationship-oriented as well as highly task-oriented. Respondents with the "high relationship-high task" leadership style had the highest scores for subordinate participation. There were no significant differences in scores for innovative services by leadership style. A positive correlation between scores for subordinate participation and scores for innovative services was demonstrated. Most hospital pharmacy directors used a management style in which relationships and staff participation were important.
Research leadership: should clinical directors be distinguished researchers?
Allison, Stephen; Goodall, Amanda H; Bastiampillai, Tarun
2016-06-01
Clinical directors established research-led healthcare by combining research, teaching and clinical excellence within the teaching hospitals. This research culture created high clinical standards, which benefited patients, the workforce and healthcare organisations. The current paper explores this research leadership role for clinical directors. It reviews studies arising from the theory of expert leadership, which focuses on the relationship between a leader's core knowledge and organisational performance. More specifically, we examine the expert leader's research track record, the associations with their organisation's performance, and the influence of research activity on clinical excellence. Distinguished researchers still lead the most prestigious teaching hospitals and the most trusted departments of psychiatry in the United States where the clinical directorate structure originated. It is also known that good scholars can improve research output when appointed to leadership positions. This suggests that the clinical director's research track record should be a consideration at a time when research is being embedded in Australia's local health networks. A clinical director's leadership may influence the research performance of their department and contribute to the quality of mental healthcare. © The Royal Australian and New Zealand College of Psychiatrists 2015.
Misleading outside directors in public companies – The Israeli case
Directory of Open Access Journals (Sweden)
David A. Frenkel
2006-01-01
Full Text Available The external directors, who serve by law on the board of directors, are responsible for ensuring that, in addition to protecting the interests of stakeholders, the company will take the public interest into consideration. In this research we critically assess this system of corporate governance, and examine whether the external directors can actually succeed in looking out for the public’s interest. The research is based on in-depth interviews with external directors of leading public companies in Israel, representing different sectors. The issue at stake is both conceptual and practical: Conceptually there is an issue of how the notion of "the public interest" is understood and whether the legal construct of "outside directors" is capable of manifesting the public interest. Practically the issue at stake has to do with organisational sociology and how the relations within the Board are set and who are the outside directors.
Slonecker, E. Terrence; Fisher, Gary B.
2009-01-01
This project is a research collaboration between the U.S. Environmental Protection Agency (EPA) Office of Inspector General (OIG) and the U.S. Geological Survey (USGS) Eastern Geographic Science Center (EGSC), for the purpose of evaluating the utility of hyperspectral remote sensing technology for post-closure monitoring of residual contamination at delisted and closed hazardous waste sites as defined under the Comprehensive Environmental Response Compensation and Liability Act [CERCLA (also known as 'Superfund')] of 1980 and the Superfund Amendments and Reauthorization Act (SARA) of 1986.
Potential of Field Education as Signature Pedagogy: The Field Director Role
Lyter, Sharon C.
2012-01-01
In light of the assertion that field education is the signature pedagogy of social work education, this Internet-based study explores field director demographics and questions the fulfillment of this potential, examining BSW and MSW field education through the lens of the field director position. Field directors (159) and deans/directors (150)…
CERN stop-over for KEK and Fermilab Directors
2001-01-01
En route for a meeting of the International Committee for Future Accelerators, ICFA, held at Germany's DESY laboratory, the Directors of Japan's KEK laboratory and Fermilab in the United States had a stop-over at CERN last Wednesday 7 February. Dr Hirotaka Sugawara, Director General of Japan's high energy physics laboratory, KEK, visited the Antiproton Decelerator, AD. From left to right, Masaki Hori, member of the ASACUSA collaboration, John Eades, contact person for ASACUSA, Dr Hirotaka Sugawara, Werner Pirkl, the PS Division engineer responsible for the Radio Frequency Quadrupole decelerator in the foreground, and Kurt Hübner, CERN's Director of Accelerators. Dr Michael S. Witherell, Director of the Fermi National Accelerator Laboratory, Fermilab, visited construction sites for the LHC, ATLAS, and CMS. He is seen here with a module of the CMS hadronic calorimeter in building 186.
Board Directors' Selection Process Following a Gender Quota
DEFF Research Database (Denmark)
Sigurjonsson, Olaf; Arnardottir, Audur Arna
-quota selection of new board directors as well as the attitudes of board members towards the quota and perceptions of the effect of quota on processes. We incorporate a dual qualitative and quantitative methodology with in-depth interviews with 20 board directors and chairs, and a survey of 260 directors who...... companies with 50 or more employees. Thereby legislatively going further than any other country, out of the fifteen that have amended and adopted gender quota legislation. This article utilizes resource dependency and status expectations theory lenses to explore how the new legislation affected the post...... conviction. Furthermore, there are different avenues to the board. Although initial attitudes towards quotas are more negative among men than women, these attitudes decrease over time. Finally, consistent with status expectation theory, male directors are more negative than their female counterparts about...
Pathak, K B
1993-07-01
The director's report for the International Institute for Population Sciences in Bombay, India, provides descriptions of the Institute's teaching programs, research, publications, seminars, library collection, visitors, faculty and staff, and special events. The teaching programs include regular instruction in one-year diploma courses in population studies and a masters and a masters in philosophy in population studies; a diploma is also available in health education. Student represent a variety of countries for the diploma programs, while the other certificate programs draw on the national population. A listing is provided of those receiving certificates. Research programs are listed by whether the program was completed during 1992-93 or earlier or is a new project. The Institute conducts a National Family Welfare Survey among 23 states. This household survey is directed to women and supplies village level data. The Institute publishes a quarterly newsletter about ongoing activities and a biennial compendium of research findings. The Institute observes World Population Day and organized the 10th Annual Convention on Medical Statistics and other conferences. The Institute held the first meeting of the National Council of Population Research on September 21, 1992, and the designated subcommittee members met on November 14, 1992. The library recently added 1117 volumes, which contributed to the total library collection of 55,539 volumes, including 8000 bound periodicals and 12,615 reprints. Several high government officials visited the Institute in 1992. Other visitors came from the US, Bangladesh, and the UN. The Institute is comprised of six academic departments with computer and library resources. Staff were involved a few overseas tours of study. Founders day is celebrated as a cultural event.
Rolf-Dieter Heuer, next Director General
CERN Council appointed Professor Rolf-Dieter Heuer to succeed Dr Robert Aymar as CERN’s Director General. Professor Heuer will serve a five-year term, taking office on 1 January 2009. Rolf-Dieter Heuer is currently Research Director for particle and astroparticle physics at Germany’s DESY laboratory in Hamburg. He was a staff member at CERN from 1984 to 1998, working for the OPAL collaboration at LEP, and from 1994 to 1998 he was the collaboration’s spokesman. See the Press Release.
Alpena Community College Workplace Partnership Project. Final Report.
Alpena Community Coll., MI.
This document consists of materials produced during the Workplace Partnership Project (WPP), a National Workplace Literacy Program-funded workplace literacy partnership between Alpena Community College (ACC) in Alpena, Michigan, and area businesses. Presented first is a personal reflection in which the project director shares some of the lessons…
27 CFR 28.269 - Certification by district director of customs.
2010-04-01
... director of customs. 28.269 Section 28.269 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX... Export § 28.269 Certification by district director of customs. (a) Exportation. When the district director of customs is satisfied that merchandise described on the application, notice, or claim, TTB Form...
Burnout and Resiliency Among Family Medicine Program Directors.
Porter, Maribeth; Hagan, Helen; Klassen, Rosemary; Yang, Yang; Seehusen, Dean A; Carek, Peter J
2018-02-01
Nearly one-half (46%) of physicians report at least one symptom of burnout. Family medicine residency program directors may have similar and potentially unique levels of burnout as well as resiliency. The primary aims of this study were to examine burnout and resiliency among family medicine residency directors and characterize associated factors. The questions used were part of a larger omnibus survey conducted by the Council of Academic Family Medicine (CAFM) Educational Research Alliance (CERA) in 2016. Program and director-specific characteristics were obtained. Symptoms of burnout were assessed using two single-item measures adapted from the full Maslach Burnout Inventory, and level of resiliency was assessed using the Brief Resilience Scale. The overall response rate for the survey was 53.7% (245/465). Symptoms of high emotional exhaustion or high depersonalization were reported in 27.3% and 15.8% of program directors, respectively. More than two-thirds of program directors indicated that they associated themselves with characteristics of resiliency. Emotional exhaustion and depersonalization were significantly correlated with never having personal time, an unhealthy work-life balance, and the inability to stop thinking about work. The presence of financial stress was significantly correlated with higher levels of emotional exhaustion and depersonalization. In contrast, the level of resiliency reported was directly correlated with having a moderate to great amount of personal time, healthy work-life balance, and ability to stop thinking about work, and negatively correlated with the presence of financial stress. Levels of emotional exhaustion, depersonalization, and resiliency are significantly related to personal characteristics of program directors rather than characteristics of their program.
2003-01-01
"The United Kingdom Atomic Energy Authority (UKAEA) announced the appointment of Professor Sir Chris Llewellyn Smith FRS (Fellow of the Royal Society) as Director of Culham, responsible for developing and implementing the strategy for the UK's fusion research programme" (1 page).
Examining the concept of de facto director in corporate governance
Directory of Open Access Journals (Sweden)
Anthony O. Nwafor
2016-07-01
Full Text Available There are different categories of persons involved in the execution of the company’s affairs, but not all have the capacity to bind the company as the embodiment of the company itself. Those who exercise acts of management and control over the company’s business are usually referred to as the directors. Where persons who satisfy the statutorily prescribed qualification standard are duly appointed by the shareholders to exercise control and manage the affairs of the company function in that capacity, they are usually identified as de jure directors. But where there is no such appointment, or irregular appointment, the law demands, for the protection of those dealing with the company, that the role performed by the person be examined to ascertain whether such a person is a de facto director. The more difficult part lies in identifying a de facto director where the subject company has a corporate body as its director. The extant judicial authority suggests that the human person in the corporate director must be performing functions which are beyond the natural call of duty in relation to the corporate director to constitute a de facto director of the subject company. The paper argues that the standard is satisfied in any case where the human person is involved in the initiation and execution of the affairs of the subject company, and more so where the conducts of the subject company are patently unlawful.
International Nuclear Information System (INIS)
1994-10-01
The International Programme on the Health Effects of the Chernobyl Accident (IPHECA) have been initiated in mid-1991 following its endorsement by the Forty-fourth World Health Assembly in resolution WHA44.36. This report by the Director General outlines the progress made in the implementation of the Programme, and summarises the scientific information obtained to date on the health effects and planned future activities. The major projects under the programme include Thyroid project, Hematology project, Dosimetry and Communication Support Services, Brain Damage in utero project and Epidemiological Registry project
Nguyen, Hung D.; Steele, Gynelle C.
2015-01-01
This report is intended to help NASA program and project managers incorporate Small Business Innovation Research/Small Business Technology Transfer (SBIR/STTR) technologies that have gone through Phase II of the SBIR program into NASA Human Exploration and Operations Mission Directorate (HEOMD) programs. Other Government and commercial project managers can also find this information useful.
Characteristics of CEOs and corporate boards with women inside directors
Directory of Open Access Journals (Sweden)
Deborah Dahlen Zelechowski
2006-07-01
Full Text Available Women corporate inside (executive directors constitute an elite minority of leaders of large corporations. This study examines the characteristics of CEOs and boards of Fortune 1000 firms that had women who held the dual leadership positions of corporate director and executive officer in 1998 in order to determine whether firms with women insiders had substantially different characteristics than firms without. We find that compared with firms without women inside directors, firms with women inside directors were characterized by CEOs with longer board tenure, more family ties, and fewer director interlocks, and by boards that were larger, with more insiders, and that utilize a management Chair of the board. Corporate governance implications are drawn for the presence of women at the top of the executive hierarchy.
Gunnell, James W.
2013-01-01
This research examined the relationship between Illinois Directors, of special education leadership styles and the importance of the Illinois mandated standards for Director of special education. It extends the current research in educational leadership by specifically exploring the relationship between the importance of special education…
Rolf-Dieter Heuer, CERN’s next Director General
2007-01-01
Currently Research Director for particle and astroparticle physics at Germany’s DESY laboratory in Hamburg, Professor Heuer will serve a five-year term, taking office on 1 January 2009.The CERN Council has appointed Professor Rolf-Dieter Heuer to succeed Dr Robert Aymar as CERN’s Director-General. Professor Heuer will serve a five-year term, taking office on 1 January 2009. Currently Research Director for particle and astroparticle physics at Germany’s DESY laboratory in Hamburg, a post that he took up in 2004, Rolf-Dieter Heuer is no stranger to CERN. From 1984 to 1998, he was a staff member at the Laboratory, working for the OPAL collaboration at the Large Electron Positron collider. From 1994 to 1998, he was the collaboration’s spokesman. "This is a very exciting time for particle physics," said Heuer. "To become CERN’s Director-General for the early years of LHC operation is a great honour, a great challenge, and probably the best job in physics research tod...
PRINCIPALES COMPETENCIAS QUE DEBE POSEER UN DIRECTOR DE PROYECTOS EN LA INDUSTRIA DE LA CONSTRUCCIÓN
Directory of Open Access Journals (Sweden)
R. F. Herrera
2016-12-01
Full Text Available El rol del director de proyectos es uno de los trabajos más desafiantes en cualquier organización, porque requiere una amplia comprensión sobre varias áreas que deben estar coordinadas y sobre las que se requieren habilidades interpersonales. El objetivo del trabajo es definir las principales competencias que deben poseer los directores de proyectos en la industria de la construcción, y además presentar cómo éstos podrían desarrollarlas. Para cumplir con éste, se realizó un análisis crítico que incluye diversos estudios de expertos, e instituciones dedicadas a esta área de la ingeniería. De este estudio se concluye que el director de proyectos debe poseer conocimientos, habilidades y actitudes para manejar los aspectos técnicos específicos, el alcance, los costos, los tiempos y la interrelación, alineada con los objetivos, del equipo de trabajo y de los stakeholders, entre otros. Todo ello en un ambiente cambiante, diverso y transversal, generador de incertidumbre y de conflictos a solucionar de forma competente. The role of the project manager is one of the most challenging jobs in any organization because it requires a broad understanding of several areas that need to be coordinated and require interpersonal skills. The objective of the work is to define the main competences that must be possessed by the project managers in the construction industry, and also to present how they could develop them. In order to comply with this, a critical analysis was carried out that includes several studies of experts, and institutions dedicated to this area of engineering. This study concludes that the project manager must have the knowledge, skills and attitudes to handle the specific technical aspects, scope, costs, timing and interrelationship, aligned with the objectives, teamwork and stakeholders, among others. All this in a changing, diverse and transversal environment, generating uncertainty and conflicts to be resolved competently
REGIONAL CUSTOMS DIRECTORATES MANAGEMENT
Directory of Open Access Journals (Sweden)
CABA STEFAN
2009-05-01
Full Text Available The management of a regional customs directorate is analyzed. A new approach of the managerial system, in the European integration context, is presented. The customs system is one of the first “doors” to a new economic, social and cultural community. For
Director Experience and the Performance of IPOs: Evidence from Sweden
Directory of Open Access Journals (Sweden)
Anders Isaksson
2014-03-01
Full Text Available private to public. In this paper the experience of directors is examined to determine the extent of the role they play in ensuring a successful listing. Unique data from 122 IPOs on the Swedish Stock Exchange have been examined in a search for the effect of director experience on aftermarket performance. Specific aspects of director experience within a board, such as interlocking directorships and average tenure, are connected to the underpricing of Swedish IPOs. Contrary to expectations, no statistically significant relationship was found between long-run aftermarket performance and director experience at the time of an IPO. This suggests that the previous experience of directors, as measured in earlier studies, is less relevant to long-term aftermarket performance in Sweden compared to other countries studied in the literature review. This emphasises the importance of examining different institutional contexts.
Sheikh, Mohd Raashid; Hulme, Michael
2016-01-01
The American Board of Surgery Certifying Examination (CE) is a pivotal event in a surgeon's career development, as it is the last challenge before achieving Board certification. First-time pass rate on the CE is one of the key metrics of surgery residency programs. The overall pass rate on the CE has declined significantly in recent years. The goal of this study was the identification of attributes of general surgery residents that are associated with passing the CE at the first attempt. The modified Delphi process was used to survey general surgery program directors. The study was conducted in 2 rounds in the interest of time available for surgical education research fellowship project. All 259 program directors were contacted in each round of surveys. In all, 49 (19%) responded to the first round and 54 (21%) responded to the second round of survey. The characteristics of a successful resident on CE include confidence, self-motivation, sound knowledge base, strong performance on the Board's training examination (American Board of Surgery In-Training Examination), and mock orals, and good communication skills. Postgraduate years 4 and 5 are the most likely resident levels at which failure could be predicted. Copyright © 2015 Association of Program Directors in Surgery. Published by Elsevier Inc. All rights reserved.
50 CFR 11.13 - Decision by the Director.
2010-10-01
... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false Decision by the Director. 11.13 Section 11..., POSSESSION, TRANSPORTATION, SALE, PURCHASE, BARTER, EXPORTATION, AND IMPORTATION OF WILDLIFE AND PLANTS CIVIL PROCEDURES Assessment Procedure § 11.13 Decision by the Director. Upon expiration of the period required or...
Maximilien Brice
2008-01-01
23rd May 2008 - CERN Director-General R. Aymar with German Federal Minister of Education and Research A. Schavan, CERN Director-General Designate R. Heuer, Swiss Federal Councillor M. Calmy-Rey and CERN Deputy Director-General and Chief Scientific Officer J. Engelen.
2010-09-09
... customers; and 7. Workforce satisfaction. An evaluation model was developed for the Director, Defense... personnel system under an appropriate demonstration project as defined in section 342(b) of Public Law 103... satisfaction. With some modifications, this project mirrors the STRL personnel management demonstration project...
Family and Provider/Teacher Relationship Quality: Director Measure
Administration for Children & Families, 2015
2015-01-01
The director measure is intended for use with program directors in center-based, family child care, and Head Start/Early Head Start settings for children from birth through five years old. This measure asks respondents general questions about the early childhood education environment, the children enrolled in the program, and how the program…
7 CFR 2.36 - Director, Office of Communications.
2010-01-01
... are made by the Secretary of Agriculture to Director, Office of Communications: (1) Related to public...) Organize and direct the activities of a public affairs office to include press relations of the secretary... 7 Agriculture 1 2010-01-01 2010-01-01 false Director, Office of Communications. 2.36 Section 2.36...
Director Networks and Takeovers
Renneboog, L.D.R.; Zhao, Y.
2013-01-01
Abstract: We study the impact of corporate networks on the takeover process. We find that better connected companies are more active bidders. When a bidder and a target have one or more directors in common, the probability that the takeover transaction will be successfully completed augments, and
Message from Fermilab Director
2009-01-01
With this issue’s message, Fermilab Director Pier Oddone opens a new series of occasional exchanges between CERN and other laboratories world-wide. As part of this exchange, CERN Director-General Rolf Heuer, wrote a message in Tuesday’s edition of Fermilab TodayPerspectivesNothing is more important for our worldwide particle physics community than successfully turning on the LHC later this year. The promise for great discoveries is huge, and many of the plans for our future depend on LHC results. Those of us planning national programmes in anticipation of data from the LHC face formidable challenges to develop future facilities that are complementary to the LHC, whatever the physics discoveries may be. At Fermilab, this has led us to move forcefully with a programme at the intensity frontier, where experiments with neutrinos and rare decays open a complementary window into nature. Our ultimate goal for a unified picture of nat...
Director networks and takeovers
Renneboog, L.D.R.; Zhao, Y.
2014-01-01
We study the impact of corporate networks on the takeover process. We find that better connected companies are more active bidders. When a bidder and a target have one or more directors in common, the probability that the takeover transaction will be successfully completed augments, and the duration
Directory of Open Access Journals (Sweden)
Hans Christian Hagedorn
2011-01-01
Full Text Available En el presente estudio se analizan las fuentes de la versión de la "Historia del califa cigüeña", incluida en la narración Feral y las cigüeñas (1971, de Fernando Alonso. Para ello se tienen en cuenta el cuento original del autor postromántico alemán Wilhelm Hauff ("Die Geschichte von Kalif Storch", 1825, y la adaptación de este cuento que Sara Cone Bryant realizó para su libro How to tell stories to children (1905, traducción española: El arte de contar cuentos, 1965.
Aguilera Velandia, Mónica Natalia; Álvarez Rodríguez, María Isabel; Báez Millán, Christian Danilo; Cuestas Díaz, Andrea Patricia; Escobar Campos, Lina Marcela; Galindo Londoño, Ana María; García Sierra, María Camila; García, Lina María; Jaramillo Barrios, María Paola; Mesa Torres, Karen Eliana; Mora Barrero, Daniel; Morales Morales, Ángela Beatriz; Moreno, Ana María; Naranjo Pinilla, Juan Sebastian; Ochoa Rodríguez, Ángela Marcela
2015-01-01
Contenido Introducción 1. Inteligencia emocional, liderazgo transformacional y género: factores que influencian el desempeño organizacional / Ana María Galindo Londoño, Sara Urrego Mayorga; Director: Juan Carlos Espinosa Méndez. 2. El rol de la mujer en el liderazgo / Andrea Patricia Cuestas Díaz; Directora: Francoise Venezia Contreras Torres. 3. Liderazgo transformacional, clima organizacional, satisfacción laboral y desempeño. Una revisión de la literatura / Juliana Restrepo O...
Child Welfare Training in Child Psychiatry Residency: A Program Director Survey
Lee, Terry G.; Cox, Julia R.; Walker, Sarah C.
2013-01-01
Objective: This study surveys child psychiatry residency program directors in order to 1) characterize child welfare training experiences for child psychiatry residents; 2) evaluate factors associated with the likelihood of program directors' endorsing the adequacy of their child welfare training; and 3) assess program directors'…
Outside directors and the Japanese board room: An in-depth study
Directory of Open Access Journals (Sweden)
Ralf Bebenroth
2007-07-01
Full Text Available The purpose of this paper is to investigate the performance impact at the board level in the corporate governance of Japanese companies. We investigated the composition of outside directors and outside auditors for three years and found evidence, that a higher outside ratio leads to a better performance. As a second step, we cluster Japanese companies into three groups, companies without outside directors, companies which appointed outside directors and companies who apply to the “US-style system.” Companies without outside directors every single year show the weakest performance and US-style Japanese companies the strongest what leads to the conclusion that Japanese companies might be better off having a high ratio of outside directors and outside auditors.
2018-02-01
ARL-TR-8283 ● FEB 2018 US Army Research Laboratory Potential Science and Technology Game Changers for the Ground Warfare of 2050...Science and Technology Game Changers for the Ground Warfare of 2050: Selected Projections Made in 2017 by Alexander Kott Office of the Director...Brian Sadler Vehicle Technology Directorate, ARL Ananthram Swami Computational and Information Sciences Directorate, ARL Approved for
Photovoltaic demonstration projects
Energy Technology Data Exchange (ETDEWEB)
Kaut, W [Commission of the European Communities, Brussels (Belgium); Gillett, W B; Hacker, R J [Halcrow Gilbert Associates Ltd., Swindon (GB)
1992-12-31
This publication, comprising the proceedings of the fifth contractor`s meeting organized by the Commission of the European Communities, Directorate-General for Energy, provides an overview of the photovoltaic demonstration projects which have been supported in the framework of the energy demonstration programme since 1983. It includes reports by each of the contractors who submitted proposals in 1987 and 1988, describing progress within their projects. Projects accepted from earlier calls for proposals and not yet completed were reviewed by a rapporteur and are discussed in the summary section. The results of the performance monitoring of all projects and the lessons drawn from the practical experience of the projects are also presented in the summaries and conclusions. Contractors whose projects were submitted in 1989 were also present at the meeting and contributed to the reported discussions. This proceeding is divided into four sessions (General, Housing, technical presentations, other applications) and 24 papers are offered.
