Altered expression of prohibitin in psoriatic lesions and its cellular implication
International Nuclear Information System (INIS)
Kim, Soon Young; Kim, Younghwa; Hwang, Ha Young; Kim, Tae-Yoon
2007-01-01
Psoriasis is characterized by excessive proliferation of keratinocytes accompanying acanthosis and incomplete differentiation. Prohibitin was investigated by examining its function of HaCaT as well as psoriasis. Psoriatic involved skin revealed high level of prohibitin in the basal layer. Prohibitin was analyzed by applying RNAi (PHBi) with HaCaT, which demonstrated increased S-phase. PHBi showed enhanced sensitivity to anthralin-mediated cell death due to enhanced loss of mitochondrial membrane potential, suggesting a protective role of prohibitin against apoptosis. Collectively, prohibitin plays a role both in cell cycle regulation and in maintaining mitochondrial integrity, implying its association with pathogenesis of psoriasis
An Unusual Prohibitin Regulates Malaria Parasite Mitochondrial Membrane Potential
Directory of Open Access Journals (Sweden)
Joachim Michael Matz
2018-04-01
Full Text Available Summary: Proteins of the stomatin/prohibitin/flotillin/HfIK/C (SPFH family are membrane-anchored and perform diverse cellular functions in different organelles. Here, we investigate the SPFH proteins of the murine malaria model parasite Plasmodium berghei, the conserved prohibitin 1, prohibitin 2, and stomatin-like protein and an unusual prohibitin-like protein (PHBL. The SPFH proteins localize to the parasite mitochondrion. While the conserved family members could not be deleted from the Plasmodium genome, PHBL was successfully ablated, resulting in impaired parasite fitness and attenuated virulence in the mammalian host. Strikingly, PHBL-deficient parasites fail to colonize the Anopheles vector because of complete arrest during ookinete development in vivo. We show that this arrest correlates with depolarization of the mitochondrial membrane potential (ΔΨmt. Our results underline the importance of SPFH proteins in the regulation of core mitochondrial functions and suggest that fine-tuning of ΔΨmt in malarial parasites is critical for colonization of the definitive host. : Matz et al. present an experimental genetics study of an unusual prohibitin-like protein in the malaria parasite and find that it regulates mitochondrial membrane polarity. Ablation of this protein causes almost complete mitochondrial depolarization in the mosquito vector, which, in turn, leads to a block in malaria parasite transmission. Keywords: Plasmodium berghei, malaria, SPFH, prohibitin, stomatin-like protein, mitochondrion, membrane potential, ookinete, transmission
Molecular identification and characterization of prohibitin from Echinococcus granulosus.
Zhong, Xiuqin; Song, Xingju; Wang, Ning; Hu, Dandan; Liu, Tinayu; Wang, Tao; Gu, Xiaobin; Lai, Weimin; Peng, Xuerong; Yang, Guangyou
2016-02-01
Prohibitin (PHB) is a widely distributed protein that functions as a molecular chaperone, is involved in the regulation of cell cycle, and maintains mitochondrial structure and functions of the anti-apoptosis, senescence, and proliferation. The aim of this study was to characterize PHB in Echinococcus granulosus (EgPHB), a harmful cestode parasite of humans, many livestock species, and wild animals. We found that EgPHB is a conserved SPFH (stomatin, prohibitin, flotillin, and HflK/C) domain-containing protein, consisting of 289 amino acids, which shares 42.66-99.31% identity with PHBs from other parasites and mammals. EgPHB was located mainly in the tegument issue of protoscoleces, in the inner body of adult worms, and was expressed widely in the germinal layer. This is the first report on prohibitin from E. granulosus, and EgPHB is considered to be a valuable protein to study more in the future.
Prohibitin Is Involved in Patients with IgG4 Related Disease.
Directory of Open Access Journals (Sweden)
Hongwu Du
Full Text Available IgG4-related disease (IgG4-RD is a chronic systemic disease involved in many organs and tissues. As only limited autoantigens have been found since the beginning of this century, the aim of this study was to reveal new candidate autoantigens of IgG4-RD.Multiple cell lines including HT-29, EA.hy926, HEK 293 and HepG2 were used to test the binding ability of circulating autoantibodies from IgG4-RD sera. The amino-acid sequence was then analyzed by matrix-assisted laser desorption/ionization time-of-flight tandem (MALDI-TOF/TOF mass spectrometry. After the cloning and expression of recombinant putative autoantigen in a bacterial expression system, the corresponding immuno assay was set up and utilized to observe the prevalence of serum autoantibodies in a large set of confirmed clinical samples.One positive autoantigen was identified as prohibitin. ELISA analysis showed that a majority of patients with IgG4-RD have antibodies against prohibitin. Anti-prohibitin antibodies were present in the sera of patients with definite autoimmune pancreatitis (25/34; 73.5%, Mikulicz's disease (8/15; 53.3%, retroperitoneal fibrosis (6/11; 54.5%, other probable IgG4-RD (26/29; 89.7% and Sjögren's syndrome (4/30; 13.3% but not in apparently healthy donors (1/70; 1.4%.An association between prohibitin and patients with some IgG4-RD was observed, although the results were quite heterogeneous among different individuals within autoimmune pancreatitis, Mikulicz's disease and retroperitoneal fibrosis.
Investigation of the Cry4B-prohibitin interaction in Aedes aegypti cells.
Kuadkitkan, Atichat; Smith, Duncan R; Berry, Colin
2012-10-01
Bacillus thuringiensis (Bt) produces insecticidal toxins active against insects. Cry4B, one of the major insecticidal toxins produced by Bt subsp. israelensis, is highly toxic to mosquitoes in the genus Aedes: the major vectors of dengue, yellow fever, and chikungunya. Previous work has shown that Cry4B binds to several mid-gut membrane proteins in Aedes aegypti larvae including prohibitin, a protein recently identified as a receptor that also mediates entry of dengue virus into Aedes cells. This study confirms the interaction between Cry4B and prohibitin by co-immunoprecipitation analysis and demonstrates colocalization of prohibitin and Cry4B by confocal microscopy. While activated Cry4B toxin showed high larvicidal activity, it was not cytotoxic to two Aedes cell lines, allowing determination of its effect on dengue virus infectivity in the absence of Cry4B-induced cell lysis. Pre-exposure of Aedes cells to Cry4B resulted in a significant reduction in the number of infected cells compared to untreated cells.
Probing for primary functions of prohibitin in Trypanosoma brucei
Czech Academy of Sciences Publication Activity Database
Týč, Jiří; Faktorová, Drahomíra; Kriegová, Eva; Jirků, Milan; Vávrová, Zuzana; Maslov, D. A.; Lukeš, Julius
2010-01-01
Roč. 40, č. 1 (2010), s. 73-83 ISSN 0020-7519 R&D Projects: GA ČR GA204/09/1667; GA AV ČR IAA500960705; GA ČR(CZ) GP204/06/P423 Institutional research plan: CEZ:AV0Z60220518 Keywords : prohibitin * mitochondrion * morphology * mitochondrial translation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.822, year: 2010
Czech Academy of Sciences Publication Activity Database
Van Aken, O.; Pečenková, Tamara; van de Cotte, B.; De Rycke, R.; Eeckhout, D.; Fromm, H.; De Jaeger, G.; Witters, E.; Beemster, G.T.S.; Inzé, D.; Van Breusegem, F.
2007-01-01
Roč. 52, č. 5 (2007), s. 850-864 ISSN 0960-7412 Institutional research plan: CEZ:AV0Z50380511 Keywords : Arabidopsis * prohibitins * mitochondria Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 6.751, year: 2007
Zhou, Tian-Biao; Ou, Chao; Rong, Liang; Drummen, Gregor P C
2014-09-01
All-trans retinoic acid (ATRA) exerts various effects on physiological processes such as cell growth, differentiation, apoptosis and inflammation. Prohibitins (PHB), including prohibitin 1 (PHB1) and prohibitin 2 (PHB2), are evolutionary conserved and pleiotropic proteins implicated in various cellular functions, including proliferation, tumor suppression, apoptosis, transcription, and mitochondrial protein folding. The renin-angiotensin-aldosterone system plays a pivotal role in the regulation of blood pressure and volume homeostasis. All these factors and systems have been implicated in renal interstitial fibrosis. Therefore, the objective of this study was to investigate the effect of ATRA treatment on the renin-angiotensin-aldosterone system and expression of prohibitins to further understand its role in the processes leading to renal interstitial fibrosis. The hypoxic and oxidative stress conditions in obstructive renal disease were simulated in a hypoxia/reoxygenation model with renal tubular epithelial cells (RTEC) as a model system. Subsequently, the effect of ATRA on mRNA and protein expression levels was determined and correlations were established between factors involved in the renin-angiotensin-aldosterone system, the prohibitins, cellular redox status, renal interstitial fibrosis and ATRA treatment. Correlation analysis showed that both PHB1 and PHB2 protein levels were negatively correlated with angiotensin I, ACE1, angiotensin II, TGF-β1, Col-IV, FN, ROS, and MDA (PHB1: r = -0.792, -0.834, -0.805, -0.795, -0.778, -0.798, -0.751, -0.682; PHB2: r = -0.872, -0.799, -0.838, -0.773, -0.769, -0.841, -0.794, -0.826; each p system under hypoxia/reoxygenation conditions. © The Author(s) 2014.
Differential binding of prohibitin-2 to estrogen receptor α and to drug-resistant ERα mutants
Energy Technology Data Exchange (ETDEWEB)
Chigira, Takeru, E-mail: 8120661875@mail.ecc.u-tokyo.ac.jp [Department of Chemistry and Biotechnology, School of Engineering, University of Tokyo, 4-6-1 Shirokanedai, Minato-ku, Tokyo 108-8639 (Japan); Nagatoishi, Satoru, E-mail: nagatoishi@bioeng.t.u-tokyo.ac.jp [Department of Bioengineering, School of Engineering, University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-8654 (Japan); Tsumoto, Kouhei, E-mail: tsumoto@bioeng.t.u-tokyo.ac.jp [Department of Chemistry and Biotechnology, School of Engineering, University of Tokyo, 4-6-1 Shirokanedai, Minato-ku, Tokyo 108-8639 (Japan); Department of Bioengineering, School of Engineering, University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo 113-8654 (Japan)
2015-08-07
Endocrine resistance is one of the most challenging problems in estrogen receptor alpha (ERα)-positive breast cancer. The transcriptional activity of ERα is controlled by several coregulators, including prohibitin-2 (PHB2). Because of its ability to repress the transcriptional activity of activated ERα, PHB2 is a promising antiproliferative agent. In this study, were analyzed the interaction of PHB2 with ERα and three mutants (Y537S, D538G, and E380Q) that are frequently associated with a lack of sensitivity to hormonal treatments, to help advance novel drug discovery. PHB2 bound to ERα wild-type (WT), Y537S, and D538G, but did not bind to E380Q. The binding thermodynamics of Y537S and D538G to PHB2 were favorably altered entropically compared with those of WT to PHB2. Our results show that PHB2 binds to the ligand binding domain of ERα with a conformational change in the helix 12 of ERα. - Highlights: • Molten globule-likeness of an ERα repressor Prohibitin-2 (PHB2) is identified. • The thermodynamics is validated for the interaction between ERα and PHB2. • PHB2 binds to Y537S and D538G mutants of ERα commonly found in breast cancer. • ERα WT and mutants showed different thermodynamic parameters in the binding to PHB2. • ERα binds to PHB2 with conformational change involving packing of helix 12.
Koushyar, S.; Economides, G.; Zaat, S.; Jiang, W.; Bevan, C. L.; Dart, D. A.
2017-01-01
Prohibitin (PHB) is a tumour suppressor molecule with pleiotropic activities across several cellular compartments including mitochondria, cell membrane and the nucleus. PHB and the steroid-activated androgen receptor (AR) have an interplay where AR downregulates PHB, and PHB represses AR.
Capsaicin binds to prohibitin 2 and displaces it from the mitochondria to the nucleus
International Nuclear Information System (INIS)
Kuramori, Chikanori; Azuma, Motoki; Kume, Kanako; Kaneko, Yuki; Inoue, Atsushi; Yamaguchi, Yuki; Kabe, Yasuaki; Hosoya, Takamitsu; Kizaki, Masahiro; Suematsu, Makoto; Handa, Hiroshi
2009-01-01
Capsaicin is widely used as a food additive and as an analgesic agent. Besides its well-known role in nociception, which is mediated by vanilloid receptor 1 specifically expressed in dorsal root ganglion neurons, capsaicin has also been considered as a potential anticancer agent, as it inhibits cell proliferation and induces apoptosis in various types of cancer cells. Here we identified a new molecular target of capsaicin from human myeloid leukemia cells. We show that capsaicin binds to prohibitin (PHB) 2, which is normally localized to the inner mitochondrial membrane, and induces its translocation to the nucleus. PHB2 is implicated in the maintenance of mitochondrial morphology and the control of apoptosis. We also provide evidence suggesting that capsaicin causes apoptosis directly through the mitochondria and that PHB2 contributes to capsaicin-induced apoptosis at multiple levels. This work will serve as an important foundation for further understanding of anticancer activity of capsaicin.
Involvement of Prohibitin Upregulation in Abrin-Triggered Apoptosis
Directory of Open Access Journals (Sweden)
Yu-Huei Liu
2012-01-01
Full Text Available Abrin (ABR, a protein purified from the seeds of Abrus precatorius, induces apoptosis in various types of cancer cells. However, the detailed mechanism remains largely uncharacterized. By using a cDNA microarray platform, we determined that prohibitin (PHB, a tumor suppressor protein, is significantly upregulated in ABR-triggered apoptosis. ABR-induced upregulation of PHB is mediated by the stress-activated protein kinase/c-Jun NH2-terminal kinase (SAPK/JNK pathway, as demonstrated by chemical inhibitors. In addition, ABR significantly induced the expression of Bax as well as the activation of caspase-3 and poly(ADP-ribose polymerase (PARP in Jurkat T cells, whereas the reduction of PHB by specific RNA interference delayed ABR-triggered apoptosis through the proapoptotic genes examined. Moreover, our results also indicated that nuclear translocation of the PHB-p53 complex may play a role in the transcription of Bax. Collectively, our data show that PHB plays a role in ABR-induced apoptosis, which may be helpful for the development of diagnostic or therapeutic agents.
Prohibitin( PHB) roles in granulosa cell physiology.
Chowdhury, Indrajit; Thomas, Kelwyn; Thompson, Winston E
2016-01-01
Ovarian granulosa cells (GC) play an important role in the growth and development of the follicle in the process known as folliculogenesis. In the present review, we focus on recent developments in prohibitin (PHB) research in relation to GC physiological functions. PHB is a member of a highly conserved eukaryotic protein family containing the repressor of estrogen activity (REA)/stomatin/PHB/flotillin/HflK/C (SPFH) domain (also known as the PHB domain) found in diverse species from prokaryotes to eukaryotes. PHB is ubiquitously expressed in a circulating free form or is present in multiple cellular compartments including mitochondria, nucleus and plasma membrane. In mitochondria, PHB is anchored to the mitochondrial inner membrane and forms complexes with the ATPases associated with proteases having diverse cellular activities. PHB continuously shuttles between the mitochondria, cytosol and nucleus. In the nucleus, PHB interacts with various transcription factors and modulates transcriptional activity directly or through interactions with chromatin remodeling proteins. Many functions have been attributed to the mitochondrial and nuclear PHB complexes such as cellular differentiation, anti-proliferation, morphogenesis and maintenance of the functional integrity of the mitochondria. However, to date, the regulation of PHB expression patterns and GC physiological functions are not completely understood.
Mao, Hai-Tao; Wang, Da-Hui; Lan, Zhou; Zhou, Hong; Yang, Wan-Xi
2012-05-01
Prohibitin is essential for intracellular homeostasis and stabilization of mitochondrial respiratory chain complexes. To explore its functions during spermiogenesis of Octopus tankahkeei (O. tankahkeei), we have cloned and sequenced the cDNA of this mammalian PHB homologue (termed ot-PHB) from the testes of O. tankahkeei. The 1165 bp ot-phb cDNA contains a 100 bp 5' UTR, a 882 bp open reading frame and a 183 bp 3' UTR. The putative ot-PHB protein owns a transmembrane domain from 6 to 31 amino acid (aa) and a putative PHB domain from 26 to 178 aa. Protein alignment demonstrated that ot-PHB had 73.3, 73.6, 74.0, 75.1, and 45.4% identity with its homologues in Homo sapiens, Mus muculus, Danio rerio, Xenopus tropicalis and Trypanosoma brucei, respectively. Tissue distribution profile analysis revealed its presence in all the tissues examined. In situ hybridization in spermiogenic cells demonstrated that ot-phb was expressed moderately at the beginning of the spermiogenesis. The abundance of transcripts increased in intermediate spermatids and in drastically remodeling final spermatids. In mature spermatozoa, the residuary transcripts concentrated around the chondriosomal mantle where mitochondria assemble around. In summary, the expression of ot-phb during spermiogenesis implicates a potential function of this protein during mitochondrial ubiquitination. It is the first time to implicate the role of prohibitin in cephalopod spermiogenesis.
Modeling, Control and Coordination of Helicopter Systems
Ren, Beibei; Chen, Chang; Fua, Cheng-Heng; Lee, Tong Heng
2012-01-01
Modeling, Control and Coordination of Helicopter Systems provides a comprehensive treatment of helicopter systems, ranging from related nonlinear flight dynamic modeling and stability analysis to advanced control design for single helicopter systems, and also covers issues related to the coordination and formation control of multiple helicopter systems to achieve high performance tasks. Ensuring stability in helicopter flight is a challenging problem for nonlinear control design and development. This book is a valuable reference on modeling, control and coordination of helicopter systems,providing readers with practical solutions for the problems that still plague helicopter system design and implementation. Readers will gain a complete picture of helicopters at the systems level, as well as a better understanding of the technical intricacies involved. This book also: Presents a complete picture of modeling, control and coordination for helicopter systems Provides a modeling platform for a general class of ro...
Energy Technology Data Exchange (ETDEWEB)
Anon.
1986-07-15
While physics Laboratories are having to absorb cuts in resources, the machines they rely on are becoming more and more complex, requiring increasingly sophisticated systems. Rather than being a resourceful engineer or physicist able to timber together solutions in his 'backyard', the modern controls specialist has become a professional in his own right. Because of possible conflicts between increasing sophistication on one hand and scarcer resources on the other, there was felt a need for more contacts among controls specialists to exchange experiences, coordinate development and discuss 'family problems', away from meetings where the main interest is on experimental physics.
Coordinated control of micro-grid based on distributed moving horizon control.
Ma, Miaomiao; Shao, Liyang; Liu, Xiangjie
2018-05-01
This paper proposed the distributed moving horizon coordinated control scheme for the power balance and economic dispatch problems of micro-grid based on distributed generation. We design the power coordinated controller for each subsystem via moving horizon control by minimizing a suitable objective function. The objective function of distributed moving horizon coordinated controller is chosen based on the principle that wind power subsystem has the priority to generate electricity while photovoltaic power generation coordinates with wind power subsystem and the battery is only activated to meet the load demand when necessary. The simulation results illustrate that the proposed distributed moving horizon coordinated controller can allocate the output power of two generation subsystems reasonably under varying environment conditions, which not only can satisfy the load demand but also limit excessive fluctuations of output power to protect the power generation equipment. Copyright © 2018 ISA. Published by Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Anon.
1986-01-01
While physics Laboratories are having to absorb cuts in resources, the machines they rely on are becoming more and more complex, requiring increasingly sophisticated systems. Rather than being a resourceful engineer or physicist able to timber together solutions in his 'backyard', the modern controls specialist has become a professional in his own right. Because of possible conflicts between increasing sophistication on one hand and scarcer resources on the other, there was felt a need for more contacts among controls specialists to exchange experiences, coordinate development and discuss 'family problems', away from meetings where the main interest is on experimental physics
Self-triggered coordination with ternary controllers
De Persis, Claudio; Frasca, Paolo
2012-01-01
This paper regards coordination of networked systems with ternary controllers. We develop a hybrid coordination system which implements a self-triggered communication policy, based on polling the neighbors upon need. We prove that the proposed scheme ensures finite-time convergence to a neighborhood
Prohibitin plays a critical role in Enterovirus 71 neuropathogenesis.
Directory of Open Access Journals (Sweden)
Issac Horng Khit Too
2018-01-01
Full Text Available A close relative of poliovirus, enterovirus 71 (EV71 is regarded as an important neurotropic virus of serious public health concern. EV71 causes Hand, Foot and Mouth Disease and has been associated with neurological complications in young children. Our limited understanding of the mechanisms involved in its neuropathogenesis has hampered the development of effective therapeutic options. Here, using a two-dimensional proteomics approach combined with mass spectrometry, we have identified a unique panel of host proteins that were differentially and dynamically modulated during EV71 infection of motor-neuron NSC-34 cells, which are found at the neuromuscular junctions where EV71 is believed to enter the central nervous system. Meta-analysis with previously published proteomics studies in neuroblastoma or muscle cell lines revealed minimal overlapping which suggests unique host-pathogen interactions in NSC-34 cells. Among the candidate proteins, we focused our attention on prohibitin (PHB, a protein that is involved in multiple cellular functions and the target of anti-cancer drug Rocaglamide (Roc-A. We demonstrated that cell surface-expressed PHB is involved in EV71 entry into neuronal cells specifically, while membrane-bound mitochondrial PHB associates with the virus replication complex and facilitates viral replication. Furthermore, Roc-A treatment of EV71-infected neuronal cells reduced significantly virus yields. However, the inhibitory effect of Roc-A on PHB in NSC-34 cells was not through blocking the CRAF/MEK/ERK pathway as previously reported. Instead, Roc-A treated NSC-34 cells had lower mitochondria-associated PHB and lower ATP levels that correlated with impaired mitochondria integrity. In vivo, EV71-infected mice treated with Roc-A survived longer than the vehicle-treated animals and had significantly lower virus loads in their spinal cord and brain, whereas virus titers in their limb muscles were comparable to controls. Together, this
Prohibitin plays a critical role in Enterovirus 71 neuropathogenesis
Too, Issac Horng Khit; Bonne, Isabelle; Tan, Eng Lee; Chu, Justin Jang Hann; Alonso, Sylvie
2018-01-01
A close relative of poliovirus, enterovirus 71 (EV71) is regarded as an important neurotropic virus of serious public health concern. EV71 causes Hand, Foot and Mouth Disease and has been associated with neurological complications in young children. Our limited understanding of the mechanisms involved in its neuropathogenesis has hampered the development of effective therapeutic options. Here, using a two-dimensional proteomics approach combined with mass spectrometry, we have identified a unique panel of host proteins that were differentially and dynamically modulated during EV71 infection of motor-neuron NSC-34 cells, which are found at the neuromuscular junctions where EV71 is believed to enter the central nervous system. Meta-analysis with previously published proteomics studies in neuroblastoma or muscle cell lines revealed minimal overlapping which suggests unique host-pathogen interactions in NSC-34 cells. Among the candidate proteins, we focused our attention on prohibitin (PHB), a protein that is involved in multiple cellular functions and the target of anti-cancer drug Rocaglamide (Roc-A). We demonstrated that cell surface-expressed PHB is involved in EV71 entry into neuronal cells specifically, while membrane-bound mitochondrial PHB associates with the virus replication complex and facilitates viral replication. Furthermore, Roc-A treatment of EV71-infected neuronal cells reduced significantly virus yields. However, the inhibitory effect of Roc-A on PHB in NSC-34 cells was not through blocking the CRAF/MEK/ERK pathway as previously reported. Instead, Roc-A treated NSC-34 cells had lower mitochondria-associated PHB and lower ATP levels that correlated with impaired mitochondria integrity. In vivo, EV71-infected mice treated with Roc-A survived longer than the vehicle-treated animals and had significantly lower virus loads in their spinal cord and brain, whereas virus titers in their limb muscles were comparable to controls. Together, this study uncovers
Prohibitin/annexin 2 interaction regulates fatty acid transport in adipose tissue
Salameh, Ahmad; Daquinag, Alexes C.; Staquicini, Daniela I.; An, Zhiqiang; Pasqualini, Renata; Kolonin, Mikhail G.
2016-01-01
We have previously identified prohibitin (PHB) and annexin A2 (ANX2) as proteins interacting on the surface of vascular endothelial cells in white adipose tissue (WAT) of humans and mice. Here, we demonstrate that ANX2 and PHB also interact in adipocytes. Mice lacking ANX2 have normal WAT vascularization, adipogenesis, and glucose metabolism but display WAT hypotrophy due to reduced fatty acid uptake by WAT endothelium and adipocytes. By using cell culture systems in which ANX2/PHB binding is disrupted either genetically or through treatment with a blocking peptide, we show that fatty acid transport efficiency relies on this protein complex. We also provide evidence that the interaction between ANX2 and PHB mediates fatty acid transport from the endothelium into adipocytes. Moreover, we demonstrate that ANX2 and PHB form a complex with the fatty acid transporter CD36. Finally, we show that the colocalization of PHB and CD36 on adipocyte surface is induced by extracellular fatty acids. Together, our results suggest that an unrecognized biochemical interaction between ANX2 and PHB regulates CD36-mediated fatty acid transport in WAT, thus revealing a new potential pathway for intervention in metabolic diseases. PMID:27468426
Power Generation and Distribution via Distributed Coordination Control
Kim, Byeong-Yeon; Oh, Kwang-Kyo; Ahn, Hyo-Sung
2014-01-01
This paper presents power coordination, power generation, and power flow control schemes for supply-demand balance in distributed grid networks. Consensus schemes using only local information are employed to generate power coordination, power generation and power flow control signals. For the supply-demand balance, it is required to determine the amount of power needed at each distributed power node. Also due to the different power generation capacities of each power node, coordination of pow...
Coordinated Voltage Control of Active Distribution Network
Directory of Open Access Journals (Sweden)
Xie Jiang
2016-01-01
Full Text Available This paper presents a centralized coordinated voltage control method for active distribution network to solve off-limit problem of voltage after incorporation of distributed generation (DG. The proposed method consists of two parts, it coordinated primal-dual interior point method-based voltage regulation schemes of DG reactive powers and capacitors with centralized on-load tap changer (OLTC controlling method which utilizes system’s maximum and minimum voltages, to improve the qualified rate of voltage and reduce the operation numbers of OLTC. The proposed coordination has considered the cost of capacitors. The method is tested using a radial edited IEEE-33 nodes distribution network which is modelled using MATLAB.
Directory of Open Access Journals (Sweden)
Harish Chander
Full Text Available We previously reported that the degradation of prohibitin by the SCF(Skp2B ubiquitin ligase results in a defect in the activity of p53. We also reported that MMTV-Skp2B transgenic mice develop mammary gland tumors that are characterized by an increased proteolytic cleavage of the insulin-like growth factor binding protein 4 (IGFBP-4, an inhibitor of IGF signaling. However, whether a link exists between a defect in p53 activity and proteolysis of IGFBP-4 was not established.We analyzed the levels of pregnancy-associated plasma protein A (PAPP-A, the protease of IGFBP-4, in MMTV-Skp2B transgenic mice and found that PAPP-A levels are elevated. Further, we found a p53 binding site in intron 1 of the PAPP-A gene and that both wild type and mutant p53 bind to this site. However, binding of wild type p53 results in the transcriptional repression of PAPP-A, while binding of mutant p53 results in the transcriptional activation of PAPP-A. Since MMTV-Skp2B mice express wild type p53 and yet show elevated levels of PAPP-A, at first, these observations appeared contradictory. However, further analysis revealed that the defect in p53 activity in Skp2B overexpressing cells does not only abolish the activity of wild type of p53 but actually mimics that of mutant p53. Our results suggest that in absence of prohibitin, the half-life of p53 is increased and like mutant p53, the conformation of p53 is denatured.These observations revealed a novel function of prohibitin as a chaperone of p53. Further, they suggest that binding of denatured p53 in intron 1 causes an enhancer effect and increases the transcription of PAPP-A. Therefore, these findings indicate that the defect in p53 function and the increased proteolysis of IGFBP-4, we had observed, represent two components of the same pathway, which contributes to the oncogenic function of Skp2B.
International Nuclear Information System (INIS)
Cheng Shouyu; Peng Minjun; Liu Xinkai; Zhao Qiang; Deng Xiangxin
2014-01-01
Nuclear power plant (NPP) is a multi-input and multi-output, no-linear and time-varying complex system. The conventional PID controller is usually used in NPP control system which is based on analog instrument. The system parameters are easy to overshoot and the response time is longer in the control mode of the conventional PID. In order to improve this condition, a new coordinated control strategy which is based on expert system and the original controllers in the digital instrument and control technology was presented. In order to verify and validate it, the proposed coordinated control technology was tested by the full-scope real-time simulation system. The results prove that using digital instrument and control technology to achieve coordinated controller is feasible, the coordinated controller can effectively improve the dynamic operating characteristics of the system, and the coordinated controller is superior to the conventional PID controller in control performance. (authors)
Ande, Sudharsana R; Nguyen, K Hoa; Grégoire Nyomba, B L; Mishra, Suresh
2016-03-23
Obesity increases the risk for nonalcoholic steatohepatitis (NASH) and hepatocarcinogenesis. However, the underlying mechanisms involved in the disease process remain unclear. Recently, we have developed a transgenic obese mouse model (Mito-Ob) by prohibitin mediated mitochondrial remodeling in adipocytes. The Mito-Ob mice develop obesity in a sex-neutral manner, but obesity-associated adipose inflammation and metabolic dysregulation in a male sex-specific manner. Here we report that with aging, the male Mito-Ob mice spontaneously develop obesity-linked NASH and hepatocellular carcinoma (HCC). In contrast, the female Mito-Ob mice maintained normal glucose and insulin levels and did not develop NASH and HCC. The anti-inflammatory peptide ghrelin was significantly upregulated in the female mice and down regulated in the male mice compared with respective control mice. In addition, a reduction in the markers of mitochondrial content and function was found in the liver of male Mito-Ob mice with NASH/HCC development. We found that ERK1/2 signaling was significantly upregulated whereas STAT3 signaling was significantly down regulated in the tumors from Mito-Ob mice. These data provide a proof-of-concept that the metabolic and inflammatory status of the adipose tissue and their interplay at the systemic and hepatic level play a central role in the pathogenesis of obesity-linked NASH and HCC.