42 CFR 59.5 - What requirements must be met by a family planning project?
2010-10-01
... requirements must be met by a family planning project? (a) Each project supported under this part must: (1... (iii) Promote continued participation in the project by persons to whom family planning services may be... services purchased for project participants will be authorized by the project director or his designee on...
25 CFR 39.409 - How does the OIEP Director ensure accountability?
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false How does the OIEP Director ensure accountability? 39.409... EQUALIZATION PROGRAM Accountability § 39.409 How does the OIEP Director ensure accountability? (a) The Director of OIEP must ensure accountability in student counts and student transportation by doing all of the...
Do Director Networks Help Manager Plan and Forecast Better?
Schabus, M.
I examine whether directors' superior access to information and resources through their board network improves the quality of firms' planning and forecasting. Managers may benefit from well-connected directors as, even though managers have firm specific knowledge, they may have only limited insight
Engineering activities on New Built Projects
International Nuclear Information System (INIS)
Puravet, Guillaume
2014-01-01
Guillaume Puravet, Director of Operations at Assystem, described the engineering activities related to nuclear new builds. He presented the various competencies that Assystem can provide to its customers all along the construction phase of a new nuclear project from the conceptual design to its commissioning
Core clerkship directors: their current resources and the rewards of the role.
Ephgrave, Kimberly; Margo, Katherine L; White, Christopher; Hammoud, Maya; Brodkey, Amy; Painter, Thomas; Juel, Vern C; Shaw, Darlene; Ferguson, Kristi
2010-04-01
To conduct a national multidisciplinary investigation assessing core clinical clerkships and their directors, variances in resources from national guidelines, and the impact of the clerkship director role on faculty members' academic productivity, advancement, and satisfaction. A multidisciplinary working group of the Alliance for Clinical Education (ACE), representing all seven core clinical disciplines, created and distributed a survey to clerkship directors at 125 U.S. MD-granting medical schools, in academic year 2006-2007. A total of 544 clerkship directors from Internal Medicine (96), Family Medicine (91), Psychiatry, (91), Pediatrics (79), Surgery (71), Neurology (60), and Obstetrics-Gynecology (56) responded, representing over 60% of U.S. core clinical clerkships. The clerkship directors were similar across disciplines in demographics and academic productivity, though clinical and clerkship activities varied. Departmental staff support for clerkships averaged 0.69 people, distinctly less than the ACE's 2003 guideline of a full-time coordinator in all disciplines' clerkships. Clerkship directors reported heavy clinical responsibilities, which, as in previous studies, were negatively related to academic productivity. However, many clerkship directors felt the role enhanced their academic advancement; a large majority felt it significantly enhanced their career satisfaction. The resources and rewards of the clerkship director role were similar across disciplines. Expectations of clerkship directors were considerable, including responsibility for clinical material and the learning environment. Resources for many fall short of those stated in the ACE guidelines, particularly regarding support staff. However, the findings indicate that the clerkship director role can have benefits for academic advancement and strongly enhances career satisfaction.
75 FR 8245 - Natural Gas Pipelines; Project Cost and Annual Limits
2010-02-24
...] Natural Gas Pipelines; Project Cost and Annual Limits February 18, 2010. AGENCY: Federal Energy Regulatory... for natural gas pipelines blanket construction certificates for each calendar year. DATES: This final..., Natural gas, Reporting and recordkeeping requirements. Jeff C. Wright, Director, Office of Energy Projects...
Why so few Women on Boards of Directors?
DEFF Research Database (Denmark)
Smith, Nina; Parrotta, Pierpaolo
2015-01-01
This paper analyzes the determinants of women’s representation on boards of directors based on a panel of all privately owned or listed Danish firms with at least 50 employees observed during the period 1998–2010. We focus on the directors who are not elected by the employees and test three...... nonemployee-elected female board members. We also find clear evidence of a tokenism behavior in Danish companies. The likelihood of enlarging the share of non-employee-elected female board members is significantly smaller if one, two, or more women have sat on the board of directors. Finally, the pipeline...... suggests that an important way to increase the female proportion of non-employee-elected board members is that more women reach top executive positions....
Voice Range Profiles of Middle School and High School Choral Directors
Schwartz, Sandra M.
2009-01-01
Vocal demands of teaching are significant, and this challenge is compounded for choral directors who depend on the voice for communicating information or demonstrating music concepts. The purpose of this study is to examine the frequency and intensity of middle and high school choral directors' voices and to compare choral directors' voices with…
On The Improvement of the System of Board of Directors in China
Directory of Open Access Journals (Sweden)
Zhao Jinlong
2014-09-01
Full Text Available Currently, shareholder democracy in many countries are gaining much more attention because many factors have damaged shareholder’s rights and interest, in which is the problem of the system of board of directors when it operated, including the formalization of the board of directors, the autocracy of managers and staggered boards. To safeguard the legitimate interests of the company and minority shareholders, the system of board of directors is to be improved in following areas: defining the supervision functions and powers of the board of directors, setting up sub-committees within the board, improving the director appointing mechanism and electoral system, improving the director qualification system, abolishing the system of legal representative of company, and improving the system of duty of care and related liabilities.
Cummings, C. Peter; Cook, Desmond L.
This module is the second in a self-instructional program designed to train public school personnel in how to manage educational projects. The purpose of this module is to provide current or potential project directors with the basic knowledge, skills, abilities, and sensitivities needed to manage a local educational project. In the areas of…
Boykan, Rachel; Jacobson, Robert M
2017-10-01
The research sought to identify the general use of medical librarians in pediatric residency training, to define the role of medical librarians in teaching evidence-based medicine (EBM) to pediatric residents, and to describe strategies and curricula for teaching EBM used in pediatric residency training programs. We sent a 13-question web-based survey through the Association of Pediatric Program Directors to 200 pediatric residency program directors between August and December 2015. A total of 91 (46%) pediatric residency program directors responded. Most (76%) programs had formal EBM curricula, and more than 75% of curricula addressed question formation, searching, assessment of validity, generalizability, quantitative importance, statistical significance, and applicability. The venues for teaching EBM that program directors perceived to be most effective included journal clubs (84%), conferences (44%), and morning report (36%). While 80% of programs utilized medical librarians, most of these librarians assisted with scholarly or research projects (74%), addressed clinical questions (62%), and taught on any topic not necessarily EBM (58%). Only 17% of program directors stated that librarians were involved in teaching EBM on a regular basis. The use of a librarian was not associated with having an EBM curriculum but was significantly associated with the size of the program. Smaller programs were more likely to utilize librarians (100%) than were medium (71%) or large programs (75%). While most pediatric residency programs have an EBM curriculum and engage medical librarians in various ways, librarians' expertise in teaching EBM is underutilized. Programs should work to better integrate librarians' expertise, both in the didactic and clinical teaching of EBM.
New mine projects, positive outlook
Energy Technology Data Exchange (ETDEWEB)
M. Cremer
2006-12-15
Speaking on the first day at the Mining 2006 Resources Convention the Deputy Director General, Mining and Petroleum gave an optimistic outlook for mining in 2007 based on the number of new projects under consideration or construction. The convention was held in early November in Brisbane, Queensland, Australia. 3 figs., 1 photo.
Food Recall Attitudes and Behaviors of School Nutrition Directors
Grisamore, Amber; Roberts, Kevin R.
2014-01-01
Purpose/Objectives: The purpose of this study was to explore school nutrition directors' attitudes and behaviors about food recalls. Specific objectives included: 1) Determine current food recall attitudes and the relationship between demographics and these attitudes; 2) Determine current practices of school nutrition directors related to…
Director´s Fiduciary Duties Before Insolvency: Events Of Equity Loss
Directory of Open Access Journals (Sweden)
Felipe Suescún de Roa
2015-12-01
Full Text Available Directors owe fiduciary duties to the company and its shareholders. Before insolvency, more specifically, when corporations are facing events of equity loss, directors should refrain from initiating new transactions and should call for a shareholders meeting. By not doing so, directors would be jointly and severally liable for corporate debts after the equity loss took place.
Juan Antonio Rubio appointed as Director-General of CIEMAT
2004-01-01
Juan Antonio Rubio, Head of CERN's ETT unit (Education and Technology Transfer) has been appointed by the Spanish Ministry of Education and Science as the Director General of the Research Centre for Energy, Environment and Technology, CIEMAT. Dr Rubio's career began at the Spanish Nuclear Energy Commission where he held the posts of Investigator, Head of the High Energy Group and Head of Nuclear Physics and High Energy Division. Later, he was named Director of the Department of Basic Investigation and Scientific Director of the CIEMAT. In 1987 he joined CERN as Scientific Adviser to the Director General and Group Leader of the Scientific Assessment Group. Up to now, Dr Rubio has been the Head of the ETT unit, as well as Coordinator for Latin America and Commissioner for the 50th Anniversary of the Organization. He was born on 4 June 1944 in Madrid, and holds a Doctorate in Physical Sciences from the Universidad Complutense de Madrid.
A DUAL NETWORK MODEL OF INTERLOCKING DIRECTORATES
Directory of Open Access Journals (Sweden)
Humphry Hung
2003-01-01
Full Text Available The article proposes an integrative framework for the study of interlocking directorates by using an approach that encompasses the concepts of multiple networks and resource endowment. This serves to integrate the traditional views of interorganizational linkages and intra-class cohesion. Through appropriate strategic analysis of relevant resource endowment of internal environment and external networks of organizations and corporate elites, this article argues that the selection of directors, if used effectively, can be adopted as a strategic device to enhance the corporation's overall performance.
The role of the psychiatrist: job satisfaction of medical directors and staff psychiatrists.
Ranz, J; Stueve, A; McQuistion, H L
2001-12-01
In a previous survey of Columbia University Public Psychiatry Fellowship alumni, medical directors reported experiencing higher job satisfaction compared to staff psychiatrists. To further this inquiry, the authors conducted an expanded survey among the membership of the American Association of Community Psychiatrists (AACP). We mailed a questionnaire to all AACP members. Respondents categorized their positions as staff psychiatrist, program medical director or agency medical director, and rated their overall job satisfaction. The form also included a number of demographic and job characteristic items. Of 479 questionnaires mailed, a total of 286 individuals returned questionnaires (61%-12 forms were undeliverable). As in our previous survey, medical directors experience significantly higher job satisfaction compared to staff psychiatrists. Program and agency medical directors do not differ significantly. In addition, job satisfaction is strongly and negatively correlated with age for staff psychiatrists but not for medical directors. This survey strengthens the previously reported advantage medical directors have over staff psychiatrists regarding job satisfaction. The finding that job satisfaction decreases with increasing age of staff psychiatrists but not medical directors is particularly interesting, suggesting that staff psychiatrist positions may come to be regarded as "dead-end" over time. Psychiatrists are advised to seek promotions to program medical director positions early in their careers, since these positions are far more available, and provide equal job satisfaction, compared to agency medical director positions.
Veterinary Technician Program Director Leadership Style and Program Success
Renda-Francis, Lori A.
2012-01-01
Program directors of American Veterinary Medical Association (AVMA) accredited veterinary technician programs may have little or no training in leadership. The need for program directors of AVMA-accredited veterinary technician programs to understand how leadership traits may have an impact on student success is often overlooked. The purpose of…
Anna Pantelia
2013-01-01
8 October 2013 - Rolex Director- General G. Marini in the ATLAS Control Room with CERN Director-General R. Heuer and ATLAS Collaboration Senior Physicist C. Rembser; visiting the ATLAS experimental cavern at LHC Point 1. Were also present from the Directorate: S. Lettow, Director for Administration and General Infrastructure; from the ATLAS Collaboration: Technische Universitaet Dortmund (DE) J. Jentzsch and SLAC National Accelerator Laboratory (US) G. Piacquadio.
International Nuclear Information System (INIS)
Stuller, P.
2006-01-01
In this paper the interview with the MR. Stanislav Reguli, chairman of the board of directors and general director of the GovCo, joint-stock association is published. The state company GovCo, a.s. was originated on April 1, 2006. Process of severance of property from the Slovenske elektrarne, a.s., personnel management of new company as well as organisation of property management are presented
"Arising from Sullen Earth": The 52nd Street Project's Transformative Teen Shakespeare Project
Sandberg-Zakian, Megan
2010-01-01
The author of this document spent time as the Associate Artistic Director of The 52nd Street Project, a not-for-profit theater company dedicated to the creation and production of new plays for, and often by, kids between the ages of nine and eighteen that reside in the Hell's Kitchen neighborhood of New York City. Through a series of unique…
Female Directors and Firm Performance: Evidence from UK Listed Firms
Directory of Open Access Journals (Sweden)
Pananda Pasaribu
2017-08-01
Full Text Available The impact of female directors on firm performance has lacked consistency in the previously conducted empirical studies, which may be due to the endogeneity problem, or certain characteristics (i.e. governance, industry, competition. This study examines the relationship between female directors and firm performance by addressing those problems. This study analyses all non-financial UK listed firms during the period 2004-2012 and employs several econometric models. The regression results indicate that there is little evidence that female directors have a positive and strong relationship with firm performance. But, further analysis reports that the UK’s small listed firms experience a positive significant effect, because small firms do not suffer from the problem of over-monitoring and they have more flexibility in composing their boards of directors.
1979-12-18
I Z I UO W-1 eu 0 - 0 tD CL 0, 0 -I7 NW 2 - x M.j a CL W2 X 41 a ~ 0 0,a 4~~ 0 Z .D .J 0 2. N 0 ~N IU 0 4 - 2 0 ~. 0 Q. ’o ~ 0, e U - U ~- 0, 0 -a...0 .44 A A A Ao 0 - 2. -U 2- 4’ A 4’ A o .~ 0 .~ 2. flJ 2. A Ao ~. a 2. 2- @2 @2 @2 A 0 .~. a I- 2. Xii - 0 2 @2 ON AXe Re 2- Oi. K A.. A A AU .40...Project manager or person appointed by him SE/ TD project manager b. Senior ADP Manager Director Director computer programming Software program design
The Contractual Position of Directors in Commercial Companies in Slovene Law
Directory of Open Access Journals (Sweden)
Darja Senčur Peček
2008-01-01
Full Text Available In the Republic of Slovenia, the Companies Act in force regulates the position of directors only from the perspective of the functioning of a commercial company and not also from the perspective of the protection of their personal position. With reference to such, the Companies Act suggests that a contract be concluded between the commercial company and its director (a contract to perform the function of director. In practice, the aforementioned contract is as a general rule concluded as an employment contract and only rarely as a civil-law contact. The Employment Relations Act namely allows that a contractual relation between a company and a director be regulated as an employment relation and at the same time determines certain particularities of the labour-law position of directors, which the author discusses in the present article. The question that the author raises in this respect is whether and under what conditions a contract to perform the function of director can be an employment contract. Employment contracts namely regulate employment relations which are defi ned by the subordinate position of employees and the condition of work carried out upon instructions provided by employers and under their supervision.
Creating the Vision: Directors Don't Do It Alone.
Carlisle, Barbara; Drapeau, Don
1997-01-01
Argues that good directors are not as autocratic and individualistic as they are often portrayed. Suggests that theater is much more of an ensemble effort. States that good theater grows out of the performers' desire to reach the audience. Articulates guidelines for the teacher or theater director who wishes to change "I" to…
78 FR 69927 - SJI Board of Directors Meeting, Notice
2013-11-21
... STATE JUSTICE INSTITUTE SJI Board of Directors Meeting, Notice AGENCY: State Justice Institute. ACTION: Notice of meeting. SUMMARY: The SJI Board of Directors will be meeting on Monday, December 9, 2013 at 1:00 p.m. The meeting will be held at the 9th Judicial Circuit of Florida in Orlando, Florida...
The governance of director networks
Renneboog, L.D.R.; Zhou, Y.; Wright, M.; Siegel, D.; Keasey, K.; Filatotchev, I.
2013-01-01
This chapter studies director networks, which have gained increasing attention from sociology, finance, and management. It considers the argument that these networks have an interesting role in corporate governance and then reviews their rules in major developed countries. The chapter goes on to
Lands directorate publications
Energy Technology Data Exchange (ETDEWEB)
1981-01-01
The directorate has a lead role in providing advice to the federal government on land use policy in Canada. The Canada Land Inventory (CLI) Program has produced significant amounts of data pertaining to the capability of Canadian lands to support agriculture, forestry, recreation, wildlife and sport fish. A list of CLI reports is presented in this publication. In addition, and capability maps have been compiled for agricultural, forestry, recreation and wildlife and are listed and described in this publication. (KRM)
45 CFR 660.11 - What are the Director's obligations in interstate situations?
2010-10-01
... 45 Public Welfare 3 2010-10-01 2010-10-01 false What are the Director's obligations in interstate... SCIENCE FOUNDATION INTERGOVERNMENTAL REVIEW OF THE NATIONAL SCIENCE FOUNDATION PROGRAMS AND ACTIVITIES § 660.11 What are the Director's obligations in interstate situations? (a) The Director is responsible...
Schlesinger, E R; Skoner, M M; Trooskin, E D; Markel, J R; North, A F
1976-04-01
A questionnaire survey of Title V special projects--Maternal and Infant Care (M&I), Comprehensive Care for Children and Youth (C&Y), Neonatal Intensive Care and Children's Dental Care--indicated that the anticipated change from federal project grants to state formula grants caused anxiety among project directors, low morale and high turnover in project staff, difficulty in filling staff positions, and anticipation of service reductions. These effects were much more prevalent and severe in projects which could realistically be expected to suffer budget cuts as a result of the shift in funding method. Despite the widespread anxiety, low morale and adverse effects reported by program directors, there was no reduction in the number of patients served, the scope of services offered, or the number of staff employed.
Director, Platform and Audience.
Meyer, Richard D.
The open stage is discussed both as architecture and as part of a new theatrical style. In reference to use of the open stage, emphasis is given to specifics with which the director must deal, to special problems of the actor, to the approach to blocking a play, and to the open stage as "theatrical experience". The architectural advantage of the…
Emotional intelligence model for directors of research centers in mexico
Directory of Open Access Journals (Sweden)
Mara Maricela Trujillo Flores
2008-01-01
H5 Social skills exhibited by directors, that are also part of interpersonal intelligence, allow a director to exert a greater influence on the working group, facilitating communication, conflict management, leadership, collaboration, cooperation and development of team skills.
7 CFR 27.11 - Area Director, Marketing Services Office; responsibility.
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Area Director, Marketing Services Office... MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE COMMODITY... Regulations Administration § 27.11 Area Director, Marketing Services Office; responsibility. Subject to this...
19 CFR 146.2 - Port director as Board representative.
2010-04-01
...; DEPARTMENT OF THE TREASURY (CONTINUED) FOREIGN TRADE ZONES General Provisions § 146.2 Port director as Board representative. The appropriate port director shall be in charge of the zone as the representative of the Board. [T.D. 86-16, 51 FR 5049, Feb. 11, 1986, as amended by T.D. 99-27, 64 FR 13676, Mar. 22, 1999] ...
1975-01-01
At a special session on 21 March, presided over by P. Levaux, the Council of the European Organization for Nuclear Research appointed J . B. Adams and L . Van Hove as Directors General of the Organization for a period of five years beginning 1 January 1976. Dr. Adams will be responsible for the administration of CERN, for the operation of the equipment and services and for the construction of buildings and major equipment. Professor Van Hove will be responsible for the research activities of the Organization.
Directory of Open Access Journals (Sweden)
Yunling Song
2013-06-01
Full Text Available In the Chinese securities market, with its characteristics of influence through personal relationships (Guanxi and underdeveloped standards of law and enforcement, can independent directors play the supervisory role expected by securities regulators? In this study we use the degree of precision and accuracy in corporate earnings forecasts as proxies for the quality of information disclosure by listed companies and examine the supervisory efficiency of independent directors with respect to information disclosure. Using data from 2007 to 2009, we find that in the absence of ownership balance, independent directors have a significant positive effect on the accuracy of management forecasts. In addition, the personal backgrounds of independent directors have specific effects on management earnings forecasts. Directors with certified public accountant (CPA expertise significantly improve the precision of management forecasts. However, directors with industrial expertise significantly reduce the precision of management forecasts. In other words, having directors with CPA expertise improves the independence of boards, but having independent directors with industrial expertise has the opposite effect.
[Administration of the "Healthy School" project].
Bjegović, V; Zivković, M; Marinković, J; Vuković, D; Legetić, B
1996-01-01
, the level of personal influence on different aspects of Project development and overall work motivation and satisfaction of all participants. (c) The outcomes of the given management attempts were analyzed by the following output variables: the number of different types of meetings held, the number of seminars, mass media presentation and articles, the amount of money raised and the number of questionnaires administered. Triangular method was used to gather the data: (1) direct observation, (2) four types of questionnaires and (3) project reports and documentation. Four types of specially designed questionnaires were used to examine four groups of participants (Project Coordinators, School Project Managers, Directors and Project Co-operators). The questionnaires were different in the questions concerning examinees' project tasks and types of external communication, while the questions referring to personal characteristics, general features of the project (goals, common jobs, participation in decision making, motivation and satisfaction) were the same for all groups. The average age of the project participants was 45.50 ranging from 25 to 60 years of age. The oldest group was the group of School Directors, while the youngest were School Co-operators. The project has been run mostly by women, while men were predominantly represented in the group of School Directors. The teaching occupation is presented by 61.8%, the rest being health professionals, mostly of preventive orientation. The analysis and classification of participants goals verify that the personal goals of all participants correspond with the main Project goals. Certain groups have also some additional motives which support their successful and affective movement towards the overall Project goals. The largest problem in all groups appear to be in the field of financing the Project activities (Figure 1). (ABSTRACT TRUNCATED)
A practitioner’s research: Director remuneration in Ukraine
Directory of Open Access Journals (Sweden)
Alexander N. Kostyuk
2006-07-01
Full Text Available Remuneration of members of the supervisory boards in Ukrainian joint-stock companies is the most controversial issue of the corporate board practices. Despite the firm belief of the shareholders that the director remuneration is one of the most important factors influencing the board performance, there are still many companies (21 per cent where directors are not remunerated for their work on the supervisory board. This report examines practices of the director’s remuneration in Ukraine.
Regional Director | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
... its effective utilization in the design and execution of the IDRC strategic plan. ... Provides assistance to Program Managers/Leaders, Directors of Program Areas, ... the Partnership and Business Development Division and Programs Branch.
Rahim-Jamal, Sherin; Quail, Patrick; Bhaloo, Tajudaullah
2010-01-01
To develop a national role description for medical directors in long-term care (LTC) based on role functions drawn from the literature and the LTC industry. A questionnaire about the role functions identified from the literature was mailed or e-mailed to randomly selected medical directors, directors of care or nursing (DOCs), and administrators in LTC facilities. Long-term care facilities in Canada randomly selected from regional clusters. Medical directors, DOCs, and administrators in LTC facilities; a national advisory group of medical directors from the Long Term Care Medical Directors Association of Canada; and a volunteer group of medical directors. Respondents were asked to indicate, from the list of identified functions, 1) whether medical directors spent any time on each activity; 2) whether medical directors should spend time on each activity; and 3) if medical directors should spend time on an activity, whether the activity was "essential" or "desirable." An overall response rate of 37% was obtained. At least 80% of the respondents from all 3 groups (medical directors, DOCs, and administrators) highlighted 24 functions they deemed to be "essential" or "desirable," which were then included in the role description. In addition, the advisory group expanded the role description to include 5 additional responsibilities from the remaining 18 functions originally identified. A volunteer group of medical directors confirmed the resulting role description. The role description developed as a result of this study brings clarity to the medical director's role in Canadian LTC facilities; the functions outlined are considered important for medical directors to undertake. The role description could be a useful tool in negotiations pertaining to time commitment and expectations of a medical director and fair compensation for services rendered.
7 CFR 2.92 - Director, Office of Human Resources Management.
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Director, Office of Human Resources Management. 2.92... Secretary for Administration § 2.92 Director, Office of Human Resources Management. (a) Delegations... Human Resources Management: (1) Formulate and issue Department policy, standards, rules and regulations...
The Managerial Roles of Academic Library Directors: The Mintzberg Model.
Moskowitz, Michael Ann
1986-01-01
A study based on a model developed by Henry Mintzberg examined the internal and external managerial roles of 126 New England college and university library directors. Survey results indicate that the 97 responding directors were primarily involved with internal managerial roles and work contacts. (CDD)
Directory of Open Access Journals (Sweden)
Adiane Conceição de Oliveira
2010-05-01
Full Text Available In the presente work, the Director Plan of Rio das Ostras, Rio de Janeiro, Brazil, and the Management Plan of a municipal Conservation Unit (CU named Birds Natural Park were investigated aiming at detecting possible territorial management conflicts, as well as pointing out potential of using these two regulations as tools for improving life quality and for developing sustainable local strategies. The study allowed for the inference of the need to review not only the Director Plans of mediumsized cities, but also the Managements Plans of the Conservation Units (CUs. Furthermore, Director Plans must be consistent in terms of articles and objectives, detailing sustainable projects for CUs by means of action plans, chronograms for the implementation of ecological corridors, and use and occupation of CUs buffer zone criteria.
Female directors and real activities manipulation: Evidence from China
Directory of Open Access Journals (Sweden)
Jin-hui Luo
2017-06-01
Full Text Available Unlike previous studies that focus on accrual-based earnings management, this study analyzes real activities manipulation and investigates whether female directors on boards of directors (BoDs affect managers’ real activities manipulation. Using a large sample of 11,831 firm-year observations from Chinese listed companies from the 2000 to 2011 period, we find that higher female participation on BoDs is associated with lower levels of real activities manipulation, and that this negative relationship is stronger when female directors have higher ownership. These results hold for a battery of robustness checks. Overall, our findings indicate that board gender diversity may serve as a substitute mechanism for corporate governance to curb real activities manipulation and thus provide interested stakeholders with higher quality earnings reports.
Pandemic Influenza Preparedness Among Child Care Center Directors in 2008 and 2016.
Shope, Timothy R; Walker, Benjamin H; Aird, Laura D; Southward, Linda; McCown, John S; Martin, Judith M
2017-06-01
Children in child care centers represent an important population to consider in attempts to mitigate the spread of an influenza pandemic. This national survey, conducted in 2008 and 2016, assessed directors' reports of their child care centers' pandemic influenza preparation before and after the 2009 H1N1 novel influenza pandemic. This was a telephone-based survey of child care center directors randomly selected from a national database of licensed US child care centers who were queried about their preparedness for pandemic influenza. We grouped conceptually related items in 6 domains into indexes: general infection control, communication, seasonal influenza control, use of health consultants, quality of child care, and perceived barriers. These indexes, along with other center and director characteristics, were used to predict pandemic influenza preparedness. Among 1500 and 518 child care center directors surveyed in 2008 and 2016, respectively, preparation for pandemic influenza was low and did not improve. Only 7% of directors had taken concrete actions to prepare their centers. Having served as a center director during the 2009 influenza pandemic did not influence preparedness. After adjusting for covariates, child care health consultation and years of director's experience were positively associated with pandemic influenza preparation, whereas experiencing perceived barriers such as lack of knowing what to do in the event of pandemic influenza, was negatively associated with pandemic influenza preparedness. Pandemic influenza preparedness of child care center's directors needs to improve. Child care health consultants are likely to be important collaborators in addressing this problem. Copyright © 2017 by the American Academy of Pediatrics.
Nguyen, Hung D.; Steele, Gynelle C.
2015-01-01
This report is intended to help NASA program and project managers incorporate Small Business Innovation Research/Small Business Technology Transfer (SBIR/STTR) technologies that have gone through Phase II of the SBIR program into NASA Aeronautics and Mission Directorate (ARMD) programs. Other Government and commercial program managers can also find this information useful.
Fermilab Education Office - Director's Award
Search The Director's Award Exceptional Service To Fermilab's K-12 Education Programs The many successes of Fermilab's K-12 education programs depend on the talents of the over 200 employees, users, and $1,000, made possible by an anonymous donor to Fermilab Friends for Science Education, recognizes one
76 FR 58303 - Regular Board of Directors Meeting; Sunshine Act
2011-09-20
..., Washington, DC 20005. STATUS: Open. CONTACT PERSON FOR MORE INFORMATION: Erica Hall, Assistant Corporate... Directors Minutes III. Approval of the Special Board of Directors Minutes IV. Approval of the Corporate Administration Committee Minutes V. Approval of the Finance, Budget and Program Committee Minutes VI. Approval of...
17 CFR 200.18 - Director of Division of Corporation Finance.
2010-04-01
... Corporation Finance. 200.18 Section 200.18 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... General Organization § 200.18 Director of Division of Corporation Finance. The Director of the Division of Corporation Finance is responsible to the Commission for the administration of all matters (except those...
STS-61 mission director's post-mission report
Newman, Ronald L.
1995-01-01
To ensure the success of the complex Hubble Space Telescope servicing mission, STS-61, NASA established a number of independent review groups to assess management, design, planning, and preparation for the mission. One of the resulting recommendations for mission success was that an overall Mission Director be appointed to coordinate management activities of the Space Shuttle and Hubble programs and to consolidate results of the team reviews and expedite responses to recommendations. This report presents pre-mission events important to the experience base of mission management, with related Mission Director's recommendations following the event(s) to which they apply. All Mission Director's recommendations are presented collectively in an appendix. Other appendixes contain recommendations from the various review groups, including Payload Officers, the JSC Extravehicular Activity (EVA) Section, JSC EVA Management Office, JSC Crew and Thermal Systems Division, and the STS-61 crew itself. This report also lists mission events in chronological order and includes as an appendix a post-mission summary by the lead Payload Deployment and Retrieval System Officer. Recommendations range from those pertaining to specific component use or operating techniques to those for improved management, review, planning, and safety procedures.
Interlocking Corporate Directorates and the Global City Hierarchy
Directory of Open Access Journals (Sweden)
Jeffrey Kentor
2015-08-01
Full Text Available This paper examines the direct and indirect economic linkages of the most prominent cities in the world, those commonly referred to as global cities, in terms of the direct and indirect linkages of the boards of directors of Fortune Global 500 firms headquartered in a given city with boards of directors of other firms. Specifically, we identify the interlocks of corporate boards located within these major cities with other Fortune 500 boards of directors by degrees of separation, and present a new ranking for selected global cities based upon these direct and indirect ties. We find that New York clearly dominates these economic linkages, followed by London and Paris. This is most pronounced for financial companies. Contrary to other global city rankings, we locate Tokyo below Frankfurt and Chicago on this dimension. We argue that these multiple levels of indirect relationships reflect a significant, and until now unexplored, dimension of what it means to be a global city.
Recent Trends in Publications of US and European Directors in Vascular Surgery.
Aurshina, Afsha; Hingorani, Anil; Hingorani, Amrit; Marks, Natalie; Ascher, Enrico
2018-02-24
We hypothesized that there may be significant differences between academic productivity of the vascular training programs in the United States (US) and Europe. In an effort to explore this theory, we reviewed the number of vascular publications listed in PubMed from 2010 to 2015 for US and European directors in vascular surgery. The list of program directors from the Association of Program Directors in Vascular Surgery (APDVS) and the European Union of Medical Specialists (EUMS) were queried for the names of the directors of vascular surgical training programs at the end of 2015. PubMed listed 5,474 citations published from 2010 to 2015. Three thousand five hundred sixty-one were from Europe while 1,912 were from the US. UK and German programs did not list their directors' names in the EUMS website and were thus not included in the European data. The average number of citations in PubMed per program director was 2.36 per year. In Europe, each of the 273 program directors averaged 2.17 publications per year, whereas each of the 114 US program directors averaged 2.80 publications per year (P = 0.37). Journal of Vascular Surgery (JVS) publications made up 24.0% (12.7% in Europe and 45.0% in the US). In the US, the top third produced 69% of the publications and 77% of the JVS publications, whereas in Europe, the top third produced 87% of the publications and 98% of the JVS publications. In the US, 5 program directors (4.4%) had no publications and 21 (18.4%) had no JVS publications. In Europe, 82 program directors (30.0%) had no publications, whereas 180 (65.9%) had no JVS publications. Abstracts were categorized by topic for comparison. In both Europe and the US, the top third produced more than two-thirds of the publications, with the disparity being even more pronounced in Europe where the top third produced almost 90% of the total publications. Comparing the topics of the publications from Europe and the US, it was found that the US program directors published a
Creative director as a leader El director como líder creativo
Directory of Open Access Journals (Sweden)
Paulo Felipe Quintero
2011-12-01
Full Text Available The current organizational dynamic in the world places universities in a relevant role to be performed in the society. Hence, the concept of “creativity” is studied from the hierarchical levels to understand the implications of completing creative processes within an organization. The creativity in the universities require management plans, which demand effort from strategic leaders to materialize and make the mission tangible to all involved actors in the organization; thus, facilitating the achievement of financial quality results, impact on entrepreneurial spirit and optimal labor climate. Subsequently, the creativity could become a strategic topic in the institutional development plans for the directors. This article shows the theoretical construction of the research Creative Abilities of Private Universities Directors in Manizales and the Relation with the Organizational Climate.La dinámica actual de las organizaciones en el mundo, pone a las universidades en unlugar relevante frente al papel que deben desempeñar en la sociedad. En este sentido, seaborda el concepto de “creatividad” tan de moda en el escenario actual, desde los nivelesjerárquicos, con el fin de entender lo que verdaderamente implica llevar a cabo procesoscreativos en una organización. La creatividad en las universidades requiere mucho másque metas en planes de gestión. Exige un esfuerzo de los líderes estratégicos, para quela misión no se quede en el papel y sea tangible para todos los actores involucradosen la empresa, y de esa manera sea el vehículo para lograr resultados de calidad en lofinanciero, impactos en el espíritu empresarial y ambientes de trabajo óptimos, de modoque la creatividad se convierta para los directores en un tema estratégico en los planesde desarrollo institucional para la excelencia en los climas de trabajo. El presente artículoresultó de la construcción teórica del trabajo de investigación
Photovoltaic demonstration projects
Energy Technology Data Exchange (ETDEWEB)
Gillett, W B; Hacker, R J; Kaut, W [eds.
1991-01-01
This book, the proceedings of the fourth PV-Contractors' Meeting organized by the Commission of the European Communities, Directorate-General for Energy, held at Brussels on 21 and 22 November 1989, provides an overview of the photovoltaic demonstration projects which have been supported in the framework of the Energy Demonstration Program since 1983. It includes reports by each of the contractors who submitted proposals in 1983, 1984, 1985 and 1986, describing progress with their projects. Summaries of the discussions held at the meeting, which included contractors whose projects were submitted in 1987, are also presented. The different technologies which are being demonstrated concern the modules, the cabling of the array, structure design, storage strategy and power conditioning. The various applications include desalination, communications, dairy farms, water pumping, and warning systems. Papers have been processed separately for inclusion on the data base.
Discussion with CERN Directorate
CERN. Geneva
2017-01-01
Please note that the Discussion with CERN Directorate will be transmitted also in the following rooms: Council Chamber - 503-1-001 IT Amphitheatre - 31-3-004 Prevessin 774-R-013 Simultaneous interpreting into French and English will be available in the Main Auditorium. Une interprétation simultanée en français et en anglais sera disponible dans l'amphithéâtre principal.
2012-06-07
... and Human Resources Project Monitoring Clearance AGENCY: National Science Foundation. ACTION: Notice...). SUPPLEMENTARY INFORMATION: Title of Collection: Education and Human Resources Project Monitoring Clearance. OMB... States and internationally. The Directorate for Education and Human Resources (EHR), a unit within NSF...
State-Owned Enterprise Director Training: A Review of Canadian Experiences
O'Neill, Michael A.
2015-01-01
This article surveys state-owned enterprise director training programmes in Canada at both the national and provincial levels. In Canada director training programmes have emerged to enable good private-sector corporate governance. This trend has been embraced by governments seeking to improve corporate governance among their state-owned…
27 CFR 28.38 - Action by district director of customs.
2010-04-01
... director of customs. 28.38 Section 28.38 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... of customs. On receipt of the appropriate TTB officer's authorization for destruction of the liquor, or his disapproval of the application for destruction, the district director of customs shall act...
Swanson, Joseph M; Shafeeq, Hira; Hammond, Drayton A; Li, Chenghui; Devlin, John W
2018-03-15
The association among residency program and research mentor characteristics, program director perceptions, and the publication of the primary research project for postgraduate year 2 (PGY2) graduates was assessed. Using a validated electronic survey, residency program directors (RPDs) of critical care PGY2 graduates were asked about primary research project publication success, program and research project mentor characteristics, and RPDs' perceptions surrounding project completion. All 55 RPDs surveyed responded; 44 (79%) reported being a research project mentor. PGY2 research project publications in 2011 and 2012 totaled 26 (37%) and 27 (35%), respectively. A significant relationship existed between research project publication and the number of residents in the program ( p project publication is important to their employer ( p projects versus no publications included the number of graduates in the PGY2 program (odds ratio [OR], 5.6; p project publication (OR, 10.2; p project versus no research projects was also independently associated with the RPD's perception that the employer valued research project publication (OR, 5.1; p = 0.04). A survey of RPDs of critical care PGY2 residents found that the number of PGY2 residents, the number of publications by the least experienced research mentor, and the perception that publishing the residents' research projects is important to the employer were independently associated with publication rates of residency research projects. Copyright © 2018 by the American Society of Health-System Pharmacists, Inc. All rights reserved.
The Astronomy Genealogy Project
Tenn, Joseph S.
2014-01-01
The Astronomy Genealogy Project, to be known as AstroGen, will list as many as possible of the world's astronomers with their academic parents (aka thesis advisors) and enable the reader to trace both academic ancestors and descendants. It will be very similar to the highly successful Mathematics Genealogy Project (MGP), available at http://genealogy.math.ndsu.nodak.edu. The MGP, which has been in operation since 1996, now contains the names of about 170,000 "mathematicians." These include many physicists and astronomers, as well as practitioners of related sciences. Mitchel Keller, the director of the MGP, has generously shared the software used in that project, and the American Astronomical Society (AAS) will host AstroGen, a project of the Historical Astronomy Division, on its website. We expect to start seeking entries soon, depending on the availability of computational assistance from the AAS IT department. We are seeking volunteers to help run the project. If you are interested, please contact me at joe.tenn@sonoma.edu.
27 CFR 26.261 - Action by district director of customs.
2010-04-01
... director of customs. 26.261 Section 26.261 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX... customs. The district director of customs will direct the proper customs gauger to determine the taxable... revenue tax applicable thereto. When the rate of tax applicable to the product has been ascertained, the...
TECHNICAL RISK RATING OF DOE ENVIRONMENTAL PROJECTS - 9153
International Nuclear Information System (INIS)
Cercy, M.; Fayfich, Ronald; Schneider, Steven P.
2008-01-01
The U.S. Department of Energy's Office of Environmental Management (DOE-EM) was established to achieve the safe and compliant disposition of legacy wastes and facilities from defense nuclear applications. The scope of work is diverse, with projects ranging from single acquisitions to collections of projects and operations that span several decades and costs from hundreds of millions to billions US$. The need to be able to manage and understand the technical risks from the project to senior management level has been recognized as an enabler to successfully completing the mission. In 2008, DOE-EM developed the Technical Risk Rating as a new method to assist in managing technical risk based on specific criteria. The Technical Risk Rating, and the criteria used to determine the rating, provides a mechanism to foster open, meaningful communication between the Federal Project Directors and DOE-EM management concerning project technical risks. Four indicators (technical maturity, risk urgency, handling difficulty and resolution path) are used to focus attention on the issues and key aspects related to the risks. Pressing risk issues are brought to the forefront, keeping DOE-EM management informed and engaged such that they fully understand risk impact. Use of the Technical Risk Rating and criteria during reviews provides the Federal Project Directors the opportunity to openly discuss the most significant risks and assists in the management of technical risks across the portfolio of DOE-EM projects. Technical Risk Ratings can be applied to all projects in government and private industry. This paper will present the methodology and criteria for Technical Risk Ratings, and provide specific examples from DOE-EM projects
Selected Publications by the NCI Director
Dr. Norman Sharpless's written work on cancer research appears in many leading scientific journals, as well as a variety of other publications. This page lists some of the articles published by Dr. Sharpless since becoming NCI director.
Conception of personal career as a self-realization project
Tarasova, Julija
2017-01-01
SUMMARY Conception of personal career as a self-realization project. Bachelor work. Relevance: Nowadays career is an important aspect in an individual’s life where the main author of the script, the director and creator is the person who takes responsibility for his/her own life. Modern career management is a life long process, which is more like a self monitored project based on self realisation. A successful career in project management is not only about an individual’s personal qualities, ...
Program directors in their role as leaders of teaching teams in residency training
Slootweg, Irene A.; van der Vleuten, Cees; Heineman, Maas Jan; Scherpbier, Albert; Lombarts, Kiki M. J. M. H.
2014-01-01
Program directors have a formal leading position within a teaching team. It is not clear how program directors fulfill their leadership role in practice. In this interview study we aim to explore the role of the program director as strategic leader, based on the research-question: What are the
Program directors in their role as leaders of teaching teams in residency training
Slootweg, I.A.; Vleuten, C.P.M. van der; Heineman, M.J.; Scherpbier, A.; Lombarts, K.M.
2014-01-01
BACKGROUND: Program directors have a formal leading position within a teaching team. It is not clear how program directors fulfill their leadership role in practice. In this interview study we aim to explore the role of the program director as strategic leader, based on the research-question: What
Systems Engineering Applications for Small Business Innovative Research (SBIR) Projects
2012-09-01
Engineering processes within the SBIR community. Information was collected from multiple organizations throughout the SBIR community to support this research...Force by Program Executive Officers, Technolgy Directorates, Air Logistics Centers and Test Centers. SBIR projects are developed in three phases...found to be associated with SBIR projects and varied among organizations. Thus it became essential to conduct interviews to gather the information
Happell, Brenda; McAllister, Margaret
2014-11-01
There is an ongoing global shortage of mental health nurses. Within Australia, the principal strategy of offering a postgraduate education programme with various incentives to encourage nurses back to study has not been successful. This has led to the consideration of radical alternatives, including the return to pre-registration specialisation in mental health. The successful introduction of this strategy would require the full support of industry partners. To date, the voice of industry has not been heard in relation to this issue. The aim of this paper is to present the views of an Australian sample of mental health nursing directors regarding the resources and other factors required, should undergraduate specialist programmes in mental health be developed, to ensure they are relevant and likely to be successful. A qualitative exploratory research project was undertaken to explore the perspectives and opinions of industry partners. In-depth interviews were conducted with nursing directors (n = 12) in Queensland Australia. Five main themes were identified: relationships with universities; clinical placement preparation and support; workplace culture; facilitators and preceptors; and practical student learning. Genuine collaboration between the two organisations was considered crucial for delivering a quality programme and providing the required support for students. Transformative leadership could inform this collaboration by promoting acknowledgement of and respect for differences.
27 CFR 28.261 - Notice to district director of customs.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Notice to district director of customs. 28.261 Section 28.261 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX... Export § 28.261 Notice to district director of customs. On arrival at the port of exportation, of...
Use of social media by residency program directors for resident selection.
Cain, Jeff; Scott, Doneka R; Smith, Kelly
2010-10-01
Pharmacy residency program directors' attitudes and opinions regarding the use of social media in residency recruitment and selection were studied. A 24-item questionnaire was developed, pilot tested, revised, and sent to 996 residency program directors via SurveyMonkey.com. Demographic, social media usage, and opinions on social media data were collected and analyzed. A total of 454 residency program directors completed the study (response rate, 46.4%). The majority of respondents were women (58.8%), were members of Generation X (75.4%), and worked in a hospital or health system (80%). Most respondents (73%) rated themselves as either nonusers or novice users of social media. Twenty percent indicated that they had viewed a pharmacy residency applicant's social media information. More than half (52%) had encountered e-professionalism issues, including questionable photos and posts revealing unprofessional attitudes, and 89% strongly agreed or agreed that information voluntarily published online was fair game for judgments on character, attitudes, and professionalism. Only 4% of respondents had reviewed applicants' profiles for residency selection decisions. Of those respondents, 52% indicated that the content had no effect on resident selection. Over half of residency program directors were unsure whether they will use social media information for future residency selection decisions. Residency program directors from different generations had different views regarding social media information and its use in residency applicant selections. Residency program directors anticipated using social media information to aid in future decisions for resident selection and hiring.
75 FR 17037 - Federal Home Loan Bank Directors' Eligibility, Elections, Compensation and Expenses
2010-04-05
... determined by a resolution adopted by the board of directors of the Bank and subject to the provisions of... 2590-AA03, 2590-AA31 and 2590-AA34 Federal Home Loan Bank Directors' Eligibility, Elections... that implements two separate proposed rules, which relate to Federal Home Loan Bank (Bank) director...
Laurent Guiraud
2001-01-01
CERN Director-General Luciano Maiani (second from the right) with Mrs Maiani in front of the tunnelling machine to excavate the 1 kilometre decay tunnel producing neutrinos for the CERN Neutrinos to Gran Sasso (CNGS) project. A beam of neutrinos will be produced at CERN by colliding a proton beam with a graphite target and manipulating the decay products. This beam will then travel 730 km to Gran Sasso, Italy where huge detectors will be used to study the phenomenon of neutrino oscillation.
Directors' report and accounts 1991-1992
International Nuclear Information System (INIS)
1993-01-01
This report for Scottish Hydro-Electric PLC contains details of key financial statistics, the financial calendar, the Directors' Report, the Auditors' Report, accounting policies, a Group Profit and Loss Account, balance sheets and a Group Cash Flow Statement. (UK)
The risk-adjusted performance of companies with female directors: A South African case
Directory of Open Access Journals (Sweden)
Mkhethwa Mkhize
2013-04-01
Full Text Available The objective of this research was to examine the effects of female directors on the risk-adjusted performance of firms listed on the JSE Securities Exchange of South Africa (the JSE. The theoretical underpinning for the relationship between representation of female directors and the risk-adjusted performance of companies was based on institutional theory. The hypothesis that there is no difference between the risk-adjusted performance of companies with female directors and that of companies without female directors was rejected. Implications of the results are discussed and suggestions for future research presented.