Robust Self-Triggered Coordination With Ternary Controllers
De Persis, Claudio; Frasca, Paolo; Nair, G.N.
2013-01-01
This paper regards the coordination of networked systems, studied in the framework of hybrid dynamical systems. We design a coordination scheme which combines the use of ternary controllers with a self-triggered communication policy. The communication policy requires the agents to measure, at each
Robust self-triggered coordination with ternary controllers
De Persis, Claudio; Frasca, Paolo
2013-01-01
This paper regards the coordination of networked systems, studied in the framework of hybrid dynamical systems. We design a coordination scheme which combines the use of ternary controllers with a self-triggered communication policy. The communication policy requires the agents to measure, at each
Control Coordination of Large Scale Hereditary Systems.
1985-07-01
Theory - A Hilbert Space Approach, (Academic Press, New York, 1982). [4] W. Findeisen , F. N. Bailey, M. Brdys, K Malinowski, P. Tatjewski and A. Wozniak... Findeisen et al. (1980), in the sense that local models are used in the design of component control laws and a higher level coordination problem is...Vol. 1, pp. 590-591, 1985. 3. W. Findeisen , F.N. Bailley, M. Brdys, K. Malinowski, P. Tatjewski and A. Wozniak, Control Coordination in Hierarchical
Control coordination abilities in shock combat sports
Directory of Open Access Journals (Sweden)
Natalya Boychenko
2014-12-01
Full Text Available Purpose: optimize the process control level of coordination abilities in martial arts. Material and Methods: analysis and compilation of scientific and methodological literature, interviews with coaches of drum martial arts, video analysis techniques, teacher observations. Results: identified specific types of coordination abilities in shock combat sports. Pod branny and offered specific and nonspecific tests to monitor the level of species athletes coordination abilities. Conclusion: it is determined that in order to achieve victory in the fight martial artists to navigate the space to be able to assess and manage dynamic and spatio-temporal parameters of movements, maintain balance, have a high coordination of movements. The proposed tests to monitor species coordination abilities athletes allow an objective assessment of not only the overall level of coordination, and the level of specific types of manifestations of this ability.
Development of the Coordination between Posture and Manual Control
Haddad, Jeffrey M.; Claxton, Laura J.; Keen, Rachel; Berthier, Neil E.; Riccio, Gary E.; Hamill, Joseph; Van Emmerik, Richard E. A.
2012-01-01
Studies have suggested that proper postural control is essential for the development of reaching. However, little research has examined the development of the coordination between posture and manual control throughout childhood. We investigated the coordination between posture and manual control in children (7- and 10-year-olds) and adults during…
Breakdowns in Coordination Between Air Traffic Controllers
Bearman, Chris; Orasanu, Judith; Miller, Ronald C.
2011-01-01
This talk outlines the complexity of coordination in air traffic control, introduces the NextGen technologies, identifies common causes for coordination breakdowns in air traffic control and examines whether these causes are likely to be reduced with the introduction of NextGen technologies. While some of the common causes of breakdowns will be reduced in a NextGen environment this conclusion should be drawn carefully given the current stage of development of the technologies and the observation that new technologies often shift problems rather than reduce them.
Towards Coordination and Control of Multi-robot Systems
DEFF Research Database (Denmark)
Quottrup, Michael Melholt
This thesis focuses on control and coordination of mobile multi-robot systems (MRS). MRS can often deal with tasks that are difficult to be accomplished by a single robot. One of the challenges is the need to control, coordinate and synchronize the operation of several robots to perform some...... specified task. This calls for new strategies and methods which allow the desired system behavior to be specified in a formal and succinct way. Two different frameworks for the coordination and control of MRS have been investigated. Framework I - A network of robots is modeled as a network of multi...... a requirement specification in Computational Tree Logic (CTL) for a network of robots. The result is a set of motion plans for the robots which satisfy the specification. Framework II - A framework for controller synthesis for a single robot with respect to requirement specification in Linear-time Temporal...
Shi, Ying; Guo, Sicheng; Wang, Ying; Liu, Xin; Li, Qingwei; Li, Tiesong
2018-03-02
Prohibitin 2(PHB2) is a member of the SFPH trans-membrane family proteins. It is a highly conserved and functionally diverse protein that plays an important role in preserving the structure and function of the mitochondria. In this study, the lamprey PHB2 gene was expressed in HeLa cells to investigate its effect on cell proliferation. The effect of Lm-PHB2 on the proliferation of HeLa cells was determined by treating the cells with pure Lm-PHB2 protein followed by MTT assay. Using the synchronization method with APC-BrdU and PI double staining revealed rLm-PHB2 treatment induced the decrease of both S phase and G0/G1 phase and then increase of G2/M phase. Similarly, cells transfected with pEGFP-N1-Lm-PHB2 also exhibited remarkable reduction in proliferation. Western blot and quantitative real-time PCR(qRT-PCR) assays suggested that Lm-PHB2 caused cell cycle arrest in HeLa cells through inhibition of CDC25C and CCNB1 expression. According to our western blot analysis, Lm-PHB2 was also found to reduce the expression level of Wee1 and PLK1 and the phosphorylation level of CCNB1, CDC25C and CDK1 in HeLa cells. Lamprey prohibitin 2 could arrest G2/M phase transition of HeLa cells through down-regulating expression and phosphorylation level of cell cycle proteins.
Coordination control of distributed systems
Villa, Tiziano
2015-01-01
This book describes how control of distributed systems can be advanced by an integration of control, communication, and computation. The global control objectives are met by judicious combinations of local and nonlocal observations taking advantage of various forms of communication exchanges between distributed controllers. Control architectures are considered according to increasing degrees of cooperation of local controllers: fully distributed or decentralized control, control with communication between controllers, coordination control, and multilevel control. The book covers also topics bridging computer science, communication, and control, like communication for control of networks, average consensus for distributed systems, and modeling and verification of discrete and of hybrid systems. Examples and case studies are introduced in the first part of the text and developed throughout the book. They include: control of underwater vehicles, automated-guided vehicles on a container terminal, contro...
A novel coordinated control for Integrated Pressurized Water Reactor
International Nuclear Information System (INIS)
Zhao, Yuxin; Du, Xue; Xia, Genglei; Gao, Feng
2015-01-01
Highlights: • Proposed IPWR coordinated control strategy to avoid flow instability of OTSG. • Tuned PID controller parameters by Fuzzy kernel wavelet neural network with kernel trick and adaptive variable step-size. • Transition process exhibit the effectiveness of the novel IPWR control system. - Abstract: Integrated Pressurized Water Reactor (IPWR) has the characteristic of strong coupling, nonlinearity and complicated dynamic performance, which requires high standards of the control strategy and controller design. Most of IPWR systems utilize control strategy of ideal steady-state and PID controller, even though this strategy causes flow instability in the once through steam generator (OTSG) in low load conditions. Besides, the simple form of PID limits the performance developing which could not appropriately satisfy the requirements for quality. Motivated by these drawbacks, this paper proposes an IPWR coordinated control strategy and adopts PID controller to control each subsystem. The control strategy considers the system as a two-level hierarchical control system, and considers coordinating controller and bottom controllers. In the period of controller design, this strategy utilizes PID controller to control each subsystem, and modifies the controller parameters in real time by Fuzzy-KWNN algorithm, which adaptively achieves the system adjustment. Finally, simulation results are presented to exhibit the effectiveness of the proposed IPWR control system
Dual motor drive vehicle speed synchronization and coordination control strategy
Huang, Hao; Tu, Qunzhang; Jiang, Chenming; Ma, Limin; Li, Pei; Zhang, Hongxing
2018-04-01
Multi-motor driven systems are more and more widely used in the field of electric engineering vehicles, as a result of the road conditions and the variable load of engineering vehicles, makes multi-motors synchronization coordinated control system as a key point of the development of the electric vehicle drive system. This paper based on electrical machinery transmission speed in the process of engineering vehicles headed for coordinated control problem, summarized control strategies at home and abroad in recent years, made analysis and comparison of the characteristics, finally discussed the trend of development of the multi-motor coordination control, provided a reference for synchronized control system research of electric drive engineering vehicles.
Coordinated Voltage Control Scheme for VSC-HVDC Connected Wind Power Plants
DEFF Research Database (Denmark)
Guo, Yifei; Gao, Houlei; Wu, Qiuwei
2017-01-01
This paper proposes a coordinated voltage control scheme based on model predictive control (MPC) for voltage source converter‐based high voltage direct current (VSC‐HVDC) connected wind power plants (WPPs). In the proposed scheme, voltage regulation capabilities of VSC and WTGs are fully utilized...... and optimally coordinated. Two control modes, namely operation optimization mode and corrective mode, are designed to coordinate voltage control and economic operation of the system. In the first mode, the control objective includes the bus voltages, power losses and dynamic Var reserves of wind turbine...
Jiang, L; Dong, P; Zhang, Z; Li, C; Li, Y; Liao, Y; Li, X; Wu, Z; Guo, S; Mai, S; Xie, D; Liu, Z; Zhou, F
2015-01-01
Bladder cancer (BC) is very common and associated with significant morbidity and mortality, though the molecular underpinnings of its origination and progression remain poorly understood. In this study, we demonstrate that Prohibitin 1 (PHB) was overexpressed in human BC tissues and that PHB upregulation was associated with poor prognosis. We also found that PHB was necessary and sufficient for BC cell proliferation. Interestingly, the overexpressed PHB was primarily found within mitochondria, and we provide the first direct evidence that phosphorylation by Akt at Thr258 of PHB induces this mitochondrial localization. Inhibiton of Akt reverses these effects and inhibited the proliferation of BC cells. Finally, the phosphorylation of PHB was required for BC cell proliferation, further implicating the importance of the Akt in BC. Taken together, these findings identify the Akt/PHB signaling cascade as a novel mechanism of cancer cell proliferation and provide the scientific basis for the establishment of PHB as a new prognostic marker and treatment target for BC. PMID:25719244
Coordinate control of integral reactor based on single neuron PID controller
International Nuclear Information System (INIS)
Liu Yan; Xia Hong
2014-01-01
As one of the main type of reactors in the future, the development of the integral reactor has attracted worldwide attention. On the basis of understanding the background of the integral reactor, the author will be familiar with and master the power control of reactor and the feedwater flow control of steam generator, and the speed control of turbine (turbine speed control is associated with the turbine load control). According to the expectative program 'reactor power following turbine load' of the reactor, it will make coordinate control of the three and come to a overall control scheme. The author will use the supervisory learning algorithm of Hebb for single neuron PID controller with self-adaptation to study the coordinate control of integral reactor. Compared with conventional PI or PID controller, to a certain extent, it solves the problems that traditional PID controller is not easy to tune real-time parameters and lack of effective control for a number of complex processes and slow-varying parameter systems. It improves the security, reliability, stability and flexibility of control process and achieves effective control of the system. (authors)
Optimal coordination and control of posture and movements.
Johansson, Rolf; Fransson, Per-Anders; Magnusson, Måns
2009-01-01
This paper presents a theoretical model of stability and coordination of posture and locomotion, together with algorithms for continuous-time quadratic optimization of motion control. Explicit solutions to the Hamilton-Jacobi equation for optimal control of rigid-body motion are obtained by solving an algebraic matrix equation. The stability is investigated with Lyapunov function theory and it is shown that global asymptotic stability holds. It is also shown how optimal control and adaptive control may act in concert in the case of unknown or uncertain system parameters. The solution describes motion strategies of minimum effort and variance. The proposed optimal control is formulated to be suitable as a posture and movement model for experimental validation and verification. The combination of adaptive and optimal control makes this algorithm a candidate for coordination and control of functional neuromuscular stimulation as well as of prostheses. Validation examples with experimental data are provided.
Coordinated Control of Wave Energy Converters Subject to Motion Constraints
Directory of Open Access Journals (Sweden)
Liguo Wang
2016-06-01
Full Text Available In this paper, a generic coordinated control method for wave energy converters is proposed, and the constraints on motion amplitudes and the hydrodynamic interaction between converters are considered. The objective of the control problem is to maximize the energy converted from ocean waves, and this is achieved by coordinating the power take-off (PTO damping of each wave energy converter in the frequency domain in each sea state. In a case study, a wave energy farm consisting of four converters based on the concept developed by Uppsala University is studied. In the solution, motion constraints, including constraints on the amplitudes of displacement and velocity, are included. Twelve months of sea states, based on measured wave data at the Lysekil test site on the Swedish west coast, are used in the simulation to evaluate the performance of the wave energy farm using the new method. Results from the new coordinated control method and traditional control method are compared, indicating that the coordinated control of wave energy converters is an effective way to improve the energy production of wave energy farm in harmonic waves.
Neuromuscular Control and Coordination during Cycling
Li, Li
2004-01-01
The neuromuscular control aspect of cycling has been investigated through the effects of modifying posture and cadence. These studies show that changing posture has a more profound influence on neuromuscular coordination than does changing slope. Most of the changes with standing posture occur late in the downstroke: increased ankle and knee joint…
Fuzzy Coordinated PI Controller: Application to the Real-Time Pressure Control Process
Directory of Open Access Journals (Sweden)
N. Kanagaraj
2008-01-01
Full Text Available This paper presents the real-time implementation of a fuzzy coordinated classical PI control scheme for controlling the pressure in a pilot pressure tank system. The fuzzy system has been designed to track the variation parameters in a feedback loop and tune the classical controller to achieve a better control action for load disturbances and set point changes. The error and process inputs are chosen as the inputs of fuzzy system to tune the conventional PI controller according to the process condition. This online conventional controller tuning technique will reduce the human involvement in controller tuning and increase the operating range of the conventional controller. The proposed control algorithm is experimentally implemented for the real-time pressure control of a pilot air tank system and validated using a high-speed 32-bit ARM7 embedded microcontroller board (ATMEL AT91M55800A. To demonstrate the performance of the fuzzy coordinated PI control scheme, results are compared with a classical PI and PI-type fuzzy control method. It is observed that the proposed controller structure is able to quickly track the parameter variation and perform better in load disturbances and also for set point changes.
Prohibitin-induced obesity leads to anovulation and polycystic ovary in mice
Directory of Open Access Journals (Sweden)
Sudharsana Rao Ande
2017-06-01
Full Text Available Polycystic ovary syndrome (PCOS is a prevalent endocrine disorder and the most common cause of female infertility. However, its etiology and underlying mechanisms remain unclear. Here we report that a transgenic obese mouse (Mito-Ob developed by overexpressing prohibitin in adipocytes develops polycystic ovaries. Initially, the female Mito-Ob mice were equally fertile to their wild-type littermates. The Mito-Ob mice began to gain weight after puberty, became significantly obese between 3-6 months of age, and ∼25% of them had become infertile by 9 months of age. Despite obesity, female Mito-Ob mice maintained glucose homeostasis and insulin sensitivity similar to their wild-type littermates. Mito-Ob mice showed morphologically distinct polycystic ovaries and elevated estradiol, but normal testosterone and insulin levels. Histological analysis of the ovaries showed signs of impaired follicular dynamics, such as preantral follicular arrest and reduced number, or absence, of corpus luteum. The ovaries of the infertile Mito-Ob mice were closely surrounded by periovarian adipose tissue, suggesting a potential role in anovulation. Collectively, these data suggest that elevated estradiol and obesity per se might lead to anovulation and polycystic ovaries independent of hyperinsulinemia and hyperandrogenism. As obesity often coexists with other abnormalities known to be involved in the development of PCOS such as insulin resistance, compensatory hyperinsulinemia and hyperandrogenism, the precise role of these factors in PCOS remains unclear. Mito-Ob mice provide an opportunity to study the effects of obesity on anovulation and ovarian cyst formation independent of the major drivers of obesity-linked PCOS.
Coordinated control of electrical drives
International Nuclear Information System (INIS)
Keresztely, S.
1983-01-01
The control system developed for the fuel handling machine of nuclear power plants contains seven microcomputers. Redundant hardware and software structure ensures high reliability and availability. The sensors are doubled and each set is connected to its own microcomputer for evaluation of measurements. The control program, coordinating seven electrical drives, is run on two identical microcomputers, and has access to both sets of measurement results. Two control desks are provided. The seventh microcomputer generates the digital picture of the working site around the actual position and the picture is sent to color TV monitors at the control desks. System reliability: failure of any part of the system causes an error message and no action. System availability: for emergency purposes, one of every pair of the identical subsystems must be operational. In this emergency mode unconditional reliability is lost. (author)
Coordination of baseload power plant group control with static reactive power compensator control
Directory of Open Access Journals (Sweden)
Zbigniew Szczerba
2012-06-01
Full Text Available Reactive power sources in power system nodes: generators and static reactive power compensators, are controlled by control systems. Generators – by generator node group controllers, compensators – by voltage controllers. The paper presents issues of these control systems’ coordination and proposals for its implementation.
Secondary Coordinated Control of Islanded Microgrids Based on Consensus Algorithms
DEFF Research Database (Denmark)
Wu, Dan; Dragicevic, Tomislav; Vasquez, Juan Carlos
2014-01-01
systems. Nevertheless, the conventional decentralized secondary control, although does not need to be implemented in a microgrid central controller (MGCC), it has the limitation that all decentralized controllers must be mutually synchronized. In a clear cut contrast, the proposed secondary control......This paper proposes a decentralized secondary control for islanded microgrids based on consensus algorithms. In a microgrid, the secondary control is implemented in order to eliminate the frequency changes caused by the primary control when coordinating renewable energy sources and energy storage...... requires only a more simplified communication protocol and a sparse communication network. Moreover, the proposed approach based on dynamic consensus algorithms is able to achieve the coordinated secondary performance even when all units are initially out-of-synchronism. The control algorithm implemented...
A coordinated MIMO control design for a power plant using improved sliding mode controller.
Ataei, Mohammad; Hooshmand, Rahmat-Allah; Samani, Siavash Golmohammadi
2014-03-01
For the participation of the steam power plants in regulating the network frequency, boilers and turbines should be co-ordinately controlled in addition to the base load productions. Lack of coordinated control over boiler-turbine may lead to instability; oscillation in producing power and boiler parameters; reduction in the reliability of the unit; and inflicting thermodynamic tension on devices. This paper proposes a boiler-turbine coordinated multivariable control system based on improved sliding mode controller (ISMC). The system controls two main boiler-turbine parameters i.e., the turbine revolution and superheated steam pressure of the boiler output. For this purpose, a comprehensive model of the system including complete and exact description of the subsystems is extracted. The parameters of this model are determined according to our case study that is the 320MW unit of Islam-Abad power plant in Isfahan/Iran. The ISMC method is simulated on the power plant and its performance is compared with the related real PI (proportional-integral) controllers which have been used in this unit. The simulation results show the capability of the proposed controller system in controlling local network frequency and superheated steam pressure in the presence of load variations and disturbances of boiler. © 2013 ISA. Published by Elsevier Ltd. All rights reserved.
Riccio, Gary E.; McDonald, P. Vernon
1998-01-01
The purpose of this report is to identify the essential characteristics of goal-directed whole-body motion. The report is organized into three major sections (Sections 2, 3, and 4). Section 2 reviews general themes from ecological psychology and control-systems engineering that are relevant to the perception and control of whole-body motion. These themes provide an organizational framework for analyzing the complex and interrelated phenomena that are the defining characteristics of whole-body motion. Section 3 of this report applies the organization framework from the first section to the problem of perception and control of aircraft motion. This is a familiar problem in control-systems engineering and ecological psychology. Section 4 examines an essential but generally neglected aspect of vehicular control: coordination of postural control and vehicular control. To facilitate presentation of this new idea, postural control and its coordination with vehicular control are analyzed in terms of conceptual categories that are familiar in the analysis of vehicular control.
Coordination control of discrete-event systems revisited
Czech Academy of Sciences Publication Activity Database
Komenda, Jan; Masopust, Tomáš; van Schuppen, J. H.
2015-01-01
Roč. 25, 1-2 (2015), s. 65-94 ISSN 0924-6703 R&D Projects: GA ČR(CZ) GPP202/11/P028; GA ČR(CZ) GAP103/11/0517 Institutional support: RVO:67985840 Keywords : coordination control * supervisory control Subject RIV: BA - General Mathematics Impact factor: 1.268, year: 2015 http://link.springer.com/article/10.1007%2Fs10626-013-0179-x
Coordinated Pitch & Torque Control of Large-Scale Wind Turbine Based on Pareto Eciency Analysis
DEFF Research Database (Denmark)
Lin, Zhongwei; Chen, Zhenyu; Wu, Qiuwei
2018-01-01
For the existing pitch and torque control of the wind turbine generator system (WTGS), further development on coordinated control is necessary to improve effectiveness for practical applications. In this paper, the WTGS is modeled as a coupling combination of two subsystems: the generator torque...... control subsystem and blade pitch control subsystem. Then, the pole positions in each control subsystem are adjusted coordinately to evaluate the controller participation and used as the objective of optimization. A two-level parameters-controllers coordinated optimization scheme is proposed and applied...... to optimize the controller coordination based on the Pareto optimization theory. Three solutions are obtained through optimization, which includes the optimal torque solution, optimal power solution, and satisfactory solution. Detailed comparisons evaluate the performance of the three selected solutions...
Prohibitin regulates the FSH signaling pathway in rat granulosa cell differentiation.
Chowdhury, Indrajit; Thomas, Kelwyn; Zeleznik, Anthony; Thompson, Winston E
2016-05-01
Published results from our laboratory identified prohibitin (PHB), a gene product expressed in granulosa cells (GCs) that progressively increases during follicle maturation. Our current in vitro studies demonstrate that follicle-stimulating hormone (FSH) stimulates Phb expression in rat primary GCs. The FSH-dependent expression of PHB was primarily localized within mitochondria, and positively correlates with the morphological changes in GCs organelles, and synthesis and secretions of estradiol (E2) and progesterone (P4). In order to confirm that PHB plays a regulatory role in rat GC differentiation, endogenous PHB-knockdown studies were carried out in undifferentiated GCs using adenoviral (Ad)-mediated RNA interference methodology. Knockdown of PHB in GCs resulted in the suppression of the key steroidogenic enzymes including steroidogenic acute regulatory protein (StAR), p450 cholesterol side-chain cleavage enzyme (p450scc), 3β-hydroxysteroid dehydrogenase (3β-HSD), and aromatase (Cyp19a1); and decreased E2 and P4 synthesis and secretions in the presence of FSH stimulation. Furthermore, these experimental studies also provided direct evidence that PHB within the mitochondrial fraction in GCs is phosphorylated at residues Y249, T258, and Y259 in response to FSH stimulation. The observed levels of phosphorylation of PHB at Y249, T258, and Y259 were significantly low in GCs in the absence of FSH stimulation. In addition, during GC differentiation FSH-induced expression of phospho-PHB (pPHB) requires the activation of MEK1-ERK1/2 signaling pathway. Taken together, these studies provide new evidence supporting FSH-dependent PHB/pPHB upregulation in GCs is required to sustain the differentiated state of GCs. © 2016 The authors.
Gopal, Atul; Murthy, Aditya
2016-06-01
Voluntary control has been extensively studied in the context of eye and hand movements made in isolation, yet little is known about the nature of control during eye-hand coordination. We probed this with a redirect task. Here subjects had to make reaching/pointing movements accompanied by coordinated eye movements but had to change their plans when the target occasionally changed its position during some trials. Using a race model framework, we found that separate effector-specific mechanisms may be recruited to control eye and hand movements when executed in isolation but when the same effectors are coordinated a unitary mechanism to control coordinated eye-hand movements is employed. Specifically, we found that performance curves were distinct for the eye and hand when these movements were executed in isolation but were comparable when they were executed together. Second, the time to switch motor plans, called the target step reaction time, was different in the eye-alone and hand-alone conditions but was similar in the coordinated condition under assumption of a ballistic stage of ∼40 ms, on average. Interestingly, the existence of this ballistic stage could predict the extent of eye-hand dissociations seen in individual subjects. Finally, when subjects were explicitly instructed to control specifically a single effector (eye or hand), redirecting one effector had a strong effect on the performance of the other effector. Taken together, these results suggest that a common control signal and a ballistic stage are recruited when coordinated eye-hand movement plans require alteration. Copyright © 2016 the American Physiological Society.
Hierarchical Delay-Dependent Distributed Coordinated Control for DC Ring-Bus Microgrids
DEFF Research Database (Denmark)
Dou, Chunxia; Yue, Dong; Zhang, Zhanqiang
2017-01-01
In this paper, a hierarchical distributed coordinated control method is proposed based on the multi-agent system for dc ring-bus microgrids to improve the bus voltage performance. First, a two-level multi-agent system is built, where each first-level unit control agent is associated with a distri......In this paper, a hierarchical distributed coordinated control method is proposed based on the multi-agent system for dc ring-bus microgrids to improve the bus voltage performance. First, a two-level multi-agent system is built, where each first-level unit control agent is associated...
Coordinated Formation Control of Multiple Autonomous Underwater Vehicles for Pipeline Inspection
Directory of Open Access Journals (Sweden)
Xianbo Xiang
2010-02-01
Full Text Available This paper addresses the control problem of inspecting underwater pipeline on the seabed, with coordinated multiple autonomous underwater vehicles in a formation. Based on the leader-follower strategy, the dedicated nonlinear path following controller is rigorously built on Lyapunov-based design, driving a fleet of vehicles onto assigned parallel paths elevated and offset from the underwater pipeline, while keeping a triangle formation to capture complete 3D images for inspection. Due to the spatial-temporal decoupling characteristics of individual path following controller, the velocities of the followers can be adapted in the coordinated control level, only relying on the information of generalized along-path length from the leader, in order to build the desired formation. Thus, the communication variable broadcast from the leader is kept to a minimum, which is feasible under the severely constraints of acoustic communication bandwidth. Simulation results illustrate the efficiency of coordinated formation controller proposed for underwater pipeline inspection.
Directory of Open Access Journals (Sweden)
Shufeng Liu
2015-11-01
Full Text Available Identification of novel drug targets and affordable therapeutic agents remains a high priority in the fight against chronic hepatitis C virus (HCV infection. Here, we report that the cellular proteins prohibitin 1 (PHB1 and 2 (PHB2 are pan-genotypic HCV entry factors functioning at a post-binding step. While predominantly found in mitochondria, PHBs localize to the plasma membrane of hepatocytes through their transmembrane domains and interact with both EGFR and CRaf. Targeting PHB by rocaglamide (Roc-A, a natural product that binds PHB1 and 2, reduced cell surface PHB1 and 2, disrupted PHB-CRaf interaction, and inhibited HCV entry at low nanomolar concentrations. A structure-activity analysis of 32 synthetic Roc-A analogs indicated that the chiral, racemic version of aglaroxin C, a natural product biosynthetically related to Roc-A, displayed improved potency and therapeutic index against HCV infection. This study reveals a new class of HCV entry inhibitors that target the PHB1/2-CRaf pathway.
A microgrid cluster structure and its autonomous coordination control strategy
DEFF Research Database (Denmark)
Zhou, Xiaoping; Zhou, Leming; Chen, Yandong
2018-01-01
This paper proposes a microgrid cluster structure and its autonomous coordination control strategy. Unlike existing microgrids that are purely AC or DC, the microgrid cluster studied here is an interconnected system with multiple AC and DC microgrids, which enables mutual power support among...... control method combining the normalized droop-based control and adaptive control is proposed for PEU, which can effectively realize mutual power support among microgrids and reduce the bus voltage or frequency deviation in microgrids. In addition, the adaptive control strategy of PEU can ensure...... that the bigger the normalized index of microgrid is, the larger the active power exchange coefficient is, which can make all of microgrids operate around the rated state as much as possible. Besides, EP is mainly used to balance the system power, and the hierarchical coordinated control method of EP is proposed...
A Coordinated LVRT Control for a PMSG Wind Turbine
DEFF Research Database (Denmark)
Kim, Chunghun; Gui, Yonghao; Chung, Chung Choo
2017-01-01
This paper proposes a coordinated controller for a permanent-magnet synchronous generator wind turbine to enhance its low voltage ride through capability. In the proposed method, both rotor side and grid side converters are cooperatively controlled to regulate the DC link voltage during the grid...
DEFF Research Database (Denmark)
Dou, Chun-Xia; Yue, Dong; Guerrero, Josep M.
2017-01-01
This paper focuses on a multi-agent based distributed coordinated control for radial DC microgrid considering trans-mission time delays. Firstly, a two-level multi-agent system is constructed, where local control is formulated based on local states and executed by means of the first-level agent......, and dis-tributed coordinated control law is formulated based on wide-area information and executed by means of the secondary- level agent in order to improve the voltage control performances. Afterwards, the research mainly focuses on designing the local controller and the distributed coordinated...
Coordinating IMC-PID and adaptive SMC controllers for a PEMFC.
Wang, Guo-Liang; Wang, Yong; Shi, Jun-Hai; Shao, Hui-He
2010-01-01
For a Proton Exchange Membrane Fuel Cell (PEMFC) power plant with a methanol reformer, the process parameters and power output are considered simultaneously to avoid violation of the constraints and to keep the fuel cell power plant safe and effective. In this paper, a novel coordinating scheme is proposed by combining an Internal Model Control (IMC) based PID Control and adaptive Sliding Mode Control (SMC). The IMC-PID controller is designed for the reformer of the fuel flow rate according to the expected first-order dynamic properties. The adaptive SMC controller of the fuel cell current has been designed using the constant plus proportional rate reaching law. The parameters of the SMC controller are adaptively tuned according to the response of the fuel flow rate control system. When the power output controller feeds back the current references to these two controllers, the coordinating controllers system works in a system-wide way. The simulation results of the PEMFC power plant demonstrate the effectiveness of the proposed method. 2009 ISA. Published by Elsevier Ltd. All rights reserved.