The MedAustron project: an example of large-scale technology transfer
Antonella Del Rosso & Michael Benedikt
2013-01-01
In January this year, CERN’s Director-General Rolf Heuer handed over the first ion source to the MedAustron therapy centre in the town of Wiener Neustadt in the presence of the Austrian authorities. This milestone marks the beginning of the transition from the development and design phase to the commissioning of the new facility. Handover of the ion source to MedAustron on 11 January, 2013. From left to right: Michael Benedikt (Project Leader MedAustron at CERN), Karlheinz Töchterle (Austrian Federal Minister of Science and Research), Erwin Pröll (Governor of Lower Austria), Rolf Heuer (Director-General CERN), Klaus Schneeberger (Lower Austrian State Parliament, Head of EBG MedAustron Council). The goal of the MedAustron project is the construction of an ion-therapy and research centre, based on a synchrotron accelerator complex, in Austria (for more about the technical part of the MedAustron project, click here). “MedAustron will be the first large-sca...
Resource Planning and Management: Job One for Software Project Managers
2011-05-01
negotiation based on mutual understanding of and belief i th j t t t i lAcceptancen e pro ec managemen r ang e – Project leaders need to communicate...Directorate for Information Operations and Reports, 1215 Jefferson Davis Highway, Suite 1204, Arlington VA 22202-4302. Respondents should be aware that...puts the figure at $1.22 T (even more zeros) Constant barrage of project doom and gloom Optimize tomorrow today.TM …. Reasons for Project
Directors' report and accounts 1990-1991
International Nuclear Information System (INIS)
1992-01-01
The Director's Report and accounts for Scottish Hydro-Electric PLC are presented for the period 1990-91. Details are given of the accounting policies, profit and loss account, balance sheet, source and application of funds and abridged current cost information. (UK)
The function of a medical director in healthcare institutions: a master or a servant.
Kossaify, Antoine; Rasputin, Boris; Lahoud, Jean Claude
2013-01-01
The function of a medical director is presented along with features of efficiency and deficiencies from the perspective of healthcare system improvement. A MEDLINE/Pubmed research was performed using the terms "medical director" and "director", and 50 relevant articles were selected. Institutional healthcare quality is closely related to the medical director efficiency and deficiency, and a critical discussion of his or her function is presented along with a focus on the institutional policies, protocols, and procedures. The relationship between the medical director and the executive director is essential in order to implement a successful healthcare program, particularly in private facilities. Issues related to professionalism, fairness, medical records, quality of care, patient satisfaction, medical teaching, and malpractice are discussed from the perspective of institutional development and improvement strategies. In summary, the medical director must be a servant to the institutional constitution and to his or her job description; when his or her function is fully implemented, he or she may represent a local health governor or master, ensuring supervision and improvement of the institutional healthcare system.
Power in the role of the medical director: what it is and how to get more.
Gabel, Stewart
2011-05-01
The formal leadership of mental health care organizations commonly resides in an executive director, who may or may not have had clinical training. The medical director is a psychiatrist who reports to the executive director. For some, this arrangement suggests that the medical director lacks or has lost power in the organization. This paper examines more specifically the types of power available to the medical director using French & Raven (1959) and Raven (2008) bases of power framework. The executive director/medical director relationship can be thought of as a relationship between individuals holding formal and informal power, respectively. Although medical directors lack formal or positional power, they potentially have and can gain more informal power based on their recognized clinical/medical expertise, their personal presence and an assertive involvement and focus on the organizational mission.
12 CFR 905.10 - Board of Directors.
2010-01-01
... the five directors may belong to the same political party. (2) Responsibilities. The Board of..., functioning and organization of the Finance Board; (iii) Ensuring effective coordination and communication...
76 FR 72220 - Board of Directors Audit Committee Meeting; Sunshine Act
2011-11-22
... NEIGHBORHOOD REINVESTMENT CORPORATION Board of Directors Audit Committee Meeting; Sunshine Act... Director III. Executive Session Related to Pending Litigation IV. Internal Audit Report with Management's Response V. FY '12 Risk Assessment and Internal Audit Plan VI. FY '12 EHLP Risk Assessment and Internal...
From the Director: The Joy of Science, the Courage of Research
... Past Issues From the Director From the Director: The Joy of Science, the Courage of Research Past Issues / Fall 2007 Table ... probably the best scientific policy ever put forward. The greatest risk in science is to stop taking risks. When you take ...
A proto-code of ethics and conduct for European nurse directors.
Stievano, Alessandro; De Marinis, Maria Grazia; Kelly, Denise; Filkins, Jacqueline; Meyenburg-Altwarg, Iris; Petrangeli, Mauro; Tschudin, Verena
2012-03-01
The proto-code of ethics and conduct for European nurse directors was developed as a strategic and dynamic document for nurse managers in Europe. It invites critical dialogue, reflective thinking about different situations, and the development of specific codes of ethics and conduct by nursing associations in different countries. The term proto-code is used for this document so that specifically country-orientated or organization-based and practical codes can be developed from it to guide professionals in more particular or situation-explicit reflection and values. The proto-code of ethics and conduct for European nurse directors was designed and developed by the European Nurse Directors Association's (ENDA) advisory team. This article gives short explanations of the code' s preamble and two main parts: Nurse directors' ethical basis, and Principles of professional practice, which is divided into six specific points: competence, care, safety, staff, life-long learning and multi-sectorial working.
Board of directors and risk management
van der Elst, C.F.; Birkmose, H.; Neville, M.; Sorensen, K.
2013-01-01
The board of directors is responsible for an appropriate business risk management environment. The paper studies in a comparative way how legislators and courts fill this duty. We question whether the legislative and regulatory framework will improve the equilibrium between entrepreneurship and risk
Postdoctoral periodontal program directors' perspectives of resident selection.
Khan, Saba; Carmosino, Andrew J; Yuan, Judy Chia-Chun; Lucchiari, Newton; Kawar, Nadia; Sukotjo, Cortino
2015-02-01
Applications for postdoctoral periodontal programs have recently increased. The National Board Dental Examinations (NBDE) has adopted a pass/fail format. The purpose of this study is to examine the criteria used by accredited postdoctoral periodontal programs in the United States to evaluate potential applicants. A secondary purpose was to determine whether the absence of NBDE scores would change program directors' selection process. Basic demographic information of the program directors was also collected. A questionnaire was sent to all 54 program directors of accredited postdoctoral periodontal programs in the United States. The raw data were compiled, descriptive analyses were performed, and results were tabulated and ranked when applicable. Thirty-five of 54 program directors (64.8%) responded to the survey. The five most important factors in selecting residents were: 1) interview ratings; 2) dental school clinical grades; 3) dental school periodontics grades; 4) personal statement; and 5) letters of recommendation. The majority of the programs (94%; n = 33) require an interview, and many (86%; n = 30) have a committee that makes the final decision on candidate acceptance. More than half of the respondents (56%; n = 17) stated that the pass/fail format of the NBDE would affect the decision-making process. This study describes the criteria used by postdoctoral periodontal programs to help select applicants. Interview ratings, dental school grades, personal statements, and letters of recommendation were found to be the most important factors. Results from this study may be helpful for prospective postdoctoral periodontal program applicants in the United States.
Kennedy, Kriss J.; Toup, Larry; Gill, Tracy; Tri, Terry; Howe, Scott; Smitherman, David
2011-01-01
This paper gives an overview of the National Aeronautics and Space Administration (NASA) led multi-center Habitat Demonstration Unit (HDU) project leadership and management strategies being used by the NASA HDU team for a rapid prototyping project. The HDU project team constructed and tested an analog prototype lunar surface habitat/laboratory called the Pressurized Excursion Module (PEM) during 2010. The prototype unit subsystems were integrated in a short amount of time, utilizing a tiger team rapid prototyping approach that brought together over 20 habitation-related technologies and innovations from a variety of NASA centers. This paper describes the leadership and management strategies as well as lessons learned pertaining to leading and managing a multi-center diverse team in a rapid prototype environment. The PEM configuration went from a paper design to an operational surface habitat demonstration unit in less than 12 months. The HDU project is part of the strategic plan from the Exploration Systems Mission Directorate (ESMD) Directorate Integration Office (DIO) and the Exploration Mission Systems Office (EMSO) to test destination elements in analog environments. The 2011 HDU-Deep Space Habitat (DSH) configuration will build upon the PEM work, and emphasize validity of crew operations (remote working and living), EVA operations, mission operations, logistics operations, and science operations that might be required in a deep space context for Near Earth Object (NEO) exploration mission architectures. The 2011 HDU-DSH will be field-tested during the 2011 Desert Research and Technologies Studies (DRaTS) field tests. The HDU project is a "technology-pull" project that integrates technologies and innovations from multiple NASA centers. This project will repurpose the HDU 2010 demo unit that was field tested in the 2010 DRaTS, adding habitation functionality to the prototype unit. This paper will describe the strategy of establishing a multi-center project
Novel Round Energy Director for Use with Servo-driven Ultrasonic Welder
Savitski, Alex; Klinstein, Leo; Holt, Kenneth
Increasingly stringent process repeatability and precision of assembly requirements are common for high-volume manufacturing for electronic, automotive and especially medical device industries, in which components for disposable medication delivery devices are produced in hundreds of millions annually. Ultrasonic welding, one of the most efficient of plastic welding processes often joins these small plastic parts together, and quite possibly, the one most broadly adopted for high volume assembly. The very fundamental factor in ultrasonic welding process performance is a proper joint design, the most common of which is a design utilizing an energy director. Keeping the energy director size and shape consistent on a part-to-part basis in high volume, multi-cavity operations presents a constant challenge to molded part vendors, as dimensional variations from cavity to cavity and variations in the molding process are always present. A newly developed concept of energy director design, when the tip of the energy director is round, addresses these problems, as the round energy director is significantly easier to mold and maintain its dimensional consistency. It also eliminates a major source of process variability for assembly operations. Materializing the benefits of new type of joint design became possible with the introduction of servo-driven ultrasonic welders, which allow an unprecedented control of material flow during the welding cycle and results in significantly improved process repeatability. This article summarizes results of recent studies focused on evaluating performance of round energy director and investigating the main factors responsible for the joint quality.
Burnout and distress among internal medicine program directors: results of a national survey.
West, Colin P; Halvorsen, Andrew J; Swenson, Sara L; McDonald, Furman S
2013-08-01
Physician burnout and distress has been described in national studies of practicing physicians, internal medicine (IM) residents, IM clerkship directors, and medical school deans. However, no comparable national data exist for IM residency program directors. To assess burnout and distress among IM residency program directors, and to evaluate relationships of distress with personal and program characteristics and perceptions regarding implementation and consequences of Accreditation Council for Graduate Medical Education (ACGME) regulations. The 2010 Association of Program Directors in Internal Medicine (APDIM) Annual Survey, developed by the APDIM Survey Committee, was sent in August 2010 to the 377 program directors with APDIM membership, representing 99.0 % of the 381 United States categorical IM residency programs. The 2010 APDIM Annual Survey included validated items on well-being and distress, including questions addressing quality of life, satisfaction with work-life balance, and burnout. Questions addressing personal and program characteristics and perceptions regarding implementation and consequences of ACGME regulations were also included. Of 377 eligible program directors, 282 (74.8 %) completed surveys. Among respondents, 12.4 % and 28.8 % rated their quality of life and satisfaction with work-life balance negatively, respectively. Also, 27.0 % reported emotional exhaustion, 10.4 % reported depersonalization, and 28.7 % reported overall burnout. These rates were lower than those reported previously in national studies of medical students, IM residents, practicing physicians, IM clerkship directors, and medical school deans. Aspects of distress were more common among younger program directors, women, and those reporting greater weekly work hours. Work-home conflicts were common and associated with all domains of distress, especially if not resolved in a manner effectively balancing work and home responsibilities. Associations with program characteristics
2002-01-01
Dr Robert Aymar, Director of the International Thermonuclear Experimental Reactor (ITER), was nominated to succeed Professor Luciano Maiani as CERN's Director General, to take office on 1 January 2004.
78 FR 54925 - Audit Committee Meeting of The Board of Directors; Sunshine Act Meeting
2013-09-06
... NEIGHBORHOOD REINVESTMENT CORPORATION Audit Committee Meeting of The Board of Directors; Sunshine.... Executive Session With Internal Audit Director III. Title Change of the Internal Audit Director IV. Executive Session With Officers: Pending Litigation V. FY14 Risk Assessment & Internal Audit Plan VI...
Elective time during dermatology residency: A survey of residents and program directors.
Uppal, Pushpinder; Shantharam, Rohini; Kaufmann, Tara Lynn
2017-12-15
Elective time during residency training provides residents with exposure to different subspecialties. This opportunity gives residents the chance tonurture growth in particular areas of interest and broaden their knowledge base in certain topics in dermatology by having the chance to work withexperts in the field. The purpose of this study was to assess the views of residency program directors and dermatology residents on the value of elective time through a cross sectional survey. An eight-questionIRB exempt survey was sent out to 113 residency program directors via email through the American Professors of Dermatology (APD) program director listserv. Program directors were asked to forward a separate set of 9 questions to their residents. The majority of programs that responded allowed for some elective time within their schedule, often duringthe PGY 4 (3rd year of dermatology training), but the amount of time allowed widely varied among many residency programs. Overall, residents and program directors agree that elective is important in residencytraining, but no standardization is established across programs.
Where Is the Next Rose Director?
John Blundell
2013-01-01
Rose Friedman (née Director), the Chicago-trained economist, was a very important contributor to Milton Friedman’s scholarly output, popular writings, and television series. His remarkable role in society was to a significant extent a joint role from which she cannot be separated.
5 CFR 2638.506 - Director's recommendation.
2010-01-01
... of the respondent employee's agency that appropriate disciplinary action be taken. If the respondent..., thereafter, will provide appropriate notice of the disciplinary action taken. (c) Notice of noncompliance. If the Director determines that the head of an agency has not taken appropriate disciplinary action...
VMware vCloud Director essentials
Pal, Lipika
2014-01-01
If you are a technical professional with system administration knowledge, then this book is for you. The book also covers areas of importance if you are a virtualization engineer, consultant, architect, senior system engineer, or senior system analyst. You should possess core vSphere platform knowledge necessary to serve as a base to learn vCloud Director and its associated components.
32 CFR Appendix D to Part 247 - AFIS Print Media Directorate
2010-07-01
... for word processing or desktop publishing. All other PMD publications should be requisitioned through... Directorate (PMD), an element of AFIS, develops, publishes, and distributes a variety of print media products.../defenselink/afis/. B. Use of materials published by print media directorate. With the exception of copyrighted...
12 CFR 1261.11 - Conflict-of-interests policy for Bank directors.
2010-01-01
... parent, sibling, spouse, child, or dependent, or any relative sharing the same residence as the director..., property, or relationship that involves receiving or providing something of monetary value, and includes... whom a director has a business relationship, including, but not limited to: (i) Any corporation or...
17 CFR 200.20b - Director of Division of Investment Management.
2010-04-01
... Investment Management. 200.20b Section 200.20b Commodity and Securities Exchanges SECURITIES AND EXCHANGE... General Organization § 200.20b Director of Division of Investment Management. The Director of the Division of Investment Management is responsible to the Commission for the administration of the Commission's...
Project Selection for NASA's R&D Programs
Jones, Harry
2005-01-01
The purpose of NASA s Research and Development (R&D) programs is to provide advanced human support technologies for the Exploration Systems Mission Directorate (ESMD). The new technologies must be sufficiently attractive and proven to be selectable for future missions. This requires identifying promising candidate technologies and advancing them in technology readiness until they are likely options for flight. The R&D programs must select an array of technology development projects, manage them, and either terminate or continue them, so as to maximize the delivered number of potentially usable advanced human support technologies. This paper proposes an effective project selection methodology to help manage NASA R&D project portfolios.
45 CFR 1700.5 - Executive Director.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Executive Director. 1700.5 Section 1700.5 Public Welfare Regulations Relating to Public Welfare (Continued) NATIONAL COMMISSION ON LIBRARIES AND..., recommendation and implementation of overall plans and policies to achieve the Commission's goals. (d) To...
Women on the corporate board of directors and corporate sustainability disclosure
Directory of Open Access Journals (Sweden)
Emeldah M. Modiba
2017-09-01
Full Text Available This research examined whether an improved participation of women in the board of directors has any relationship with sustainability disclosure. Accordingly, the objective of this research was to examine the relationship between the number of women on the board of directors and social investment disclosure and energy disclosure in the sample of companies. The paper used a quantitative approach and data were collected from the archives of sustainability reports of five companies that formed the sample. The panel-data regression analysis was used in data arrangement. Five sample of companies over five years produced a (5 x 5 panel resulting in 25 observations. Data was tested at an alpha of 0.05. Results from all the analysis showed a P value below the research alpha (P < 0,05 indicating a significant relationship. Therefore, findings from the panel-data regression analysis disclosed a positive relationship between the number of women on the board of directors and corporate disclosure on social investment and energy consumption. Further analysis also disclosed that women on the board of directors are related with the overall number of women employees in the company. The paper concludes that within the sample of companies, women on the board of directors may influence sustainability disclosure such as energy and social investment. Women on the board of directors might also assist the companies to achieve gender equity employment goals. The research recommends that given the unique social and environmental proclivity of women, the corporate should recruit more women in the boards to enhance accelerated corporate sustainability performance. Further research using expanded number of companies is recommended.
CERN Bulletin
2015-01-01
On 2 March 2015, Mónica Bello will take the reins of the Arts@CERN programme. A few days before taking over the new job, the curator and art critic talked to the CERN Bulletin about her interest in arts and science, her motivations for the job, and her plans for the future of the programme. Mónica Bello. “The exciting nature of CERN almost demands an artistic programme like Arts@CERN,” says Mónica, former artistic director of VIDA (one of the most important competitions in digital and new media arts worldwide), who has recently been appointed as the new director of the Arts@CERN programme. “The programme is unique as it provides the artist not only with resources, but also with interesting scientific topics and a natural way for the artists to become involved. Thanks to this programme, artists can come to CERN, bring their individuality, and really benefit from the sharing experience with scientists.” Mónica,...
22 CFR 67.2 - Board of Directors.
2010-04-01
..., Washington, DC 20005-5000. (b) All major policy and funding decisions are made by the Board of Directors. The primary statement of NED's operating philosophy, general principles and priorities is contained in the...
The untold stories of film directors: Hollywood’s depiction as metacinematic mythmaking
Chinita, Fátima
2017-01-01
In the Hollywood metafilm, from the Studio System period to the present day, only a few film directors have been tackled on screen. Also, whereas the biopic of Hollywood stars is usually simply a “rags to riches” tale and/or vice-versa, the film director biopic is foremost the evidence of an authorial discourse, although presented with some sentiment. In other words, what moves some filmmakers (especially directors) to approach the life and art of their famous peers is a wish to reflect on th...
17 CFR 143.7 - Delegation of authority to the Executive Director.
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Delegation of authority to the... JURISDICTION General Provisions § 143.7 Delegation of authority to the Executive Director. (a) The Commission... Commission employee under the Executive Director's supervision as he or she may designate, authority to take...
75 FR 44271 - Office of the Director; Notice of Closed Meeting
2010-07-28
... 20892. Contact Person: Lawrence A. Tabak, PhD, DDS, Acting Director, Division of Program Coordination..., Building 31, Room 2C39, Bethesda, MD 20892, 301- 496-3571, lawrence[email protected] . This notice is being.... Dated: July 22, 2010. Jennifer Spaeth, Director, Office of Federal Advisory Committee Policy. [FR Doc...
JRC/IE support activities to PHARE nuclear safety programmes. Dissemination of PHARE project results
International Nuclear Information System (INIS)
Ranguelova, V.; Pla, P.; Rieg, C.; Bieth, M.
2005-01-01
Nuclear safety in Europe is one of European Union's primary concerns, therefore the European Union decided to take a prominent role to help the New Independent States and countries of Central and Eastern Europe to ensure the safety of their nuclear reactors. The European Union TACIS and PHARE programmes in nuclear safety have been undertaken since 1990. The European Commission's Directorate General External Relations (EC DG RELEX) and, Directorate General Europe Aid Co-operation Office (EC DG AIDCO), are responsible for programming and management of implementation of TACIS projects. Directorate General Enlargement (EC DG ELARG) is responsible for programming PHARE programmes, but implementation of most projects has been decentralised since 1999 budget year to the Beneficiary countries. DG ELARG acts as backstopping for the relevant EC Delegations. In these activities, the TSSTP Unit at the JRC/IE in Petten, The Netherlands, is a technical and scientific adviser of DG RELEX and DG AIDCO and provides support to DG ELARG for very specific technical issues. Several PHARE projects aiming at improving nuclear safety have been successfully implemented for a number of plants from Central and Eastern Europe. In some cases major safety issues have been addressed by means of multi-country projects and results have been disseminated to the rest of the nuclear community. Although a lot of information has been exchanged at a bilateral level, further effort is needed to collect the project results in a systematic way and make them available by means of the internet. At present the TSSTP Unit is implementing two projects for dissemination of PHARE project results. This activity will take a better advantage of today's communication technologies and ensure the management of the acquired knowledge through preservation and user-friendly access and retrieval of the project results. The paper provides an outline of the TSSTP Unit relevant knowledge preservation initiative, a description
Mergers and acquisitions: director and consultant liability exposure.
Waxman, J M
1995-02-01
Corporate directors and their consultants must make decisions in an uncertain and changing health care environment. The losses each may face as a result of an incomplete analysis of the true value of the entities involved in mergers or acquisitions may extend beyond the failure of the transaction to the creation of personal liability as well. Accordingly, objective, careful, detailed, and fair decision-making based upon adequate information is more critical than ever for directors if they are to be able to take advantage of the business judgment rule, and also for consultants to avoid their own liability when transactions fail to deliver the values they have estimated.
50 CFR 18.91 - Director's decision.
2010-10-01
... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Director's decision. 18.91 Section 18.91...) TAKING, POSSESSION, TRANSPORTATION, SALE, PURCHASE, BARTER, EXPORTATION, AND IMPORTATION OF WILDLIFE AND... decision. (a) Upon receipt of the recommended decision and transcript and after the thirty-day period for...
36 CFR 51.8 - Where will the Director publish the notice of availability of the prospectus?
2010-07-01
... Award Procedures § 51.8 Where will the Director publish the notice of availability of the prospectus? The Director will publish notice of the availability of the prospectus at least once in the Commerce... Director may also publish notices, if determined appropriate by the Director, electronically or in local or...
The Role of Board of Directors in the Establishment of Risk Management Committee
Directory of Open Access Journals (Sweden)
Ishak Suhaimi
2017-01-01
Full Text Available The objective of the study is to discuss the roles of board of directors in the establishment of risk management committee for Malaysian’s public listed companies. In Malaysia, based on the Malaysian Code on Corporate Governance (MCCG, (2007; 2012 clearly stated the role and responsibility of the board of directors toward the risk management activities. At the Corporate Governance Week 2010 and 2011 as well, the chairman of the Security Commission Malaysia highlighted the responsibility of the board of directors in risk management processes and she expressed concern over the failure of the board of directors to establish appropriate measures for the risk management process in the company. The statement of the chairman of Security Commission Malaysia is in line with MCCG’s best practices (2000; 2007; 2012, i.e., the board of directors should identify principle risks and ensure the implementation of an appropriate system to manage these risks.
Gender differences in salary of internal medicine residency directors: a national survey.