Coordinated Control of Cross-Flow Turbines
Strom, Benjamin; Brunton, Steven; Polagye, Brian
2016-11-01
Cross-flow turbines, also known as vertical-axis turbines, have several advantages over axial-flow turbines for a number of applications including urban wind power, high-density arrays, and marine or fluvial currents. By controlling the angular velocity applied to the turbine as a function of angular blade position, we have demonstrated a 79 percent increase in cross-flow turbine efficiency over constant-velocity control. This strategy uses the downhill simplex method to optimize control parameter profiles during operation of a model turbine in a recirculating water flume. This optimization method is extended to a set of two turbines, where the blade motions and position of the downstream turbine are optimized to beneficially interact with the coherent structures in the wake of the upstream turbine. This control scheme has the potential to enable high-density arrays of cross-flow turbines to operate at cost-effective efficiency. Turbine wake and force measurements are analyzed for insight into the effect of a coordinated control strategy.
Wang, Dunxing; Gao, Qin; Li, Zhizhong; Song, Fei; Ma, Liang
2017-12-01
This study aims to develop a taxonomy of coordination behaviours during emergencies in nuclear power plants (NPPs). We summarised basic coordination behaviours from literature in aviation, health care and nuclear field and identified coordination behaviours specific to the nuclear domain by interviewing and surveying control crew operators. The established taxonomy includes 7 workflow stages and 24 basic coordination behaviours. To evaluate the reliability and feasibility of the taxonomy, we analysed 12 videos of operators' training sessions by coding coordination behaviours with the taxonomy and the inter-rater reliability was acceptable. Further analysis of the frequency, the duration and the direction of the coordination behaviours revealed four coordination problems. This taxonomy provides a foundation of systematic observation of coordination behaviours among NPP crews, advances researchers' understanding of the coordination mechanism during emergencies in NPPs and facilitate the possibility to deepen the understanding of the relationships between coordination behaviours and team performance. Practitioner Summary: A taxonomy of coordination behaviours during emergencies in nuclear power plants was developed. Reliability and feasibility of the taxonomy was verified through the analysis of 12 training sessions. The taxonomy can serve as an observation system for analysis of coordination behaviours and help to identify coordination problems of control crews.
Wide Area Coordinated Control of Multi-FACTS Devices to Damp Power System Oscillations
Directory of Open Access Journals (Sweden)
Shiyun Xu
2017-12-01
Full Text Available Aiming at damping the inter-area oscillations of power systems, the present study proposes a wide-area decentralized coordinated control framework, where the upper-level controller is designed to coordinate the lower-level multiple FACTS devices. Based on the polytopic differential inclusion method, the derived controller adopts a decentralized structure and it is guaranteed to be robust to meet the demand of operation under multiple operating conditions. Since time delay of wide area signal transmission is inevitable, in what follows, the quantum evolution algorithm (QEA method is introduced to find an optimal solution of the time-delay coordinated controller. In this regard, the stability of the system with a prescribed time delay is guaranteed and the system damping ratio is increased. Effectiveness and applicability of the proposed controller design methods have been demonstrated through numerical simulations.
DEFF Research Database (Denmark)
Petersen, Lennart; Iov, Florin
2017-01-01
This study focuses on distributed voltage control coordination between renewable generation plants in medium-voltage distribution grids (DGs). A distributed offline coordination concept has been defined in a previous publication, leading to satisfactory voltage regulation in the DG. However, here...
Decentralized Receding Horizon Control and Coordination of Autonomous Vehicle Formations
Keviczky, T.; Borelli, F.; Fregene, K.; Godbole, D.; Bals, G.J.
2008-01-01
This paper describes the application of a novel methodology for high-level control and coordination of autonomous vehicle teams and its demonstration on high-fidelity models of the organic air vehicle developed at Honeywell Laboratories. The scheme employs decentralized receding horizon controllers
Voice loops as coordination aids in space shuttle mission control.
Patterson, E S; Watts-Perotti, J; Woods, D D
1999-01-01
Voice loops, an auditory groupware technology, are essential coordination support tools for experienced practitioners in domains such as air traffic management, aircraft carrier operations and space shuttle mission control. They support synchronous communication on multiple channels among groups of people who are spatially distributed. In this paper, we suggest reasons for why the voice loop system is a successful medium for supporting coordination in space shuttle mission control based on over 130 hours of direct observation. Voice loops allow practitioners to listen in on relevant communications without disrupting their own activities or the activities of others. In addition, the voice loop system is structured around the mission control organization, and therefore directly supports the demands of the domain. By understanding how voice loops meet the particular demands of the mission control environment, insight can be gained for the design of groupware tools to support cooperative activity in other event-driven domains.
Arm coordination in octopus crawling involves unique motor control strategies.
Levy, Guy; Flash, Tamar; Hochner, Binyamin
2015-05-04
To cope with the exceptional computational complexity that is involved in the control of its hyper-redundant arms [1], the octopus has adopted unique motor control strategies in which the central brain activates rather autonomous motor programs in the elaborated peripheral nervous system of the arms [2, 3]. How octopuses coordinate their eight long and flexible arms in locomotion is still unknown. Here, we present the first detailed kinematic analysis of octopus arm coordination in crawling. The results are surprising in several respects: (1) despite its bilaterally symmetrical body, the octopus can crawl in any direction relative to its body orientation; (2) body and crawling orientation are monotonically and independently controlled; and (3) contrasting known animal locomotion, octopus crawling lacks any apparent rhythmical patterns in limb coordination, suggesting a unique non-rhythmical output of the octopus central controller. We show that this uncommon maneuverability is derived from the radial symmetry of the arms around the body and the simple pushing-by-elongation mechanism by which the arms create the crawling thrust. These two together enable a mechanism whereby the central controller chooses in a moment-to-moment fashion which arms to recruit for pushing the body in an instantaneous direction. Our findings suggest that the soft molluscan body has affected in an embodied way [4, 5] the emergence of the adaptive motor behavior of the octopus. Copyright © 2015 Elsevier Ltd. All rights reserved.
Coordinated Resolved Motion Control of Dual-Arm Manipulators with Closed Chain
Directory of Open Access Journals (Sweden)
Tianliang Liu
2016-05-01
Full Text Available When applied to some tasks, such as payload handling, assembling, repairing and so on, the two arms of a humanoid robot will form a closed kinematic chain. It makes the motion planning and control for dual-arm coordination very complex and difficult. In this paper, we present three types of resolved motion control methods for a humanoid robot during coordinated manipulation. They are, respectively, position-level, velocity-level and acceleration-level resolved motion control methods. The desired pose, velocity and acceleration of each end-effector are then resolved according to the desired motion of the payload and the constraints on the closed-chain system without consideration of the internal force. Corresponding to the three cases above, the joint variables of each arm are then calculated using the inverse kinematic equations, at position-level, velocity-level or acceleration-level. Finally, a dynamic modelling and simulation platform is established based on ADAMS and Matlab software. The proposed methods are verified by typical cases. The simulation results show that the proposed control strategy can realize the dual-arm coordinated operation and the internal force of the closed chain during the operation is controlled in a reasonable range at the same time.
Two-phase strategy of controlling motor coordination determined by task performance optimality.
Shimansky, Yury P; Rand, Miya K
2013-02-01
A quantitative model of optimal coordination between hand transport and grip aperture has been derived in our previous studies of reach-to-grasp movements without utilizing explicit knowledge of the optimality criterion or motor plant dynamics. The model's utility for experimental data analysis has been demonstrated. Here we show how to generalize this model for a broad class of reaching-type, goal-directed movements. The model allows for measuring the variability of motor coordination and studying its dependence on movement phase. The experimentally found characteristics of that dependence imply that execution noise is low and does not affect motor coordination significantly. From those characteristics it is inferred that the cost of neural computations required for information acquisition and processing is included in the criterion of task performance optimality as a function of precision demand for state estimation and decision making. The precision demand is an additional optimized control variable that regulates the amount of neurocomputational resources activated dynamically. It is shown that an optimal control strategy in this case comprises two different phases. During the initial phase, the cost of neural computations is significantly reduced at the expense of reducing the demand for their precision, which results in speed-accuracy tradeoff violation and significant inter-trial variability of motor coordination. During the final phase, neural computations and thus motor coordination are considerably more precise to reduce the cost of errors in making a contact with the target object. The generality of the optimal coordination model and the two-phase control strategy is illustrated on several diverse examples.
Directory of Open Access Journals (Sweden)
Shiyun Xu
2015-01-01
Full Text Available The present study proposes a hierarchical wide-area decentralized coordinated control framework for HVDC power system that is robust to multiple operating conditions. The upper level wide-area coordinated controller is designed in the form of dynamic output feedback control that coordinates the lower level HVDC supplementary controller, PSS, and SVC. In order to enhance the robustness of the designed controller under various operating conditions, the polytopic model is introduced such that the closed-loop control system can be operated under strong damping mode in virtue of the stability criterion based on damping ratio. Simulation results demonstrate that the proposed controller design algorithm is capable of enhancing the system damping over four different conditions.
Coordinated Voltage Control of a Wind Farm based on Model Predictive Control
DEFF Research Database (Denmark)
Zhao, Haoran; Wu, Qiuwei; Guo, Qinglai
2016-01-01
This paper presents an autonomous wind farm voltage controller based on Model Predictive Control (MPC). The reactive power compensation and voltage regulation devices of the wind farm include Static Var Compensators (SVCs), Static Var Generators (SVGs), Wind Turbine Generators (WTGs) and On...... are calculated based on an analytical method to improve the computation efficiency and overcome the convergence problem. Two control modes are designed for both voltage violated and normal operation conditions. A wind farm with 20 wind turbines was used to conduct case studies to verify the proposed coordinated...
Feedforward Coordinate Control of a Robotic Cell Injection Catheter.
Cheng, Weyland; Law, Peter K
2017-08-01
Remote and robotically actuated catheters are the stepping-stones toward autonomous catheters, where complex intravascular procedures may be performed with minimal intervention from a physician. This article proposes a concept for the positional, feedforward control of a robotically actuated cell injection catheter used for the injection of myogenic or undifferentiated stem cells into the myocardial infarct boundary zones of the left ventricle. The prototype for the catheter system was built upon a needle-based catheter with a single degree of deflection, a 3-D printed handle combined with actuators, and the Arduino microcontroller platform. A bench setup was used to mimic a left ventricle catheter procedure starting from the femoral artery. Using Matlab and the open-source video modeling tool Tracker, the planar coordinates ( y, z) of the catheter position were analyzed, and a feedforward control system was developed based on empirical models. Using the Student's t test with a sample size of 26, it was determined that for both the y- and z-axes, the mean discrepancy between the calibrated and theoretical coordinate values had no significant difference compared to the hypothetical value of µ = 0. The root mean square error of the calibrated coordinates also showed an 88% improvement in the z-axis and 31% improvement in the y-axis compared to the unmodified trial run. This proof of concept investigation leads to the possibility of further developing a feedfoward control system in vivo using catheters with omnidirectional deflection. Feedforward positional control allows for more flexibility in the design of an automated catheter system where problems such as systemic time delay may be a hindrance in instances requiring an immediate reaction.
Prohibitin 1 modulates mitochondrial stress-related autophagy in human colonic epithelial cells.
Directory of Open Access Journals (Sweden)
Arwa S Kathiria
Full Text Available Autophagy is an adaptive response to extracellular and intracellular stress by which cytoplasmic components and organelles, including damaged mitochondria, are degraded to promote cell survival and restore cell homeostasis. Certain genes involved in autophagy confer susceptibility to Crohn's disease. Reactive oxygen species and pro-inflammatory cytokines such as tumor necrosis factor α (TNFα, both of which are increased during active inflammatory bowel disease, promote cellular injury and autophagy via mitochondrial damage. Prohibitin (PHB, which plays a role in maintaining normal mitochondrial respiratory function, is decreased during active inflammatory bowel disease. Restoration of colonic epithelial PHB expression protects mice from experimental colitis and combats oxidative stress. In this study, we investigated the potential role of PHB in modulating mitochondrial stress-related autophagy in intestinal epithelial cells.We measured autophagy activation in response to knockdown of PHB expression by RNA interference in Caco2-BBE and HCT116 WT and p53 null cells. The effect of exogenous PHB expression on TNFα- and IFNγ-induced autophagy was assessed. Autophagy was inhibited using Bafilomycin A(1 or siATG16L1 during PHB knockdown and the affect on intracellular oxidative stress, mitochondrial membrane potential, and cell viability were determined. The requirement of intracellular ROS in siPHB-induced autophagy was assessed using the ROS scavenger N-acetyl-L-cysteine.TNFα and IFNγ-induced autophagy inversely correlated with PHB protein expression. Exogenous PHB expression reduced basal autophagy and TNFα-induced autophagy. Gene silencing of PHB in epithelial cells induces mitochondrial autophagy via increased intracellular ROS. Inhibition of autophagy during PHB knockdown exacerbates mitochondrial depolarization and reduces cell viability.Decreased PHB levels coupled with dysfunctional autophagy renders intestinal epithelial cells
Dynamic coordinated control laws in multiple agent models
International Nuclear Information System (INIS)
Morgan, David S.; Schwartz, Ira B.
2005-01-01
We present an active control scheme of a kinetic model of swarming. It has been shown previously that the global control scheme for the model, presented in [Systems Control Lett. 52 (2004) 25], gives rise to spontaneous collective organization of agents into a unified coherent swarm, via steering controls and utilizing long-range attractive and short-range repulsive interactions. We extend these results by presenting control laws whereby a single swarm is broken into independently functioning subswarm clusters. The transition between one coordinated swarm and multiple clustered subswarms is managed simply with a homotopy parameter. Additionally, we present as an alternate formulation, a local control law for the same model, which implements dynamic barrier avoidance behavior, and in which swarm coherence emerges spontaneously
The design of traffic signal coordinated control
Guo, Xueting; Sun, Hongsheng; Wang, Xifu
2017-05-01
Traffic as the tertiary industry is an important pillar industry to support the normal development of the economy. But now China's road traffic development and economic development has shown a great imbalance and fault phenomenon, which greatly inhibited the normal development of China's economy. Now in many large and medium-sized cities in China are implementing green belt construction. The so-called green band is when the road conditions to meet the conditions for the establishment of the green band, the sections of the intersection of several planning to a traffic coordination control system, so that when the driver at a specific speed can be achieved without stopping the continuous Through the intersection. Green belt can effectively reduce the delay and queuing length of vehicle driving, the normal function of urban roads and reduce the economic losses caused by traffic congestion is a great help. In this paper, the theoretical basis of the design of the coordinated control system is described. Secondly, the green time offset is calculated by the analytic method and the green band is established. And then the VISSIM software is used to simulate the traffic system before and after the improvement. Finally, the results of the two simulations are compared.
Fast Coordinated Control of DFIG Wind Turbine Generators for Low and High Voltage Ride-Through
DEFF Research Database (Denmark)
Wang, Yun; Wu, Qiuwei; Xu, Honghua
2014-01-01
This paper presents a fast coordinated control scheme of the rotor side converter (RSC), the DC chopper and the grid side converter (GSC) of doubly fed induction generator (DFIG) wind turbine generators (WTGs) which is to improve the low voltage ride through (LVRT) and high voltage ride through...... were proposed considering the characteristics of the DFIG WTGs during voltage changes. The fast coordinated control of RSC and GSC were developed based on the characteristic analysis in order to realize efficient LVRT and HVRT of the DFIG WTGs. The proposed fast coordinated control schemes were...
Coordinated control of distributed energy resources to support load frequency control
International Nuclear Information System (INIS)
Ravikumar Pandi, V.; Al-Hinai, A.; Feliachi, Ali
2015-01-01
Highlights: • We aims to maintain feeder power flow by the coordination of DER units. • The error in feeder flow with respect to scheduled value is used by the controller. • The particle swarm optimization is employed to minimize the error in feeder flow. • Implemented on a transmission system along with 37 bus distribution feeder. • The results of proposed feeder control is analyzed with no feeder control scheme. - Abstract: The control of generating resources to follow the unscheduled load changes is considered to be an essential process in the power system in order to maintain the frequency of power supply. This load frequency control (LFC) problem has been given more importance in the recent smart grid environment because of the impact from high penetration of distributed energy resources (DER) installed at the distribution level. The renewable sources are highly intermittent in nature, so it is required to coordinate and control the DER units to maintain the feeder power flow at substation bus bar which is seen by transmission system operator during the LFC process. This paper aims to identify the impact of distributed generation and its control method to reduce the deviation of feeder power flow from the scheduled value in real time operation. The error in feeder power flow with respect to scheduled value is utilized by the PI controller to estimate the change in power reference of all DER units. The power output of DER units are maintained to reference values by the individual PI controllers. The particle swarm optimization algorithm is employed to minimize the error in feeder power flow by optimally tuning the gain values of all PI controllers. The proposed method is examined on a small transmission system along with the feeder of IEEE 37 bus distribution system with balanced loading condition. The complete system along with DER units is implemented in the MATLAB based stability package named Power Analysis Toolbox (PAT) for performing time domain
Torque Coordination Control during Braking Mode Switch for a Plug-in Hybrid Electric Vehicle
Directory of Open Access Journals (Sweden)
Yang Yang
2017-10-01
Full Text Available Hybrid vehicles usually have several braking systems, and braking mode switches are significant events during braking. It is difficult to coordinate torque fluctuations caused by mode switches because the dynamic characteristics of braking systems are different. In this study, a new type of plug-in hybrid vehicle is taken as the research object, and braking mode switches are divided into two types. The control strategy of type one is achieved by controlling the change rates of clutch hold-down and motor braking forces. The control strategy of type two is achieved by simultaneously changing the target braking torque during different mode switch stages and controlling the motor to participate in active coordination control. Finally, the torque coordination control strategy is modeled in MATLAB/Simulink, and the results show that the proposed control strategy has a good effect in reducing the braking torque fluctuation and vehicle shocks during braking mode switches.
ICT Based HIL Validation of Voltage Control Coordination in Smart Grids Scenarios
DEFF Research Database (Denmark)
Shahid, Kamal; Petersen, Lennart; Olsen, Rasmus Løvenstein
2018-01-01
. However, here, the results are validated through a real-time Hardware-In-The-Loop framework using an exemplary benchmark grid area in Denmark as a base case that includes flexible renewable power plants providing voltage control functionality. The provision of voltage control support from ReGen plants...... is verified on a large-scale power system against the baseline scenario, considering the hierarchical industrial controller platforms used nowadays in power plants. Moreover, the verification of online voltage control support is carried out by taking into account a communication network as well......This paper aims to validate the capability of renewable generation (ReGen) plants to provide online voltage control coordination ancillary service to the system operators. Simulation studies on online coordination concepts from ReGen plants have already been identified in previous publications...
Overvoltage Mitigation Using Coordinated Control of Demand Response and Grid-tied Photovoltaics
DEFF Research Database (Denmark)
Bhattarai, Bishnu Prasad; Bak-Jensen, Birgitte; Pillai, Jayakrishnan Radhakrishna
2015-01-01
Overvoltages in low voltage distribution grids with high solar photovoltaic (PV) integration are usually alleviated by implementing various active/reactive power control techniques. As those methods create revenue loss or inverter cost increase to PV owners, a coordinated control of load demand...... and the PVs, considering electric vehicles (EVs) as potential demand response resource, is proposed in this study to alleviate the overvoltages. A two-stage control is designed to comprehend the proposed coordinated control such that a centralized stage periodically determines optimum operating set......-points for PVs/EVs and a decentralized stage adaptively control the PVs/EVs in real-time. To demonstrate effectiveness of the proposed approach, simulations are performed in a typical 0.4 kV/400 kVA Danish distribution network containing 45 detached residential consumers. The presented method demonstrates better...
Motion Intention Analysis-Based Coordinated Control for Amputee-Prosthesis Interaction
Directory of Open Access Journals (Sweden)
Fei Wang
2010-01-01
Full Text Available To study amputee-prosthesis (AP interaction, a novel reconfigurable biped robot was designed and fabricated. In homogeneous configuration, two identical artificial legs (ALs were used to simulate the symmetrical lower limbs of a healthy person. Linear inverted pendulum model combining with ZMP stability criterion was used to generate the gait trajectories of ALs. To acquire interjoint coordination for healthy gait, rate gyroscopes were mounted on CoGs of thigh and shank of both legs. By employing principal component analysis, the measured angular velocities were processed and the motion synergy was obtained in the final. Then, one of two ALs was replaced by a bionic leg (BL, and the biped robot was changed into heterogeneous configuration to simulate the AP coupling system. To realize symmetrical stable walking, master/slave coordinated control strategy is proposed. According to information acquired by gyroscopes, BL recognized the motion intention of AL and reconstructed its kinematic variables based on interjoint coordination. By employing iterative learning control, gait tracking of BL to AL was archived. Real environment robot walking experiments validated the correctness and effectiveness of the proposed scheme.
Optimization Method of Intersection Signal Coordinated Control Based on Vehicle Actuated Model
Directory of Open Access Journals (Sweden)
Chen Zhao-Meng
2015-01-01
Full Text Available Traditional timing green wave control with predetermined cycle, split, and offset cannot adapt for dynamic real-time traffic flow. This paper proposes a coordinated control method for variable cycle time green wave bandwidth optimization integrated with traffic-actuated control. In the coordinated control, green split is optimized in real time by the measured presence of arriving and/or standing vehicles in each intersection and simultaneously green waves along arterials are guaranteed. Specifically, the dynamic bound of green wave is firstly determined, and then green early-start and green late-start algorithms are presented respectively to accommodate the fluctuations in vehicle arrival rates in each phase. Numerical examples show that the proposed method improves green time, expands green wave bandwidth, and reduces queuing.
Microgrids and distributed generation systems: Control, operation, coordination and planning
Che, Liang
Distributed Energy Resources (DERs) which include distributed generations (DGs), distributed energy storage systems, and adjustable loads are key components in microgrid operations. A microgrid is a small electric power system integrated with on-site DERs to serve all or some portion of the local load and connected to the utility grid through the point of common coupling (PCC). Microgrids can operate in both grid-connected mode and island mode. The structure and components of hierarchical control for a microgrid at Illinois Institute of Technology (IIT) are discussed and analyzed. Case studies would address the reliable and economic operation of IIT microgrid. The simulation results of IIT microgrid operation demonstrate that the hierarchical control and the coordination strategy of distributed energy resources (DERs) is an effective way of optimizing the economic operation and the reliability of microgrids. The benefits and challenges of DC microgrids are addressed with a DC model for the IIT microgrid. We presented the hierarchical control strategy including the primary, secondary, and tertiary controls for economic operation and the resilience of a DC microgrid. The simulation results verify that the proposed coordinated strategy is an effective way of ensuring the resilient response of DC microgrids to emergencies and optimizing their economic operation at steady state. The concept and prototype of a community microgrid that interconnecting multiple microgrids in a community are proposed. Two works are conducted. For the coordination, novel three-level hierarchical coordination strategy to coordinate the optimal power exchanges among neighboring microgrids is proposed. For the planning, a multi-microgrid interconnection planning framework using probabilistic minimal cut-set (MCS) based iterative methodology is proposed for enhancing the economic, resilience, and reliability signals in multi-microgrid operations. The implementation of high-reliability microgrids
Acquisition and Retention of Team Coordination in Command-and-Control
National Research Council Canada - National Science Library
Cooke, Nancy J; Gorman, Jamie; Pedersen, Harry K; Winner, Jennifer; Duran, Jasmine; Taylor, Amanda; Amazeen, Polemnia G; Andrews, Dee; Rowe, Leah
2007-01-01
...) command-and-control. In Experiment 1 we addressed the development of team coordination with experience and over lengthy intervals without practice in situations in which the team retains the same or different members over time...
Coordinated Control Design for the HTR-PM Plant: From Theoretic Analysis to Simulation Verification
International Nuclear Information System (INIS)
Dong Zhe; Huang Xiaojin
2014-01-01
HTR-PM plant is a two-modular nuclear power plant based on pebble bed modular high temperature gas-cooled reactor (MHTGR), and adopts operation scheme of two nuclear steam supplying systems (NSSSs) driving one turbine. Here, an NSSS is composed of an MHTGR, a once-through steam generator (OTSG) and some connecting pipes. Due to the coupling effect induced by two NSSSs driving one common turbine and that between the MHTGR and OTSG given by common helium flow, it is necessary to design a coordinated control for the safe, stable and efficient operation of the HTR-PM plant. In this paper, the design of the feedback loops and control algorithms of the coordinated plant control law is firstly given. Then, the hardware-in-loop (HIL) system for verifying the feasibility and performance of this control strategy is introduced. Finally, some HIL simulation results are given, which preliminarily show that this coordinated control law can be implemented practically. (author)
A Novel Distributed Secondary Coordination Control Approach for Islanded Microgrids
DEFF Research Database (Denmark)
Lu, Xiaoqing; Yu, Xinghuo; Lai, Jingang
2018-01-01
This paper develops a new distributed secondary cooperative control scheme to coordinate distributed generators (DGs) in islanded microgrids (MGs). A finite time frequency regulation strategy containing a consensus-based distributed active power regulator is presented, which can not only guarantee...
Motion coordination for VTOL unmanned aerial vehicles attitude synchronisation and formation control
Abdessameud, Abdelkader
2013-01-01
Motion Coordination for VTOL Unmanned Aerial Vehicles develops new control design techniques for the distributed coordination of a team of autonomous unmanned aerial vehicles. In particular, it provides new control design approaches for the attitude synchronization of a formation of rigid body systems. In addition, by integrating new control design techniques with some concepts from nonlinear control theory and multi-agent systems, it presents a new theoretical framework for the formation control of a class of under-actuated aerial vehicles capable of vertical take-off and landing. Several practical problems related to the systems’ inputs, states measurements, and restrictions on the interconnection topology between the aerial vehicles in the team are addressed. Worked examples with sufficient details and simulation results are provided to illustrate the applicability and effectiveness of the theoretical results discussed in the book. The material presented is primarily intended for researchers an...
Efficient Messaging through Cluster Coordinators in Decentralized Controlled Material Flow Systems
Directory of Open Access Journals (Sweden)
Lieberoth-Leden Christian
2016-01-01
Full Text Available The modularization of the hard- and software is one approach handling the demand for increasing flexibility and changeability of automated material flow systems. A control that is distributed across several different hardware controllers leads to a great demand for coordination between the modules while planning for example transports, especially if there is a mutual dependency between the modules on the executing tasks. Short-term changes in planning often initiate a rescheduling chain reaction, which causes a high communication load in the system. In the presented approach, module clusters with a centralized coordinator are automatically formed out of multiple modules and substitutional take over the surrounding communication for the modules. As a result, they minimize exchanged messages by focusing on the essential information.
Directory of Open Access Journals (Sweden)
Changjiang Zheng
2012-01-01
Full Text Available To solve the problem in pedestrian Mid-Block street crossing, the method of signal coordination control between mid-block street crossing and intersection is researched in this paper. The paper proposes to use “distance-flow rate-time” graph as the tool for building coordination control system model which is for different situations of traffic control. Through alternating the linear optimization model, the system outputs the distribution of signal timing and system operational factors (delays in vehicles and mid-block street crossing. Finally, taking one section on the Taiping North Road in Nanjing as an example, the signal coordination control is carried out. And the results which are delays in the vehicles and mid-block street crossing are compared to those in the current distribution of signal timing.
Sakurada, Takeshi; Ito, Koji; Gomi, Hiroaki
2016-01-01
Although strong motor coordination in intrinsic muscle coordinates has frequently been reported for bimanual movements, coordination in extrinsic visual coordinates is also crucial in various bimanual tasks. To explore the bimanual coordination mechanisms in terms of the frame of reference, here we characterized implicit bilateral interactions in visuomotor tasks. Visual perturbations (finger-cursor gain change) were applied while participants performed a rhythmic tracking task with both index fingers under an in-phase or anti-phase relationship in extrinsic coordinates. When they corrected the right finger's amplitude, the left finger's amplitude unintentionally also changed [motor interference (MI)], despite the instruction to keep its amplitude constant. Notably, we observed two specificities: one was large MI and low relative-phase variability (PV) under the intrinsic in-phase condition, and the other was large MI and high PV under the extrinsic in-phase condition. Additionally, using a multiple-interaction model, we successfully decomposed MI into intrinsic components caused by motor correction and extrinsic components caused by visual-cursor mismatch of the right finger's movements. This analysis revealed that the central nervous system facilitates MI by combining intrinsic and extrinsic components in the condition with in-phases in both intrinsic and extrinsic coordinates, and that under-additivity of the effects is explained by the brain's preference for the intrinsic interaction over extrinsic interaction. In contrast, the PV was significantly correlated with the intrinsic component, suggesting that the intrinsic interaction dominantly contributed to bimanual movement stabilization. The inconsistent features of MI and PV suggest that the central nervous system regulates multiple levels of bilateral interactions for various bimanual tasks. © 2015 The Authors. European Journal of Neuroscience published by Federation of European Neuroscience Societies and
Decentralized Coordinated Control Strategy of Islanded Microgrids
DEFF Research Database (Denmark)
Wu, Dan
as grid voltage/frequency regulation. In order to enhance the reliability of overall islanded Microgrid operation, basic functions of coordinated control which taking into account the state of charge (SoC) limitation and power availability of renewable energy sources is implemented in a distributed level...... control strategies in this thesis, in order to promote the decentralization of the overall system. Especially the consensus algorithm based secondary level is investigated in the thesis in order to simplify the communication configuration which only flood information through the neighboring units......Facing the challenges brought by the traditional large power system concerning the environmental and economic issues, along recent years distributed generation is considered as an alternative solution to provide clean energy in a local manner. In this context, Microgrid which performing as a local...