Willett, Lisa L; Halvorsen, Andrew J; McDonald, Furman S; Chaudhry, Saima I; Arora, Vineet M
2015-06-01
Whether salary disparities exist between men and women in medical education leadership roles is not known. The study objective was to determine whether salary disparities exist between male and female Internal Medicine residency program directors, and if so, to identify factors associated with the disparities and explore historical trends. The annual Association of Program Directors in Internal Medicine (APDIM) survey in August 2012 included items to assess the salary and demographic characteristics of program directors, which were merged with publically available program data. To assess historical trends, we used similarly obtained survey data from 2008 to 2011. The study included program directors of 370 APDIM member programs, representing 95.6% of the 387 accredited Internal Medicine training programs in the United States and Puerto Rico. Of the 370 APDIM member programs, 241 (65.1%) completed the survey, of whom 169 (70.1%) were men and 72 (29.9%) were women. Program directors' total annual salary, measured in $25,000 increments, ranged from $75,000 or less to more than $400,000. Historical trends of mode salary by gender from 2008 to 2012 were assessed. The mode salary was $200,000 to 225,000 for men and $175,000 to $200,000 for women (P = .0005). After controlling for academic rank, career in general internal medicine, and program director age, the distribution of salary remained different by gender (P = .004). Historical trends show that the difference in mode salary has persisted since 2008. Leaders in academic medical centers, residency and fellowship directors, and all faculty in medical education need to be aware that salary disparities cited decades ago persist in this sample of medical educators. Closing the gender gap will require continued advocacy for measuring and reporting salary gaps, and changing the culture of academic medical centers. Copyright © 2015 Alliance for Academic Internal Medicine. Published by Elsevier Inc. All rights reserved.
Jean-Claude Gadmer
2013-01-01
29 August 2013 - Director Variable Energy Cyclotron Centre, India D. Srivastava signing the guest book with CERN Director-General R. Heuer. Coordinator of India-ALICE Collaboration T. Nayak present throughout.
International Nuclear Information System (INIS)
Peng, Chenhui; Turiv, Taras; Guo, Yubing; Shiyanovskii, Sergij V; Wei, Qi-Huo; Lavrentovich, Oleg D; Zhang, Rui; De Pablo, Juan
2017-01-01
Placing colloidal particles in predesigned sites represents a major challenge of the current state-of-the-art colloidal science. Nematic liquid crystals with spatially varying director patterns represent a promising approach to achieve a well-controlled placement of colloidal particles thanks to the elastic forces between the particles and the surrounding landscape of molecular orientation. Here we demonstrate how the spatially varying director field can be used to control placement of non-spherical particles of boomerang shape. The boomerang colloids create director distortions of a dipolar symmetry. When a boomerang particle is placed in a periodic splay-bend director pattern, it migrates towards the region of a maximum bend. The behavior is contrasted to that one of spherical particles with normal surface anchoring, which also produce dipolar director distortions, but prefer to compartmentalize into the regions with a maximum splay. The splay-bend periodic landscape thus allows one to spatially separate these two types of particles. By exploring overdamped dynamics of the colloids, we determine elastic driving forces responsible for the preferential placement. Control of colloidal locations through patterned molecular orientation can be explored for future applications in microfluidic, lab on a chip, sensing and sorting devices. (paper)
Peng, Chenhui; Turiv, Taras; Zhang, Rui; Guo, Yubing; Shiyanovskii, Sergij V.; Wei, Qi-Huo; de Pablo, Juan; Lavrentovich, Oleg D.
2017-01-01
Placing colloidal particles in predesigned sites represents a major challenge of the current state-of-the-art colloidal science. Nematic liquid crystals with spatially varying director patterns represent a promising approach to achieve a well-controlled placement of colloidal particles thanks to the elastic forces between the particles and the surrounding landscape of molecular orientation. Here we demonstrate how the spatially varying director field can be used to control placement of non-spherical particles of boomerang shape. The boomerang colloids create director distortions of a dipolar symmetry. When a boomerang particle is placed in a periodic splay-bend director pattern, it migrates towards the region of a maximum bend. The behavior is contrasted to that one of spherical particles with normal surface anchoring, which also produce dipolar director distortions, but prefer to compartmentalize into the regions with a maximum splay. The splay-bend periodic landscape thus allows one to spatially separate these two types of particles. By exploring overdamped dynamics of the colloids, we determine elastic driving forces responsible for the preferential placement. Control of colloidal locations through patterned molecular orientation can be explored for future applications in microfluidic, lab on a chip, sensing and sorting devices.
31 CFR 401.3 - Authority of District Directors of Customs to hold in custody.
2010-07-01
....3 Authority of District Directors of Customs to hold in custody. District Directors of Customs are... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Authority of District Directors of Customs to hold in custody. 401.3 Section 401.3 Money and Finance: Treasury Regulations Relating to Money...
Governance of the International Linear Collider Project
Energy Technology Data Exchange (ETDEWEB)
Foster, B.; /Oxford U.; Barish, B.; /Caltech; Delahaye, J.P.; /CERN; Dosselli, U.; /INFN, Padua; Elsen, E.; /DESY; Harrison, M.; /Brookhaven; Mnich, J.; /DESY; Paterson, J.M.; /SLAC; Richard, F.; /Orsay, LAL; Stapnes, S.; /CERN; Suzuki, A.; /KEK, Tsukuba; Wormser, G.; /Orsay, LAL; Yamada, S.; /KEK, Tsukuba
2012-05-31
Governance models for the International Linear Collider Project are examined in the light of experience from similar international projects around the world. Recommendations for one path which could be followed to realize the ILC successfully are outlined. The International Linear Collider (ILC) is a unique endeavour in particle physics; fully international from the outset, it has no 'host laboratory' to provide infrastructure and support. The realization of this project therefore presents unique challenges, in scientific, technical and political arenas. This document outlines the main questions that need to be answered if the ILC is to become a reality. It describes the methodology used to harness the wisdom displayed and lessons learned from current and previous large international projects. From this basis, it suggests both general principles and outlines a specific model to realize the ILC. It recognizes that there is no unique model for such a laboratory and that there are often several solutions to a particular problem. Nevertheless it proposes concrete solutions that the authors believe are currently the best choices in order to stimulate discussion and catalyze proposals as to how to bring the ILC project to fruition. The ILC Laboratory would be set up by international treaty and be governed by a strong Council to whom a Director General and an associated Directorate would report. Council would empower the Director General to give strong management to the project. It would take its decisions in a timely manner, giving appropriate weight to the financial contributions of the member states. The ILC Laboratory would be set up for a fixed term, capable of extension by agreement of all the partners. The construction of the machine would be based on a Work Breakdown Structure and value engineering and would have a common cash fund sufficiently large to allow the management flexibility to optimize the project's construction. Appropriate contingency
Female Directors and Firm Performance: Evidence from UK Listed Firms
Pasaribu, Pananda
2017-01-01
The impact of female directors on firm performance has lacked consistency in the previously conducted empirical studies, which may be due to the endogeneity problem, or certain characteristics (i.e. governance, industry, competition). This study examines the relationship between female directors and firm performance by addressing those problems. This study analyses all non-financial UK listed firms during the period 2004-2012 and employs several econometric models. The regression results indi...
Financial performance and remuneration of executive directors of brazilian
Directory of Open Access Journals (Sweden)
Larissa Degenhart
2017-09-01
Full Text Available This study aimed to examine whether there is a relationship between financial performance and the remuneration of executive directors of Brazilian companies. Thus, there was a descriptive, documentary and quantitative research. The review period was the years 2011 to 2015. The study population consisted of Brazilian companies listed on the BM&FBovespa and the sample consisted of companies that presented all the variables used in each year surveyed, totaling 219 companies. For the data analysis was conducted to Spearman correlation analysis and linear regression, and was performed using the SPSS statistical software. From the study results it was found that the variables: Total Asset Profitability (ROA and company size had a significant and positive relationship with the fixed remuneration, variable and total executive directors. These results showed for the analyzed scenario, the compensation of executive officers is higher when the ROA is high and also in relation to the company size, large companies pay their executives more than smaller companies. Finally, it can be concluded that there is a relationship between financial performance and Fixed Compensation, and Variable Total executive directors of Brazilian companies listed on the BM&FBovespa. In addition, this research contributes to the understanding of the amounts paid to executive officers, demonstrating that the performance of companies reflected in the remuneration of the executive directors, so that they act in the company in order to raise the economic and financial results.
Beleaguered Egypt project running out of funds and time.
1992-01-01
Started in 1979 as part of the International Planned Parenthood Federation (IPPF), the Family of the Future (FOF) social marketing project accounts for 35% of all contraceptives used in Egypt. FOF left the IPPF in 1981 to work as a nonprofit, semiprivate organization under the supervision of Egypt's Ministry of Health and has become the third largest social marketing project in the world. FOF has, however, gone through 5 executive directors in the last 6 years, prompting critics to think that the Board of Directors is hand-picked by the Egyptian Ministry of Health. additional allegations of financial mismanagement have caused the U.S. Agency for International Development (USAID) to cancel over $1.5 million in annual funding and product support for the program. Until recently, FOF has benefited from products and operations and technical assistance totalling near $20 million as part of a USAID 10-year, $118-million Egyptian effort. FOF has responded to the funding cut by downsizing its staff and preparing to raise contraceptive prices. Even though USAID has solicited proposals for competitive replacement programs, the new executive director is optimistic that funding cuts leading to organizational change and price increases will ultimately help FOF become self-sufficient. Once USAID-provided supplies have been depleted, FOF will most likely turn to IPPF for assistance.
Does skin in the game matter?: director incentives and governance in the mutual fund industry
Cremers, M.; Driessen, J.; Maenhout, P.; Weinbaum, D.
2009-01-01
We use a unique database on ownership stakes of equity mutual fund directors to analyze whether the directors' incentive structure is related to fund performance. Ownership of both independent and nonindependent directors plays an economically and statistically significant role. Funds in which
75 FR 39266 - National Protection and Programs Directorate; National Infrastructure Advisory Council
2010-07-08
... Infrastructure Disruptions VII. New Business VIII. Closing Remarks IX. Adjournment Procedural While this meeting... Directorate; National Infrastructure Advisory Council AGENCY: National Protection and Programs Directorate... Infrastructure Advisory Council (NIAC) will meet on Tuesday, July 13, 2010, at the National Press Club's Ballroom...
31 CFR 10.1 - Director of the Office of Professional Responsibility.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Director of the Office of Professional Responsibility. 10.1 Section 10.1 Money and Finance: Treasury Office of the Secretary of the Treasury PRACTICE BEFORE THE INTERNAL REVENUE SERVICE Rules Governing Authority to Practice § 10.1 Director of the Office of Professional Responsibility. ...
Directors' report and accounts for the year ended 31 March 1993
International Nuclear Information System (INIS)
1993-01-01
The report of the Directors of Scottish Power for 1992/1993 is presented, and accounting policies, group profit and loss account, balance sheets and group cash flow statement are given. Notes concerning the accounts are included. The report of the Auditors is also presented, and the names of the directors, secretaries and advisors, and shareholder information is listed. (UK)
Influence of Surface Geometry of Grating Substrate on Director in Nematic Liquid Crystal Cell
International Nuclear Information System (INIS)
Ye Wenjiang; Xing Hongyu; Yang Guochen; Zhang Zhidong; Sun Yubao; Chen Guoying; Xuan Li
2011-01-01
The director in nematic liquid crystal cell with a weak anchoring grating substrate and a strong anchoring planar substrate is relative to the coordinates x and z. The influence of the surface geometry of the grating substrate in the cell on the director profile is numerically simulated using the two-dimensional finite-difference iterative method under the condition of one elastic constant approximation and zero driven voltage. The deepness of groove and the cell gap affect the distribution of director. For the relatively shallow groove and the relatively thick cell gap, the director is only dependent on the coordinate z. For the relatively deep groove and the relatively thin cell gap, the director must be dependent on the two coordinates x and z because of the increased elastic strain energy induced by the grating surface. (condensed matter: structural, mechanical, and thermal properties)
IAEA Director General to Visit Iran
International Nuclear Information System (INIS)
2013-01-01
Full text: IAEA Director General Yukiya Amano will travel to Tehran on 10 November 2013 to meet senior Iranian leaders on Monday, 11 November 2013, with the aim of strengthening dialogue and cooperation. Separately, as previously announced, IAEA and Iranian experts will meet in Tehran on Monday to discuss technical issues. IAEA)
Leader in Digital Transformation: Director, Information Management ...
International Development Research Centre (IDRC) Digital Library (Canada)
As the Deputy Chief Information Officer, the Director is also accountable for developing ... operations and maintenance of key business systems (financial applications, ... Plays a key role in the control of access to personal information in e-mail ...
Wanted: Fermilab director who can build consensus
Pierce, G M
2004-01-01
"With current Fermilab Director Michael Witherell stepping down in July 2005, an appointed committee has vowed to find a new leader who will keep the Batavia lab at the forefront of the high-energy physics field" (1 page).
Getting the best value from refurb projects.
Dimitrijevic, Branka
2013-04-01
Professor Branka Dimitrijevic, director of CIC Start Online, a project funded by the Scottish Government and European Regional Development Fund combining the resources of seven Scottish universities that aims to embed sustainable building design and refurbishment into practice, reports on a conference jointly staged in Glasgow recently by the organisation and Health Facilities Scotland that considered this topical issue in some depth.
Vickers, John; Fikes, John
2015-01-01
The Advance Manufacturing Technology (AMT) Project supports multiple activities within the Administration's National Manufacturing Initiative. A key component of the Initiative is the Advanced Manufacturing National Program Office (AMNPO), which includes participation from all federal agencies involved in U.S. manufacturing. In support of the AMNPO the AMT Project supports building and Growing the National Network for Manufacturing Innovation through a public-private partnership designed to help the industrial community accelerate manufacturing innovation. Integration with other projects/programs and partnerships: STMD (Space Technology Mission Directorate), HEOMD, other Centers; Industry, Academia; OGA's (e.g., DOD, DOE, DOC, USDA, NASA, NSF); Office of Science and Technology Policy, NIST Advanced Manufacturing Program Office; Generate insight within NASA and cross-agency for technology development priorities and investments. Technology Infusion Plan: PC; Potential customer infusion (TDM, HEOMD, SMD, OGA, Industry); Leverage; Collaborate with other Agencies, Industry and Academia; NASA roadmap. Initiatives include: Advanced Near Net Shape Technology Integrally Stiffened Cylinder Process Development (launch vehicles, sounding rockets); Materials Genome; Low Cost Upper Stage-Class Propulsion; Additive Construction with Mobile Emplacement (ACME); National Center for Advanced Manufacturing.
Case management directors: how to manage in a transition-focused world: part 2.
Bankston White, Cheri; Birmingham, Jackie
2015-01-01
Case management directors are in a dynamic position to affect the transition of care of patients across the continuum, work with all levels of providers, and support the financial well-being of a hospital. Most importantly, they can drive good patient outcomes. Although the position is critical on many different levels, there is little to help guide a new director in attending to all the "moving parts" of such a complex role.This is Part 2 of a two-part article written for case management directors, particularly new ones.Part 1 covered the first 4 of 7 tracks: (1) Staffing and Human Resources, (2) Compliance and Accreditation, (3) Discharge Planning and (4) Utilization Review and Revenue Cycle. Part 2 addresses (5) Internal Departmental Relationships (Organizational), (6) External Relationships (Community Agency), and (7) Quality and Program Outcomes.This article attempts to answer the following questions: : The information is most meaningful to those case management directors who work in either stand-alone hospitals or integrated health systems and have frontline case managers (CMs) reporting to them. Part 1 found that case management directors would benefit from further research and documentation of "best practices" related to their role, particularly in the areas of leadership and management. The same conclusion applies to Part 2, which addresses the director's responsibilities outside her immediate department. Leadership and management skills apply as well to building strong, productive relationships across a broad spectrum of external organizations that include payer, provider, and regulatory agencies. At the same time, they must also develop the skills to positively influence the revenue cycle and financial health of both the organization for which they work and those to whom they transition patients. A director of case management with responsibility for transitions of care has more power and influence over patient safety than is commonly known. Few of the
Case management directors: how to manage in a transition-focused world: part 1.
Bankston-White, Cheri; Birmingham, Jackie
2015-01-01
Case management directors are in a dynamic position to affect the transition of care for patients across the continuum, work with all levels of providers, and support the financial well-being of a hospital. Most importantly, they can drive good patient outcomes. Although the position is critical on many different levels, there is little to help guide a new director in attending to all the "moving parts" of such a complex role. The purpose of this two-part article is to provide case management directors, particularly new ones, with a framework for understanding and fulfilling their role.We have divided the guide into seven tracks of responsibility. Part 1 discusses the first four tracks: (1) staffing and human resources, (2) compliance and accreditation, (3) discharge planning, and (4) utilization review and revenue cycle. Part 2 addresses (5) internal departmental relationships (organizational), (6) external relationships (Community agency), and (7) quality and program outcomes. The information is most meaningful to those case management directors who work in either stand-alone hospitals or integrated health systems, and have frontline case managers reporting to them. Case management directors would benefit from further research and documentation of "best practices" related to their role, particularly in the areas of leadership and management. New directors would benefit from mentoring and networking with one another. As new regulations and models of care bring increased emphasis and focus to transitions of care, the role of the case management director continues to evolve, growing in importance and complexity. The growing financial impact of readmissions also brings added scrutiny and increased pressure to get the transitions of care right the first time.To operate most effectively, case management directors must understand the full range of their responsibilities and impact. They must find opportunities for themselves and their departments to learn and stay
OTA director to be Clinton's science advisor
Leath, Audrey
President Clinton has nominated John H. “Jack” Gibbons to be Assistant to the President for Science and Technology, and director of the White House Office of Science and Technology Policy (OSTP). For over a decade, Gibbons has served as director of the Office of Technology Assessment (OTA), a bipartisan research arm of Congress.In nominating Gibbons, Clinton said, “I am delighted to appoint a brilliant scientist and gifted administrator… It is profoundly important that the president have a science advisor who understands science, who understands technology, who understands the practical application of these disciplines to the myriad of problems we face today. And I can tell you that from [Vice-president] Al Gore on down to every other member of Congress I have discussed John Gibbons with, I have hardly ever received more glowing and more consistent recommendations for anyone.”
Directory of Open Access Journals (Sweden)
Feng Wei
2017-12-01
Full Text Available Taking Chinese listed companies in 2008–2015 as the sample, in this paper we test in detail the impact of female directors on corporate environmental investments. Furthermore, we study the impact of female directors on environmental investment in enterprises with different types of ownership and industry attributes. Empirical studies show that when there are only 1 or 2 female directors on the board, no significant impact on the scale of corporate environmental investment can be seen. However, when the number reaches at least 3, female directors have a significantly positive impact on the scale of corporate environmental investment. This confirms critical-mass theory; meanwhile, we find that the empirical results do not indicate any significant correlation when the variable of female directors is measured by the proportion of female directors and the Blau index of gender balance. Further analysis suggests that in state-owned enterprises and enterprises from heavily-polluting industries, the above findings remain true, while in non-state-owned enterprises and enterprises from non-heavily-polluting industries, the above findings prove false, i.e., that the impact of female directors on corporate environmental investment is not significant. The conclusion demonstrates that the impact of female directors on environmental investment varies in enterprises with different types of ownership and industry attributes.
Sweet, David B; Vasilias, Jerry; Clough, Lynn; Davis, Felicia; McDonald, Furman S; Reynolds, Eileen E; O'Malley, Cheryl W; Hinchey, Kevin T; Kirk, Lynne M; Gersoff, Andrew S; Clyburn, E Benjamin; Frohna, John G
2014-09-01
The Internal Medicine Educational Innovations Project (EIP) is a 10-year pilot project for innovating in accreditation, which involves annual reporting of information and less-restrictive requirements for a group of high-performing programs. The EIP program directors' experiences offer insight into the benefits and challenges of innovative approaches to accreditation as the Accreditation Council for Graduate Medical Education transitions to the Next Accreditation System. We assessed participating program directors' perceptions of the EIP at the midpoint of the project's 10-year life span. We conducted telephone interviews with 15 of 18 current EIP programs (83% response rate) using a 19-item, open-ended, structured survey. Emerging themes were identified with content analysis. Respondents identified a number of the benefits from the EIP, most prominent among them, collaboration between programs (87%, 13 of 15) and culture change around quality improvement (47%, 7 of 15). The greatest benefit for residents was training in quality improvement methods (53%, 8 of 15), enhancing those residents' ability to become change agents in their future careers. Although the requirement for annual data reporting was identified by 60% (9 of 15) of program directors as the biggest challenge, respondents also considered it an important element for achieving progress on innovations. Program directors unanimously reported their ability to sustain innovation projects beyond the 10-year participation in EIP. The work of EIP was not viewed as "more work," but as "different work," which created a new mindset of continuous quality improvement in residency training. Lessons learned offer insight into the value of collaboration and opportunities to use accreditation to foster innovation.
Wolfe, Jean; Bauer, Jeff; Bixby, C.J.; Lauderdale, Todd; Shively, Jay; Griner, James; Hayhurst, Kelly
2010-01-01
Topics discussed include: Aeronautics Research Mission Directorate Integrated Systems Research Program (ISRP) and UAS Integration in the NAS Project; UAS Integration into the NAS Project; Separation Assurance and Collision Avoidance; Pilot Aircraft Interface Objectives/Rationale; Communication; Certification; and Integrated Tests and Evaluations.
El-Jardali, Fadi; Merhi, Mirvat; Jamal, Diana; Dumit, Nuhad; Mouro, Gladys
2009-05-01
Assess nurse retention challenges and strategies as perceived by nursing directors in Lebanese hospitals. The Kampala Health Workforce Declaration stressed the importance of retaining an effective, responsive and equitably distributed health workforce, particularly nurses. Little is known about nurse retention challenges and strategies in Lebanon. Nursing directors of 76 hospitals participated and were sent a two-page survey on perceived retention challenges and hospital-based retention strategies. Retention challenges included unsatisfactory salary, unsuitable shifts and working hours, as well as better opportunities in other areas within or outside Lebanon. Retention strategies included implementing financial rewards and benefits, a salary scale, staff development, praise and improving work environment. Nursing directors did not address all perceived challenges in their strategies. To better manage the nursing workforce, nursing directors should regularly measure and monitor nurse turnover rates and also their causes and predictors. Nursing directors should develop, implement and evaluate retention strategies. More information is needed on the management and leadership capacities of nursing directors in addition to their span of control. Nursing directors are facing challenges in retaining their nurses. If these problems are not addressed, Lebanon will continue to lose competent and skilled nurses.
Decree-Law No. 189/93 of 24 May establishing the General Directorate for the Environment
International Nuclear Information System (INIS)
1993-01-01
This Decree-Law sets up a General Directorate for the Environment with the Ministry for the Environment and Natural Resources. The Protection and Nuclear Safety Bureau-GPSN which had first been transferred from the Ministry of Industry, has now been merged with other Directorates into this new General Directorate for the Environment. The tasks of this Directorate include assessing and examining the radiological impact of nuclear and radioactive installations, including radioactive waste management and the safety of nuclear installations. (NEA)
49 CFR 1.63 - Delegations to Assistant to the Secretary and Director of Public Affairs.
2010-10-01
... Director of Public Affairs. 1.63 Section 1.63 Transportation Office of the Secretary of Transportation... and Director of Public Affairs. The Assistant to the Secretary and Director of Public Affairs is delegated authority to: (a) [Reserved] (b) Monitor the overall public information program and review and...
Emotional inteligence model for directors of research centers in Mexico
Directory of Open Access Journals (Sweden)
Mara Maricela Trujillo Flores
2008-01-01
Full Text Available El objetivo de este trabajo es mostrar resultados del modelo IE-Martruj, concebido para la medición de la inteligencia emocional de directores de centros de investigación; fue aplicado a cuarenta y tres directores de centros de investigación en México. El proceso de validación y confiabilidad del modelo es descrito en detalle, así como su formulación matemática. Como resultado de esta investigación, se muestra como conclusión general que: El modelo estudiado es un instrumento apropiado para la tarea propuesta, y que la Inteligencia Emocional (IE de los directores de centros de investigación en México está asociada positivamente con la motivación, la capacidad de autoevaluación, la autorregulación, la empatía y las habilidades sociales. Así mismo, se sometieron a prueba, con resultados positivos, las siguientes hipótesis: H1 - La motivación, iniciativa, optimismo e involucramiento son condiciones que se hallan correlacionadas positivamente con la efectividad del funcionamiento de los directores de centros de investigación. H2 - El autoconocimiento, la conciencia emocional, la auto evaluación precisa y la autoconciencia están positivamente correlacionados entre ellas y son parte esencial de la inteligencia intrapersonal. H3 - La autorregulación exhibida por los directores, su autocontrol, adaptabilidad y autoconciencia están positivamente correlacionados entre sí y también son parte de la inteligencia intrapersonal. H4 - La empatía, la comprensión de los demás, el desarrollo de las competencias de los subordinados, la inclinación al servicio, el manejo de la diversidad y la congruencia política están positivamente correlacionados entre sí y son parte de la inteligencia interpersonal. H5 - Las habilidades sociales de los directores, que también integran la inteligencia interpersonal, les permiten tener mayor influencia sobre el equipo de trabajo,expresada en mayor comunicación, mejor manejo de situaciones
Craig Reynolds, Ph.D., to Retire as NCI Associate Director for Frederick | Poster
On December 2, Craig Reynolds, Ph.D., director, Office of Scientific Operations, and NCI associate director for Frederick, will put the finishing touches on a 37-year career with the National Cancer Institute.
An interview with the Director-General
James Gillies
2012-01-01
At its March meeting, the Council took the step of extending Rolf Heuer’s mandate until the end of 2015. What can we expect from the extra two years? Extensions to Director-General’s mandates are few and far between, with the last being for Herwig Schopper, who served an eight-year term in the 1980s. For Rolf Heuer, the proposal was raised by the Belgian delegation, so we asked delegate Walter Van Doninck why the Council felt that circumstances warranted an extension now. “We felt that the LHC's first long shutdown needed management continuity, given the important nature of the work to be carried out,” he explained. “That’s why we proposed extending the mandate of the current Director-General.” James Gillies spoke to Professor Heuer to find out what he plans to achieve with the extra time. James Gillies: First of all, how do you feel about your time in office so far? Rolf Heuer: I feel I’m about midwa...
Independent Directors and Stakeholders Protection: A Case of Sime Darby
Prashanth Beleya; Gopalan Raman; Charles Ramendren; Suresh Nodeson
2012-01-01
In today’s ever challenging corporate environment, the unfortunate events of decision making by top management has led major companies to suffer huge losses. This results and mistakes made have given a significant impact to the stake holder’s perception and raise a serious questions on the role of board of directors especially the role of independent directors. In today’s fast evolving business pace with stiff economic conditions, unethical and misjudgment in business decisions are driving th...
Quality Improvement in Otolaryngology Residency: Survey of Program Directors.
Bowe, Sarah N
2016-02-01
The Clinical Learning Environment Review focuses on the responsibility of the sponsoring institution for quality and patient safety. Very little information is known regarding the status of quality improvement (QI) education during otolaryngology training. The purpose of this survey is to evaluate the extent of resident and faculty participation in QI and identify opportunities for both resident curriculum and faculty development. Cross-sectional survey A 15-item survey was distributed to all 106 otolaryngology program directors. The survey was developed after an informal review of the literature regarding education in QI and patient safety. Questions were directed at the format and content of the QI curriculum, as well as barriers to implementation. There was a 39% response rate. Ninety percent of responding program directors considered education in QI important or very important to a resident's future success. Only 23% of responding programs contained an educational curriculum in QI, and only 33% monitored residents' individual outcome measures. Barriers to implementation of a QI program included inadequate number of faculty with expertise in QI (75%) and competing resident educational demands (90%). Every program director considered morbidity and mortality conferences as an integral component in QI education. Program directors recognize the importance of QI in otolaryngology practice. Unfortunately, this survey identifies a distinct lack of resources in support of these educational goals. The results highlight the need to generate a comprehensive and stepwise approach to QI for faculty development and resident instruction. © American Academy of Otolaryngology—Head and Neck Surgery Foundation 2015.
Bennett Walling, Catherine
2016-01-01
The purpose of this study was to determine whether secondary choral directors employed at international schools implemented a multicultural education in their programs. Participants (N = 126) were secondary choral directors working at international schools in 59 different countries. A researcher-designed questionnaire was used to collect…
Role of independent director in corporate governance – Reference to India
Directory of Open Access Journals (Sweden)
Indrajit Dube
2013-01-01
Full Text Available A company is the common platform of various stakeholders, such as customers, employees, investors, shareholders etc.. It is an instrument that can attract huge capital for doing business. Every transaction in a company should be fair and transparent to its stakeholders. A company having good Corporate Governance and an effective Board of Directors attract investors and ensure investment. Independence of the Board is critical to ensure that the board fulfills its role objectively and holds the management accountable to the company. The practice across jurisdictions indicates that the presence of Independent Director is answer to that. The present write up delves into the current scenario in Indian Corporate Sector and examine the role of Independent Director in Corporate Governance, in particular.
1980-01-01
The ASEAN Population Expert Group met in Manila and was followed by a meeting of the ASEAN heads of population programs, during the period November 5-10, 1979. Heads of population programs from Indonesia, Malaysia, Singapore, Thailand, and the Philippines attended. The meetings were held to review progress-to-date on phase 1 projects and to consider the development of an expanded population program. 5 projects funded by UNFPA are reviewed in tabular form with the project, the sponsoring country, date of implementation, data analysis, and date of completion. Suggestions were made for improving and extending these projects and it was also suggested that all projects being developed and proposed should include a section on use of research. 7 new projects were proposed as phase 2 projects. The 1st, sponsored by Malaysia, deals with women in development; project 2, lead by Thailand, will investigate population movement and its effect on development; project 3, led by the Philippines, will develop and strengthen national population information systems and networks in ASEAN countries; project 4, led by Indonesia, is directed towards institutional development and exchanges of personnel; project 5, led by the Philippines, will examine population and development dynamics and the man/resources balance; project 6, led by Thailand, will develop ASEAN social indicators; and project 7, led by Indonesia and Malaysia, will make a comprehensive analysis of existing medical/health care and family planning systems. It was recommended that an executive director of the proposed ASEAN population coordination unit should be appointed to expedite the recommendations of the meeting related to preparation and submission of phase 2 project proposals.
Program Director Survey: Attitudes Regarding Child Neurology Training and Testing.
Valencia, Ignacio; Feist, Terri B; Gilbert, Donald L
2016-04-01
As a result of major clinical and scientific advances and changes in clinical practice, the role of adult neurology training for Child Neurology and Neurodevelopmental Disability (NDD) certification has become controversial. The most recently approved requirements for board eligibility for child neurology and neurodevelopmental disability residents still include 12 months in adult neurology rotations. The objective of this study was to assess United States child neurology and neurodevelopmental disability residency program directors' opinions regarding optimal residency training. The authors developed an 18-item questionnaire and contacted all 80 child neurology and neurodevelopmental disability program directors via e-mail, using SurveyMonkey. A total of 44 program directors responded (55%), representing programs that train 78 categorical and 94 total resident positions, approximately 70% of those filled in the match. Respondents identified multiple areas where child neurology residents need more training, including genetics and neuromuscular disease. A substantial majority (73%) believed child neurology and neurodevelopmental disability residents need less than 12 adult neurology training months; however, most (75%) also believed adult hospital service and man-power needs (55%) and finances (34%) would pose barriers to reducing adult neurology. Most (70%) believed reductions in adult neurology training should be program flexible. A majority believed the written initial certification examination should be modified with more child neurology and fewer basic neuroscience questions. Nearly all (91%) felt the views of child neurology and neurodevelopmental disability program directors are under-represented within the Accreditation Council for Graduate Medical Education Residency Review Committee. The requirement for 12 adult neurology months for Child Neurology and Neurodevelopmental Disability certification is not consistent with the views of the majority of program
International Nuclear Information System (INIS)
1984-09-01
The document includes 5 attachments: the letter of 9 April 1984 from the President of the Atomic Energy Organization of Iran to the Director General, the letter of 11 May 1984 from the Director General to the President of the Atomic Energy Organization of Iran, the text of the telex of 27 May 1984 from the President of the Atomic Energy Organization of Iran to the Director General, the text of the telex of 28 May 1984 from the Director General to the President of the Atomic Energy Organization of Iran and the text of the telex from 30 May 1984 from the President of the Atomic Energy Organization of Iran to the Director General refering to ''Military attack on Iran's Bushehr Nuclear Power Plant''
Chamberlain, Heather; Samec, Ronald G.; Caton, Daniel Bruce; Van Hamme, Walter
2018-01-01
PY Aqr (GSC 05191-00853) is a solar Type (T ~ 5750K) eclipsing binary. It was observed in July to October, 2017 at Cerro Tololo in remote mode with the 0.6-m SARA South reflector. Two times of minimum light were calculated from our present observations, a primary and a secondary eclipse:HJD Min I = 2457951.7762±0.0006 HJD Min II = 2458019.5295±00.0003. Both weighted as 1.0.In addition, four timings were determined from online data given in IBVS 5600 and five observations at minima were determined from archived All Sky Automated Survey Data:HJD Min I = 2452908.3165, 2452912.33612 HJD Min II = 2452877.5621, 2452913.34465. All weighted as 0.5.ASAS Observations at minima: 2452094.688, 2453478.882, 2453266.576, 2452093.685 and 54729.600. Each weighted as 0.10The following linear and quadratic ephemerides were determined from all available times of minimum light:JD Hel Min I=2452951.7443±0.0008d + 0.402093441±0.000000099 X E {1} JD Hel Min I=2452951.7439±0.0007d + 0.4020912±0.0000007 X E +0.00000000018 ± 0.00000000006 X E2 {2}A BVRI Bessell filtered simultaneous Wilson-Devinney Program (W-D) solution reveals that the system has a mass ratio of ~0.34 and a component temperature difference of only ~40 K. One low luminosity (Tfact ~ 0.94, ~66 degree radius) large cool region of spots was iterated on the primary component in the WD Synthetic Light Curve computations. It appears in the Southern Hemisphere (colatitude 155 degrees). The Roche Lobe fill-out of the binary is ~17%. The inclination is ~86 degrees. An eclipse duration of ~10 minutes was determined for the primary eclipse and the light curve solution. Additional and more detailed information is given in this report.
Maximilien Brice
2010-01-01
CERN-HI-1012325 36, from left to right: WIPO Arbitration and Mediation Center, Global Issues Sector Director E. Wilbers; CERN Adviser, Relations with International Organisations, M. Bona; CMS Collaboration Deputy Spokesperson, University of California Santa Barbara J. Incandela; WIPO Deputy Director General, Global Issues Sector J. C. Wichard; WIPO Director-General F. Gurry; WIPO Executive Director and Chief of Staff, Office of the Director General N. Prasad.
1980 Annual status report: super-SARA
International Nuclear Information System (INIS)
1981-01-01
The essential tasks of the JRC for the SUPERSARA project during 1980 were therefore twofold: 1. Actuation of an international Task Force with which to: a. discuss in depth the test objectives and the relationships between the SSTP and the world mosaic of activities in the field of LWR fuel behaviour; b. establish a consensus test matrix; c. identify and discuss the major technological problems affecting the feasibility of attaining the consensus test objectives, especially for the boil-down SFD tests. A Task Force with these objectives was necessary in order to provide the elements for a Council decision on phase II. 2. Conservation of the rythm of the main contractor (UKAEA-Harwell) and subcontractors for the timely fabrication of loop components and the timely design of those new aspects of the plant necessary for the boil-down SFD tests
The independence paradox : (im)possibilities facing non-executive directors in the Netherlands
Hooghiemstra, Reginald; van Manen, J
The paper adds to our knowledge of what non-executive directors do, knowledge which is still in its infancy. More specifically, it reports the findings of a survey among more than 250 Dutch non-executive directors regarding their roles and limitations. Although the majority agreed that monitoring is
75 FR 14454 - National Protection and Programs Directorate; National Infrastructure Advisory Council
2010-03-25
..., National Infrastructure Advisory Council. [FR Doc. 2010-6633 Filed 3-24-10; 8:45 am] BILLING CODE 9110-9P-P ... Directorate; National Infrastructure Advisory Council AGENCY: National Protection and Programs Directorate... Infrastructure Advisory Council (NIAC) will meet on Tuesday, April 13, 2010, at the National Press Club's...
Athletic Departments' Operating Expenses as a Predictor of Their Directors' Cup Standing
Magner, Amber
2014-01-01
The NACDA Directors' Cup is a competition utilizing an unbiased scoring system that encourages a broad based athletic department as the standard for defining intercollegiate athletic success. Therefore, for NCAA DI athletic administrators the Directors' Cup should be the standard for defining intercollegiate athletic success. The purpose of this…
Arbuckle, Melissa R.; DeGolia, Sallie G.; Esposito, Karin; Miller, Deborah A.; Weinberg, Michael; Brenner, Adam M.
2012-01-01
Objective: The purpose of this study was to characterize associate training director (ATD) positions in psychiatry. Method: An on-line survey was e-mailed in 2009 to all ATDs identified through the American Association of Directors of Psychiatric Residency Training (AADPRT). Survey questions elicited information regarding demographics,…
THE IMPACT OF FEMALE DIRECTORS ON FIRM PERFORMANCE: EVIDENCE FROM INDONESIA
Directory of Open Access Journals (Sweden)
Triana
2017-01-01
Full Text Available This research shows the impact of female directors on firm performance in Indonesia by using as its sample the public companies listed on the Indonesian Stock Exchange (IDX from 2011 until 2015. There were 347 companies, with 1,735 samples observed. This research uses the multiple regression method. The model is a modified model from 9 recent articles published between 2012 and 2015. The empirical result shows that a female director has a positive significant effect on firm performance. The control variables, consisting of leverage, firm size and firm age have negative significance for firm performance. This research is conducted across 9 sectors of industrial classification, which support the International Finance Corporation (IFC in increasing the number of female directors in Indonesia. For managers, this research will promote gender development in the boardroom, female executive training programmes as well as female representation on boards of directors. For regulators, this research may provide a contribution to gender representation in board’s policies, rules and regulations. This research can build awareness of women’s contributions to firms and encourage a greater female presence in the boardroom.
When to fire bad managers: The role of collusion between managment and board of directors.
Beetsma, R.M.W.J.; Peters, H.; Rebers, E.
2000-01-01
We develop a model in which a shareholder hires a director to monitor a manager who faces stochastic firing costs. We study the optimal incentive scheme for the director, allowing for the possibility that the manager bribes the director in order to change his firing intentions. Such collusion may be
Wulfemeyer, K. Tim
A study examined the perceptions about what is and is not ethical behavior in electronic journalism. Subjects, 220 television news directors and 66 radio news directors, responded to a 117-item survey of ethics in electronic journalism. Results indicated that the news directors identified: (1) 10 "acceptable" behaviors, including working…
Directory of Open Access Journals (Sweden)
Margarita Salvador
2009-10-01
Full Text Available
This study aims to discover the extent of public school directors have developed and practiced their social skills, in performing his managerial functions, to plan and propose, based on the results, the training necessary additions to the exercise such leadership reach higher levels of efficiency. The sample was composed of 99 directors of schools of Public Elementary and Secondary Education, in the provinces of Granada and Almeria. The results obtained in this research provide us with reliable knowledge, hitherto non-existent, the profiles that characterize the current directors of schools, in their social and interpersonal skills. A summary of results is as follows: a half of the principals (49% obtained scores that are above the 75 centile, in behavior and social skills assertion b nearly half of the directors in our sample are characterized by implementing social skills, through behavior, where the "self-expression", "say no", "initiate interactions” and “express their anger", are the most relevant components and c the level of the center, the number of students at the school and the old director has made some significant differences.
Key words: Social skills, school directors, managerial function, leadership.
Este estudio pretende conocer, en qué medida los directores escolares de centros públicos tienen desarrolladas y practican las habilidades sociales en el desempeño de sus funciones directivas, con objeto de planificar y proponer, en función de los resultados, los necesarios complementos formativos, para que el ejercicio de dicha función directiva alcance niveles más altos de eficacia. La muestra ha estado compuesta por 99 directores, de Centros Educativos Públicos de Primaria y Secundaria, de las provincias de Granada y Almería. Los resultados obtenidos en esta investigación nos proporcionan un conocimiento fiable, hasta ahora inexistente, sobre los perfiles que caracterizan a los
75 FR 56667 - Facilitating Shareholder Director Nominations
2010-09-16
...', nominees for director. We believe that these rules will benefit shareholders by improving corporate suffrage, the disclosure provided in connection with corporate proxy solicitations, and communication... Communications E. Costs 1. Costs Related to Potential Adverse Effects on Company and Board Performance 2. Costs...
Complexities of Social Capital in Boards of Directors
DEFF Research Database (Denmark)
Sulinska, Iwona Magdalena
and firm performance. Chapter 3 explores social capital of board chair, which has been overlooked in previous studies. It suggests that individual social capital of board chair is as important for organizational performance as social capital of CEO and directors. Therefore, performance effect derives from...... and external networks of social relationships created by board members. Evolution paths are consequently proposed for diversity and strength of external network ties, and for internal network cohesion. In light of the overarching research question, the final chapter summarizes the findings.......The aim of the dissertation is to disentangle complexities of social capital in boards of directors through proposing new theoretical perspectives and methodological approaches. Although extant previous research has discussed various aspects of social capital and its association with numerous...
36 CFR 51.11 - May the Director amend, extend, or cancel a prospectus or solicitation?
2010-07-01
..., extend, or cancel a prospectus or solicitation? 51.11 Section 51.11 Parks, Forests, and Public Property... Procedures § 51.11 May the Director amend, extend, or cancel a prospectus or solicitation? The Director may... cancel a solicitation at any time prior to award of the concession contract if the Director determines in...
25 CFR 1000.52 - What criteria will the Director use to award advance planning grants?
2010-04-01
... 25 Indians 2 2010-04-01 2010-04-01 false What criteria will the Director use to award advance... Planning Grant Funding § 1000.52 What criteria will the Director use to award advance planning grants? Advance planning grants are discretionary and based on need. The Director will use the following criteria...
2011-06-14
... 1974; Department of Homeland Security/National Protection and Programs Directorate--002 Chemical... Homeland Security/National Protection and Programs Directorate--002 Chemical Facility Anti-Terrorism.... 552a, the Department of Homeland Security (DHS)/National Protection and Programs Directorate (NPPD...
Sexual Health Education in Massage Therapy Programs: A Survey of Program Directors
Zamboni, Brian D.; Healey, Dale K.
2016-01-01
Massage therapy program directors completed an online survey to explore sexual education in massage therapy programs. The overall data suggest that program directors are supportive of sexual health education in the training of massage therapists and that such education is integrated into several aspects of their training programs. To enhance…
Operating room nursing directors' influence on anesthesia group operating room productivity.
Masursky, Danielle; Dexter, Franklin; Nussmeier, Nancy A
2008-12-01
Implementation of initiatives to increase anesthesia group productivity depends not just on anesthesia groups, but on operating room (OR) nursing administration. OR nursing directors may encourage organizational change based on the needs of their hospitals and nurses. These changes may differ from those that would increase the anesthesia group's productivity. We assessed reward structures using (A) letters of nomination for the "OR Manager of the Year" award offered annually by the publication OR Manager, and (B) data from a salary/career survey of OR directors by the same publication. (A) There were 164 nomination letters submitted from 2004 through 2007 for 45 nominees. The letters contained n = 2659 full sentences and n = 50,821 words. We systematically created a list of 36 terms related to finance, profit, and productivity. We also analyzed the frequency of use of these terms relative to the use of the 15 most common relationship-oriented terms (e.g., compassion, encourage, mentor, and respect). (B) The salary/career survey's questions relevant to anesthesia group productivity had responses from 303 US OR directors, 97% of whom were nurses. We tested the strength of the relationship between the budget responsibility of the OR nursing director and his or her annual salary. (A) 2.6% of sentences in the nomination letters included at least one term related to profit and productivity (95% confidence interval 2.0%-3.2%). Relationship-oriented terms were 9.0 times more prevalent (95% confidence interval 7.1-11.4). (B) There was statistically significant positive proportionality between the OR nursing director's operational budget (including personnel) and his or her salary (Pearson r = 0.64, P time and OR nursing labor costs. Resulting decisions can differ from those that would increase the productivity (profit) of the anesthesia group. Anesthesia groups need to champion initiatives to increase anesthesia productivity, while being sensitive to institutional
International Nuclear Information System (INIS)
Aparo, M.; Dionisi, M.; Vicini, C.; Zeppa, P.; Frazzoli, F.V.; Remetti, R.; Portale, C.
1989-01-01
Nuclear Material Accountability, supported by Containment and Surveillance measures, is a foundamental means for an effective International Safeguard implemention in nuclear plants. Accountability is based on the verification that difference between a material quantity entering a given material balance and the quantity leaving that area in a given period of time, correspond and the amount of material actually present at the moment of the inspection. In the recent years International Safeguards appealing to the needs of timeliness in detecting diversion and concealing activities, devoted ReD efforts on a new Dynamic Accountability procedures (NRTMA) with particular concern with reprocessing plants. The present paper, which is the result of a research activity carried out in the frame of the Italian Support Programme to IAEA for Safeguards implementation, deals with a feasibility study of a NRTMA system to be applied to the EUREX pilot reprocessing plant. Such a feasibility study was performed by developing a computer program based on simulated plant generated data
Attitudes of experiential education directors regarding tobacco sales in pharmacies in the USA.
Rider, Katherine; Kaya, Hatice; Jha, Vinayak; Hudmon, Karen Suchanek
2016-04-01
Accreditation guidelines in the USA suggest that experiential sites for pharmacy students should demonstrate 'a strong commitment to health promotion and illness prevention'; however, most community pharmacies sell tobacco products. This study aimed to determine the proportion of students rotating through advanced pharmacy practice experience (APPE) sites where tobacco is sold and experiential education directors' perception regarding the sales of tobacco in APPE sites. A brief survey was distributed by mail to experiential education directors at US pharmacy schools. The survey characterized the proportion of students who rotate at practice sites where tobacco is sold, directors' perceptions of tobacco sales in experiential sites, and the number of hours of tobacco education in their pharmacy curricula. Directors (n = 81; 63%) estimated that 69% of students rotate through sites where tobacco is sold. If given the opportunity to choose between two potential sites, where one sells tobacco and the other does not, 40% of directors would be unlikely to choose a site that sold tobacco. With respect to tobacco sales, pharmacy schools are largely noncompliant with guidelines and resolutions of professional organizations. © 2015 Royal Pharmaceutical Society.
The Making of Tomato Red: An Interview with Director Juanita Wilson
Directory of Open Access Journals (Sweden)
Wilson, Juanita
2017-06-01
Full Text Available Juanita Wilson is a Dublin-based Film Director and Writer. In 2008, she was nominated for an Academy Award for her short film, The Door, which went on to win the IFTA Award for Best Short Film. She was awarded the prestigious Katrin Cartlidge Foundation Bursary at the Sarajevo Film Festival in 2009. Juanita’s first feature, As If I Am Not There, adapted from the work by Slavenka Drakulic, won the IFTA Awards for Best Film, Best Director and Best Film Script in 2011. She was selected by Variety as one of the Ten Directors to Watch in 2011. She developed and produced Inside I’m Dancing (2004 and H3 (2001. Juanita’s latest film is Tomato Red, based on the novel by Daniel Woodrell.