DEFF Research Database (Denmark)
Zhou, Xiaoping; Chen, Yandong; Zhou, Leming
2018-01-01
storage unit (ESU) are added into hybrid single/three-phase microgrid, and a power coordinated control method with frequency support capability is proposed for hybrid single/three-phase microgrid in this study. PEU is connected with three single-phase microgrids to coordinate power exchange among three...... phases and provide frequency support for hybrid microgrid. Meanwhile, a power coordinated control method based on the droop control is proposed for PEU to alleviate three-phase power imbalance and reduce voltage fluctuation of hybrid microgrid. Besides, ESU is injected into the DC-link to buffer......Due to the intermittent output power of distributed generations (DGs) and the variability of loads, voltage fluctuation and three-phase power imbalance easily occur when hybrid single/three-phase microgrid operates in islanded mode. To address these issues, the power exchange unit (PEU) and energy...
Naruse, Takashi; Sakai, Mahiro; Nagata, Satoko
2016-04-01
Home-visiting nursing agencies are required to foster staff nurse's work engagement; thus, the factors related to work engagement require identification. This study examined relational coordination among colleagues and agency span of control on the work engagement of home-visiting nurses. Cross-sectional data from 93 staff nurses in 31 home-visiting nursing agencies were collected via a survey and analyzed using mixed linear regression. There was no significant main effect of relational coordination among nurse colleagues on work engagement. In large agencies with a large span of control, relational coordination among nursing colleagues predicted work engagement. Nursing managers' relational coordination was found to be positively associated with staff nurse work engagement. Agency span of control is a moderating factor on the positive effect of relational coordination with nursing colleagues on staff nurse work engagement. © 2016 Japan Academy of Nursing Science.
Artificial neural network controller for automatic ship berthing using head-up coordinate system
Directory of Open Access Journals (Sweden)
Nam-Kyun Im
2018-05-01
Full Text Available The Artificial Neural Network (ANN model has been known as one of the most effective theories for automatic ship berthing, as it has learning ability and mimics the actions of the human brain when performing the stages of ship berthing. However, existing ANN controllers can only bring a ship into a berth in a certain port, where the inputs of the ANN are the same as those of the teaching data. This means that those ANN controllers must be retrained when the ship arrives to a new port, which is time-consuming and costly. In this research, by using the head-up coordinate system, which includes the relative bearing and distance from the ship to the berth, a novel ANN controller is proposed to automatically control the ship into the berth in different ports without retraining the ANN structure. Numerical simulations were performed to verify the effectiveness of the proposed controller. First, teaching data were created in the original port to train the neural network; then, the controller was tested for automatic berthing in other ports, where the initial conditions of the inputs in the head-up coordinate system were similar to those of the teaching data in the original port. The results showed that the proposed controller has good performance for ship berthing in ports. Keywords: Automatic ship berthing, ANN controller, Head-up coordinate system, Low speed, Relative bearing
Model-Free Coordinated Control for MHTGR-Based Nuclear Steam Supply Systems
Directory of Open Access Journals (Sweden)
Zhe Dong
2016-01-01
Full Text Available The modular high temperature gas-cooled reactor (MHTGR is a typical small modular reactor (SMR that offers simpler, standardized and safer modular design by being factory built, requiring smaller initial capital investment, and having a shorter construction period. Thanks to its small size, the MHTGRs could be beneficial in providing electric power to remote areas that are deficient in transmission or distribution and in generating local power for large population centers. Based on the multi-modular operation scheme, the inherent safety feature of the MHTGRs can be applicable to large nuclear plants of any desired power rating. The MHTGR-based nuclear steam supplying system (NSSS is constituted by an MHTGR, a side-by-side arranged helical-coil once-through steam generator (OTSG and some connecting pipes. Due to the side-by-side arrangement, there is a tight coupling effect between the MHTGR and OTSG. Moreover, there always exists the parameter perturbation of the NSSSs. Thus, it is meaningful to study the model-free coordinated control of MHTGR-based NSSSs for safe, stable, robust and efficient operation. In this paper, a new model-free coordinated control strategy that regulates the nuclear power, MHTGR outlet helium temperature and OTSG outlet overheated steam temperature by properly adjusting the control rod position, helium flowrate and feed-water flowrate is established for the MHTGR-based NSSSs. Sufficient conditions for the globally asymptotic closed-loop stability is given. Finally, numerical simulation results in the cases of large range power decrease and increase illustrate the satisfactory performance of this newly-developed model-free coordinated NSSS control law.
Impedance coordinative control for cascaded converter in bidirectional application
DEFF Research Database (Denmark)
Tian, Yanjun; Loh, Poh Chiang; Deng, Fujin
2016-01-01
A two-stage cascaded converter is formed by connecting two sub-converters in series. Output impedance of one sub-converter will therefore interact with input impedance of the other sub-converter. Such interaction may affect the system dynamics and stability, especially when one sub......-converter is constant-power-controlled, and hence has different impedance characteristics when its power reverses. To lessen such constant-power effects, a control scheme that can coordinate impedance behaviors of the two sub-converters is proposed. The idea is to reshape the lowfrequency negative impedance...
Directory of Open Access Journals (Sweden)
A. V. Masloboev
2015-01-01
Full Text Available The paper deals with development of methods and tools for mathematical and computer modeling of the multilevel network-centric control systems of regional security. This research is carried out under development strategy implementation of the Arctic zone of the Russian Federation and national safeguarding for the period before 2020 in the Murmansk region territory. Creation of unified interdepartmental multilevel computer-aided system is proposed intended for decision-making information support and socio-economic security monitoring of the Arctic regions of Russia. The distinctive features of the investigated system class are openness, self-organization, decentralization of management functions and decision-making, weak hierarchy in the decision-making circuit and goal generation capability inside itself. Research techniques include functional-target approach, mathematical apparatus of multilevel hierarchical system theory and principles of network-centric control of distributed systems with pro-active components and variable structure. The work considers network-centric management local decisions coordination problem-solving within the multilevel distributed systems intended for information support of regional security. The coordination problem-solving approach and problem formalization in the multilevel network-centric control systems of regional security have been proposed based on developed multilevel recurrent hierarchical model of regional socio-economic system complex security. The model provides coordination of regional security indexes, optimized by the different elements of multilevel control systems, subject to decentralized decision-making. The model specificity consists in application of functional-target technology and mathematical apparatus of multilevel hierarchical system theory for coordination procedures implementation of the network-centric management local decisions. The work-out and research results can find further
DEFF Research Database (Denmark)
Guan, Yajuan; Guerrero, Josep M.; Quintero, Juan Carlos Vasquez
2015-01-01
current and unintentional outage of DGs. Thus, the stability and reliability of islanded MG can be improved. The eigenvalues and root locus with the proposed controller are presented to design the parameters as well as analyzing the system stability. Simulation results based on Matlab......A coordinated secondary control based on a novel autonomous currents sharing control strategy for balanced discharge rate of energy storage systems in islanded microgrid (MG) is proposed in this paper. The coordinated secondary controller is able to regulate the output power of distributed...... generating (DG) systems according to their state-of-charge by adjusting the virtual resistances of their voltage controlled inverters. This controller can not only provide the faster response and accurate output current sharing control, but also avoid the potential operation failure resulting from the over...
PSS and TCSC damping controller coordinated design using PSO in multi-machine power system
Energy Technology Data Exchange (ETDEWEB)
Shayeghi, H., E-mail: hshayeghi@gmail.co [Technical Engineering Department, University of Mohaghegh Ardabili, Ardabil (Iran, Islamic Republic of); Safari, A.; Shayanfar, H.A. [Center of Excellence for Power System Automation and Operation, Electrical Engineering Department, Iran University of Science and Technology, Tehran (Iran, Islamic Republic of)
2010-12-15
The paper develops a new design procedure for simultaneous coordinated designing of the thyristor controlled series capacitor (TCSC) damping controller and power system stabilizer (PSS) in multi-machine power system. The coordinated design problem of PSS and TCSC damping controllers over a wide range of loading conditions is converted to an optimization problem with the time domain-based objective function that is solved by a particle swarm optimization (PSO) technique which has a strong ability to find the most optimistic results. By minimizing the proposed fitness function in which oscillatory characteristics between areas are included and thus the interactions among the TCSC controller and PSS under transient conditions in the multi-machine power system are improved. To ensure the robustness of the proposed stabilizers, the design process takes a wide range of operating conditions into account. The effectiveness of the proposed controller is demonstrated through the nonlinear time-domain simulation and some performance indices studies. The results of these studies show that the proposed coordinated controllers have an excellent capability in damping power system inter-area oscillations and enhance greatly the dynamic stability of the power system. Moreover, it is superior to both the uncoordinated designed stabilizers of the PSS and the TCSC damping controller.
Zou, An-Min; Kumar, Krishna Dev
2012-07-01
This brief considers the attitude coordination control problem for spacecraft formation flying when only a subset of the group members has access to the common reference attitude. A quaternion-based distributed attitude coordination control scheme is proposed with consideration of the input saturation and with the aid of the sliding-mode observer, separation principle theorem, Chebyshev neural networks, smooth projection algorithm, and robust control technique. Using graph theory and a Lyapunov-based approach, it is shown that the distributed controller can guarantee the attitude of all spacecraft to converge to a common time-varying reference attitude when the reference attitude is available only to a portion of the group of spacecraft. Numerical simulations are presented to demonstrate the performance of the proposed distributed controller.
Care coordinators: a controlled evaluation of an inpatient mental health service innovation.
Stewart, Malcolm W; Wilson, Michael; Bergquist, Karla; Thorburn, John
2012-02-01
The study aimed to evaluate the impact of introducing designated care coordinators into an acute mental health inpatient unit in terms of service delivery, clinical outcomes, and service user and significant other perceptions. A pre-post-controlled design was implemented with a consecutive sample of 292 service users admitted and staying more than 5 days in two wards, with care coordinators introduced in one ward. Data were obtained from clinical records, standard measures, and service user and significant other surveys. Care coordinator input was associated with significant improvements in service delivery and stronger involvement of significant others and community resources. Care-coordinated clients showed significantly better clinical outcomes, including the Health of Nations Outcome Scales behaviour subscale, less time in the intensive care subunit, less community crisis team input in the week following discharge, and lower rates of readmission in the month following discharge. Care-coordinated service users and their significant others gave higher ratings of service delivery, outcome, and satisfaction. The results indicate that designated care coordinators significantly improve care processes, outcomes, and service user experience in acute inpatient mental health settings. © 2011 The Authors. International Journal of Mental Health Nursing © 2011 Australian College of Mental Health Nurses Inc.
Controlling the wave propagation through the medium designed by linear coordinate transformation
International Nuclear Information System (INIS)
Wu, Yicheng; He, Chengdong; Wang, Yuzhuo; Liu, Xuan; Zhou, Jing
2015-01-01
Based on the principle of transformation optics, we propose to control the wave propagating direction through the homogenous anisotropic medium designed by linear coordinate transformation. The material parameters of the medium are derived from the linear coordinate transformation applied. Keeping the space area unchanged during the linear transformation, the polarization-dependent wave control through a non-magnetic homogeneous medium can be realized. Beam benders, polarization splitter, and object illusion devices are designed, which have application prospects in micro-optics and nano-optics. The simulation results demonstrate the feasibilities and the flexibilities of the method and the properties of these devices. Design details and full-wave simulation results are provided. The work in this paper comprehensively applies the fundamental theories of electromagnetism and mathematics. The method of obtaining a new solution of the Maxwell equations in a medium from a vacuum plane wave solution and a linear coordinate transformation is introduced. These have a pedagogical value and are methodologically and motivationally appropriate for physics students and teachers at the undergraduate and graduate levels. (paper)
Controlling the wave propagation through the medium designed by linear coordinate transformation
Wu, Yicheng; He, Chengdong; Wang, Yuzhuo; Liu, Xuan; Zhou, Jing
2015-01-01
Based on the principle of transformation optics, we propose to control the wave propagating direction through the homogenous anisotropic medium designed by linear coordinate transformation. The material parameters of the medium are derived from the linear coordinate transformation applied. Keeping the space area unchanged during the linear transformation, the polarization-dependent wave control through a non-magnetic homogeneous medium can be realized. Beam benders, polarization splitter, and object illusion devices are designed, which have application prospects in micro-optics and nano-optics. The simulation results demonstrate the feasibilities and the flexibilities of the method and the properties of these devices. Design details and full-wave simulation results are provided. The work in this paper comprehensively applies the fundamental theories of electromagnetism and mathematics. The method of obtaining a new solution of the Maxwell equations in a medium from a vacuum plane wave solution and a linear coordinate transformation is introduced. These have a pedagogical value and are methodologically and motivationally appropriate for physics students and teachers at the undergraduate and graduate levels.
Coordinated Control of Multi-terminal DC Grid for Wind Power Integration
DEFF Research Database (Denmark)
Hao, Yu; Zhao, Haoran; Wu, Qiuwei
2016-01-01
Multi-terminal HVDC (MTDC) technology using voltage source converter (VSC) is a good option for wind power integration. Compared with point to point DC connection, MTDC provide better controllability based on different control strategies. In this paper, proportional-integral (PI) controllers...... with tuned PI parameters are designed to coordinate DC flow among the DC grid with good dynamic performance. In order to overcome the disadvantages of the conventional PI control, a simple adaptive PI control strategy is proposed based on the system transfer function. Case studies were conducted with PowerFactory....
Dounskaia, Natalia; Shimansky, Yury
2016-06-01
Optimality criteria underlying organization of arm movements are often validated by testing their ability to adequately predict hand trajectories. However, kinematic redundancy of the arm allows production of the same hand trajectory through different joint coordination patterns. We therefore consider movement optimality at the level of joint coordination patterns. A review of studies of multi-joint movement control suggests that a 'trailing' pattern of joint control is consistently observed during which a single ('leading') joint is rotated actively and interaction torque produced by this joint is the primary contributor to the motion of the other ('trailing') joints. A tendency to use the trailing pattern whenever the kinematic redundancy is sufficient and increased utilization of this pattern during skillful movements suggests optimality of the trailing pattern. The goal of this study is to determine the cost function minimization of which predicts the trailing pattern. We show that extensive experimental testing of many known cost functions cannot successfully explain optimality of the trailing pattern. We therefore propose a novel cost function that represents neural effort for joint coordination. That effort is quantified as the cost of neural information processing required for joint coordination. We show that a tendency to reduce this 'neurocomputational' cost predicts the trailing pattern and that the theoretically developed predictions fully agree with the experimental findings on control of multi-joint movements. Implications for future research of the suggested interpretation of the trailing joint control pattern and the theory of joint coordination underlying it are discussed.
Immersion and Invariance-Based Coordinated Generator Excitation and SVC Control for Power Systems
Directory of Open Access Journals (Sweden)
Adirak Kanchanaharuthai
2014-01-01
Full Text Available A nonlinear coordinated control of excitation and SVC of an electrical power system is proposed for transient stability, and voltage regulation enhancement after the occurrence of a large disturbance and a small perturbation. Using the concept of Immersion and Invariance (I&I design methodology, the proposed nonlinear controller is used to not only achieve power angle stability, frequency and voltage regulation but also ensure that the closed-loop system is transiently and asymptotically stable. In order to show the effectiveness of the proposed controller design, the simulation results illustrate that, in spite of the case where a large perturbation occurs on the transmission line or there is a small perturbation to mechanical power inputs, the proposed controller can not only keep the system transiently stable but also simultaneously accomplish better dynamic properties of the system as compared to operation with the existing controllers designed through a coordinated passivation technique controller and a feedback linearization scheme, respectively.
Directory of Open Access Journals (Sweden)
Arnautović Dušan
2014-01-01
Full Text Available The paper, discusses the possibility to use coordinated Q-V controller (CQVC to perform secondary voltage control at the power plant level. The CQVC performs the coordination of the synchronous generators' (SG reactive power outputs in order to maintain the same total reactive power delivered by the steam power plant (SPP, while at the same time maintaining a constant voltage with programmed reactive droop characteristic at the SPP HV busbar. This busbar is the natural pilot node for secondary voltage control at HV level as the node with maximum power production and maximum power consumption. In addition to voltage control, the CQVC maintains the uniform allocation of reactive power reserves at all SGs in the power plant. This is accomplished by setting the reactive power of each SG at given operating point in accordance to the available reactive power of the same SG at that point. Different limitations imposed by unit's and plant equipment are superimposed on original SG operating chart (provided by the manufacturer in order to establish realistic limits of SG operation at given operating point. The CQVC facilitates: i practical implementation of secondary voltage control in power system, as it is capable of ensuring delivery of reactive power as requested by regional/voltage control while maintaining voltage at system pilot node, ii the full deployment of available reactive power of SGs which in turn contributes to system stability, iii assessment of the reactive power impact/contribution of each generator in providing voltage control as ancillary service. Furthermore, it is also possible to use CQVC to pricing reactive power production cost at each SG involved and to design reactive power bidding structure for transmission network devices by using recorded data. Practical exploitation experience acquired during CQVC continuous operation for over two years enabled implementation of the optimal setting of reference voltage and droop on daily
DEFF Research Database (Denmark)
Guan, Yajuan; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.
2016-01-01
A coordinated secondary control approach based on an autonomous current-sharing control strategy for balancing the discharge rates of energy storage systems (ESSs) in islanded AC microgrids is proposed in this paper. The coordinated secondary controller can regulate the power outputs of distributed...... incidents and unintentional outages in DG units, but also aims to provide a fast transient response and an accurate output-current-sharing performance. A complete root locus analysis is given in order to achieve system stability and parameter sensitivity. Experimental results are presented to show...... the performance of the whole system and to verify the effectiveness of the proposed controller....
Energy Technology Data Exchange (ETDEWEB)
Hao, He [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Liu, Guopeng [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Huang, Sen [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Katipamula, Srinivas [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2016-10-31
Renewable energy resources such as wind and solar power have a high degree of uncertainty. Large-scale integration of these variable generation sources into the grid is a big challenge for power system operators. Buildings, in which we live and work, consume about 75% of the total electricity in the United States. They also have a large capacity of power flexibility due to their massive thermal capacitance. Therefore, they present a great opportunity to help the grid to manage power balance. In this report, we study coordination and control of flexible building loads for renewable integration. We first present the motivation and background, and conduct a literature review on building-to-grid integration. We also compile a catalog of flexible building loads that have great potential for renewable integration, and discuss their characteristics. We next collect solar generation data from a photovoltaic panel on Pacific Northwest National Laboratory campus, and conduct data analysis to study their characteristics. We find that solar generation output has a strong uncertainty, and the uncertainty occurs at almost all time scales. Additional data from other sources are also used to verify our study. We propose two transactive coordination strategies to manage flexible building loads for renewable integration. We prove the theories that support the two transactive coordination strategies and discuss their pros and cons. In this report, we select three types of flexible building loads—air-handling unit, rooftop unit, and a population of WHs—for which we demonstrate control of the flexible load to track a dispatch signal (e.g., renewable generation fluctuation) using experiment, simulation, or hardware-in-the-loop study. More specifically, we present the system description, model identification, controller design, test bed setup, and experiment results for each demonstration. We show that coordination and control of flexible loads has a great potential to integrate
Chowdhury, Indrajit; Branch, Alicia; Olatinwo, Moshood; Thomas, Kelwyn; Matthews, Roland; Thompson, Winston E
2011-08-29
Ceramide is a key factor in inducing germ cell apoptosis by translocating from cumulus cells into the adjacent oocyte and lipid rafts through gap junctions. Therefore studies designed to elucidate the mechanistic pathways in ceramide induced granulosa cell (GC) apoptosis and follicular atresia may potentially lead to the development of novel lipid-based therapeutic strategies that will prevent infertility and premature menopause associated with chemo and/or radiation therapy in female cancer patients. Our previous studies have shown that Prohibitin (PHB) is intimately involved in GCs differentiation, atresia, and luteolysis. In the present study, we have examined the functional effects of loss-/gain-of-function of PHB using adenoviral technology in delaying apoptosis induced by the physiological ligand ceramide in rat GCs. Under these experimental conditions, exogenous ceramide C-8 (50 μM) augmented the expression of mitochondrial PHB and subsequently cause the physical destruction of GC by the release of mitochondrial cytochrome c and activation of caspase-3. In further studies, silencing of PHB expression by adenoviral small interfering RNA (shRNA) sensitized GCs to ceramide C8-induce apoptosis. In contrast, adenovirus (Ad) directed overexpression of PHB in GCs resulted in increased PHB content in mitochondria and delayed the onset of ceramide induced apoptosis in the infected GCs. Taken together, these results provide novel evidences that a critical level of PHB expression within the mitochondria plays a key intra-molecular role in GC fate by mediating the inhibition of apoptosis and may therefore, contribute significantly to ceramide induced follicular atresia. Copyright © 2011 Elsevier Inc. All rights reserved.
Video Demo: Deep Reinforcement Learning for Coordination in Traffic Light Control
van der Pol, E.; Oliehoek, F.A.; Bosse, T.; Bredeweg, B.
2016-01-01
This video demonstration contrasts two approaches to coordination in traffic light control using reinforcement learning: earlier work, based on a deconstruction of the state space into a linear combination of vehicle states, and our own approach based on the Deep Q-learning algorithm.
DEFF Research Database (Denmark)
Petersen, Lennart; Iov, Florin; Hansen, Anca Daniela
2016-01-01
This paper focusses on voltage control support and coordination between renewable generation plants in medium voltage distribution systems. An exemplary benchmark grid in Denmark, including a number of flexible ReGen plants providing voltage control functionality, is used as a base case. First...
Coordinated signal control for arterial intersections using fuzzy logic
Kermanian, Davood; Zare, Assef; Balochian, Saeed
2013-09-01
Every day growth of the vehicles has become one of the biggest problems of urbanism especially in major cities. This can waste people's time, increase the fuel consumption, air pollution, and increase the density of cars and vehicles. Fuzzy controllers have been widely used in many consumer products and industrial applications with success over the past two decades. This article proposes a comprehensive model of urban traffic network using state space equations and then using Fuzzy Logic Tool Box and SIMULINK Program MATLAB a fuzzy controller in order to optimize and coordinate signal control at two intersections at an arterial road. The fuzzy controller decides to extend, early cut or terminate a signal phase and phase sequence to ensure smooth flow of traffic with minimal waiting time and length of queue. Results show that the performance of the proposed traffic controller at novel fuzzy model is better that of conventional controllers under normal and abnormal traffic conditions.
Co-ordinated voltage control of DFIG wind turbines in uninterrupted operation during grid faults
DEFF Research Database (Denmark)
Hansen, Anca Daniela; Michalke, G.; Sørensen, Poul Ejnar
2007-01-01
Emphasis in this article is on the design of a co-ordinated voltage control strategy for doubly fed induction generator (DFIG) wind turbines that enhances their capability to provide grid support during grid faults. In contrast to its very good performance in normal operation, the DFIG wind turbine...... concept is quite sensitive to grid faults and requires special power converter protection. The fault ride-through and grid support capabilities of the DFIG address therefore primarily the design of DFIG wind turbine control with special focus on power converter protection and voltage control issues....... A voltage control strategy is designed and implemented in this article, based on the idea that both converters of the DFIG (i.e. rotor-side converter and grid-side converter) participate in the grid voltage control in a co-ordinated manner. By default the grid voltage is controlled by the rotor...
DEFF Research Database (Denmark)
Wu, Dan; Tang, Fen; Dragicevic, Tomislav
2013-01-01
In this paper, a distributed coordinated control scheme based on frequency-bus-signaling (FBS) method for a low-voltage AC three phase microgrid is proposed. The control scheme is composed by two levels. Firstly a primary local control which is different for the DGs and the ESS is proposed. The ESS...... control is implemented to restore the frequency deviation produced by the primary ESS controller while preserving the coordinated control performance. Real-time simulation results show the feasibility of the proposed approach by showing the operation of the microgrid in different scenarios....
Directory of Open Access Journals (Sweden)
Ali Nasser Hussain
2016-09-01
Full Text Available The aim of this study is to present a comprehensive comparison and assessment of the damping function improvement of power system oscillation for the multiple damping controllers using the simultaneously coordinated design based on Power System Stabilizer (PSS and Flexible AC Transmission System (FACTS devices. FACTS devices can help in the enhancing the stability of the power system by adding supplementary damping controller to the control channel of the FACTS input to implement the task of Power Oscillation Damping (FACT POD controller. Simultaneous coordination can be performed in different ways. First, the dual coordinated designs between PSS and FACTS POD controller or between different FACTS POD controllers are arranged in a multiple FACTS devices without PSS. Second, the simultaneous coordination has been extended to triple coordinated design among PSS and different FACTS POD controllers. The parameters of the damping controllers have been tuned in the individual controllers and coordinated designs by using a Chaotic Particle Swarm Optimization (CPSO algorithm that optimized the given eigenvalue-based objective function. The simulation results for a multi-machine power system show that the dual coordinated design provide satisfactory damping performance over the individual control responses. Furthermore, the triple coordinated design has been shown to be more effective in damping oscillations than the dual damping controllers.
ICT Based HIL Validation of Voltage Control Coordination in Smart Grids Scenarios
Directory of Open Access Journals (Sweden)
Kamal Shahid
2018-05-01
Full Text Available This paper aims to validate the capability of renewable generation (ReGen plants to provide online voltage control coordination ancillary service to the system operators in smart grids. Simulation studies about online coordination concepts from ReGen plants have already been identified in previous publications. However, here, the results are validated through a real-time Hardware-In-the-Loop framework using an exemplary benchmark grid area in Denmark as a base case that includes flexible renewable power plants providing voltage control functionality. The provision of voltage control support from ReGen plants is verified on a large-scale power system against the baseline scenario, considering the hierarchical industrial controller platforms used nowadays in power plants. Moreover, the verification of online voltage control support is carried out by taking into account a communication network as well as the associated data traffic patterns obtained from a real network. Based on the sets of recordings, guidelines and recommendations for practical implementation of the developed control algorithms for targeted ancillary service are made. This provides a deep insight for stakeholders, i.e., wind turbine and photo-voltaic system manufacturers and system operators, regarding the existing boundaries for current technologies and requirements for accommodating the new ancillary services in industrial application.
Synthesis of controllable and normal sublanguages for discrete-event systems using a coordinator
Czech Academy of Sciences Publication Activity Database
Komenda, Jan; Masopust, Tomáš; van Schuppen, J. H.
2011-01-01
Roč. 60, č. 7 (2011), s. 492-502 ISSN 0167-6911 R&D Projects: GA ČR(CZ) GAP103/11/0517; GA ČR(CZ) GPP202/11/P028 Grant - others:European Commission(XE) EU. ICT .DISC 224498 Institutional research plan: CEZ:AV0Z10190503 Keywords : discrete-event system * coordination control * coordinator Subject RIV: BA - General Mathematics Impact factor: 1.222, year: 2011 http://www.sciencedirect.com/science/article/pii/S0167691111000739
Synthesis of controllable and normal sublanguages for discrete-event systems using a coordinator
Czech Academy of Sciences Publication Activity Database
Komenda, Jan; Masopust, Tomáš; van Schuppen, J. H.
2011-01-01
Roč. 60, č. 7 (2011), s. 492-502 ISSN 0167-6911 R&D Projects: GA ČR(CZ) GAP103/11/0517; GA ČR(CZ) GPP202/11/P028 Grant - others:European Commission(XE) EU.ICT.DISC 224498 Institutional research plan: CEZ:AV0Z10190503 Keywords : discrete-event system * coordination control * coordinator Subject RIV: BA - General Mathematics Impact factor: 1.222, year: 2011 http://www.sciencedirect.com/science/article/pii/S0167691111000739
Fast Coordinated Control of DFIG Wind Turbine Generators for Low and High Voltage Ride-Through
Directory of Open Access Journals (Sweden)
Yun Wang
2014-06-01
Full Text Available This paper presents a fast coordinated control scheme of the rotor side converter (RSC, the Direct Current (DC chopper and the grid side converter (GSC of doubly fed induction generator (DFIG wind turbine generators (WTGs to improve the low voltage ride through (LVRT and high voltage ride through (HVRT capability of the DFIG WTGs. The characteristics of DFIG WTGs under voltage sags and swells were studied focusing on the DFIG WTG stator flux and rotor voltages during the transient periods of grid voltage changes. The protection schemes of the rotor crowbar circuit and the DC chopper circuit were proposed considering the characteristics of the DFIG WTGs during voltage changes. The fast coordinated control of RSC and GSC were developed based on the characteristic analysis in order to realize efficient LVRT and HVRT of the DFIG WTGs. The proposed fast coordinated control schemes were verified by time domain simulations using Matlab-Simulink.
DEFF Research Database (Denmark)
Su, Chi; Liu, Zhou; Chen, Zhe
2014-01-01
of network protection devices. As a protection measure commonly used in distribution network, recloser-fuse coordination could suffer from this impact. Research work has been conducted to deal with this problem by modifying the control strategy of the DG converters during faults. These solutions generally...... reduce the current output from the converters during faults so as to mitigate the influence on protection coordination. However, converter current reduction may not be necessary for all types of faults. This paper proposes a converter control strategy with adaptivity to different fault types and also non......-fault voltage drop events. This control strategy is validated by simulations in DIgSILENT PowerFactory....
Coordination Control Strategy for AC/DC Hybrid Microgrids in Stand-Alone Mode
Directory of Open Access Journals (Sweden)
Dwi Riana Aryani
2016-06-01
Full Text Available Interest in DC microgrids is rapidly increasing along with the improvement of DC power technology because of its advantages. To support the integration process of DC microgrids with the existing AC utility grids, the form of hybrid AC/DC microgrids is considered for higher power conversion efficiency, lower component cost and better power quality. In the system, AC and DC portions are connected through interlink bidirectional AC/DC converters (IC with a proper control system and power management. In the stand-alone operation mode of AC/DC hybrid microgrids, the control of power injection through the IC is crucial in order to maintain the system security. This paper mainly deals with a coordination control strategy of IC and a battery energy storage system (BESS converter under stand-alone operation. A coordinated control strategy for the IC, which considers the state of charge (SOC level of BESS and the load shedding scheme as the last resort, is proposed to obtain better power sharing between AC and DC subgrids. The scheme will be tested with a hybrid AC/DC microgrid, using the tool of the PSCAD/EMTDC software.
DEFF Research Database (Denmark)
Wu, Dan; Tang, Fen; Guerrero, Josep M.