Breach of duty: Power of shareholders to ratify directors fraudulent dealings
Directory of Open Access Journals (Sweden)
Anthony O. Nwafor
2014-07-01
Full Text Available Company directors owe duty of loyalty to the company which prohibits them from fraudulent dealings in the course of conducting the affairs of the company. Although the shareholders could, in the exercise of their voting powers, grant relieves to the directors from liabilities arising from a breach of duty that amounts to fraud, the extent and capacity in which the shareholders could exercise such powers is confounded by the elusive attempts by the courts in defining fraud. The paper argues that without a definite meaning ascribed to fraud, the power and capacity in which the shareholders could ratify a breach of duty arising from self-dealing and expropriation of corporate opportunities by directors cannot be predetermined, but that each case would be based on the peculiarities of its own facts.
Foreword by the director of Bohunice NPPs
International Nuclear Information System (INIS)
1998-01-01
In this foreword the director briefly describes activities of the NPP Bohunice in 1997. Main activities were: electric and heat production , the V-1 NPP Gradual Reconstruction Programme, nuclear safety programmes, environment protection, international co-operation as well as national and international public information
Brice, Maximilien
2014-01-01
Ms Wendy Watson-Wright Assistant Director General and Executive Secretary UNESCO Intergovernmental Oceanographic Commission Assistant Director-General for the Natural Sciences Sector ad interim UNESCO
Report to the Director General on the forty-fifth series of SAGSI meetings
International Nuclear Information System (INIS)
1997-11-01
Mr. Graham Andrew chaired the 45th Series of SAGSI Meetings. Seventeen members of SAGSI attended the meeting, which was held in Vienna from 10 to 14 November 1997. The Secretariat was represented by Mr. R. Hooper, Director of the Division of Concepts and Planning, and other senior staff. SAGSI addressed the items on the agenda approved by the Director General, considered its work programme for the next period, and recommended an agenda for the next SAGSI meeting. This report to the Director General was prepared using drafting groups and was approved in plenary
NREL Manager Elected to IREC Board of Directors
Manager Elected to IREC Board of Directors For more information contact: Sarah Holmes Barba, 303 -275-3023 email: Sarah Barba Golden, Colo., May 14, 2001 - David Warner, manager of the Information and
Radiology Architecture Project Primer.
Sze, Raymond W; Hogan, Laurie; Teshima, Satoshi; Davidson, Scott
2017-12-19
The rapid pace of technologic advancement and increasing expectations for patient- and family-friendly environments make it common for radiology leaders to be involved in imaging remodel and construction projects. Most radiologists and business directors lack formal training in architectural and construction processes but are expected to play significant and often leading roles in all phases of an imaging construction project. Avoidable mistakes can result in significant increased costs and scheduling delays; knowledgeable participation and communication can result in a final product that enhances staff workflow and morale and improves patient care and experience. This article presents practical guidelines for preparing for and leading a new imaging architectural and construction project. We share principles derived from the radiology and nonradiology literature and our own experience over the past decade completely remodeling a large pediatric radiology department and building a full-service outpatient imaging center. Copyright © 2017 American College of Radiology. Published by Elsevier Inc. All rights reserved.
The Director as Entrepreneur: Increasing Patron Benefits at a Time of Austerity.
Carrigan, Dennis P.
1993-01-01
Discusses the role of the library director as entrepreneur, defined as one who shifts economic resources from areas of lower productivity to areas of greater yield. The importance of this role during a time of austerity is highlighted, and six examples of directors acting as entrepreneurs are presented. (Contains 12 references.) (KRN)
Annual report of Fusion Research and Development Directorate of JAEA
International Nuclear Information System (INIS)
Kubo, Hirotaka; Hoshino, Katsumichi; Isei, Nobuaki; Nakamura, Hiroo; Sato, Satoshi; Shimada, Katsuhiro; Sugie, Tatsuo
2009-01-01
This annual report provides an overview of major results and progress on research and development (R and D) activities at Fusion Research and Development Directorate of Japan Atomic Energy Agency (JAEA) from April 1, 2007 to March 31, 2008, including those performed in collaboration with other directorates of JAEA, research institutes, and universities. The JT-60U operation regime was extended toward the long sustainment of high normalized beta (β N ) with good confinement (β N =2.6 x 28 s). Effectiveness of real-time control of current profile was demonstrated in high β plasmas. Toroidal momentum diffusivity and the convection velocity were systematically clarified for the first time, and intrinsic rotation due to pressure gradient was discovered. Effects of toroidal rotation and magnetic field ripple on type 1 ELM size and pedestal performance were clarified, and type I ELM control was demonstrated by toroidal rotation control. Variety of inter-machine experiments, such as JT-60U and JET, and domestic collaborations were performed. In theoretical and analytical researches, for the NEXT (Numerical Experiment of Tokamak) project, numerical simulations of a tokamak plasma turbulence progressed and a zonal field generation was investigated. Also, nonlinear MHD simulations found the Alfven resonance effects on the evolution of magnetic islands driven by externally applied perturbations. Integrations of several kinds of element codes progressed in the integrated transport/MHD model, the integrated edge/pedestal model and the integrated SOL/divertor model. In fusion reactor technologies, R and Ds for ITER and fusion DEMO plants have been carried out. For ITER, a steady state operation of the 170GHz gyrotron up to 800 s with 1 MW was demonstrated. Also extracted beam current of the neutral beam injector has been extended to 320 mA at 796 keV. In the ITER Test Blanket Module (TBM), designs and R and Ds on Water and Helium Cooled Solid Breeder TBMs were progressed. For
Maximilien Brice
2013-01-01
4 July 2013- European Commission DG CONNECT Director-General R. Madelin, signing the guest book with CERN Director-General R. Heuer and visiting CMS experimental area with Collaboration Deputy Spokesperson J. Varela.
2011-01-18
... DEPARTMENT OF STATE [Public Notice: 7301] Bureau of Political-Military Affairs: Directorate of..., Managing Director, Directorate of Defense Trade Controls, Bureau of Political- Military Affairs, Department... services to support the design, manufacture and delivery of the Anik G1 Commercial Communication Satellite...
12 CFR 611.210 - Director qualifications and training.
2010-01-01
... periodically updated and provided to the institution's nominating committee. (2) Each Farm Credit institution... advisor who is a financial expert. The financial advisor must report to the board of directors and be free...
Thomas Sinks, Director, Office of the Science Advisor
Biography of the Director of the Office of the Science Advisor which is responsible for is responsible for EPA’s human subject research ethics, scientific integrity, and developing cross-agency science policy guidance.
Pilot project - Promoting protection of the right to housing
DEFF Research Database (Denmark)
This study was undertaken for the European Commission Directorate-General for Employment, Social Affairs & Inclusion as part of the ‘Promoting protection of the right to housing - Homelessness prevention in the context of evictions’ pilot project. The key objectives of the research were: - to pro......This study was undertaken for the European Commission Directorate-General for Employment, Social Affairs & Inclusion as part of the ‘Promoting protection of the right to housing - Homelessness prevention in the context of evictions’ pilot project. The key objectives of the research were......: - to provide an overview and analysis of available data and trends regarding housing evictions between 2010 and 2013 across the 28 EU Member States; - to establish the reasons for and impacts of eviction, in particular the relative importance of eviction as a pathway into homelessness; - to analyse...... the legislative and regulatory framework and the availability, effectiveness and cost-efficiency of measures designed to prevent and tackle evictions and enable early interventions; - to suggest ways to improve data collection and the monitoring of evictions in the Member States, identifying the most important...
Schwed, Alexander C; Lee, Steven L; Salcedo, Edgardo S; Reeves, Mark E; Inaba, Kenji; Sidwell, Richard A; Amersi, Farin; Are, Chandrakanth; Arnell, Tracey D; Damewood, Richard B; Dent, Daniel L; Donahue, Timothy; Gauvin, Jeffrey; Hartranft, Thomas; Jacobsen, Garth R; Jarman, Benjamin T; Melcher, Marc L; Mellinger, John D; Morris, Jon B; Nehler, Mark; Smith, Brian R; Wolfe, Mary; Kaji, Amy H; de Virgilio, Christian
2017-12-01
Previous studies of resident attrition have variably included preliminary residents and likely overestimated categorical resident attrition. Whether program director attitudes affect attrition has been unclear. To determine whether program director attitudes are associated with resident attrition and to measure the categorical resident attrition rate. This multicenter study surveyed 21 US program directors in general surgery about their opinions regarding resident education and attrition. Data on total resident complement, demographic information, and annual attrition were collected from the program directors for the study period of July 1, 2010, to June 30, 2015. The general surgery programs were chosen on the basis of their geographic location, previous collaboration with some coauthors, prior work in surgical education and research, or a program director willing to participate. Only categorical surgical residents were included in the study; thus, program directors were specifically instructed to exclude any preliminary residents in their responses. Five-year attrition rates (2010-2011 to 2014-2015 academic years) as well as first-time pass rates on the General Surgery Qualifying Examination and General Surgery Certifying Examination of the American Board of Surgery (ABS) were collected. High- and low-attrition programs were compared. The 21 programs represented different geographic locations and 12 university-based, 3 university-affiliated, and 6 independent program types. Programs had a median (interquartile range [IQR]) number of 30 (20-48) categorical residents, and few of those residents were women (median [IQR], 12 [5-17]). Overall, 85 of 966 residents (8.8%) left training during the study period: 15 (17.6%) left after postgraduate year 1, 34 (40.0%) after postgraduate year 2, and 36 (42.4%) after postgraduate year 3 or later. Forty-four residents (51.8%) left general surgery for another surgical discipline, 21 (24.7%) transferred to a different surgery
Veltrop, Dennis B.; Molleman, Eric; Hooghiemstra, Reggy B. H.; van Ees, Hans
2017-01-01
In this paper we address how director expertise impacts a director's social status and conformity within the board. Our results, derived from two unique multi-source datasets of peer ratings on director status and conformity of non-executive directors from Dutch organizations, indicate that
12 CFR 1710.11 - Board of directors.
2010-01-01
... DEVELOPMENT SAFETY AND SOUNDNESS CORPORATE GOVERNANCE Corporate Practices and Procedures § 1710.11 Board of... once a calendar quarter to carry out its obligations and duties under applicable laws, rules... of board of directors; proxies not permissible. For the transaction of business, a quorum of the...
Casamassimo, P S; Wilson, S
1999-01-01
This study was performed to assess opinions of program directors and practitioners about the importance and necessary numbers of experiences required by current accreditation standards for training of pediatric dentists. A 32-item questionnaire was sent to all program directors of ADA-accredited postdoctoral pediatric dentistry training programs and to a random sample of 10% of the fellow/active membership of the American Academy of Pediatric Dentistry. An overall response rate of 56% was obtained from the single mailing. Practitioners and program directors differed significantly (P dentistry: initiating and completing a research paper, biostatistics/epidemiology, and practice management. Program directors had little difficulty obtaining required experiences, and program dependence on Medicaid did not negatively affect quality of education. Practitioners and program directors agreed on the importance of most experiences and activities required by current accreditation standards.
Millin, Michael G; Johnson, David E; Schimelpfenig, Tod; Conover, Keith; Sholl, Matthew; Busko, Jonnathan; Alter, Rachael; Smith, Will; Symonds, Jennifer; Taillac, Peter; Hawkins, Seth C
2017-01-01
A disparity exists between the skills needed to manage patients in wilderness EMS environments and the scopes of practice that are traditionally approved by state EMS regulators. In response, the National Association of EMS Physicians Wilderness EMS Committee led a project to define the educational core content supporting scopes of practice of wilderness EMS providers and the conditions when wilderness EMS providers should be required to have medical oversight. Using a Delphi process, a group of experts in wilderness EMS, representing educators, medical directors, and regulators, developed model educational core content. This core content is a foundation for wilderness EMS provider scopes of practice and builds on both the National EMS Education Standards and the National EMS Scope of Practice Model. These experts also identified the conditions when oversight is needed for wilderness EMS providers. By consensus, this group of experts identified the educational core content for four unique levels of wilderness EMS providers: Wilderness Emergency Medical Responder (WEMR), Wilderness Emergency Medical Technician (WEMT), Wilderness Advanced Emergency Medical Technician (WAEMT), and Wilderness Paramedic (WParamedic). These levels include specialized skills and techniques pertinent to the operational environment. The skills and techniques increase in complexity with more advanced certification levels, and address the unique circumstances of providing care to patients in the wilderness environment. Furthermore, this group identified that providers having a defined duty to act should be functioning with medical oversight. This group of experts defined the educational core content supporting the specific scopes of practice that each certification level of wilderness EMS provider should have when providing patient care in the wilderness setting. Wilderness EMS providers are, indeed, providing health care and should thus function within defined scopes of practice and with
Characteristics of the organizational and managerial activity of the fitness club director
Directory of Open Access Journals (Sweden)
Svitlana Stadnyk
2017-12-01
Full Text Available Purpose: describe the organizational and managerial activities of the fitness club director. Material & Methods: analysis of literary sources; analysis of documents; system analysis; survey (questionnaire methods of mathematical statistics. The study was conducted on the basis of 12 fitness clubs in Kharkiv. Respondents were 12 directors, managers of fitness clubs. Results: the obtained results of the study made it possible to reveal the levels of management of the fitness club activities, structural divisions and links, their functions, management ties. From the perspective of an integrated approach, the activity of the director of the fitness club on the complexity of the tasks to be solved. Conclusion: optimal organizational structure of management of fitness clubs is defined, includes the following functional blocks: fitness staff service personnel technical staff and administration. It is determined that the financial and economic activities of the fitness club and the continuous improvement of their professional activities are the most difficult tasks in the activity of the director and manager of the fitness club.
What competencies should directors possess? Malaysia perspective
Directory of Open Access Journals (Sweden)
Wan Fauziah Wan Yusoff
2011-07-01
Full Text Available Directors’ competencies are seeing to be of importance to corporate governance. As this issue has not yet being studied extensively in Malaysia, this study determines the key competencies of Malaysian company’s directors using qualitative approach involving two stages of Delphi Technique. In the first stage all information pertaining to directors’ competences in the literature had been reviewed. In the second stage, the key competencies identified in stage one were the criteria for developing a semi structured questionnaire. Participants were asked to rank the competencies in term of their importance for directors’ performance. Based on personel interviews with 41 participants eight types of competencies were found to be essential for Malaysian companies’ directors. Financial competencies received the highest responses, followed by corporate planning, business forecasting, legal, risk management, marketing, human resource and international business. This paper provides important evidence to support the conclusions drawn from the study about the importance of relevant directors’ competencies for board and corporate effectiveness.
2003-01-01
APPL is a research-based organization that serves NASA program and project managers, as well as project teams, at every level of development. In 1997, APPL was created from an earlier program to underscore the importance that NASA places on project management and project teams through a wide variety of products and services, including knowledge sharing, classroom and online courses, career development guidance, performance support, university partnerships, and advanced technology tools. ASK Magazine grew out of APPL's Knowledge Sharing Initiative. The stories that appear in ASK are written by the 'best of the best' project managers, primarily from NASA, but also from other government agencies and industry. Contributors to this issue include: Teresa Bailey, a librarian at the Jet Propulsion Laboratory, Roy Malone, Deputy Director in the Safety and Mission Assurance (S&MA) Office at the NASA Marshall Space Flight Center (MSFC), W. Scott Cameron, Capital Systems Manager for the Food and Beverage Global Business Unit of Procter and Gamble, Ray Morgan, recent retiree as Vice President of AeroVironment, Inc., Marty Davis, Program Manager of the Geostationary Operational Environmental Satellite (GOES) at the NASA Goddard Space Flight Center (GSFC) in Greenbelt, Maryland, Todd Post, editor of ASK Magazine, and works for EduTech Ltd. in Silver Spring, Maryland, Dr. Owen Gadeken, professor of Engineering Management at the Defense Acquisition University, Ken Schwer, currently the Project Manager of Solar Dynamics Observatory, Dr. Edward Hoffmwan, Director of the NASA Academy of Program and Project Leadership, Frank Snow, a member of the NASA Explorer Program at Goddard Space Flight Center since 1992, Dr. Alexander Laufer, Editor-in-Chief of ASK Magazine and a member of the Advisory Board of the NASA Academy of Program and Project Leadership, Judy Stokley, presently Air Force Program Executive Officer for Weapons in Washington, D.C. and Terry Little, Director of the Kinetic
STS-95 Commander Brown presents a photo to Center Director Bridges
1998-01-01
STS-95 Commander Curtis L. Brown Jr. (left) presents a composite photograph of images taken during the STS-95 mission to Kennedy Space Center (KSC) Director Roy Bridges in the Training Auditorium. The auditorium is filled with KSC employees who were invited to hear the crew describe their experiences during their successful mission dedicated to microgravity research and to view a videotape of the highlights of the mission. The other crew members are Pilot Steven W. Lindsey; Mission Specialist and Payload Commander Stephen K. Robinson; Mission Specialists Scott E. Parazynski and Pedro Duque, with the European Space Agency (ESA); and Payload Specialists Chiaki Mukai, with the National Space Development Agency of Japan (NASDA), and John H. Glenn Jr., a senator from Ohio and one of the original seven Project Mercury astronauts. Later in the afternoon, the crew will participate in a parade down State Road A1A in nearby Cocoa Beach, reminiscent of those held after missions during the Mercury Program.
78 FR 13904 - Millennium Challenge Corporation Board of Directors Meeting; Sunshine Act Meetings
2013-03-01
... MILLENNIUM CHALLENGE CORPORATION [MCC FR 13-01] Millennium Challenge Corporation Board of Directors Meeting; Sunshine Act Meetings AGENCY: Millennium Challenge Corporation. TIME AND DATE: 10:00 a.m... CONSIDERED: The Board of Directors (the ``Board'') of the Millennium Challenge Corporation (``MCC'') will...
76 FR 55124 - Audit Committee Meeting of the Board of Directors; Sunshine Act
2011-09-06
... NEIGHBORHOOD REINVESTMENT CORPORATION Audit Committee Meeting of the Board of Directors; Sunshine... Internal Audit Director III. Internal Audit Report with Management's Response IV. FY `11 and `12 Risk Assessments and Internal Audit Plans V. Internal Audit Resource Capacity Proposal VI. Communication of...
75 FR 6642 - Notice of Proposed Information Collection; Naval Special Warfare Recruiting Directorate
2010-02-10
... Information Collection; Naval Special Warfare Recruiting Directorate AGENCY: Department of the Navy, DoD. ACTION: Notice. SUMMARY: The Naval Special Warfare (NSW) Recruiting Directorate announces the submission... any of the following methods: Federal eRulemaking Portal: http://www.regulations.gov . Follow the...
Continuous Briefing and User Participation in Building Projects
DEFF Research Database (Denmark)
Jensen, Per Anker
2006-01-01
and the methods for user participation, identifies problem areas and point out possible improvements. The author has been actively involved in the project as deputy project director with re-sponsibility for the briefing process until spring 2005 and is now a researcher.......Briefing is not just about specifying needs as requirements but also about evaluating how well design pro-posals fulfill the needs and aspirations. Furthermore, briefing is not only about building design. Briefing starts at the pre-project stage to create a basis for the project decision...... into the building is required. A building project is often part of a change process of the organisation that is going to occupy the building, and this change process should be management carefully to reach a successful result. An important aspect of briefing is to manage the par-ticipation of the coming users...
12 CFR 563b.125 - Must my board of directors adopt a plan of conversion?
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Must my board of directors adopt a plan of... board of directors adopt a plan of conversion? Prior to filing an application for conversion, your board of directors must adopt a plan of conversion that conforms to §§ 563b.320 through 563b.485 and 563b...
Industrial participation in TRISTAN project at KEK, Japan
International Nuclear Information System (INIS)
Ozaki, Satoshi.
1990-01-01
Industry-Laboratory collaborations played a very important role in the construction of TRISTAN electron-positron colliding beam facility, and brought this construction project to a successful completion in a scheduled time. What had motivated the collaborations, what were the important elements in the successful collaborations and how the collaborations worked will be given based on the authors experience as the TRISTAN Project Director. It is my pleasure to participate in this meeting of IISSC, and to present a talk on my experience with industry-laboratory cooperations in the construction of a major high energy accelerator facility in Japan; namely the TRISTAN electron-positron colliding beam facility project at KEK, (National Laboratory for High Energy Physics) in Tsukuba, Japan
Jean-Claude Gadmer
2013-01-01
5 June 2013 - European Union Ambassador to Switzerland and the Principality of Liechtenstein R. Jones in the ATLAS cavern with ATLAS Collaboration Deputy Spokesperson T. Wengler, in the LHC tunnel at Point 1 with Technology Department Head F. Bordry and signing the guest book with Director-General R. Heuer. Head of the EU Projects Office S. Stavrev present.
The Function of a Medical Director in Healthcare Institutions: A Master or a Servant
Directory of Open Access Journals (Sweden)
Antoine Kossaify
2013-01-01
Full Text Available The function of a medical director is presented along with features of efficiency and deficiencies from the perspective of healthcare system improvement. A MEDLINE/Pubmed research was performed using the terms “medical director” and “director”, and 50 relevant articles were selected. Institutional healthcare quality is closely related to the medical director efficiency and deficiency, and a critical discussion of his or her function is presented along with a focus on the institutional policies, protocols, and procedures. The relationship between the medical director and the executive director is essential in order to implement a successful healthcare program, particularly in private facilities. Issues related to professionalism, fairness, medical records, quality of care, patient satisfaction, medical teaching, and malpractice are discussed from the perspective of institutional development and improvement strategies. In summary, the medical director must be a servant to the institutional constitution and to his or her job description; when his or her function is fully implemented, he or she may represent a local health governor or master, ensuring supervision and improvement of the institutional healthcare system.
Annual review and directors' report and accounts
International Nuclear Information System (INIS)
1992-07-01
This annual report of Midlands Electricity PLC (MEB) presents a financial review of the Group and the directors' and auditors reports. Historical and current cost profit and loss accounts, balance sheets and cash flow statements are tabulated. The Group's financial history and regulatory accounts are also presented. (UK)
Computation Directorate 2007 Annual Report
Energy Technology Data Exchange (ETDEWEB)
Henson, V E; Guse, J A
2008-03-06
If there is a single word that both characterized 2007 and dominated the thoughts and actions of many Laboratory employees throughout the year, it is transition. Transition refers to the major shift that took place on October 1, when the University of California relinquished management responsibility for Lawrence Livermore National Laboratory (LLNL), and Lawrence Livermore National Security, LLC (LLNS), became the new Laboratory management contractor for the Department of Energy's (DOE's) National Nuclear Security Administration (NNSA). In the 55 years under the University of California, LLNL amassed an extraordinary record of significant accomplishments, clever inventions, and momentous contributions in the service of protecting the nation. This legacy provides the new organization with a built-in history, a tradition of excellence, and a solid set of core competencies from which to build the future. I am proud to note that in the nearly seven years I have had the privilege of leading the Computation Directorate, our talented and dedicated staff has made far-reaching contributions to the legacy and tradition we passed on to LLNS. Our place among the world's leaders in high-performance computing, algorithmic research and development, applications, and information technology (IT) services and support is solid. I am especially gratified to report that through all the transition turmoil, and it has been considerable, the Computation Directorate continues to produce remarkable achievements. Our most important asset--the talented, skilled, and creative people who work in Computation--has continued a long-standing Laboratory tradition of delivering cutting-edge science even in the face of adversity. The scope of those achievements is breathtaking, and in 2007, our accomplishments span an amazing range of topics. From making an important contribution to a Nobel Prize-winning effort to creating tools that can detect malicious codes embedded in commercial
Roles, tasks and educational functions of postgraduate programme directors: a qualitative study.
Frydén, Hanna; Ponzer, Sari; Heikkilä, Kristiina; Kihlström, Lars; Nordquist, Jonas
2015-10-01
A programme director is often required to organise postgraduate medical education. This leadership role can include educational as well as managerial duties. Only a few published studies have explored programme directors' own perceptions of their role. There is a need to explore the use of theoretical frameworks to improve the understanding of educational roles. To explore programme directors' own perceptions of their role in terms of tasks and functions, and to relate these roles to the theoretical framework developed by Bolman and Deal. Semi-structured interviews were conducted with 17 programme directors between February and August 2013. The data were subjected to content analysis using a deductive approach. The various roles and tasks included by participants in their perceptions of their work could be categorised within the framework of functions described by Bolman and Deal. These included: structuring the education (structural function); supporting individuals and handling relations (human resource function); negotiating between different interests (political function); and influencing the culture at the departmental level (symbolic function). The functions most often emphasised by participants were the structural and human resource functions. Some tasks involved several functions which varied over time. Programme directors' own perceptions of their roles, tasks and functions varied widely. The theoretical framework of Bolman and Deal might be helpful when explaining and developing these roles. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.
An Empirical Analysis of Latin American Board of Directors and Minority Shareholders’ Rights
Directory of Open Access Journals (Sweden)
Marisela Santiago
2009-09-01
Full Text Available This paper examines the link between corporate governance structures and the potential for expropriation of minority shareholders’ rights. Analysis of 97 firms from Brazil, Chile and Mexico that traded ADR shares in the United States between 2000 and 2002, indicates that increasing the size of the board by inclusion of additional independent outside directors lowers the potential for expropriation of minority shareholders’ rights. Also, increases in the tenure of independent outside directors, decreases in CEOs’ shareholdings and more interlocking directors on a board all serve to lower the potential for expropriation of minority shareholders’ rights.
Projects financing in the hydrocarbons sector: a necessary help in some cases
International Nuclear Information System (INIS)
Musset, O.; Salles, E.
2003-01-01
French banks are in the forefront of the financing of international projects of the petroleum industry. Among these banks, the most active one is certainly Societe Generale, which ranks second at the world scale and first in the Middle-East area for 2002. With a significant presence in the hydrocarbons sector, it participates also to the development of projects as huge as the BTC pipeline between Bakou and Ceyhan and the ELNG gas liquefaction project in Egypt in association with Gaz de France company. This paper reprints an interview of O. Musset, director of project and sectorial finance of Societe Generale. (J.S.)
IAEA Director General welcomes NPT consensus
International Nuclear Information System (INIS)
2000-01-01
The document informs that the Director General of the IAEA welcomed the adoption with consensus by the Review Conference of the Parties to the Treaty on the Non-Proliferation of Nuclear Weapons of the final document on the review and operation of the Treaty, and that he was pleased by the vote of confidence shown in the IAEA and its role in the implementation of the Treaty
Case Studies in Application of System Engineering Practices to Capstone Projects
Murphy, Gloria; vanSusante, Paul; Carmen, Christina; Morris, Tommy; Schmidt, Peter; Zalewski, Janusz
2011-01-01
The Exploration Systems Mission Directorate (ESMD) of the National Aeronautics and Space Administration (NASA) sponsors a faculty fellowship program that engages researchers with interests aligned with current ESMD development programs. The faculty-members are committed to run a capstone senior design project based- on the materials and experience gained during the fellowship. For the 2010 - 2011 academic year, 5 projects were approved. These projects are in the areas of mechanical and electrical hardware design and optimization, fault prediction and extra planetary civil site preparation. This work summarizes the projects, describes the student teams performing the work, and comments on the integration of Systems Engineering principles into the projects, as well as the affected course curriculums.
Introducing ICSMP, The International Contraceptive Social Marketing Project.
1981-04-01
The International Contraceptive Social Marketing Project (ICSMP) began operations in October 1980 to act as a central technical assistance and funding resource for contraceptive social marketing (CSM) programs in Latin America, Africa, the Middle East, and Asia. CSM is an interrelationship of the public and private sectors working to improve contraceptive availability by applying commercial advertising sales and management techniques. At present Bangladesh, Egypt, El Salvador, Ghana, India, Jamaica, Mexico, Nepal, and Sri Lanka have active programs. ICSMP provides the following services: 1) skilled CSM consultants to assist with studies, planning, product line expansion, management training, and marketing problems; and 2) grants and contracts to initiate or expand programs. ICSMP also sponsors regional and international conferences to provide practitioners a chance to share experiences. Its newsletter, "Update" is written to keep CSM directors in touch with developments. To communicate with "Update," write to Update, c/o CEFPA, Suite 202, 1717 Massachusetts avenue, N.W., Washington, D.C., 20036, USA. For more information about ICSMP write: Betty Butler Howell, Project Director, ICSMP, The Futures Group, 1029 Vermont Avenue, N.W., Washington, D.C., 20005, USA.
Resident Preferences for Program Director Role in Wellness Management.
Kolarik, Russ C; O'Neal, Richard L; Ewing, Joseph A
2018-05-01
Burnout and depression are prevalent among resident physicians, though the supportive role of the program director (PD) is not well defined. To understand the residents' view of the residency program director's role in assessing and promoting resident wellness. A single institution survey of all house staff was conducted in 2017. Rates of burnout and depression were identified via the 2-item Maslach Burnout Inventory (MBI) and the Patient Health Questionaire-2 (PHQ-2), respectively. Residents then qualified their preferences for various assistance services and for the role of their program directors in assisting them. One-hundred sixty-one of 202 (79.7%) residents completed the survey. The rate of depression was 28%. Rates of emotional exhaustion and depersonalization (2-item MBI) were 44 and 62%, respectively. Only 4% of respondents had used the Employee Assistance Program (EAP) in the prior 12 months. Eighty-two percent of residents were in favor of PDs inquiring about wellness regardless of their job performance and only 1% of residents stated the PD should not inquire about wellness at all. Thirty-three percent of residents reported that they would be likely to contact EAP on their own if they felt unwell. Significantly more residents (62%) reported being more likely to contact EAP if recommended by their PD (33 vs 62%, p assistance were lack of time (65%), lack of knowledge of how to contact EAP (41%), and concerns about appearing weak (35%). Despite a high prevalence of burnout and depression, residents are unlikely to seek help on their own. Program directors have an important role in assessing and promoting the wellness of their residents. The majority of residents wants their PD to inquire about wellness and may be more likely to seek and receive help if recommended and facilitated by their PD.
Exchange of letters between the Resident Representative of Mexico and the Director General
International Nuclear Information System (INIS)
1987-11-01
The document reproduces the text of a letter (dated 23 November 1987) to the Director General of the IAEA from the Resident Representative of Mexico and the Director General's reply (dated 24 November 1987) in connection with the military attack of the Bushehr Nuclear Power Plant
New representative of the Director-General of the IAEA to the United Nations
International Nuclear Information System (INIS)
2000-01-01
The document gives information about Mr. Kwaku Aning (Ghana) who was nominated as the Representative of the Director-General of the IAEA to the United Nations and as Director of its Office at the United Nations Headquarters in New York, USA, as of 1 February 2000
Virtue training in medical schools: the perspective of behavioral science course directors.
Olufowote, James Olumide
2015-01-01
Although the multidisciplinary research on physician socialization has focused on areas such as developments in learners' ideological commitments and ethics knowledge and skills, the literature on physician virtues has been anecdotal. To contribute empirical knowledge of virtue development during socialization, I performed constant comparisons on interviews with 20 directors of preclinical behavioral science courses. In discussing their courses, participants revealed foci on virtues involved in making intimate connections with patients (e.g., empathy) and "being professional" with colleagues (e.g., trustworthiness). To cultivate virtues for intimate connections, participants used the strategies of learner engagement with patients' narratives of illness, service in underserved communities, and shadowing and observing role models. To develop virtues for being professional, participants used the strategy of small learner groups, which consisted of discussions, project collaborations, and group evaluations. I conclude with implications for training students of various health sciences and managing health care teams.
A Director's Guide to High School Horns.
Conway, Collen
1998-01-01
Conveys that the horn (French horn) is the most difficult instrument for band and orchestra directors to teach because playing the horn requires students to have very strong aural skills. Identifies the horn specific techniques students should know, such as hand positions, alternate fingerings, and transposition. Provides different methods for…
2013-06-10
... CONTACT: Office of Naval Research: Ms. Margaret J. Mitchell, Director, Human Resources Office, Office of... established position management criteria, and (2) Pay Band V of the S&E Professional Career Track require... Personnel Management Demonstration Project, Department of Navy, Office of Naval Research (ONR); Proposed...
Carek, Peter J; Mims, Lisa D; Conry, Colleen M; Maxwell, Lisa; Greenwood, Vicki; Pugno, Perry A
2015-01-01
The association between a residency program director completing a leadership and management skills fellowship and characteristics of quality and innovation of his/her residency program has not been studied. Therefore, the aim of this study is to examine the association between a residency program director's completion of a specific fellowship addressing these skills (National Institute for Program Director Development or NIPDD) and characteristics of quality and innovation of the program they direct. Using information from the American Academy of Family Physicians (AAFP), National Resident Matching Program (NRMP) and FREIDA® program characteristics were obtained. Descriptive statistics were used to summarize the data. The relationship between programs with a NIPDD graduate as director and program quality measures and indicators of innovation was analyzed using both chi square and logistic regression. Initial analyses showed significant associations between the NIPDD graduate status of a program director and regional location, mean years of program director tenure, and the program's 5-year aggregate ABFM board pass rate from 2007--2011. After grouping the programs into tertiles, the regression model showed significant positive associations with programs offering international experiences and being a NIPDD graduate. Program director participation in a fellowship addressing leadership and management skills (ie, NIPDD) was found to be associated with higher pass rates of new graduates on a Board certification examination and predictive of programs being in the upper tertile of programs in terms of Board pass rates.
Energy Technology Data Exchange (ETDEWEB)
NONE
2007-04-15
The project 'developments in risk level - Norwegian shelf', also known as the risk level project, was initiated by the Norwegian Petroleum Directorate in 2000. From 2004 the project has been continued by Petroleum Safety Authority Norway. The project's main objectives are to measure the effect of the health, security and environment (HSE) work in the industry, and contribute to identify the areas critical to HSE, where efforts must be made to prevent unwanted events or accidents. A summary report with results from phase 7 in the project (ml)
17 CFR 21.04 - Delegation of authority to the Director of the Division of Market Oversight.
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Delegation of authority to the... COMMODITY FUTURES TRADING COMMISSION SPECIAL CALLS § 21.04 Delegation of authority to the Director of the... to be exercised by such Director or by such other employee or employees of such Director as...
36 CFR 51.24 - May the Director award a temporary concession contract without a public solicitation?
2010-07-01
... visitor services. Further, the Director must publish notice in the Federal Register of the proposed... infeasible. The Director must publish a notice of his intention to award a temporary concession contract to a... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false May the Director award a...
The Central Institute for Brain Research in Amsterdam and its directors.
Eling, Paul; Hofman, Michel A
2014-01-01
The Central Institute for Brain Research was founded in Amsterdam in 1908 as part of an international effort to study the nervous system with multiple institutions and various disciplines. The development of research in the past hundred years at the Brain Institute has hardly been documented. We analyze the history of this institute by means of brief portraits of its directors and their main research topics. It appears that each director introduced his own branch of neuroscience into the institute. Initially, mainly comparative neuroanatomical data were collected. Following the Second World War, the multidisciplinary approach slowly developed with research programs on systems neuroscience, neuroendocrinology, and brain disorders. Every new director introduced new approaches to the study of the brain and thus played an important role in keeping brain research in the Netherlands at the international forefront where it has been ever since its foundation in 1908.
Nursing directors' leadership styles and faculty members' job satisfaction in Taiwan.
Chen, Hsiu-Chin; Baron, Mark
2006-10-01
Nursing leaders in Taiwan seldom receive the leadership training necessary to lead an academic organization. As a result, leaders may experience burn out, and dissatisfaction among faculty may increase. This study examined nursing faculty members' perceptions of nursing directors' leadership and their job satisfaction levels to understand how perceptions of leadership styles related to job satisfaction in Taiwan. This descriptive, correlational, cross-sectional study used self-administered questionnaires. Transformational leadership theory supported the research framework. Nine schools with nursing programs awarding diplomas to students participated in this study. A total of 175 questionnaires were returned (72% response rate). The findings indicated that Taiwan's nursing directors tend to display transformational leadership more frequently in their workplaces and that Taiwan's nursing faculty members are moderately satisfied in their jobs. In addition, nursing faculty in Taiwan are more satisfied with directors who practice the leadership style of attributed idealized influence.
An analysis of collegiate band directors' exposure to sound pressure levels
Roebuck, Nikole Moore
Noise-induced hearing loss (NIHL) is a significant but unfortunate common occupational hazard. The purpose of the current study was to measure the magnitude of sound pressure levels generated within a collegiate band room and determine if those sound pressure levels are of a magnitude that exceeds the policy standards and recommendations of the Occupational Safety and Health Administration (OSHA), and the National Institute of Occupational Safety and Health (NIOSH). In addition, reverberation times were measured and analyzed in order to determine the appropriateness of acoustical conditions for the band rehearsal environment. Sound pressure measurements were taken from the rehearsal of seven collegiate marching bands. Single sample t test were conducted to compare the sound pressure levels of all bands to the noise exposure standards of OSHA and NIOSH. Multiple regression analysis were conducted and analyzed in order to determine the effect of the band room's conditions on the sound pressure levels and reverberation times. Time weighted averages (TWA), noise percentage doses, and peak levels were also collected. The mean Leq for all band directors was 90.5 dBA. The total accumulated noise percentage dose for all band directors was 77.6% of the maximum allowable daily noise dose under the OSHA standard. The total calculated TWA for all band directors was 88.2% of the maximum allowable daily noise dose under the OSHA standard. The total accumulated noise percentage dose for all band directors was 152.1% of the maximum allowable daily noise dose under the NIOSH standards, and the total calculated TWA for all band directors was 93dBA of the maximum allowable daily noise dose under the NIOSH standard. Multiple regression analysis revealed that the room volume, the level of acoustical treatment and the mean room reverberation time predicted 80% of the variance in sound pressure levels in this study.
7 CFR 2.71 - Director, Office of Risk Assessment and Cost-Benefit Analysis.
2010-01-01
... Chief Economist § 2.71 Director, Office of Risk Assessment and Cost-Benefit Analysis. (a) Delegations. Pursuant to § 2.29(a)(2), the following delegations of authority are by the Chief Economist to the Director... reserved to the Chief Economist: Review all proposed decisions having substantial economic policy...
25 CFR 1000.67 - How will the Director award planning and negotiation grants?
2010-04-01
... SELF-DETERMINATION AND EDUCATION ACT Other Financial Assistance for Planning and Negotiation Grants for Non-BIA Programs Eligibility and Application Process § 1000.67 How will the Director award planning... 25 Indians 2 2010-04-01 2010-04-01 false How will the Director award planning and negotiation...
Emergent scar lines in chaotic advection of passive directors
Hejazi, Bardia; Mehlig, Bernhard; Voth, Greg A.
2017-12-01
We examine the spatial field of orientations of slender fibers that are advected by a two-dimensional fluid flow. The orientation field of these passive directors are important in a wide range of industrial and geophysical flows. We introduce emergent scar lines as the dominant coherent structures in the orientation field of passive directors in chaotic flows. Previous work has identified the existence of scar lines where the orientation rotates by π over short distances, but the lines that were identified disappeared as time progressed. As a result, earlier work focused on topological singularities in the orientation field, which we find to play a negligible role at long times. We use the standard map as a simple time-periodic two-dimensional flow that produces Lagrangian chaos. This class of flows produces persistent patterns in passive scalar advection and we find that a different kind of persistent pattern develops in the passive director orientation field. We identify the mechanism by which emergent scar lines grow to dominate these patterns at long times in complex flows. Emergent scar lines form where the recent stretching of the fluid element is perpendicular to earlier stretching. Thus these scar lines can be labeled by their age, defined as the time since their stretching reached a maximum.
McPhillips, Heather A; Frohna, John G; Murad, M Hassan; Batra, Maneesh; Panda, Mukta; Miller, Marsha A; Brigham, Timothy P; Doughty, Robert A
2011-12-01
An effective working relationship between chief residents and residency program directors is critical to a residency program's success. Despite the importance of this relationship, few studies have explored the characteristics of an effective program director-chief resident partnership or how to facilitate collaboration between the 2 roles, which collectively are important to program quality and resident satisfaction. We describe the development and impact of a novel workshop that paired program directors with their incoming chief residents to facilitate improved partnerships. The Accreditation Council for Graduate Medical Education sponsored a full-day workshop for residency program directors and their incoming chief residents. Sessions focused on increased understanding of personality styles, using experiential learning, and open communication between chief residents and program directors, related to feedback and expectations of each other. Participants completed an anonymous survey immediately after the workshop and again 8 months later to assess its long-term impact. Participants found the workshop to be a valuable experience, with comments revealing common themes. Program directors and chief residents expect each other to act as a role model for the residents, be approachable and available, and to be transparent and fair in their decision-making processes; both groups wanted feedback on performance and clear expectations from each other for roles and responsibilities; and both groups identified the need to be innovative and supportive of changes in the program. Respondents to the follow-up survey reported that workshop participation improved their relationships with their co-chiefs and program directors. Participation in this experiential workshop improved the working relationships between chief residents and program directors. The themes that were identified can be used to foster communication between incoming chief residents and residency directors and to
From the Tevatron to Project X
Pier Oddone, Fermilab director (from CERN Courier)
2011-01-01
In the October issue of the CERN Courier, Fermilab Director Pier Oddone will present the past, present and future of the US laboratory after the Tevatron. The Bulletin presents some early extracts from his article… Fermilab Director, Pier Oddone. The end of September marks the end of an era at Fermilab, with the shutdown of the Tevatron after 28 years of operation at the frontiers of particle physics. The Tevatron’s far-reaching legacy spans particle physics, accelerator science and industry. The collider established Fermilab as a world leader in particle physics research, a role that will be strengthened with a new set of facilities, programmes and projects in neutrino and rare-process physics, astroparticle physics, and accelerator and detector technologies. The Tevatron exceeded every expectation ever set for it. This remarkable machine achieved luminosities with antiprotons once considered impossible, reaching more than 4x1032 cm-2s-1 instantaneous luminosity and...
76 FR 55710 - Sunshine Act Meeting of LSC Board of Directors Finance Committee
2011-09-08
... LEGAL SERVICES CORPORATION Sunshine Act Meeting of LSC Board of Directors Finance Committee TIME AND DATE: The Legal Services Corporation (``LSC'' or ``Corporation'') Board of Directors (``Board'') Finance Committee will meet telephonically on September 13, 2011 at 11 a.m., Eastern Time. LOCATION: Legal Services Corporation, F. William McCalpin...
Noted astrophysicist Michael S. Turner to Head NSF'S mathematical and physical sciences directorate
2003-01-01
"The National Science Foundation has named celebrated astrophysicist Michael S. Turner of the University of Chicago as Assistant Director for Mathematical and Physical Sciences. He will head a $1 billion directorate that supports research in mathematics, physics, chemistry, materials and astronomy, as well as multidisciplinary programs and education" (1/2 page).
Fabiola Gianotti signs her contract as CERN's new Director- General
Antonella Del Rosso
2014-01-01
Today, 12 December 2014, Fabiola Gianotti signed her five-year contract as the new CERN Director-General. Her mandate will begin on 1 January 2016. Fabiola Gianotti (left) and President of CERN Council Agnieszka Zalewska (right) after the signature of the contract. The Italian physicist, Fabiola Gianotti was appointed as the Organization’s next Director-General at the 173rd Closed Session of the CERN Council on 4 November. The appointment was formalised this week at the December session of Council. More news from this week Council meetings can be found here.
16 CFR 1000.30 - Directorate for Laboratory Sciences.
2010-01-01
... for compliance with the Consumer Product Safety Act, the Federal Hazardous Substances Act, the Flammable Fabrics Act, and the Poison Prevention Packaging Act. The Directorate is composed of the Mechanical Engineering Division, the Electrical Engineering Division (which includes flammable fabrics), and...
Papike appointed Director of IOM
James Papike was appointed director of the Institute of Meteoritics in the Department of Geology and Presidential Professor at the University of New Mexico, Albuquerque, on July 1, 1990. Papike succeeded Klaus Keil, who moved to the University of Hawaii to direct the Planetary Geoscience Division at the Hawaii Institute of Geosciences.The newly constituted IOM will emphasize planetary volcanic processes through the study of achondritic meteorites, the Moon, and Earth, and the origin of primitive solar system materials and planetary formation through the study of chondritic meteorites.
THE IMPACT OF FEMALE DIRECTORS ON FIRM PERFORMANCE: EVIDENCE FROM INDONESIA
Triana; Marwan Asri
2017-01-01
This research shows the impact of female directors on firm performance in Indonesia by using as its sample the public companies listed on the Indonesian Stock Exchange (IDX) from 2011 until 2015. There were 347 companies, with 1,735 samples observed. This research uses the multiple regression method. The model is a modified model from 9 recent articles published between 2012 and 2015. The empirical result shows that a female director has a positive significant effect on firm performance. The ...
Board diligence, director business and corporate governance
Directory of Open Access Journals (Sweden)
Saibal Ghosh
2007-11-01
Full Text Available The paper examines the association between financial performance and boards of non-financial firms. Using data on over 200 listed manufacturing firms in India for 2005, the findings indicate that, after controlling for various firm-specific factors, board diligence as well as director busyness exerts a positive influence on corporate performance.
The ethical commitment of independent directors in different contexts of investor protection
Directory of Open Access Journals (Sweden)
Isabel María García-Sánchez
2015-04-01
Full Text Available The purpose of this study is to compare, for countries with different legal environments, the degree to which boards of directors may improve corporate ethical behaviour by designing codes of ethics. These codes address issues such as a company's responsibility regarding the quality of its products and services, compliance with laws and regulations, conflicts of interest, corruption and fraud, and protection of the natural environment. Using a sample of firms from 12 countries, we obtain evidence that a greater presence of independent directors on the board leads to the existence of more complex codes of ethics. Moreover, there are significant differences between countries with high levels and countries with low levels of investor protection as regards the effectiveness of independent directors in constraining unethical behaviour by managers.
Directory of Open Access Journals (Sweden)
J-L. W. Mitchell Van der Zahn
2006-01-01
Full Text Available This study examines the association between the gender and ethnic composition of boards of directors and firm performance in a transitional nation. In contrast to prior research that largely focuses on firm performance within a financial context, this study concentrates on intellectual capital performance. Using data collected from 84 South African, empirical results indicate a positive association between the percentage of female and non-white directors on the board and a firm’s intellectual capital performance. Additional analysis shows the designation of female directors as an insider has a negative effect of intellectual capital performance. Designation of female and non-white directors as outsiders, meanwhile, has a positive influence on a firm’s intellectual capital performance. Finally, there was no association between the percentage of non-white inside directors on the board and intellectual capital performance.
2011-01-14
... Programs Directorate (NPPD)/Office of Cybersecurity and Communications (CS&C)/Office of Emergency Communications (OEC) will submit the following Information Collection Request to the Office of Management and... Directorate; National Emergency Communications Plan (NECP) Goal 2 Performance Report AGENCY: National...