2014-01-01
In this paper, a decentralized control for coordinate both active and reactive powers is proposed for islanded microgrids. Compared with the conventional droop control strategies, the proposed control realizes decentralized power distribution among renewable energy sources (RES) and energy storage...... systems (ESS) according to the local source conditions. Based on bus-signaling method, the ESS is able to limit charging power by decreasing RES power generation automatically. As well, the reactive power coordinated control makes the RES units able to support reactive power in a decentralized way, which...... allows ESS providing for more active power availability. Moreover, the reactive power is distributed according to the apparent power capacity of each unit. The control strategy principle is simple and easy to implement without extra communication requirements. Real time hardware-in-the-loop results...
DEFF Research Database (Denmark)
Han, Yang; Zhang, Ke; Hong, Li
2018-01-01
The increasing integration of the distributed renewable energy sources highlights the requirement to design various control strategies for microgrids (MGs) and microgrid clusters (MGCs). The multi-agent system (MAS)-based distributed coordinated control strategies shows the benefits to balance...... the power and energy, stabilize voltage and frequency, achieve economic and coordinated operation among the MGs and MGCs. However, the complex and diverse combinations of distributed generations in multi-agent system increase the complexity of system control and operation. In order to design the optimized...... configuration and control strategy using MAS, the topology models and mathematic models such as the graph topology model, non-cooperative game model, the genetic algorithm and particle swarm optimization algorithm are summarized. The merits and drawbacks of these control methods are compared. Moreover, since...
A coordinated multivariable control system design for a HVDC linked remote ABWR nuclear power park
International Nuclear Information System (INIS)
Hara, T.; Kurita, A.; Younkins, T.D.; Sanchez-Gasca, J.J.; Chow, J.H.
1987-01-01
This paper presents a conceptual design of a coordinated output feedback multivariable control system for a remote nuclear generation park connected to a load area with an HVDC link. The control design presented in this paper is for both normal operation (e.g., load following and frequency regulation) and contingencies (e.g., loss of a dc bipole or loss of two nuclear reactors). The design is simple and compact: four control signals, five measurements, and the integrals of two measurements are used to meet all the objectives and constraints for normal operation and contingencies. The multivariable control coordinates the measurements and controls according to the time frame of response and the amount of interactions between variables. This paper describes the model of the system, the multivariable control design, and the nonlinear time domain simulation of the overall system performance
Directory of Open Access Journals (Sweden)
Firmanzah Firmanzah
2013-07-01
Full Text Available New product launching (NPL to the local market by subsidiary managers is a strategic activity, which requires organizational supports from MNC global network. The NPL activity is marked by high level of uncertainty, risk, and market failure. Thus, a headquarter needs to integrate the subsidiary NPL into global strategy. There are two mechanisms to integrate subsidiaries’ activities during NPL process; coordination and control process. By testing the effect of each mechanism on role clarity and functional conflict, I found that coordination mechanism increase role clarity between headquarter and subsidiaries’ managers. In contrast, exercising control mechanism reduces role clarity and functional conflict between headquarter and subsidiaries’ managers during NPL. This research shows that both role clarity and functional conflict increase new product commercial performance introduced by subsidiary in the local market. Keywords: new product launching (NPL, coordination mechanism, control mechanism, and new product performance
Mode transition coordinated control for a compound power-split hybrid car
Wang, Chen; Zhao, Zhiguo; Zhang, Tong; Li, Mengna
2017-03-01
With a compound power-split transmission directly connected to the engine in hybrid cars, dramatic fluctuations in engine output torque result in noticeable jerks when the car is in mode transition from electric drive mode to hybrid drive mode. This study designed a mode transition coordinated control strategy, and verified that strategy's effectiveness with both simulations and experiments. Firstly, the mode transition process was analyzed, and ride comfort issues during the mode transition process were demonstrated. Secondly, engine ripple torque was modeled using the measured cylinder pumping pressure when the engine was not in operation. The complete dynamic plant model of the power-split hybrid car was deduced, and its effectiveness was validated by a comparison of experimental and simulation results. Thirdly, a coordinated control strategy was designed to determine the desired engine torque, motor torque, and the moment of fuel injection. Active damping control with two degrees of freedom, based on reference output shaft speed estimation, was designed to mitigate driveline speed oscillations. Carrier torque estimation based on transmission kinematics and dynamics was used to suppress torque disturbance during engine cranking. The simulation and experimental results indicate that the proposed strategy effectively suppressed vehicle jerks and improved ride comfort during mode transition.
Neuromotor task training for children with developmental coordination disorder: a controlled trial.
Niemeijer, A.S.; Smits-Engelsman, B.C.M.; Schoemaker, M.M.
2007-01-01
The aim of this study was to evaluate neuromotor task training (NTT), a recently developed child-centred and task-oriented treatment programme for children with developmental coordination disorder (DCD). A treatment and a non-treatment control group of children with DCD were included. Children were
Neuromotor Task Training for children with Developmental Coordination Disorder : a controlled trial
Niemeijer, A. S.; Smits-Engelsman, B. C. M.; Schoemaker, M. M.
The aim of this study was to evaluate neuromotor task training (NTT), a recently developed child-centred and task-oriented treatment programme for children with developmental coordination disorder (DCD). A treatment and a non-treatment control group of children with DCD were included. Children were
Directory of Open Access Journals (Sweden)
Zielinski Stephanie M
2012-01-01
Full Text Available Abstract Background Surgeons in the Netherlands, Canada and the US participate in the FAITH trial (Fixation using Alternative Implants for the Treatment of Hip fractures. Dutch sites are managed and visited by a financed central trial coordinator, whereas most Canadian and US sites have local study coordinators and receive per patient payment. This study was aimed to assess how these different trial management strategies affected trial performance. Methods Details related to obtaining ethics approval, time to trial start-up, inclusion, and percentage completed follow-ups were collected for each trial site and compared. Pre-trial screening data were compared with actual inclusion rates. Results Median trial start-up ranged from 41 days (P25-P75 10-139 in the Netherlands to 232 days (P25-P75 98-423 in Canada (p = 0.027. The inclusion rate was highest in the Netherlands; median 1.03 patients (P25-P75 0.43-2.21 per site per month, representing 34.4% of the total eligible population. It was lowest in Canada; 0.14 inclusions (P25-P75 0.00-0.28, representing 3.9% of eligible patients (p Conclusions In this trial, a central financed trial coordinator to manage all trial related tasks in participating sites resulted in better trial progression and a similar follow-up. It is therefore a suitable alternative for appointing these tasks to local research assistants. The central coordinator approach can enable smaller regional hospitals to participate in multicenter randomized controlled trials. Circumstances such as available budget, sample size, and geographical area should however be taken into account when choosing a management strategy. Trial Registration ClinicalTrials.gov: NCT00761813
Mathematical analysis and coordinated current allocation control in battery power module systems
Han, Weiji; Zhang, Liang
2017-12-01
As the major energy storage device and power supply source in numerous energy applications, such as solar panels, wind plants, and electric vehicles, battery systems often face the issue of charge imbalance among battery cells/modules, which can accelerate battery degradation, cause more energy loss, and even incur fire hazard. To tackle this issue, various circuit designs have been developed to enable charge equalization among battery cells/modules. Recently, the battery power module (BPM) design has emerged to be one of the promising solutions for its capability of independent control of individual battery cells/modules. In this paper, we propose a new current allocation method based on charging/discharging space (CDS) for performance control in BPM systems. Based on the proposed method, the properties of CDS-based current allocation with constant parameters are analyzed. Then, real-time external total power requirement is taken into account and an algorithm is developed for coordinated system performance control. By choosing appropriate control parameters, the desired system performance can be achieved by coordinating the module charge balance and total power efficiency. Besides, the proposed algorithm has complete analytical solutions, and thus is very computationally efficient. Finally, the efficacy of the proposed algorithm is demonstrated using simulations.
Energy Technology Data Exchange (ETDEWEB)
Miller, Nicholas; MacDowell, Jason; Chmiel, Gary; Konopinski, Ryan; Gautam, Durga [GE Energy, Schenectady, NY (United States); Laughter, Grant; Hagen, Dave [PacifiCorp., Salt Lake City, UT (United States)
2012-07-01
At high levels of wind power penetration, multiple wind plants may be the predominant generation resource over large geographic areas. Thus, not only do wind plants need to provide a high level of functionality, they must coordinate properly with each other. This paper describes the analysis and field testing of wind plant voltage controllers designed to improve system voltage performance through passive coordination. The described wind power plant controls can coordinate the real and reactive power response of multiple wind turbines and thereby make the plant function as a single ''grid friendly'' power generation source. For this application, involving seven large wind plants with predominantly GE wind turbines in Eastern Wyoming, the voltage portion of the controllers were configured and tuned to allow the collective reactive power response of multiple wind plants in the region to work well together. This paper presents the results of the initial configuration and tuning study, and the results of the subsequent field tuning and testing of the modified controls. The paper also presents some comparisons of the measured field performance with the stability simulation models, which show that the available wind plant models provide accurate, high fidelity results for actual operating conditions of commercial wind power plants. (orig.)
Coordinated Control of Wind Turbine and Energy Storage System for Reducing Wind Power Fluctuation
Energy Technology Data Exchange (ETDEWEB)
Muljadi, Eduard [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kim, Chunghun [Hanyang University; Chung, Chung Choo [Hanyang University
2017-11-13
This paper proposes a coordinated control of wind turbine and energy storage system (ESS). Because wind power (WP) is highly dependent on variable wind speed and could induce a severe stability problem to power system especially when the WP has high penetration level. To solve this problem, many power generation corporations or grid operators recently use the ESS. It has very quick response and good performance for reducing the impact of WP fluctuation but has high cost for its installation. Therefore, it is very important to design the control algorithm considering both ESS capacity and grid reliability. Thus, we propose the control algorithm to mitigate the WP fluctuation by using the coordinated control between wind turbine and ESS considering ESS state of charge (SoC) and the WP fluctuation. From deloaded control according to WP fluctuation and ESS SoC management, we can expect the ESS lifespan expansion and improved grid reliability. The effectiveness of the proposed method is validated in MATLAB/Simulink considering power system including both wind turbine generator and conventional generators which react to system frequency deviation.
Ji, Yu; Sheng, Wanxing; Jin, Wei; Wu, Ming; Liu, Haitao; Chen, Feng
2018-02-01
A coordinated optimal control method of active and reactive power of distribution network with distributed PV cluster based on model predictive control is proposed in this paper. The method divides the control process into long-time scale optimal control and short-time scale optimal control with multi-step optimization. The models are transformed into a second-order cone programming problem due to the non-convex and nonlinear of the optimal models which are hard to be solved. An improved IEEE 33-bus distribution network system is used to analyse the feasibility and the effectiveness of the proposed control method
DEFF Research Database (Denmark)
Han, Renke; Meng, Lexuan; Ferrari-Trecate, Giancarlo
2017-01-01
This paper offers a highly flexible and reliable control strategy to achieve voltage bounded regulation and accurate reactive power sharing coordinately in AC Micro-Grids. A containment and consensus-based distributed coordination controller is proposed, by which each output voltage magnitude can...... be bounded within a reasonable range and the accurate reactive power sharing among distributed generators can be also achieved. Combined with the two proposed controllers and electrical part of the AC Micro-Grid, a small signal model is fully developed to analyze the sensitivity of different control...... parameters. The effectiveness of the proposed controller in case of load variation, communication failure, plug-and-play capability are verified by the experimental setup as an islanded Micro-Grid....
Directory of Open Access Journals (Sweden)
Juan Carlos Beltrán-Véliz
2016-01-01
Full Text Available This article consists of a case study regarding curriculum management practices of pedagogical coordinators in schools in Araucania area. The study aims to reveal technical/instrumental rationality, control and power mechanisms that underlie the curriculum management practices of such pedagogical coordinators of schools in Araucania region. A descriptive qualitative design based on the constructionist grounded theory and the constant comparative method is considered. Subjects studied included 12 technical leaders and 22 teachers from Araucania schools. Techniques for collecting information were semi-structured interview and texts for reading. Four categories rose from axial coding. Findings reveal that the teaching process is reduced to an instructional process. Furthermore, there is no uniformity of criteria regarding general functions that must be met. In the same extent, activity coordination is centered on bureaucratic administrative aspects, with main focus on task control. Regulations, programs and educational projects are used as control mechanisms. In addition, absence of spaces for professional discussion of pedagogical work and for constructive criticism is envisioned. This study concludes that pedagogical coordination practices are geared from an “instrumental rationality”, anchored in technical management set up in control and power.
Pilot/Controller Coordinated Decision Making in the Next Generation Air Transportation System
Bearman, Chris; Miller, Ronald c.; Orasanu, Judith M.
2011-01-01
Introduction: NextGen technologies promise to provide considerable benefits in terms of enhancing operations and improving safety. However, there needs to be a thorough human factors evaluation of the way these systems will change the way in which pilot and controllers share information. The likely impact of these new technologies on pilot/controller coordinated decision making is considered in this paper using the "operational, informational and evaluative disconnect" framework. Method: Five participant focus groups were held. Participants were four experts in human factors, between x and x research students and a technical expert. The participant focus group evaluated five key NextGen technologies to identify issues that made different disconnects more or less likely. Results: Issues that were identified were: Decision Making will not necessarily improve because pilots and controllers possess the same information; Having a common information source does not mean pilots and controllers are looking at the same information; High levels of automation may lead to disconnects between the technology and pilots/controllers; Common information sources may become the definitive source for information; Overconfidence in the automation may lead to situations where appropriate breakdowns are not initiated. Discussion: The issues that were identified lead to recommendations that need to be considered in the development of NextGen technologies. The current state of development of these technologies provides a good opportunity to utilize recommendations at an early stage so that NextGen technologies do not lead to difficulties in resolving breakdowns in coordinated decision making.
A. Ball
Overview From a technical perspective, CMS has been in “beam operation” state since 6th November. The detector is fully closed with all components operational and the magnetic field is normally at the nominal 3.8T. The UXC cavern is normally closed with the radiation veto set. Access to UXC is now only possible during downtimes of LHC. Such accesses must be carefully planned, documented and carried out in agreement with CMS Technical Coordination, Experimental Area Management, LHC programme coordination and the CCC. Material flow in and out of UXC is now strictly controlled. Access to USC remains possible at any time, although, for safety reasons, it is necessary to register with the shift crew in the control room before going down.It is obligatory for all material leaving UXC to pass through the underground buffer zone for RP scanning, database entry and appropriate labeling for traceability. Technical coordination (notably Stephane Bally and Christoph Schaefer), the shift crew and run ...
Niamul Islam, Naz; Hannan, M A; Mohamed, Azah; Shareef, Hussain
2016-01-01
Power system oscillation is a serious threat to the stability of multimachine power systems. The coordinated control of power system stabilizers (PSS) and thyristor-controlled series compensation (TCSC) damping controllers is a commonly used technique to provide the required damping over different modes of growing oscillations. However, their coordinated design is a complex multimodal optimization problem that is very hard to solve using traditional tuning techniques. In addition, several limitations of traditionally used techniques prevent the optimum design of coordinated controllers. In this paper, an alternate technique for robust damping over oscillation is presented using backtracking search algorithm (BSA). A 5-area 16-machine benchmark power system is considered to evaluate the design efficiency. The complete design process is conducted in a linear time-invariant (LTI) model of a power system. It includes the design formulation into a multi-objective function from the system eigenvalues. Later on, nonlinear time-domain simulations are used to compare the damping performances for different local and inter-area modes of power system oscillations. The performance of the BSA technique is compared against that of the popular particle swarm optimization (PSO) for coordinated design efficiency. Damping performances using different design techniques are compared in term of settling time and overshoot of oscillations. The results obtained verify that the BSA-based design improves the system stability significantly. The stability of the multimachine power system is improved by up to 74.47% and 79.93% for an inter-area mode and a local mode of oscillation, respectively. Thus, the proposed technique for coordinated design has great potential to improve power system stability and to maintain its secure operation.
Directory of Open Access Journals (Sweden)
Naz Niamul Islam
Full Text Available Power system oscillation is a serious threat to the stability of multimachine power systems. The coordinated control of power system stabilizers (PSS and thyristor-controlled series compensation (TCSC damping controllers is a commonly used technique to provide the required damping over different modes of growing oscillations. However, their coordinated design is a complex multimodal optimization problem that is very hard to solve using traditional tuning techniques. In addition, several limitations of traditionally used techniques prevent the optimum design of coordinated controllers. In this paper, an alternate technique for robust damping over oscillation is presented using backtracking search algorithm (BSA. A 5-area 16-machine benchmark power system is considered to evaluate the design efficiency. The complete design process is conducted in a linear time-invariant (LTI model of a power system. It includes the design formulation into a multi-objective function from the system eigenvalues. Later on, nonlinear time-domain simulations are used to compare the damping performances for different local and inter-area modes of power system oscillations. The performance of the BSA technique is compared against that of the popular particle swarm optimization (PSO for coordinated design efficiency. Damping performances using different design techniques are compared in term of settling time and overshoot of oscillations. The results obtained verify that the BSA-based design improves the system stability significantly. The stability of the multimachine power system is improved by up to 74.47% and 79.93% for an inter-area mode and a local mode of oscillation, respectively. Thus, the proposed technique for coordinated design has great potential to improve power system stability and to maintain its secure operation.
DEFF Research Database (Denmark)
S. El Moursi, Mohamed; Bak-Jensen, Birgitte; Abdel-Rahman, Mansour Hassan
2011-01-01
and optimal tracking secondary voltage control for wind parks based on self-excited induction generators which comprise STATCOM and under-load tap changer (ULTC) substation transformers. The voltage controllers for the STATCOM and ULTC transformer are coordinated and ensure the voltage support. In steady...
Coordinated voltage control in offshore HVDC connected cluster of wind power plants
DEFF Research Database (Denmark)
Sakamuri, Jayachandra Naidu; Rather, Zakir Hussain; Rimez, Johan
This paper presents a coordinated voltage control scheme (CVCS) for a cluster of offshore wind power plants connected to a voltage-source converter-based high-voltage direct current system. The primary control point of the proposed voltage control scheme is the introduced Pilot bus, which is having...... by dispatching reactive power references to each wind turbine (WT) in the wind power plant cluster based on their available reactive power margin and network sensitivity-based participation factors, which are derived from the dV/dQ sensitivity of a WT bus w.r.t. the Pilot bus. This method leads...
A DC Microgrid Coordinated Control Strategy Based on Integrator Current-Sharing
DEFF Research Database (Denmark)
Gao, Liyuan; Liu, Yao; Ren, Huisong
2017-01-01
The DC microgrid has become a new trend for microgrid study with the advantages of high reliability, simple control and low losses. With regard to the drawbacks of the traditional droop control strategies, an improved DC droop control strategy based on integrator current-sharing is introduced....... In the strategy, the principle of eliminating deviation through an integrator is used, constructing the current-sharing term in order to make the power-sharing between different distributed generation (DG) units uniform and reasonable, which can reduce the circulating current between DG units. Furthermore......, at the system coordinated control level, a hierarchical/droop control strategy based on the DC bus voltage is proposed. In the strategy, the operation modes of the AC main network and micro-sources are determined through detecting the DC voltage variation, which can ensure the power balance of the DC microgrid...
Performance of high-level and low-level control for coordination of mobile robots
Adinandra, S.; Caarls, J.; Kostic, D.; Nijmeijer, H.
2010-01-01
We analyze performance of different strategies for coordinated control of mobile robots. By considering an environment of a distribution center, the robots should transport goods from place A to place B while maintaining the desired formation and avoiding collisions. We evaluate performance of two
Coordination failure caused by sunspots
DEFF Research Database (Denmark)
Beugnot, Julie; Gürgüç, Zeynep; Øvlisen, Frederik Roose
2012-01-01
on the efficient equilibrium, we consider sunspots as a potential reason for coordination failure. We conduct an experiment with a three player 2x2x2 game in which coordination on the efficient equilibrium is easy and should normally occur. In the control session, we find almost perfect coordination on the payoff......-dominant equilibrium, but in the sunspot treatment, dis-coordination is frequent. Sunspots lead to significant inefficiency, and we conclude that sunspots can indeed cause coordination failure....
DEFF Research Database (Denmark)
Gui, Yonghao; Li, Mingshen; Guerrero, Josep M.
2018-01-01
A novel coordinated control for energy storage system (ESS) and renewable energy source (RES) units is proposed in islanded AC microgrids without a phase-locked loop system. We use a proportional-resonant control technique for the ESS, which fixes the voltage and frequency of the microgrid...
Robust coordinated control of a dual-arm space robot
Shi, Lingling; Kayastha, Sharmila; Katupitiya, Jay
2017-09-01
Dual-arm space robots are more capable of implementing complex space tasks compared with single arm space robots. However, the dynamic coupling between the arms and the base will have a serious impact on the spacecraft attitude and the hand motion of each arm. Instead of considering one arm as the mission arm and the other as the balance arm, in this work two arms of the space robot perform as mission arms aimed at accomplishing secure capture of a floating target. The paper investigates coordinated control of the base's attitude and the arms' motion in the task space in the presence of system uncertainties. Two types of controllers, i.e. a Sliding Mode Controller (SMC) and a nonlinear Model Predictive Controller (MPC) are verified and compared with a conventional Computed-Torque Controller (CTC) through numerical simulations in terms of control accuracy and system robustness. Both controllers eliminate the need to linearly parameterize the dynamic equations. The MPC has been shown to achieve performance with higher accuracy than CTC and SMC in the absence of system uncertainties under the condition that they consume comparable energy. When the system uncertainties are included, SMC and CTC present advantageous robustness than MPC. Specifically, in a case where system inertia increases, SMC delivers higher accuracy than CTC and costs the least amount of energy.
Coordinated Control Strategies of VSC-HVDC-Based Wind Power Systems for Low Voltage Ride Through
Directory of Open Access Journals (Sweden)
Xinyin Zhang
2015-07-01
Full Text Available The Voltage Source Converter-HVDC (VSC-HVDC system applied to wind power generation can solve large scale wind farm grid-connection and long distance transmission problems. However, the low voltage ride through (LVRT of the VSC-HVDC connected wind farm is a key technology issue that must be solved, and it is currently lacking an economic and effective solution. In this paper, a LVRT coordinated control strategy is proposed for the VSC-HVDC-based wind power system. In this strategy, the operation and control of VSC-HVDC and wind farm during the grid fault period is improved. The VSC-HVDC system not only provides reactive power support to the grid, but also effectively maintains the power balance and DC voltage stability by reducing wind-farm power output, without increasing the equipment investment. Correspondingly, to eliminate the influence on permanent magnet synchronous generator (PMSG-based wind turbine (WT systems, a hierarchical control strategy is designed. The speed and validity of the proposed LVRT coordinated control strategy and hierarchical control strategy were verified by MATLAB/Simulink simulations.
Directory of Open Access Journals (Sweden)
Ting Yan
2017-01-01
Full Text Available Considering the inherent disadvantages that severely affect driving comfortability during the shift process in HEVs, a dynamic shift coordinated control based on motor active speed synchronization is proposed to improve shift quality by reduction of shift vibration. The whole control scheme is comprised of three phases, preparatory phase, speed regulation phase, and synchronization phase, which are implemented consecutively in order. The key to inhibiting impact and jerk depends on the speed regulation phase, where motor active speed synchronization is utilized to reach the minimum speed difference between the two ends of synchronizer. A new hybrid system with superior performances is applied to present the validity of the adopted control algorithm during upshift or downshift, which can represent planetary gear system and conventional AMT shift procedure, respectively. Bench test, simulation, and road test results show that, compared with other methods, the proposed dynamic coordinated control can achieve shifting control in real time to effectively improve gear-shift comfort and shorten power interruption transients, with robustness in both conventional AMT and planetary gear train.
A role based coordination model in agent systems
Institute of Scientific and Technical Information of China (English)
ZHANG Ya-ying; YOU Jin-yuan
2005-01-01
Coordination technology addresses the construction of open, flexible systems from active and independent software agents in concurrent and distributed systems. In most open distributed applications, multiple agents need interaction and communication to achieve their overall goal. Coordination technologies for the Internet typically are concerned with enabling interaction among agents and helping them cooperate with each other.At the same time, access control should also be considered to constrain interaction to make it harmless. Access control should be regarded as the security counterpart of coordination. At present, the combination of coordination and access control remains an open problem. Thus, we propose a role based coordination model with policy enforcement in agent application systems. In this model, coordination is combined with access control so as to fully characterize the interactions in agent systems. A set of agents interacting with each other for a common global system task constitutes a coordination group. Role based access control is applied in this model to prevent unauthorized accesses. Coordination policy is enforced in a distributed manner so that the model can be applied to the open distributed systems such as Intemet. An Internet online auction system is presented as a case study to illustrate the proposed coordination model and finally the performance analysis of the model is introduced.
Wu, Qiong; Wu, Shiyong
2017-07-01
Prohibitin (PHB) plays a role in regulation of ultraviolet B light (UVB)-induced apoptosis of human keratinocytes, HaCaT cells. The regulatory function of PHB appears to be associated with its lipid raft translocation. However, the detailed mechanism for PHB-mediated apoptosis of these keratinocytes upon UVB irradiation is not clear. In this report, we determined the role of lipid raft translocation of PHB in regulation of UVB-induced apoptosis. Our data show that upon UVB irradiation PHB is translocated from the non-raft membrane to the lipid rafts, which is correlated with a release of both Akt and Raf from membrane. Overexpression of Akt and/or Raf impedes UVB-induced lipid raft translocation of PHB. Immunoprecipitation analysis indicates that UVB alters the interactions among PHB, Akt, and Raf. Reduced expression of PHB leads to a decreased phosphorylation of Akt and ERK, as well as a decreased activity of Akt, and increased apoptosis of the cells upon UVB irradiation. These results suggest that PHB regulates UVB-induced apoptosis of keratinocytes via a mechanism that involves detachment from Akt and Raf on the plasma membrane, and sequential lipid raft translocation. © 2017 Wiley Periodicals, Inc.
Directory of Open Access Journals (Sweden)
Sudharsana R Ande
Full Text Available Prohibitin (PHB or PHB1 is an evolutionarily conserved, multifunctional protein which is present in various cellular compartments including the plasma membrane. However, mechanisms involved in various functions of PHB are not fully explored yet. Here we report for the first time that PHB interacts with O-linked beta-N-acetylglucosamine transferase (O-GlcNAc transferase, OGT and is O-GlcNAc modified; and also undergoes tyrosine phosphorylation in response to insulin. Tyrosine 114 (Tyr114 and tyrosine 259 (Tyr259 in PHB are in the close proximity of potential O-GlcNAc sites serine 121 (Ser121 and threonine 258 (Thr258 respectively. Substitution of Tyr114 and Tyr259 residues in PHB with phenylalanine by site-directed mutagenesis results in reduced tyrosine phosphorylation as well as reduced O-GlcNAc modification of PHB. Surprisingly, this also resulted in enhanced tyrosine phosphorylation and activity of OGT. This is attributed to the presence of similar tyrosine motifs in PHB and OGT. Substitution of Ser121 and Thr258 with alanine and isoleucine respectively resulted in attenuation of O-GlcNAc modification and increased tyrosine phosphorylation of PHB suggesting an association between these two dynamic modifications. Sequence analysis of O-GlcNAc modified proteins having known O-GlcNAc modification site(s or known tyrosine phosphorylation site(s revealed a strong potential association between these two posttranslational modifications in various proteins. We speculate that O-GlcNAc modification and tyrosine phosphorylation of PHB play an important role in tyrosine kinase signaling pathways including insulin, growth factors and immune receptors signaling. In addition, we propose that O-GlcNAc modification and tyrosine phosphorylation is a novel previously unidentified binary switch which may provide new mechanistic insights into cell signaling pathways and is open for direct experimental examination.
PI and repetitive control for single phase inverter based on virtual rotating coordinate system
Li, Mengqi; Tong, Yibin; Jiang, Jiuchun; Liang, Jiangang
2018-03-01
Microgrid technology developed rapidly and nonlinear loads were connected increasingly. A new control strategy was proposed for single phase inverter when connected nonlinear loads under island condition. PI and repetitive compound controller was realized under synchronous rotating coordinate system and acquired high quality sinusoidal voltage output without voltage spike when loads step changed. Validity and correctness were verified by simulation using MATLAB/Simulink.
Fong, Shirley S. M.; Tsang, William W. N.; Ng, Gabriel Y. F.
2012-01-01
Children with developmental coordination disorder (DCD) have poorer postural control and are more susceptible to falls and injuries than their healthy counterparts. Sports training may improve sensory organization and balance ability in this population. This study aimed to evaluate the effects of three months of Taekwondo (TKD) training on the…
Coordinated Control Based on Bus-Signaling and Virtual Inertia for Islanded DC Microgrids
DEFF Research Database (Denmark)
Wu, Dan; Tang, Fen; Dragicevic, Tomislav
2015-01-01
A low-voltage DC islanded microgrid contains a number of renewable energy sources (RES), local loads, and energy storage systems (ESS). To avoid the over-charging and over-discharging situations of ESS, a coordinated control strategy should be used in DC islanded microgrids. In this paper, a nove...
Directory of Open Access Journals (Sweden)
Sebastian Ludyga
2017-12-01
Full Text Available The current body of evidence suggests that an aerobic exercise session has a beneficial effect on inhibitory control, whereas the impact of coordinative exercise on this executive function has not yet been examined in children with ADHD. Therefore, the present study aims to investigate the acute effects of aerobic and coordinative exercise on behavioral performance and the allocation of attentional resources in an inhibitory control task.Using a cross-over design, children with ADHD-combined type and healthy comparisons completed a Flanker task before and after 20Â min moderately-intense cycling exercise, coordinative exercise and an inactive control condition. During the task, stimulus-locked event-related potentials were recorded with electroencephalography.Both groups showed an increase of P300 amplitude and decrease of reaction time after exercise compared to the control condition. Investigating the effect of exercise modality, aerobic exercise led to greater increases of P300 amplitude and reductions in reaction time than coordinative exercise in children with ADHD.The findings suggest that a single exercise bout improves inhibitory control and the allocation of attentional resources. There were some indications that an aerobic exercise session seems to be more efficient than coordinative exercise in reducing the inhibitory control deficits that persist in children with ADHD. Keywords: P300, Executive function, Cognitive performance, Flanker task, Development, Healthy children
Comparison of intelligent fuzzy based AGC coordinated PID controlled and PSS controlled AVR system
Energy Technology Data Exchange (ETDEWEB)
Mukherjee, V. [Department of Electrical Engineering, Asansol Engineering College, Asansol, West Bengal (India); Ghoshal, S.P. [Department of Electrical Engineering, National Institute of Technology, Durgapur, West Bengal (India)
2007-11-15
This paper attempts to investigate the performance of intelligent fuzzy based coordinated control of the Automatic Generation Control (AGC) loop and the excitation loop equipped with Proportional Integral Derivative (PID) controlled Automatic Voltage Regulator (AVR) system and Power System Stabilizer (PSS) controlled AVR system. The work establishes that PSS controlled AVR system is much more robust in dynamic performance of the system over a wide range of system operating configurations. Thus, it is revealed that PSS equipped AVR is much more superior than PID equipped AVR in damping the oscillation resulting in improved transient response. The paper utilizes a novel class of Particle Swarm Optimization (PSO) termed as Craziness based Particle Swarm Optimization (CRPSO) as optimizing tool to get optimal tuning of PSS parameters as well as the gains of PID controllers. For on-line, off-nominal operating conditions Takagi Sugeno Fuzzy Logic (TSFL) has been applied to obtain the off-nominal optimal gains of PID controllers and parameters of PSS. Implementation of TSFL helps to achieve very fast dynamic response. Fourth order model of generator with AVR and high gain thyristor excitation system is considered for PSS controlled system while normal gain exciter is considered for PID controlled system. Simulation study also reveals that with high gain exciter, PID control is not at all effective. Transient responses are achieved by using modal analysis. (author)
Communicating Processes with Data for Supervisory Coordination
Directory of Open Access Journals (Sweden)
Jasen Markovski
2012-08-01
Full Text Available We employ supervisory controllers to safely coordinate high-level discrete(-event behavior of distributed components of complex systems. Supervisory controllers observe discrete-event system behavior, make a decision on allowed activities, and communicate the control signals to the involved parties. Models of the supervisory controllers can be automatically synthesized based on formal models of the system components and a formalization of the safe coordination (control requirements. Based on the obtained models, code generation can be used to implement the supervisory controllers in software, on a PLC, or an embedded (microprocessor. In this article, we develop a process theory with data that supports a model-based systems engineering framework for supervisory coordination. We employ communication to distinguish between the different flows of information, i.e., observation and supervision, whereas we employ data to specify the coordination requirements more compactly, and to increase the expressivity of the framework. To illustrate the framework, we remodel an industrial case study involving coordination of maintenance procedures of a printing process of a high-tech Oce printer.
A Process Algebra for Supervisory Coordination
Directory of Open Access Journals (Sweden)
Jos Baeten
2011-08-01
Full Text Available A supervisory controller controls and coordinates the behavior of different components of a complex machine by observing their discrete behaviour. Supervisory control theory studies automated synthesis of controller models, known as supervisors, based on formal models of the machine components and a formalization of the requirements. Subsequently, code generation can be used to implement this supervisor in software, on a PLC, or embedded microprocessor. In this article, we take a closer look at the control loop that couples the supervisory controller and the machine. We model both event-based and state-based observations using process algebra and bisimulation-based semantics. The main application area of supervisory control that we consider is coordination, referred to as supervisory coordination, and we give an academic and an industrial example, discussing the process-theoretic concepts employed.
Coordinated control of three-phase AC and DC type EV–ESSs for efficient hybrid microgrid operations
International Nuclear Information System (INIS)
Rahman, Md Shamiur; Hossain, M.J.; Lu, Junwei
2016-01-01
Highlights: • A coordinated control is proposed for three-phase AC and DC type electric vehicles. • A four-quadrant interlinking converter is designed for hybrid microgrid operations. • Concurrent real irradiation data and commercial load profile are used for testing. • Unbalanced scenario due to single-phase electric vehicle charging is considered. • Improved AC and DC bus voltages and frequency regulations are achieved. - Abstract: This paper presents a three-layered coordinated control to incorporate three-phase (3P) alternating current (AC) and direct current (DC) type electric vehicle energy storage systems (EV–ESSs) for improved hybrid AC/DC microgrid operations. The first layer of the algorithm ensures DC subgrid management by regulating the DC bus voltage and DC side power management. The second and third layer manages AC subgrid by regulating the AC bus voltage and the frequency by managing reactive and active power respectively. The multi-layered coordination is embedded into the microgrid central controller (MGCC) which controls the interlinking controller in between AC and DC microgrid and the interfacing controllers of the participating electric vehicles (EVs) and distributed generation (DG) units. The whole system is designed in MATLAB/SIMULINK® environment resembling the under construction microgrid at Griffith University, Australia. Extensive case studies are performed using real life irradiation data and commercial loads of the campus buildings. Impacts of homogeneous and heterogeneous single-phase EV charging are investigated to observe both balanced and unbalanced scenarios. Synchronization during the transition from the islanded to grid-tied mode is tested considering a contingency situation. From the comparative simulation results it is evident that the proposed controller exhibits effective, reliable and robust performance for all the cases.
Transactive Control and Coordination of Distributed Assets for Ancillary Services
Energy Technology Data Exchange (ETDEWEB)
Subbarao, Krishnappa [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Fuller, Jason C. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Kalsi, Karanjit [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Somani, Abhishek [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Pratt, Robert G. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Widergren, Steven E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Chassin, David P. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2013-09-18
The need to diversify energy supplies, the need to mitigate energy-related environmental impact, and the entry of electric vehicles in large numbers present challenges and opportunities to power system professionals. Wind and solar power provide many benefits, and to reap the benefits the resulting increased variability—forecasted as well as unforecasted—should be addressed. A majority of states and the District of Columbia, representing over half of the total load, have passed renewable portfolio standards. California’s plans call for 33% renewable energy by 2020. For grid balancing and for meeting reliability standards, ancillary services are needed. The needs for these services are poised to increase significantly. Demand resources are receiving increasing attention as one means of providing the ancillary services. Control and coordination of a large number (~millions) of distributed smart grid assets requires innovative approaches. One such approach is transactive control and coordination (TC2)—a distributed, hierarchical, agent-based incentive and control system. The TC2 paradigm is to create a market-like control system in which participation is voluntary and the participant sets the price for participation. For transactions that are frequent, automation of bids and responses is necessary. Such an approach has been developed and demonstrated at the Pacific Northwest National Laboratory. The devices, typically thermostatically controlled heating, ventilating, and air conditioning (HVAC) loads, send their bids—the quantity of energy they need and, based on the consumer preferences encoded in a simple user interface, the price they are willing to pay. The typical bid period is 5 minutes. By aggregating all the bids, a demand curve is generated by the aggregating entity, and matched with a supply curve or supply constraint. The aggregator transmits the clearing price to the devices. The winning devices proceed to consume the energy they bid for and won
Voetsch, Karen; Sequeira, Sonia; Chavez, Amy Holmes
2016-03-31
In 2012, the Centers for Disease Control and Prevention provided funding and technical assistance to all states and territories to implement the Coordinated Chronic Disease Program, marking the first time that all state health departments had federal resources to coordinate chronic disease prevention and control programs. This article describes lessons learned from this initiative and identifies key elements of a coordinated approach. We analyzed 80 programmatic documents from 21 states and conducted semistructured interviews with 7 chronic disease directors. Six overarching themes emerged: 1) focused agenda, 2) identification of functions, 3) comprehensive planning, 4) collaborative leadership and expertise, 5) managed resources, and 6) relationship building. These elements supported 4 essential activities: 1) evidence-based interventions, 2) strategic use of staff, 3) consistent communication, and 4) strong program infrastructure. On the basis of these elements and activities, we propose a conceptual model that frames overarching concepts, skills, and strategies needed to coordinate state chronic disease prevention and control programs.
Directory of Open Access Journals (Sweden)
Javad Morsali
2017-02-01
Full Text Available In this paper, fractional order proportional-integral-differential (FOPID controller is employed in the design of thyristor controlled series capacitor (TCSC-based damping controller in coordination with the secondary integral controller as automatic generation control (AGC loop. In doing so, the contribution of the TCSC in tie-line power exchange is extracted mathematically for small load disturbance. Adjustable parameters of the proposed FOPID-based TCSC damping controller and the AGC loop are optimized concurrently via an improved particle swarm optimization (IPSO algorithm which is reinforced by chaotic parameter and crossover operator to obtain a globally optimal solution. The powerful FOMCON toolbox is used along with MATLAB for handling fractional order modeling and control. An interconnected multi-source power system is simulated regarding the physical constraints of generation rate constraint (GRC nonlinearity and governor dead band (GDB effect. Simulation results using FOMCON toolbox demonstrate that the proposed FOPID-based TCSC damping controller achieves the greatest dynamic performance under different load perturbation patterns in comparison with phase lead-lag and classical PID-based TCSC damping controllers, all in coordination with the integral AGC. Moreover, sensitivity analyses are performed to show the robustness of the proposed controller under various uncertainty scenarios.
Directory of Open Access Journals (Sweden)
A. Ya. Krasinskii
2014-01-01
Full Text Available The method of research stability and stabilization of equilibrium of systems with geometrical constraints is elaborated and used for equilibrium for real mechatronic arrangement GBB1005 Ball & Beam. For mathematical model construction is used Shul'gin's equations with redundant coordinates. The through differentiation geometrical constraints obtained kinematic (holonomic constraints is necessary add for stability analysis. Asymptotic stability equilibrium for mechanical systems with redundant coordinates is possible , in spite of formal reduction to Lyapunov's especial case, if the number zero roots is equal the number constraints . More exact nonlinear mathematical model of the mechanical component Ball &Beam is considered in this paper. One nonlinear geometric constrain in this problem is allow find the new equilibrium position. The choice of linear control subsystem is depend from the choice of redundant coordinate.
Coordinated Control of PV Generation and EVs Charging Based on Improved DECell Algorithm
Directory of Open Access Journals (Sweden)
Guo Zhao
2015-01-01
Full Text Available Recently, the coordination of EVs’ charging and renewable energy has become a hot research all around the globe. Considering the requirements of EV owner and the influence of the PV output fluctuation on the power grid, a three-objective optimization model was established by controlling the EVs charging power during charging process. By integrating the meshing method into differential evolution cellular (DECell genetic algorithm, an improved differential evolution cellular (IDECell genetic algorithm was presented to solve the multiobjective optimization model. Compared to the NSGA-II and DECell, the IDECell algorithm showed better performance in the convergence and uniform distribution. Furthermore, the IDECell algorithm was applied to obtain the Pareto front of nondominated solutions. Followed by the normalized sorting of the nondominated solutions, the optimal solution was chosen to arrive at the optimized coordinated control strategy of PV generation and EVs charging. Compared to typical charging pattern, the optimized charging pattern could reduce the fluctuations of PV generation output power, satisfy the demand of EVs charging quantity, and save the total charging cost.
Coordinated single-phase control scheme for voltage unbalance reduction in low voltage network.
Pullaguram, Deepak; Mishra, Sukumar; Senroy, Nilanjan
2017-08-13
Low voltage (LV) distribution systems are typically unbalanced in nature due to unbalanced loading and unsymmetrical line configuration. This situation is further aggravated by single-phase power injections. A coordinated control scheme is proposed for single-phase sources, to reduce voltage unbalance. A consensus-based coordination is achieved using a multi-agent system, where each agent estimates the averaged global voltage and current magnitudes of individual phases in the LV network. These estimated values are used to modify the reference power of individual single-phase sources, to ensure system-wide balanced voltages and proper power sharing among sources connected to the same phase. Further, the high X / R ratio of the filter, used in the inverter of the single-phase source, enables control of reactive power, to minimize voltage unbalance locally. The proposed scheme is validated by simulating a LV distribution network with multiple single-phase sources subjected to various perturbations.This article is part of the themed issue 'Energy management: flexibility, risk and optimization'. © 2017 The Author(s).
DEFF Research Database (Denmark)
Hashempour, Mohammad M.; Firoozabadi, Mehdi Savaghebi; Quintero, Juan Carlos Vasquez
2016-01-01
This paper proposes a control architecture of distributed generators (DGs) inverters and shunt active power filters (APFs) in microgrids to compensate voltage harmonics in a coordinated way. For this, a hierarchical control structure is proposed that includes two control levels. The primary (local......) control consists of power controllers, selective virtual impedance loops and proportional-resonant (PR) voltage/current controllers. The secondary (central) control manages the compensation level of voltage harmonic distortion of sensitive load bus (SLB). Compensation of SLB harmonics by control of DGs...... excessive harmonics or overloading of interface inverters. Effectiveness of the proposed control scheme is demonstrated through simulation studies....
DEFF Research Database (Denmark)
Hashempour, Mohammad M.; Savaghebi, Mehdi; Quintero, Juan Carlos Vasquez
2016-01-01
This paper proposes a control architecture of distributed generators (DGs) inverters and shunt active power filters (APFs) in microgrids to compensate voltage harmonics in a coordinated way. For this, a hierarchical control structure is proposed that includes two control levels. The primary (local......) control consists of power controllers, selective virtual impedance loops and proportional-resonant (PR) voltage/current controllers. The secondary (central) control manages the compensation level of voltage harmonic distortion of sensitive load bus (SLB). Compensation of SLB harmonics by control of DGs...... excessive harmonics or overloading of interface inverters. Effectiveness of the proposed control scheme is demonstrated through simulation studies....
DEFF Research Database (Denmark)
Cha, Seung-Tae; Zhao, Haoran; Wu, Qiuwei
2012-01-01
into the islanding operation mode, while the centralized joint load frequency control (CJLFC) utilizing DGs handles the secondary frequency regulation. The BESS with the associated controllers has been modelled in Real-time digital simulator (RTDS) in order to identify the improvement of the frequency and voltage......This paper describes a coordinated control scheme of battery energy storage system (BESS) and distributed generations (DGs) for electric distribution grid operation. The BESS is designed to stabilize frequency and voltages as a primary control after the electric distribution system enters...... response. The modified IEEE 9-bus system, which is comprised of several DG units, wind power plant and the BESS, has been employed to illustrate the performance of the proposed coordinated flexible control scheme using RTDS in order to verify its practical efficacy....
Wu, Sheng-Yi; Rothery, Richard A; Weiner, Joel H
2015-10-09
We test the hypothesis that pyranopterin (PPT) coordination plays a critical role in defining molybdenum active site redox chemistry and reactivity in the mononuclear molybdoenzymes. The molybdenum atom of Escherichia coli nitrate reductase A (NarGHI) is coordinated by two PPT-dithiolene chelates that are defined as proximal and distal based on their proximity to a [4Fe-4S] cluster known as FS0. We examined variants of two sets of residues involved in PPT coordination: (i) those interacting directly or indirectly with the pyran oxygen of the bicyclic distal PPT (NarG-Ser(719), NarG-His(1163), and NarG-His(1184)); and (ii) those involved in bridging the two PPTs and stabilizing the oxidation state of the proximal PPT (NarG-His(1092) and NarG-His(1098)). A S719A variant has essentially no effect on the overall Mo(VI/IV) reduction potential, whereas the H1163A and H1184A variants elicit large effects (ΔEm values of -88 and -36 mV, respectively). Ala variants of His(1092) and His(1098) also elicit large ΔEm values of -143 and -101 mV, respectively. An Arg variant of His(1092) elicits a small ΔEm of +18 mV on the Mo(VI/IV) reduction potential. There is a linear correlation between the molybdenum Em value and both enzyme activity and the ability to support anaerobic respiratory growth on nitrate. These data support a non-innocent role for the PPT moieties in controlling active site metal redox chemistry and catalysis. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.
Wu, Sheng-Yi; Rothery, Richard A.; Weiner, Joel H.
2015-01-01
We test the hypothesis that pyranopterin (PPT) coordination plays a critical role in defining molybdenum active site redox chemistry and reactivity in the mononuclear molybdoenzymes. The molybdenum atom of Escherichia coli nitrate reductase A (NarGHI) is coordinated by two PPT-dithiolene chelates that are defined as proximal and distal based on their proximity to a [4Fe-4S] cluster known as FS0. We examined variants of two sets of residues involved in PPT coordination: (i) those interacting directly or indirectly with the pyran oxygen of the bicyclic distal PPT (NarG-Ser719, NarG-His1163, and NarG-His1184); and (ii) those involved in bridging the two PPTs and stabilizing the oxidation state of the proximal PPT (NarG-His1092 and NarG-His1098). A S719A variant has essentially no effect on the overall Mo(VI/IV) reduction potential, whereas the H1163A and H1184A variants elicit large effects (ΔEm values of −88 and −36 mV, respectively). Ala variants of His1092 and His1098 also elicit large ΔEm values of −143 and −101 mV, respectively. An Arg variant of His1092 elicits a small ΔEm of +18 mV on the Mo(VI/IV) reduction potential. There is a linear correlation between the molybdenum Em value and both enzyme activity and the ability to support anaerobic respiratory growth on nitrate. These data support a non-innocent role for the PPT moieties in controlling active site metal redox chemistry and catalysis. PMID:26297003
DEFF Research Database (Denmark)
Christensen, Søren T; Pedersen, Stine F; Satir, Peter
2008-01-01
Cell cycle control and migration are critical processes during development and maintenance of tissue functions. Recently, primary cilia were shown to take part in coordination of the signaling pathways that control these cellular processes in human health and disease. In this review, we present...... an overview of the function of primary cilia and the centrosome in the signaling pathways that regulate cell cycle control and migration with focus on ciliary signaling via platelet-derived growth factor receptor alpha (PDGFRalpha). We also consider how the primary cilium and the centrosome interact...... with the extracellular matrix, coordinate Wnt signaling, and modulate cytoskeletal changes that impinge on both cell cycle control and cell migration....
Directory of Open Access Journals (Sweden)
R. Thirunavukarasu
2016-12-01
Full Text Available The nature of power system restoration problem involves status assessment, optimization of generation capability and load pickup. This paper proposes the evaluation of Power System Restoration Indices (PSRI based on the Automatic Generation Control (AGC assessment of interconnected power system in a deregulated environment. The PSRI are useful for system planners to prepare the power system restoration plans and to improve the efficiency of the physical operation of the power system with the increased transmission capacity in the network. The stabilization of frequency and tie-line power oscillations in an interconnected power system becomes challenging when implemented in the future competitive environment. This paper also deals with the concept of AGC in two-area reheat power system having coordinated control action with Redox Flow Battery (RFB and Unified Power Flow Controller (UPFC are capable of controlling the network performance in a very fast manner and improve power transfer limits in order to have a better restoration. In addition to that a new Proportional–Double Integral (PI2 controller is designed and implemented in AGC loop and controller parameters are optimized through Bacterial Foraging Optimization (BFO algorithm. Simulation results reveal that the proposed PI2 controller is that it has good stability during load variations, excellent transient and dynamic responses when compared with the system comprising PI controller. Moreover the AGC loop with RFB coordinated with UPFC has greatly improved the dynamic response and it reduces the control input requirements, to ensure improved PSRI in order to provide the reduced restoration time, thereby improving the system reliability.
Energy Technology Data Exchange (ETDEWEB)
Sanchez Parra, Marino; Castelo Cuevas, Luis [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)
1998-03-01
In this paper the coordinated control (CC) of the Distributed Control System (Sistema de Control Distribuido) (SICODI) of the Combined Cycle Central of Gomez Palacio, Durango, is presented. The description of the control scheme and its realization in software is made. From the scheme the operation strategies and automation, supervision and control are described in detail. The software components of the programming are described, the program structure and control data and its implementation in working stations VAX 3100 under the operating system VMS (Virtual Memory System), are described. [Espanol] En este articulo se presenta el control coordinado (CC) del Sistema de Control Distribuido (Sicodi) de la central de ciclo combinado Gomez Palacio, Durango. Se describe el esquema de control y su realizacion en software. Del esquema se detallan las estrategias de operacion y automatizacion, supervision y control. Del software se describen los componentes de la programacion, la estructura de programas y datos del control y su implementacion en estaciones de trabajo VAX 3100 bajo el sistema operativo VMS (Virtual Memory System).
Radar coordination and resource management in a distributed sensor network using emergent control
Weir, B. S.; Sokol, T. M.
2009-05-01
As the list of anti-air warfare and ballistic missile defense missions grows, there is an increasing need to coordinate and optimize usage of radar resources across the netted force. Early attempts at this optimization involved top-down control mechanisms whereby sensors accept resource tasking orders from networked tracking elements. These approaches rely heavily on uncertain knowledge of sensor constraints and capabilities. Furthermore, advanced sensor systems may support self-defense missions of the host platform and are therefore unable to relinquish control to an external function. To surmount these issues, the use of bottom-up emergent control techniques is proposed. The information necessary to make quality, network-wide resource allocations is readily available to sensor nodes with access to a netted track picture. By assessing resource priorities relative to the network (versus local) track picture, sensors can understand the contribution of their resources to the netted force. This allows the sensors to apply resources where most needed and remove waste. Furthermore, simple local rules for resource usage, when properly constructed, allow sensors to obtain a globally optimal resource allocation without direct coordination (emergence). These results are robust to partial implementation (i.e., not all nodes upgraded at once) and failures on individual nodes (whether from casualty or reallocation to other sensor missions), and they leave resource control decisions in the hands of the sensor systems instead of an external function. This paper presents independent research and development work on emergent control of sensor resources and the impact to resource allocation and tracking performance.
Directory of Open Access Journals (Sweden)
Geert Deconinck
2015-12-01
Full Text Available The charging of electric vehicles (EVs impacts the distribution grid, and its cost depends on the price of electricity when charging. An aggregator that is responsible for a large fleet of EVs can use a market-based control algorithm to coordinate the charging of these vehicles, in order to minimize the costs. In such an optimization, the operational parameters of the distribution grid, to which the EVs are connected, are not considered. This can lead to violations of the technical constraints of the grid (e.g., under-voltage, phase unbalances; for example, because many vehicles start charging simultaneously when the price is low. An optimization that simultaneously takes the economic and technical aspects into account is complex, because it has to combine time-driven control at the market level with event-driven control at the operational level. Different case studies investigate under which circumstances the market-based control, which coordinates EV charging, conflicts with the operational constraints of the distribution grid. Especially in weak grids, phase unbalance and voltage issues arise with a high share of EVs. A low-level voltage droop controller at the charging point of the EV can be used to avoid many grid constraint violations, by reducing the charge power if the local voltage is too low. While this action implies a deviation from the cost-optimal operating point, it is shown that this has a very limited impact on the business case of an aggregator, and is able to comply with the technical distribution grid constraints, even in weak distribution grids with many EVs.
DEFF Research Database (Denmark)
Zhang, Xueguang; Wang, Tianyi; Wang, Xiongfei
2017-01-01
This paper addresses the zero-sequence circulating current control in the multiparalleled three-phase voltage-source inverters. The model of the zero-sequence circulating current in the N-paralleled (N ≥ 3) inverters is derived. It is shown that the circulating current is not only susceptible...... to the mismatches of circuit parameters, but it is also influenced by the interactions of circulating current controllers used by other paralleled inverters. To eliminate these adverse effects on the circulating current control loop, a coordinate control strategy for the N-paralleled inverter is proposed based...... on the zero-vector feedforward method with the space-vector pulse width modulation. Moreover, a virtual inverter method is introduced to facilitate the implementation of the proposed controller, which decouples the interactions of circulating current controllers in the paralleled inverters. Finally...
Coordinated control of wind power and energy storage
DEFF Research Database (Denmark)
Zhao, Haoran
the coordinated control of wind power and ESS. Due to the different technical characteristics, such as power and energy density, ESS can play different roles either in generation-side, grid-side or demand side. This thesis focuses on the following two scenarios:• Scenario 1: As a part of wind farm, the ESS plays......Nowadays, wind power has become one of the fastest growing sources of electricity in the world. Due to the inherent variability and uncertainty, wind power integration into the grid brings challenges for power systems, particularly when the wind power penetration level is high. The challenges exist...... in many aspects, such as reliability, power quality and stability. With the rapid development of energy storage technology, the application of Energy Storage System (ESS) is considered as an effective solution to handle the aforementioned challenges. The main objective of this study is to investigate...
Torque Coordination Control during Braking Mode Switch for a Plug-in Hybrid Electric Vehicle
Yang Yang; Chao Wang; Quanrang Zhang; Xiaolong He
2017-01-01
Hybrid vehicles usually have several braking systems, and braking mode switches are significant events during braking. It is difficult to coordinate torque fluctuations caused by mode switches because the dynamic characteristics of braking systems are different. In this study, a new type of plug-in hybrid vehicle is taken as the research object, and braking mode switches are divided into two types. The control strategy of type one is achieved by controlling the change rates of clutch hold-dow...
Coordinated control of wind power plants in offshore HVDC grids
DEFF Research Database (Denmark)
Sakamuri, Jayachandra N.
2017-01-01
power between different countries, and different synchronous areas. It is very likely that they will then be combined with offshore wind power plant (OWPP) connections in the North Sea, transforming it in a multi terminal DC (MTDC) grid and, therefore, in a fully meshed offshore DC grid in near future......During the recent years, there has been a significant penetration of offshore wind power into the power system and this trend is expected to continue in the future. The North Sea in Europe has higher potential for offshore wind power; therefore, the North Seas Countries' Offshore Grid initiative....... However, increased penetration of offshore wind power into the power system poses several challenges to its security. This thesis deals with two main research challenges, (1) Develop, and analyze the coordinated control strategies for AC voltage and reactive power control in the cluster of OWPPs connected...
A novel optimal coordinated control strategy for the updated robot system for single port surgery.
Bai, Weibang; Cao, Qixin; Leng, Chuntao; Cao, Yang; Fujie, Masakatsu G; Pan, Tiewen
2017-09-01
Research into robotic systems for single port surgery (SPS) has become widespread around the world in recent years. A new robot arm system for SPS was developed, but its positioning platform and other hardware components were not efficient. Special features of the developed surgical robot system make good teleoperation with safety and efficiency difficult. A robot arm is combined and used as new positioning platform, and the remote center motion is realized by a new method using active motion control. A new mapping strategy based on kinematics computation and a novel optimal coordinated control strategy based on real-time approaching to a defined anthropopathic criterion configuration that is referred to the customary ease state of human arms and especially the configuration of boxers' habitual preparation posture are developed. The hardware components, control architecture, control system, and mapping strategy of the robotic system has been updated. A novel optimal coordinated control strategy is proposed and tested. The new robot system can be more dexterous, intelligent, convenient and safer for preoperative positioning and intraoperative adjustment. The mapping strategy can achieve good following and representation for the slave manipulator arms. And the proposed novel control strategy can enable them to complete tasks with higher maneuverability, lower possibility of self-interference and singularity free while teleoperating. Copyright © 2017 John Wiley & Sons, Ltd.
Changes to online control and eye-hand coordination with healthy ageing.
O'Rielly, Jessica L; Ma-Wyatt, Anna
2018-06-01
Goal directed movements are typically accompanied by a saccade to the target location. Online control plays an important part in correction of a reach, especially if the target or goal of the reach moves during the reach. While there are notable changes to visual processing and motor control with healthy ageing, there is limited evidence about how eye-hand coordination during online updating changes with healthy ageing. We sought to quantify differences between older and younger people for eye-hand coordination during online updating. Participants completed a double step reaching task implemented under time pressure. The target perturbation could occur 200, 400 and 600 ms into a reach. We measured eye position and hand position throughout the trials to investigate changes to saccade latency, movement latency, movement time, reach characteristics and eye-hand latency and accuracy. Both groups were able to update their reach in response to a target perturbation that occurred at 200 or 400 ms into the reach. All participants demonstrated incomplete online updating for the 600 ms perturbation time. Saccade latencies, measured from the first target presentation, were generally longer for older participants. Older participants had significantly increased movement times but there was no significant difference between groups for touch accuracy. We speculate that the longer movement times enable the use of new visual information about the target location for online updating towards the end of the movement. Interestingly, older participants also produced a greater proportion of secondary saccades within the target perturbation condition and had generally shorter eye-hand latencies. This is perhaps a compensatory mechanism as there was no significant group effect on final saccade accuracy. Overall, the pattern of results suggests that online control of movements may be qualitatively different in older participants. Crown Copyright © 2018. Published by Elsevier B.V. All
International Nuclear Information System (INIS)
Sato, Takahide; Kano, Takeshi; Ishiguro, Akio
2012-01-01
Autonomous decentralized control has attracted considerable attention because it enables us to understand the adaptive and versatile locomotion of animals and facilitates the construction of truly intelligent artificial agents. Thus far, we have developed a snake-like robot (HAUBOT I) that is driven by a decentralized control scheme based on a discrepancy function, which incorporates phasic control. In this paper, we investigate a decentralized control scheme in which phasic and tonic control are well coordinated, as an extension of our previous study. To verify the validity of the proposed control scheme, we apply it to a snake-like robot (HAUBOT II) that can adjust both the phase relationship between its body segments and the stiffness at each joint. The results indicate that the proposed control scheme enables the robot to exhibit remarkable real-time adaptability over various frictional and inclined terrains. These findings can potentially enable us to gain a deeper insight into the autonomous decentralized control mechanism underlying the adaptive and resilient locomotion of animals.
Directory of Open Access Journals (Sweden)
Rainbow T. H. Ho
2012-01-01
Full Text Available Objective. Patients with schizophrenia residing at institutions often suffer from negative symptoms, motor, and functional impairments more severe than their noninstitutionalized counterparts. Tai-chi emphasizes body relaxation, alertness, and movement coordination with benefits to balance, focus, and stress relief. This pilot study explored the efficacy of Tai-chi on movement coordination, negative symptoms, and functioning disabilities towards schizophrenia. Methods. A randomized waitlist control design was adopted, where participants were randomized to receive either the 6-week Tai-chi program and standard residential care or only the latter. 30 Chinese patients with schizophrenia were recruited from a rehabilitation residency. All were assessed on movement coordination, negative symptoms, and functional disabilities at baseline, following intervention and 6 weeks after intervention. Results. Tai-chi buffered from deteriorations in movement coordination and interpersonal functioning, the latter with sustained effectiveness 6 weeks after the class was ended. Controls showed marked deteriorations in those areas. The Tai-chi group also experienced fewer disruptions to life activities at the 6-week maintenance. There was no significant improvement in negative symptoms after Tai-chi. Conclusions. This study demonstrated encouraging benefits of Tai-chi in preventing deteriorations in movement coordination and interpersonal functioning for residential patients with schizophrenia. The ease of implementation facilitates promotion at institutional psychiatric services.
Directory of Open Access Journals (Sweden)
Firmanzah
2007-10-01
Full Text Available New product launching (NPL to the local market by subsidiary managers is a strategic activity, which requires organizational supports from MNC global network. The NPL activity is marked by high level of uncertainty, risk, and market failure. Thus, a headquarter needs to integrate the subsidiary NPL into global strategy. There are two mechanisms to integrate subsidiaries’ activities during NPL process; coordination and control process. By testing the effect of each mechanism on role clarity and functional conflict, I found that coordination mechanism increase role clarity between headquarter and subsidiaries’ managers. In contrast, exercising control mechanism reduces role clarity and functional conflict between headquarter and subsidiaries’ managers during NPL. This research shows that both role clarity and functional conflict increase new product commercial performance introduced by subsidiary in the local market.
DEFF Research Database (Denmark)
Sun, Qiuye; Han, Renke; Zhang, Huaguang
2015-01-01
With the bidirectional power flow provided by the Energy Internet, various methods are promoted to improve and increase the energy utilization between Energy Internet and Main-Grid. This paper proposes a novel distributed coordinated controller combined with a multi-agent-based consensus algorithm...... which is applied to distributed generators in the Energy Internet. Then, the decomposed tasks, models, and information flow of the proposed method are analyzed. The proposed coordinated controller installed between the Energy Internet and the Main-Grid keeps voltage angles and amplitudes consensus while...... providing accurate power-sharing and minimizing circulating currents. Finally, the Energy Internet can be integrated into the Main-Grid seamlessly if necessary. Hence the Energy Internet can be operated as a spinning reserve system. Simulation results are provided to show the effectiveness of the proposed...
The Governance of American Manufacturing Sectors: The Logic of Coordination and Control
Hollingsworth, J.
1990-01-01
In recent years, scholars in a variety of disciplines have become interested in why there is variation in the institutional arrangements for coordination and control of economic activities in capitalist economies. Some have attempted to explain why transactions occur among actors within a market, a firm, or some form of network. Another body of scholarship has attempted to understand why there are collective forms of behavior among economic actors. This paper attempts to integrate these two t...
DEFF Research Database (Denmark)
Sakamuri, Jayachandra N.; Altin, Müfit; Hansen, Anca Daniela
2017-01-01
A coordinated fast primary frequency control scheme from offshore wind power plants (OWPPs) integrated to a three terminal high voltage DC (HVDC) system is proposed in this study. The impact of wind speed variation on the OWPP active power output and thus on the AC grid frequency and DC grid...... the active power support from OWPP with a ramp rate limiter and (iii) An alternative method for the wind turbine overloading considering rotor speed. The effectiveness of the proposed control scheme is demonstrated on a wind power plant integrated into a three terminal HVDC system developed in DIg......SILIENT PowerFactory. The results show that the proposed coordinated frequency control method performs effectively at different wind speeds and minimises the secondary effects on frequency and DC voltage....
DEFF Research Database (Denmark)
Yao, Jun; Liu, Ruikuo; Zhou, Te
2017-01-01
This paper investigates the coordinated control strategy for a hybrid wind farm with doubly fed induction generator (DFIG)-based and direct-driven permanent-magnet synchronous generator (PMSG)-based wind farms during network unbalance. The negative-sequence current output capabilities of DFIG...... to the controllable operating regions, a targets selection scheme for each control unit is proposed to improve the stability of the hybrid wind farms containing both DFIG-based and PMSG-based wind farms during network unbalance, especially to avoid DFIG-based wind farm tripping from connected power grid under severe...... grid voltage unbalance conditions. Finally, the proposed coordinated control strategy is validated by the simulation results of a 30-MW-DFIG-based wind farm and a 30-MW-PMSG-based wind farm under different operation conditions and experimental results on a laboratory-scale experimental rig under severe...
Directory of Open Access Journals (Sweden)
A. A. Gurskiy
2016-09-01
Full Text Available The coordinating control system by drives of the robot-manipulator is presented in this article. The purpose of the scientific work is the development and research of the new algorithms for parametric synthesis of the coordinating control systems. To achieve this aim it is necessary to develop the system generating the required parametric synthesis algorithms and performing the necessary procedures according to the generated algorithm. This scientific work deals with the synthesis of Petri net in the specific case with the automatic generation of Petri nets.
Coordinated Voltage Control in Offshore HVDC Connected Cluster of Wind Power Plants
DEFF Research Database (Denmark)
Sakamuri, Jayachandra N.; Rather, Zakir Hussain; Rimez, Johan
2016-01-01
This paper presents a coordinated voltage control scheme (CVCS) for a cluster of offshore wind power plants (OWPPs) connected to a VSC HVDC system. The primary control point of the proposed voltage control scheme is the introduced Pilot bus, which is having the highest short circuit capacity...... in the offshore AC grid. The developed CVCS comprehends an optimization algorithm, aiming for minimum active power losses in the offshore grid, to generate voltage reference to the Pilot bus. During steady state operation, the Pilot bus voltage is controlled by dispatching reactive power references to each wind...... turbine (WT) in the WPP cluster based on their available reactive power margin and network sensitivity based participation factors, which are derived from the dV/dQ sensitivity of a WT bus w.r.t the Pilot bus. This method leads to minimization of the risk of undesired effects, particularly overvoltage...
Chronophin coordinates cell leading edge dynamics by controlling active cofilin levels
Delorme-Walker, Violaine; Seo, Ji-Yeon; Gohla, Antje; Fowler, Bruce; Bohl, Ben; DerMardirossian, Céline
2015-01-01
Cofilin, a critical player of actin dynamics, is spatially and temporally regulated to control the direction and force of membrane extension required for cell locomotion. In carcinoma cells, although the signaling pathways regulating cofilin activity to control cell direction have been established, the molecular machinery required to generate the force of the protrusion remains unclear. We show that the cofilin phosphatase chronophin (CIN) spatiotemporally regulates cofilin activity at the cell edge to generate persistent membrane extension. We show that CIN translocates to the leading edge in a PI3-kinase–, Rac1-, and cofilin-dependent manner after EGF stimulation to activate cofilin, promotes actin free barbed end formation, accelerates actin turnover, and enhances membrane protrusion. In addition, we establish that CIN is crucial for the balance of protrusion/retraction events during cell migration. Thus, CIN coordinates the leading edge dynamics by controlling active cofilin levels to promote MTLn3 cell protrusion. PMID:26324884
International Nuclear Information System (INIS)
Neilson, James R.; Schwenzer, Birgit; Seshadri, Ram; Morse, Daniel E.
2009-01-01
We report the synthesis and characterization of new structural variants of the isotypic compound with the generic chemical formula, Co 1-0.5x oct Co x tet (OH) 2 (Cl) x (H 2 O) n , all modifications of an α-Co(OH) 2 lattice. We show that the occupancy of tetrahedrally coordinated cobalt sites and associated chloride ligands, x, is modulated by the rate of formation of the respective layered hydroxide salts from kinetically controlled aqueous hydrolysis at an air-water interface. This new level of structural control is uniquely enabled by the slow diffusion of a hydrolytic catalyst, a simple technique. Independent structural characterizations of the compounds separately describe various attributes of the materials on different length scales, revealing details hidden by the disordered average structures. The precise control over the population of distinct octahedrally and tetrahedrally coordinated cobalt ions in the lattice provides a gentle, generic method for modulating the coordination geometry of cobalt in the material without disturbing the lattice or using additional reagents. A mechanism is proposed to reconcile the observation of the kinetic control of the structure with competing interactions during the initial stages of hydrolysis and condensation.
Nuclear material accounting and control: Co-ordinating assistance to newly independent States
International Nuclear Information System (INIS)
Thorstensen, S.
1995-01-01
This article outlines work under way among the IAEA, its Member States, and the Newly Independent States (NIS) relating to the establishment and development in the NIS of State Systems of Accounting and Control (SSACs) of nuclear material. It describes IAEA activities in the NIS, including fact-finding missions at technical visits, the successful attempts to find donor States providing voluntary funding and expertise, and the co-ordination of technical support between the IAEA and the donor States. 3 tabs
International Nuclear Information System (INIS)
Rahman, M.S.; Oo, A.M.T.
2017-01-01
Highlights: • Agent-based energy management and control scheme is designed for power sharing. • Distributed agent communication topology is formed by the graph theory. • Proposed scheme is capable of dynamically adapt to the change in system conditions. • Multi-agent coordination is achieved through information exchange. • Proposed power sharing strategy ensures the reliability of energy supply. - Abstract: In this paper, a distributed peer-to-peer multi-agent framework is proposed for managing the power sharing in microgrids with power electronic inverter-interfaced distributed energy resources (DERs). Recently, the introduction of electric vehicles (EVs) has gained much popularity by offering vehicle-to-home (V2H) technologies to support the sustainable operation of microgrids. Since microgrids often exhibit volatile characteristics due to natural intermittency and uncertainty, it is necessary to maintain the balancing of generation and demand through the proper management of power sharing. Therefore, the main purpose of this paper is to design an agent-based control framework to ensure the coordinated power management within the microgrids through effective utilization of EVs. The required agent communication framework is adhered to the graph theory where the control agents interact with each other using local as well as neighboring information and their distributed coordination effectively steers the proportional sharing of real and reactive powers among the inverter-interfaced EVs to maintain the stability of microgrids. The well known Ziegler-Nichols method is used to tune the proportional-integral (PI) controller of the inner current control loop within each individual control agent to perform necessary shared control tasks. A microgrid with solar photovoltaic (PV) and V2H systems is chosen to illustrate the results and it is seen that the proposed scheme improves the system performance in a smarter way through information exchange. Furthermore
Application of Coordinated SOFC and SMES Robust Control for Stabilizing Tie-Line Power
Energy Technology Data Exchange (ETDEWEB)
Ning Zhang; Wei Gu; Haojun Yu; Wei Liu [School of Electrical Engineering, Southeast University, Nanjing (China)
2013-04-15
Wind power causes fluctuations in power systems and introduces issues concerning system stability and power quality because of the lack of controllability of its discontinuous and intermittent resources. This paper presents a coordinated control strategy for solid oxide fuel cells (SOFCs) and superconducting magnetic energy storage (SMES) to match the intermittent wind power generation and compensate for the rapid load changes. An optimal H{sub {infinity}}control method, where the weighting function selection is expressed as an optimization problem, is proposed to mitigate tie-line power fluctuations and the mixed-sensitivity approach is used to deal with the interference suppression. Simulation results show that the proposed method significantly improves the smoothing effect of wind power fluctuations. Compared with the conventional control method, the proposed method has better anti-interference performance in various operating situations.
Application of Coordinated SOFC and SMES Robust Control for Stabilizing Tie-Line Power
Directory of Open Access Journals (Sweden)
Wei Liu
2013-04-01
Full Text Available Wind power causes fluctuations in power systems and introduces issues concerning system stability and power quality because of the lack of controllability of its discontinuous and intermittent resources. This paper presents a coordinated control strategy for solid oxide fuel cells (SOFCs and superconducting magnetic energy storage (SMES to match the intermittent wind power generation and compensate for the rapid load changes. An optimal H∞ control method, where the weighting function selection is expressed as an optimization problem, is proposed to mitigate tie-line power fluctuations and the mixed-sensitivity approach is used to deal with the interference suppression. Simulation results show that the proposed method significantly improves the smoothing effect of wind power fluctuations. Compared with the conventional control method, the proposed method has better anti-interference performance in various operating situations.
Coordinated Control Scheme for Ancillary Services from Offshore Wind Power Plants to AC and DC Grids
DEFF Research Database (Denmark)
Sakamuri, Jayachandra N.; Altin, Müfit; Hansen, Anca Daniela
2016-01-01
This paper proposes a new approach of providing ancillary services to AC and DC grids from offshore wind power plants (OWPPs), connected through multi-terminal HVDC network. A coordinated control scheme where OWPP’s AC grid frequency modulated according to DC grid voltage variations is used...... to detect and provide the ancillary service requirements of both AC and DC grids, is proposed in this paper. In particular, control strategies for onshore frequency control, fault ridethrough support in the onshore grid, and DC grid voltage control are considered. The proposed control scheme involves only...
A DC Microgrid Coordinated Control Strategy Based on Integrator Current-Sharing
Directory of Open Access Journals (Sweden)
Liyuan Gao
2017-08-01
Full Text Available The DC microgrid has become a new trend for microgrid study with the advantages of high reliability, simple control and low losses. With regard to the drawbacks of the traditional droop control strategies, an improved DC droop control strategy based on integrator current-sharing is introduced. In the strategy, the principle of eliminating deviation through an integrator is used, constructing the current-sharing term in order to make the power-sharing between different distributed generation (DG units uniform and reasonable, which can reduce the circulating current between DG units. Furthermore, at the system coordinated control level, a hierarchical/droop control strategy based on the DC bus voltage is proposed. In the strategy, the operation modes of the AC main network and micro-sources are determined through detecting the DC voltage variation, which can ensure the power balance of the DC microgrid under different operating conditions. Meanwhile, communication is not needed between different DG units, while each DG unit needs to sample the DC bus voltage, which retains the plug-and-play feature of the DC microgrid. The proposed control strategy is validated by simulation on a DC microgrid with permanent magnet synchronous generator-based wind turbines, solar arrays and energy storage batteries, which can be applied to small commercial or residential buildings.
Coordination of networked systems on digraphs with multiple leaders via pinning control
Chen, Gang; Lewis, Frank L.
2012-02-01
It is well known that achieving consensus among a group of multi-vehicle systems by local distributed control is feasible if and only if all nodes in the communication digraph are reachable from a single (root) node. In this article, we take into account a more general case that the communication digraph of the networked multi-vehicle systems is weakly connected and has two or more zero-in-degree and strongly connected subgraphs, i.e. there are two or more leader groups. Based on the pinning control strategy, the feasibility problem of achieving second-order controlled consensus is studied. At first, a necessary and sufficient condition is given when the topology is fixed. Then the method to design the controller and the rule to choose the pinned vehicles are discussed. The proposed approach allows us to extend several existing results for undirected graphs to directed balanced graphs. A sufficient condition is proposed in the case where the coupling topology is variable. As an illustrative example, a second-order controlled consensus scheme is applied to coordinate the movement of networked multiple mobile robots.
Strategy and Aspects of Monitoring / Control Strictly in Coordinated Subsystems
Directory of Open Access Journals (Sweden)
William José Borges
2012-06-01
Full Text Available This paper aims to discuss the approach structures of the strictly coordinated theoretical framework developed by Zylbersztajn and Farina (1999 as an expanded perspective of the firm, taking into account the food supply chains as an extension of the nexus of contracts proposed by Coase (1937 and taken up by Williamson (1985. The structures stand out as strictly coordinated. Zylbersztajn and Farina (1999 turn to identifying points of common interests that encourage firms to promote contracts between themselves in a strictly coordinated way, considering the degree of asset specificity involved in the transaction and the competitive forces that determine the search for strategic positioning organizations to achieve sustainable superior results.
Adams, I.L.; Steenbergen, B.; Lust, J.M.; Smits-Engelsman, B.C.
2016-01-01
BACKGROUND: Previous studies have shown that the predictive control of movements is impaired in children with Developmental Coordination Disorder (DCD), most likely due to a deficit in the internal modeling of movements. Motor imagery paradigms have been used to test this internal modeling deficit.
Adams, I.L.J.; Steenbergen, B.; Lust, J.M.; Smits-Engelsman, B.C.M.
2016-01-01
Background: Previous studies have shown that the predictive control of movements is impaired in children with Developmental Coordination Disorder (DCD), most likely due to a deficit in the internal modeling of movements. Motor imagery paradigms have been used to test this internal modeling deficit.
Directory of Open Access Journals (Sweden)
Einat eFuchs
2011-01-01
Full Text Available Animals’ ability to demonstrate both stereotyped and adaptive locomotor behavior is largely dependent on the interplay between centrally-generated motor patterns and the sensory inputs that shape them. We utilized a combined experimental and theoretical approach to investigate the relative importance of CPG interconnections vs. intersegmental afferents in the cockroach: an animal that is renowned for rapid and stable locomotion. We simultaneously recorded coxal levator and depressor motor neurons (MN in the thoracic ganglia of Periplaneta americana, while sensory feedback was completely blocked or allowed only from one intact stepping leg. In the absence of sensory feedback, we observed a coordination pattern with consistent phase relationship that shares similarities with a double tripod gait, suggesting central, feedforward control. This intersegmental coordination pattern was then reinforced in the presence of sensory feedback from a single stepping leg. Specifically, we report on transient stabilization of phase differences between activity recorded in the middle and hind thoracic MN following individual front-leg steps, suggesting a role for afferent phasic information in the coordination of motor circuits at the different hemiganglia. Data were further analyzed using stochastic models of coupled oscillators and maximum likelihood techniques to estimate underlying physiological parameters, such as uncoupled endogenous frequencies of hemisegmental oscillators and coupling strengths and directions. We found that descending ipsilateral coupling is stronger than ascending coupling, while left-right coupling in both the meso- and meta-thoracic ganglia appear to be symmetrical. We discuss our results in comparison with recent findings in stick insects that share similar neural and body architectures, and argue that the two species may exemplify opposite extremes of a fast-slow locomotion continuum, mediated through different intersegmental
Coordinated Scheduling and Power Control in Cloud-Radio Access Networks
Douik, Ahmed
2015-12-01
This paper addresses the joint coordinated scheduling and power control problem in cloud-enabled networks. Consider the downlink of a cloud-radio access network (CRAN), where the cloud is only responsible for the scheduling policy, power control, and synchronization of the transmit frames across the single-antenna base-stations (BS). The transmit frame consists of several time/frequency blocks, called power-zones (PZ). The paper considers the problem of scheduling users to PZs and determining their power levels (PL), by maximizing the weighted sum-rate under the practical constraints that each user cannot be served by more than one base-station, but can be served by one or more power-zones within each base-station frame. The paper solves the problem using a graph theoretical approach by introducing the joint scheduling and power control graph formed by several clusters, where each is formed by a set of vertices, representing the possible association of users, BSs, and PLs for one specific PZ. The problem is, then, formulated as a maximumweight clique problem, in which the weight of each vertex is the sum of the benefits of the individual associations belonging to that vertex. Simulation results suggest that the proposed crosslayer scheme provides appreciable performance improvement as compared to schemes from recent literature.
Coordinated Scheduling and Power Control in Cloud-Radio Access Networks
Douik, Ahmed; Dahrouj, Hayssam; Al-Naffouri, Tareq Y.; Alouini, Mohamed-Slim
2015-01-01
This paper addresses the joint coordinated scheduling and power control problem in cloud-enabled networks. Consider the downlink of a cloud-radio access network (CRAN), where the cloud is only responsible for the scheduling policy, power control, and synchronization of the transmit frames across the single-antenna base-stations (BS). The transmit frame consists of several time/frequency blocks, called power-zones (PZ). The paper considers the problem of scheduling users to PZs and determining their power levels (PL), by maximizing the weighted sum-rate under the practical constraints that each user cannot be served by more than one base-station, but can be served by one or more power-zones within each base-station frame. The paper solves the problem using a graph theoretical approach by introducing the joint scheduling and power control graph formed by several clusters, where each is formed by a set of vertices, representing the possible association of users, BSs, and PLs for one specific PZ. The problem is, then, formulated as a maximumweight clique problem, in which the weight of each vertex is the sum of the benefits of the individual associations belonging to that vertex. Simulation results suggest that the proposed crosslayer scheme provides appreciable performance improvement as compared to schemes from recent literature.
DEFF Research Database (Denmark)
Su, Chi
and residue identification. Simulation results show the effectiveness of this damping controller under different operating conditions of the SSSC. Influence of a direct‐drive‐full‐convertor based wind farm ancillary frequency control and voltage control on power system oscillation performance is investigated...... oscillation mode damping ratio, respectively. The former controller is implemented in individual wind turbines; the latter controller is implemented in the wind farm level as a supplementary damping controller. Finally, the coordinating selection and parameter design strategy for PSS is extended for all types...... to this problem need to be implemented in the power systems. On the other hand, wind power especially largescale wind farms are increasingly integrated into modern power systems and bring new challenges to power system operation and control. The influence of wind power integration on system oscillation...
DEFF Research Database (Denmark)
Speedtsberg, Merete Brink; Christensen, Sofie Bouschinger; Andersen, Ken Kjøller
2017-01-01
BACKGROUND: Developmental coordination disorder (DCD) is a neurodevelopmental impairment that affects approximately 6% of children in primary school age. Children with DCD are characterized by impaired postural control. It has yet to be determined what effect peripheral and central neuromuscular...... control has on their balance control. OBJECTIVE: The aim of this study was to investigate the underlying mechanisms to impaired postural control in children with DCD using the rambling-trembling decomposition of the center of pressure (CoP). METHOD: Nine children with DCD (9.0±0.5years, 7 boys, 2 girls...... with fixed support surface. In ML direction children with DCD had a lower relative contribution of rambling to total sway (p=0.013). CONCLUSION: This study showed that impaired postural control in children with DCD is associated with less efficient supraspinal control represented by increased rambling...
Directory of Open Access Journals (Sweden)
Xueliang Huang
2013-01-01
Full Text Available As an important component of the smart grid, electric vehicles (EVs could be a good measure against energy shortages and environmental pollution. A main way of energy supply to EVs is to swap battery from the swap station. Based on the characteristics of EV battery swap station, the coordinated charging optimal control strategy is investigated to smooth the load fluctuation. Shuffled frog leaping algorithm (SFLA is an optimization method inspired by the memetic evolution of a group of frogs when seeking food. An improved shuffled frog leaping algorithm (ISFLA with the reflecting method to deal with the boundary constraint is proposed to obtain the solution of the optimal control strategy for coordinated charging. Based on the daily load of a certain area, the numerical simulations including the comparison of PSO and ISFLA are carried out and the results show that the presented ISFLA can effectively lower the peak-valley difference and smooth the load profile with the faster convergence rate and higher convergence precision.
Kumar, M. Ajay; Srikanth, N. V.
2015-01-01
The voltage source converter (VSC) based multiterminal high voltage direct current (MTDC) transmission system is an interesting technical option to integrate offshore wind farms with the onshore grid due to its unique performance characteristics and reduced power loss via extruded DC cables. In order to enhance the reliability and stability of the MTDC system, an adaptive neuro fuzzy inference system (ANFIS) based coordinated control design has been addressed in this paper. A four terminal VSC-MTDC system which consists of an offshore wind farm and oil platform is implemented in MATLAB/ SimPowerSystems software. The proposed model is tested under different fault scenarios along with the converter outage and simulation results show that the novel coordinated control design has great dynamic stabilities and also the VSC-MTDC system can supply AC voltage of good quality to offshore loads during the disturbances.
Zero-Axis Virtual Synchronous Coordinate Based Current Control Strategy for Grid-Connected Inverter
Directory of Open Access Journals (Sweden)
Longyue Yang
2018-05-01
Full Text Available Unbalanced power has a great influence on the safe and stable operation of the distribution network system. The static power compensator, which is essentially a grid-connected inverter, is an effective solution to the three-phase power imbalance problem. In order to solve the tracking error problem of zero-sequence AC current signals, a novel control strategy based on zero-axis virtual synchronous coordinates is proposed in this paper. By configuring the operation of filter transmission matrices, a specific orthogonal signal is obtained for zero-axis reconstruction. In addition, a controller design scheme based on this method is proposed. Compared with the traditional zero-axis direct control, this control strategy is equivalent to adding a frequency tuning module by the orthogonal signal generator. The control gain of an open loop system can be equivalently promoted through linear transformation. With its clear mathematical meaning, zero- sequence current control can be controlled with only a first-order linear controller. Through reasonable parameter design, zero steady-state error, fast response and strong stability can be achieved. Finally, the performance of the proposed control strategy is verified by both simulations and experiments.
DEFF Research Database (Denmark)
Cayuso, Jordi; Dzementsei, Aliaksandr; Fischer, Johanna C
2016-01-01
Positioning organs in the body often requires the movement of multiple tissues, yet the molecular and cellular mechanisms coordinating such movements are largely unknown. Here, we show that bidirectional signaling between EphrinB1 and EphB3b coordinates the movements of the hepatic endoderm...... and adjacent lateral plate mesoderm (LPM), resulting in asymmetric positioning of the zebrafish liver. EphrinB1 in hepatoblasts regulates directional migration and mediates interactions with the LPM, where EphB3b controls polarity and movement of the LPM. EphB3b in the LPM concomitantly repels hepatoblasts...
The Use of Meta-Level Control for Coordination in a Distributed Problem Solving Network,
1983-01-01
crucial aspect of the design organizational structuring in coordinating the local activity of achs decentralized network control policies. It is...TEMTED EXflD.MENTS WITn and ratings of the subgoals." Threshold values indicating ORGANIZATIONAL STRUCIURING IkeA usaw lani of a subal are specif’ied in...the monitoring are. This environmental vehicle, approximate position, time frame, and belief. The scenario was designed to test the networks ability
Does Coordinated Postpartum Care Influence Costs?
Directory of Open Access Journals (Sweden)
Elisabeth Zemp
2017-03-01
Full Text Available Questions under study: To investigate changes to health insurance costs for post-discharge postpartum care after the introduction of a midwife-led coordinated care model. Methods: The study included mothers and their newborns insured by the Helsana health insurance group in Switzerland and who delivered between January 2012 and May 2013 in the canton of Basel Stadt (BS (intervention canton. We compared monthly post-discharge costs before the launch of a coordinated postpartum care model (control phase, n = 144 to those after its introduction (intervention phase, n = 92. Costs in the intervention canton were also compared to those in five control cantons without a coordinated postpartum care model (cross-sectional control group: n = 7, 767. Results: The average monthly post-discharge costs for mothers remained unchanged in the seven months following the introduction of a coordinated postpartum care model, despite a higher use of midwife services (increasing from 72% to 80%. Likewise, monthly costs did not differ between the intervention canton and five control cantons. In multivariate analyses, the ambulatory costs for mothers were not associated with the post-intervention phase. Cross-sectionally, however, they were positively associated with midwifery use. For children, costs in the post-intervention phase were lower in the first month after hospital discharge compared to the pre-intervention phase (difference of –114 CHF [95%CI –202 CHF to –27 CHF], yet no differences were seen in the cross-sectional comparison. Conclusions: The introduction of a coordinated postpartum care model was associated with decreased costs for neonates in the first month after hospital discharge. Despite increased midwifery use, costs for mothers remained unchanged.
Behavior coordination of mobile robotics using supervisory control of fuzzy discrete event systems.
Jayasiri, Awantha; Mann, George K I; Gosine, Raymond G
2011-10-01
In order to incorporate the uncertainty and impreciseness present in real-world event-driven asynchronous systems, fuzzy discrete event systems (DESs) (FDESs) have been proposed as an extension to crisp DESs. In this paper, first, we propose an extension to the supervisory control theory of FDES by redefining fuzzy controllable and uncontrollable events. The proposed supervisor is capable of enabling feasible uncontrollable and controllable events with different possibilities. Then, the extended supervisory control framework of FDES is employed to model and control several navigational tasks of a mobile robot using the behavior-based approach. The robot has limited sensory capabilities, and the navigations have been performed in several unmodeled environments. The reactive and deliberative behaviors of the mobile robotic system are weighted through fuzzy uncontrollable and controllable events, respectively. By employing the proposed supervisory controller, a command-fusion-type behavior coordination is achieved. The observability of fuzzy events is incorporated to represent the sensory imprecision. As a systematic analysis of the system, a fuzzy-state-based controllability measure is introduced. The approach is implemented in both simulation and real time. A performance evaluation is performed to quantitatively estimate the validity of the proposed approach over its counterparts.
International Nuclear Information System (INIS)
Sun Xingdong
2014-01-01
The coordinated instrumentation control and protection technology between reactor and steam turbine generator (TG) usually is very significant and complicated for a new construction of nuclear power plant, because it carries the safety, economy and availability of nuclear power plant. Based on successful practice of a nuclear power plant, the experience on interface design and hardware architecture of coordinated instrumentation control and protection technology between reactor and steam turbine generator was abstracted and researched. In this paper, the key points and engineering experience were introduced to give the helpful instructions for the new project. (author)
DEFF Research Database (Denmark)
Petersen, Lennart; Iov, Florin; Hansen, Anca Daniela
2016-01-01
This paper focusses on voltage control support and coordination between renewable generation plants in medium voltage distribution systems. An exemplary benchmark grid in Denmark, including a number of flexible ReGen plants providing voltage control functionality, is used as a base case. First......, voltage sensitivity analysis is performed to quantify node voltage variations due to injections of reactive power for given operational points of the network. The results are then used to develop an adaptive voltage droop control method, where various droop settings are allocated to each ReGen plant...... according to the sensitivity indices of corresponding node voltages and the location of respective ReGen plants in the distribution system. Case studies are performed in time-domain to analyze the impact of voltage fluctuations due to active power variations of ReGen plants in order to verify...
Directory of Open Access Journals (Sweden)
Zeyan Lv
2018-04-01
Full Text Available This paper proposes a distributed coordination control for multiple bidirectional power converters (BPCs in a hybrid AC/DC microgrid with consideration of state-of-charge (SOC of storages. The researched hybrid AC/DC microgrid is composed of both AC and DC subgrids connected by multiple parallel BPCs. In the literature, the storages of a hybrid microgrid are considered to allocate in only the AC subgrid or DC subgrid, which reduces the reliability of the whole system, especially during the islanded mode. Besides, the SOC management has not been considered in BPCs’ operating strategy. This paper considers a hybrid microgrid topology which has energy storages in both AC side and DC side. This ensures the reliability while increasing the complexity of the control strategy at the same time. Further, a distributed coordination control method for multiple BPCs based on SOC was proposed to enhance the reliability of hybrid microgrid. Finally, the performance of the proposed control methods was verified by real-time hardware-in-loop (HIL tests.
Anion-Controlled Architecture and Photochromism of Naphthalene Diimide-Based Coordination Polymers
Directory of Open Access Journals (Sweden)
Jian-Jun Liu
2018-02-01
Full Text Available Three new cadmium coordination polymers, namely [Cd(NO32(DPNDI(CH3OH]·CH3OH (1, [Cd(SCN2(DPNDI] (2, and [Cd(DPNDI2(DMF2]·2ClO4 (3 (DPNDI = N,N-di(4-pyridyl-1,4,5,8-naphthalene diimide, DMF = N,N-dimethylformamide have been synthesized by reactions of DPNDI with Cd(NO32, Cd(SCN2, and Cd(ClO42, respectively. Compound 1 is a one-dimensional coordination polymer with strong lone pair-π interactions between the coordinated NO3− anions and the imide ring of DPNDI; while 2 is a two-dimensional network with a (4, 4 net topology. In the case of 3, due to the presence of uncoordinated perchlorate counter ions, it exhibits a non-interpenetrated square-grid coordination polymer containing one-dimensional rhomboid channels. The structural diversity in these compounds is attributed to different coordination abilities and geometries of counter anions. Due to the presence of electron-deficient NDI moiety, the photochromic behavior of these compounds was studied. Interestingly, only compounds 1 and 3 exhibit color changes under light irradiation. The influence of the anions on the photochromism process of the NDI-based materials has been discussed.
DEFF Research Database (Denmark)
Li, Yujun; Xu, Zhao; Østergaard, Jacob
2017-01-01
Coordinated control strategies to provide system inertia support for main grid from offshore wind farm that is integrated through HVdc transmission is the subject matter of this paper. The strategy that seeks to provide inertia support to the main grid through simultaneous utilization of HVdc...... capacitors energy, and wind turbines (WTs) inertia without installing the remote communication of two HVdc terminals is introduced in details. Consequently, a novel strategy is proposed to improve system inertia through sequentially exerting dc capacitors energy and then WTs inertia via a cascading control...
DEFF Research Database (Denmark)
Andersen, Amanda; Krogsgaard, Marie; Birkedal, Henrik
2018-01-01
a catechol-based hydrogel design that allows for the degree of oxidative covalent cross-linking to be controlled. Double cross-linked hydrogels with tunable stiffness are constructed by adding the oxidizable catechol analogue, tannic acid, to an oxidation-resistant hydrogel construct held together...... by coordination of the dihydroxy functionality of 1-(2'-carboxyethyl)-2-methyl-3-hydroxy-4-pyridinone to trivalent metal ions. By varying the amount of tannic acid, the hydrogel stiffness can be customized to a given application while retaining the self-healing capabilities of the hydrogel's coordination chemical...
Directory of Open Access Journals (Sweden)
FITRI YAKUB
2016-10-01
Full Text Available This study describes a comparative study of steering and yaw moment control manoeuvres in model predictive control (MPC and linear quadratic control approaches for path following unmanned vehicles for different control manoeuvres: two-wheel steering, four-wheel steering, and direct yaw moment control. We then propose MPC with a proportional-integral (PI controller for the coordination of active front steering (AFS and active braking system, which particularly highlights direct yaw moment control (DYC manoeuvres. Based on the known trajectory, we tested a vehicle at middle forward speed with the disturbance consideration of the road surface adhesion and the wind for a double lane change scenario in order to follow the desired trajectory as close as possible, minimizing tracking errors, and enhancing vehicle stability and drivability. We compared two different controllers; i MPC with PI of an AFS and, ii MPC with PI for coordination of AFS and DYC. The operation of the proposed integrated control is demonstrated in a Matlab simulation environment by manoeuvring the vehicle along the desired trajectory. Simulation results showed that the proposed method had yielded better tracking performances, and were able to enhance the vehicle’s stability at a given speed even under road surface coefficient and wind.
Coordinated Control Strategy for a Hybrid Wind Farm with DFIG and PMSG under Symmetrical Grid Faults
Directory of Open Access Journals (Sweden)
Jiawei Li
2017-05-01
Full Text Available This paper presents a coordinated control strategy for a hybrid wind farm with doubly-fed induction generator (DFIG- and direct-driven permanent-magnet synchronous generator (PMSG-based wind turbines under symmetrical grid faults. The proposed low-voltage ride-through (LVRT strategy is based on a novel current allocation principle and is implemented for individual DFIG- or PMSG-based wind turbines. No communication equipment between different wind power generators is required. By monitoring the local voltages and active power outputs of the corresponding wind generators, the proposed control strategy can control the hybrid wind farm to provide the maximum reactive power to support the grid voltage during a symmetrical grid fault. As a result, the reduction in the active power output from the hybrid wind farm can be decreased, which also helps avoid generator over-speed issues and supply active power support for the power grid. In addition, the reactive current upper limits of DFIG- and PMSG-based sub-wind farms are investigated by considering different active power outputs and different grid voltage dip depths, and the feasible regions of the two types of sub-wind farms for meeting the LVRT requirements are further studied. Finally, the effectiveness of the proposed coordinated LVRT control strategy for the hybrid wind farm is validated by simulation and experimental results.
A Sarsa(λ)-based control model for real-time traffic light coordination.
Zhou, Xiaoke; Zhu, Fei; Liu, Quan; Fu, Yuchen; Huang, Wei
2014-01-01
Traffic problems often occur due to the traffic demands by the outnumbered vehicles on road. Maximizing traffic flow and minimizing the average waiting time are the goals of intelligent traffic control. Each junction wants to get larger traffic flow. During the course, junctions form a policy of coordination as well as constraints for adjacent junctions to maximize their own interests. A good traffic signal timing policy is helpful to solve the problem. However, as there are so many factors that can affect the traffic control model, it is difficult to find the optimal solution. The disability of traffic light controllers to learn from past experiences caused them to be unable to adaptively fit dynamic changes of traffic flow. Considering dynamic characteristics of the actual traffic environment, reinforcement learning algorithm based traffic control approach can be applied to get optimal scheduling policy. The proposed Sarsa(λ)-based real-time traffic control optimization model can maintain the traffic signal timing policy more effectively. The Sarsa(λ)-based model gains traffic cost of the vehicle, which considers delay time, the number of waiting vehicles, and the integrated saturation from its experiences to learn and determine the optimal actions. The experiment results show an inspiring improvement in traffic control, indicating the proposed model is capable of facilitating real-time dynamic traffic control.
A Sarsa(λ-Based Control Model for Real-Time Traffic Light Coordination
Directory of Open Access Journals (Sweden)
Xiaoke Zhou
2014-01-01
Full Text Available Traffic problems often occur due to the traffic demands by the outnumbered vehicles on road. Maximizing traffic flow and minimizing the average waiting time are the goals of intelligent traffic control. Each junction wants to get larger traffic flow. During the course, junctions form a policy of coordination as well as constraints for adjacent junctions to maximize their own interests. A good traffic signal timing policy is helpful to solve the problem. However, as there are so many factors that can affect the traffic control model, it is difficult to find the optimal solution. The disability of traffic light controllers to learn from past experiences caused them to be unable to adaptively fit dynamic changes of traffic flow. Considering dynamic characteristics of the actual traffic environment, reinforcement learning algorithm based traffic control approach can be applied to get optimal scheduling policy. The proposed Sarsa(λ-based real-time traffic control optimization model can maintain the traffic signal timing policy more effectively. The Sarsa(λ-based model gains traffic cost of the vehicle, which considers delay time, the number of waiting vehicles, and the integrated saturation from its experiences to learn and determine the optimal actions. The experiment results show an inspiring improvement in traffic control, indicating the proposed model is capable of facilitating real-time dynamic traffic control.
Coordinations between gene modules control the operation of plant amino acid metabolic networks
Directory of Open Access Journals (Sweden)
Galili Gad
2009-01-01
Full Text Available Abstract Background Being sessile organisms, plants should adjust their metabolism to dynamic changes in their environment. Such adjustments need particular coordination in branched metabolic networks in which a given metabolite can be converted into multiple other metabolites via different enzymatic chains. In the present report, we developed a novel "Gene Coordination" bioinformatics approach and use it to elucidate adjustable transcriptional interactions of two branched amino acid metabolic networks in plants in response to environmental stresses, using publicly available microarray results. Results Using our "Gene Coordination" approach, we have identified in Arabidopsis plants two oppositely regulated groups of "highly coordinated" genes within the branched Asp-family network of Arabidopsis plants, which metabolizes the amino acids Lys, Met, Thr, Ile and Gly, as well as a single group of "highly coordinated" genes within the branched aromatic amino acid metabolic network, which metabolizes the amino acids Trp, Phe and Tyr. These genes possess highly coordinated adjustable negative and positive expression responses to various stress cues, which apparently regulate adjustable metabolic shifts between competing branches of these networks. We also provide evidence implying that these highly coordinated genes are central to impose intra- and inter-network interactions between the Asp-family and aromatic amino acid metabolic networks as well as differential system interactions with other growth promoting and stress-associated genome-wide genes. Conclusion Our novel Gene Coordination elucidates that branched amino acid metabolic networks in plants are regulated by specific groups of highly coordinated genes that possess adjustable intra-network, inter-network and genome-wide transcriptional interactions. We also hypothesize that such transcriptional interactions enable regulatory metabolic adjustments needed for adaptation to the stresses.
Directory of Open Access Journals (Sweden)
Jian Zuo
2017-04-01
Full Text Available The potential of utilizing doubly-fed induction generator (DFIG-based wind farms to improve power system damping performance and to enhance small signal stability has been proposed by many researchers. However, the simultaneous coordinated tuning of a DFIG power oscillation damper (POD with other damping controllers is rarely involved. A simultaneous robust coordinated multiple damping controller design strategy for a power system incorporating power system stabilizer (PSS, static var compensator (SVC POD and DFIG POD is presented in this paper. This coordinated damping control design strategy is addressed as an eigenvalue-based optimization problem to increase the damping ratios of oscillation modes. Both local and inter-area electromechanical oscillation modes are intended in the optimization design process. Wide-area phasor measurement unit (PMU signals, selected by the joint modal controllability/ observability index, are utilized as SVC and DFIG POD feedback modulation signals to suppress inter-area oscillation modes. The robustness of the proposed coordinated design strategy is achieved by simultaneously considering multiple power flow situations and operating conditions. The recently proposed Grey Wolf optimizer (GWO algorithm is adopted to efficiently optimize the parameter values of multiple damping controllers. The feasibility and effectiveness of the proposed coordinated design strategy are demonstrated through frequency-domain eigenvalue analysis and nonlinear time-domain simulation studies in two modified benchmark test systems. Moreover, the dynamic response simulation results also validate the robustness of the recommended coordinated multiple damping controllers under various system operating conditions.
Lim, Kwang Soo; Baldoví, José J; Jiang, ShangDa; Koo, Bong Ho; Kang, Dong Won; Lee, Woo Ram; Koh, Eui Kwan; Gaita-Ariño, Alejandro; Coronado, Eugenio; Slota, Michael; Bogani, Lapo; Hong, Chang Seop
2017-05-01
Controlling the coordination sphere of lanthanoid complexes is a challenging critical step toward controlling their relaxation properties. Here we present the synthesis of hexacoordinated dysprosium single-molecule magnets, where tripodal ligands achieve a near-perfect octahedral coordination. We perform a complete experimental and theoretical investigation of their magnetic properties, including a full single-crystal magnetic anisotropy analysis. The combination of electrostatic and crystal-field computational tools (SIMPRE and CONDON codes) allows us to explain the static behavior of these systems in detail.
DEFF Research Database (Denmark)
Nainar, Karthikeyan; Pokhrel, Basanta Raj; Pillai, Jayakrishnan Radhakrishna
2017-01-01
This paper reviews and analyzes the existing voltage control methods of distributed solar PV inverters to improve the voltage regulation and thereby the hosting capacity of a low-voltage distribution network. A novel coordinated voltage control method is proposed based on voltage sensitivity...... optimization. The proposed method is used to calculate the voltage bands and droop settings of PV inverters at each node by the supervisory controller. The local controller of each PV inverter implements the volt/var control and if necessary, the active power curtailment as per the received settings and based...... on measured local voltages. The advantage of the proposed method is that the calculated reactive power and active power droop settings enable fair contribution of the PV inverters at each node to the voltage regulation. Simulation studies are conducted using DigSilent Power factory software on a simplified...
DEFF Research Database (Denmark)
Yao, Jun; Li, Qing; Chen, Zhe
2013-01-01
in the multiple synchronous rotating reference frames. In order to counteract the adverse effects of the voltage harmonics upon the DFIG, the SGSC generates series compensation control voltages to keep the stator voltage sinusoidal and symmetrical, which allows the use of the conventional vector control strategy......This paper presents a coordinated control method for a doubly-fed induction generator (DFIG)-based wind-power generation system with a series grid-side converter (SGSC) under distorted grid voltage conditions. The detailed mathematical models of the DFIG system with SGSC are developed...
Federal interagency radiation policy coordination
International Nuclear Information System (INIS)
Young, A.L.
1984-01-01
The author discusses Federal interagency radiation policy coordination. The Committee on Interagency Radiation Research and Policy Coordination (CIRRPC) is explained as being dedicated to the success and forward motion of enhanced radiation research and policy coordination. Both CIRRPC and the Science Panel are staffed with Federal employees. Their expertise includes many and various radiation disciplines including cytogenetics, dosimetry, epidemiology, genetics, health physics, nuclear medicine, radiology, radiation carcinogenesis, and risk assessment. Ten scientific and technical issues in their preliminary order are presented: radioepidemiological tables; de minimis radiation levels; radon progeny health effects; occupational exposure registry; measurement, recording, and control of radiation; food irradiation; use of radiation in science, industry, and medicine; nonionizing radiation; and remedial actions
Transparency and Coordinated Effects in European Merger Control
DEFF Research Database (Denmark)
Albæk, Svend; Møllgaard, H. Peter; Overgaard, Per Baltzer
2010-01-01
In this paper, we first outline the foundations in economic theory of so-called coordinated effects with a particular view to mergers and with a special focus on transparency. Then, we review a number of seminal merger cases in EU competition policy (Airtours, Sony/BMG, ABF/GBI Business) in light...
Koh, Kyoung Moo; Wong-Foy, Antek G; Matzger, Adam J; Benin, Annabelle I; Willis, Richard R
2012-11-13
The present invention provides compositions of crystalline coordination copolymers wherein multiple organic molecules are assembled to produce porous framework materials with layered or core-shell structures. These materials are synthesized by sequential growth techniques such as the seed growth technique. In addition, the invention provides a simple procedure for controlling functionality.
DEFF Research Database (Denmark)
Zhao, Haoran; Wu, Qiuwei; Wang, Chengshan
2015-01-01
Microgrid is an efficient solution to integraterenewable energy sources (RES) into power systems. Inorder to deal with the intermittent characteristics of therenewable energy based distributed generation (DG) units,a fuzzy-logic based coordinated control strategy of thebattery energy storage system...... (BESS) and dispatchableDG units is proposed in this paper for the microgridmanagement system (MMS). In the proposed coordinatedcontrol strategy, the BESS is used to mitigate the activepower exchange at the point of common coupling of themicrogrid for the grid-connected operation, and is used forthe...... frequency control for the island operation. Theeffectiveness of the proposed control strategy was verifiedby case studies using DIgSILENT/PowerFactroy....
Multi-agent coordination algorithms for control of distributed energy resources in smart grids
Cortes, Andres
Sustainable energy is a top-priority for researchers these days, since electricity and transportation are pillars of modern society. Integration of clean energy technologies such as wind, solar, and plug-in electric vehicles (PEVs), is a major engineering challenge in operation and management of power systems. This is due to the uncertain nature of renewable energy technologies and the large amount of extra load that PEVs would add to the power grid. Given the networked structure of a power system, multi-agent control and optimization strategies are natural approaches to address the various problems of interest for the safe and reliable operation of the power grid. The distributed computation in multi-agent algorithms addresses three problems at the same time: i) it allows for the handling of problems with millions of variables that a single processor cannot compute, ii) it allows certain independence and privacy to electricity customers by not requiring any usage information, and iii) it is robust to localized failures in the communication network, being able to solve problems by simply neglecting the failing section of the system. We propose various algorithms to coordinate storage, generation, and demand resources in a power grid using multi-agent computation and decentralized decision making. First, we introduce a hierarchical vehicle-one-grid (V1G) algorithm for coordination of PEVs under usage constraints, where energy only flows from the grid in to the batteries of PEVs. We then present a hierarchical vehicle-to-grid (V2G) algorithm for PEV coordination that takes into consideration line capacity constraints in the distribution grid, and where energy flows both ways, from the grid in to the batteries, and from the batteries to the grid. Next, we develop a greedy-like hierarchical algorithm for management of demand response events with on/off loads. Finally, we introduce distributed algorithms for the optimal control of distributed energy resources, i
Universal mechatronics coordinator
Muir, Patrick F.
1999-11-01
Mechatronic systems incorporate multiple actuators and sensor which must be properly coordinated to achieve the desired system functionality. Many mechatronic systems are designed as one-of-a-kind custom projects without consideration for facilitating future system or alterations and extensions to the current syste. Thus, subsequent changes to the system are slow, different, and costly. It has become apparent that manufacturing processes, and thus the mechatronics which embody them, need to be agile in order to more quickly and easily respond to changing customer demands or market pressures. To achieve agility, both the hardware and software of the system need to be designed such that the creation of new system and the alteration and extension of current system is fast and easy. This paper describes the design of a Universal Mechatronics Coordinator (UMC) which facilitates agile setup and changeover of coordination software for mechatronic systems. The UMC is capable of sequencing continuous and discrete actions that are programmed as stimulus-response pairs, as state machines, or a combination of the two. It facilitates the modular, reusable programing of continuous actions such as servo control algorithms, data collection code, and safety checking routines; and discrete actions such as reporting achieved states, and turning on/off binary devices. The UMC has been applied to the control of a z- theta assembly robot for the Minifactory project and is applicable to a spectrum of widely differing mechatronic systems.
DEFF Research Database (Denmark)
Jørgensen, Marie B; Faber, Anne; Jespersen, Tobias
2012-01-01
intervention effects, more research on implementation is needed. Trial registration: ISRCTN96241850. Practitioner summary: Both physical coordination training and cognitive behavioural training are potential effective workplace interventions among low educated job groups with high physical work demands......This study evaluates the implementation of physical coordination training (PCT) and cognitive behavioural training (CBTr) interventions in a randomised controlled trial at nine cleaners' workplaces. Female cleaners (n = 294) were randomised into a PCT, a CBTr or a reference (REF) group. Both 12...
Directory of Open Access Journals (Sweden)
Manuel eVarlet
2014-02-01
Full Text Available Defined by a persistent fear of embarrassment or negative evaluation while engaged in social interaction or public performance, social anxiety disorder (SAD is one of the most common psychiatric syndromes. Previous research has made a considerable effort to better understand and assess this mental disorder. However, little attention has been paid to social motor behavior of patients with SAD despite its crucial importance in daily social interactions. Previous research has shown that the coordination of arm, head or postural movements of interacting people can reflect their mental states or feelings such as social connectedness and social motives, suggesting that interpersonal movement coordination may be impaired in patients suffering from SAD. The current study was specifically aimed at determining whether SAD affects the dynamics of social motor coordination. We compared the unintentional and intentional rhythmic coordination of a SAD group (19 patients paired with control participants with the rhythmic coordination of a control group (19 control pairs in an interpersonal pendulum coordination task. The results demonstrated that unintentional social motor coordination was preserved with SAD while intentional coordination was impaired. More specifically, intentional coordination became impaired when patients with SAD had to lead the coordination as indicated by poorer (i.e., more variable coordination. These differences between intentional and unintentional coordination as well as between follower and leader roles reveal an impaired coordination dynamics that is specific to SAD, and thus, opens promising research directions to better understand, assess and treat this mental disorder.
Coordinate based random effect size meta-analysis of neuroimaging studies.
Tench, C R; Tanasescu, Radu; Constantinescu, C S; Auer, D P; Cottam, W J
2017-06-01
Low power in neuroimaging studies can make them difficult to interpret, and Coordinate based meta-analysis (CBMA) may go some way to mitigating this issue. CBMA has been used in many analyses to detect where published functional MRI or voxel-based morphometry studies testing similar hypotheses report significant summary results (coordinates) consistently. Only the reported coordinates and possibly t statistics are analysed, and statistical significance of clusters is determined by coordinate density. Here a method of performing coordinate based random effect size meta-analysis and meta-regression is introduced. The algorithm (ClusterZ) analyses both coordinates and reported t statistic or Z score, standardised by the number of subjects. Statistical significance is determined not by coordinate density, but by a random effects meta-analyses of reported effects performed cluster-wise using standard statistical methods and taking account of censoring inherent in the published summary results. Type 1 error control is achieved using the false cluster discovery rate (FCDR), which is based on the false discovery rate. This controls both the family wise error rate under the null hypothesis that coordinates are randomly drawn from a standard stereotaxic space, and the proportion of significant clusters that are expected under the null. Such control is necessary to avoid propagating and even amplifying the very issues motivating the meta-analysis in the first place. ClusterZ is demonstrated on both numerically simulated data and on real data from reports of grey matter loss in multiple sclerosis (MS) and syndromes suggestive of MS, and of painful stimulus in healthy controls. The software implementation is available to download and use freely. Copyright © 2017 Elsevier Inc. All rights reserved.
Lee, Junseong; Ghosh, Koushik; Stang, Peter J
2009-09-02
We present a general strategy for the synthesis of stable, multicomponent fused polygon complexes in which coordination-driven self-assembly allows for single supramolecular species to be formed from multicomponent self-assembly and the shape of the obtained polygons can be controlled simply by changing the ratio of individual components. The compounds have been characterized by multinuclear NMR spectroscopy and electrospray ionization mass spectrometry.
A Novel Group Coordination Protocol for Collaborative Multimedia Systems
1998-01-01
technology have advanced considerably, ef- ficient group coordination support for applications characterized by synchronous and wide-area groupwork is...As a component within a general coordination architecture for many-to-many groupwork , floor control coexists with proto- cols for reliable ordered...multicast and media synchronization at a sub-application level. Orchestration of multiparty groupwork with fine-grained and fair floor control is an
Directory of Open Access Journals (Sweden)
Michel Ferreira
2017-01-01
Full Text Available The behaviour of platinum(II and palladium(0 complexes coordinated by various hydrosoluble monodentate phosphane ligands has been investigated by 31P{1H} NMR spectroscopy in the presence of randomly methylated β-cyclodextrin (RAME-β-CD. This molecular receptor can have no impact on the organometallic complexes, induce the formation of phosphane low-coordinated complexes or form coordination second sphere species. These three behaviours are under thermodynamic control and are governed not only by the affinity of RAME-β-CD for the phosphane but also by the phosphane stereoelectronic properties. When observed, the low-coordinated complexes may be formed either via a preliminary decoordination of the phosphane followed by a complexation of the free ligand by the CD or via the generation of organometallic species complexed by CD which then lead to expulsion of ligands to decrease their internal steric hindrance.
A Minimal Model Describing Hexapedal Interlimb Coordination: The Tegotae-Based Approach
Directory of Open Access Journals (Sweden)
Dai Owaki
2017-06-01
Full Text Available Insects exhibit adaptive and versatile locomotion despite their minimal neural computing. Such locomotor patterns are generated via coordination between leg movements, i.e., an interlimb coordination, which is largely controlled in a distributed manner by neural circuits located in thoracic ganglia. However, the mechanism responsible for the interlimb coordination still remains elusive. Understanding this mechanism will help us to elucidate the fundamental control principle of animals' agile locomotion and to realize robots with legs that are truly adaptive and could not be developed solely by conventional control theories. This study aims at providing a “minimal" model of the interlimb coordination mechanism underlying hexapedal locomotion, in the hope that a single control principle could satisfactorily reproduce various aspects of insect locomotion. To this end, we introduce a novel concept we named “Tegotae,” a Japanese concept describing the extent to which a perceived reaction matches an expectation. By using the Tegotae-based approach, we show that a surprisingly systematic design of local sensory feedback mechanisms essential for the interlimb coordination can be realized. We also use a hexapod robot we developed to show that our mathematical model of the interlimb coordination mechanism satisfactorily reproduces various insects' gait patterns.
Directory of Open Access Journals (Sweden)
Renke Han
2014-01-01
Full Text Available It is a very crucial problem to make a microgrid operated reasonably and stably. Considering the nonlinear mathematics model of inverter established in this paper, the input-output feedback linearization method is used to transform the nonlinear mathematics model of inverters to a linear tracking synchronization and consensus regulation control problem. Based on the linear mathematics model and multiagent consensus algorithm, a decentralized coordinated controller is proposed to make amplitudes and angles of voltages from inverters be consensus and active and reactive power shared in the desired ratio. The proposed control is totally distributed because each inverter only requires local and one neighbor’s information with sparse communication structure based on multiagent system. The hybrid consensus algorithm is used to keep the amplitude of the output voltages following the leader and the angles of output voltage as consensus. Then the microgrid can be operated more efficiently and the circulating current between DGs can be effectively suppressed. The effectiveness of the proposed method is proved through simulation results of a typical microgrid system.
Guo, Jinghua; Luo, Yugong; Li, Keqiang; Dai, Yifan
2018-05-01
This paper presents a novel coordinated path following system (PFS) and direct yaw-moment control (DYC) of autonomous electric vehicles via hierarchical control technique. In the high-level control law design, a new fuzzy factor is introduced based on the magnitude of longitudinal velocity of vehicle, a linear time varying (LTV)-based model predictive controller (MPC) is proposed to acquire the wheel steering angle and external yaw moment. Then, a pseudo inverse (PI) low-level control allocation law is designed to realize the tracking of desired external moment torque and management of the redundant tire actuators. Furthermore, the vehicle sideslip angle is estimated by the data fusion of low-cost GPS and INS, which can be obtained by the integral of modified INS signals with GPS signals as initial value. Finally, the effectiveness of the proposed control system is validated by the simulation and experimental tests.
Directory of Open Access Journals (Sweden)
Yunfeng Wen
2014-03-01
Full Text Available This paper presents a novel corrective control strategy that can effectively coordinate distributed and bulk energy storage to relieve post-contingency overloads. Immediately following a contingency, distributed batteries are implemented to provide fast corrective actions to reduce power flows below their short-term emergency ratings. During the long-term period, Pumped Hydro Storage units work in pumping or generation mode to aid conventional generating units keep line flows below the normal ratings. This problem is formulated as a multi-stage Corrective Security-constrained OPF (CSCOPF. An algorithm based on Benders decomposition was proposed to find the optimal base case solution and seek feasible corrective actions to handle all contingencies. Case studies based on a modified RTS-96 system demonstrate the performance and effectiveness of the proposed control strategy.
Directory of Open Access Journals (Sweden)
Wei Zhang
2014-01-01
Full Text Available The underwater recovery of autonomous underwater vehicles (AUV is a process of 6-DOF motion control, which is related to characteristics with strong nonlinearity and coupling. In the recovery mission, the vehicle requires high level control accuracy. Considering an AUV called BSAV, this paper established a kinetic model to describe the motion of AUV in the horizontal plane, which consisted of nonlinear equations. On the basis of this model, the main coupling variables were analyzed during recovery. Aiming at the strong coupling problem between the heading control and sway motion, we designed a decoupling compensator based on the fuzzy theory and the decoupling theory. We analyzed to the rules of fuzzy compensation, the input and output membership functions of fuzzy compensator, through compose operation and clear operation of fuzzy reasoning, and obtained decoupling compensation quantity. Simulation results show that the fuzzy decoupling controller effectively reduces the overshoot of the system, and improves the control precision. Through the water tank experiments and analysis of experimental data, the effectiveness and feasibility of AUV recovery movement coordinated control based on fuzzy decoupling method are validated successful, and show that the fuzzy decoupling control method has a high practical value in the recovery mission.
Interventions for coordination of walking following stroke: systematic review.
Hollands, Kristen L; Pelton, Trudy A; Tyson, Sarah F; Hollands, Mark A; van Vliet, Paulette M
2012-03-01
Impairments in gait coordination may be a factor in falls and mobility limitations after stroke. Therefore, rehabilitation targeting gait coordination may be an effective way to improve walking post-stroke. This review sought to examine current treatments that target impairments of gait coordination, the theoretical basis on which they are derived and the effects of such interventions. Few high quality RCTs with a low risk of bias specifically targeting and measuring restoration of coordinated gait were found. Consequently, we took a pragmatic approach to describing and quantifying the available evidence and included non-randomised study designs and limited the influence of heterogeneity in experimental design and control comparators by restricting meta-analyses to pre- and post-test comparisons of experimental interventions only. Results show that physiotherapy interventions significantly improved gait function and coordination. Interventions involving repetitive task-specific practice and/or auditory cueing appeared to be the most promising approaches to restore gait coordination. The fact that overall improvements in gait coordination coincided with increased walking speed lends support to the hypothesis that targeting gait coordination gait may be a way of improving overall walking ability post-stroke. However, establishing the mechanism for improved locomotor control requires a better understanding of the nature of both neuroplasticity and coordination deficits in functional tasks after stroke. Future research requires the measurement of impairment, activity and cortical activation in an effort to establish the mechanism by which functional gains are achieved. Copyright © 2011 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
A.A. Pryimakov
2017-04-01
Full Text Available Purpose: to study reliability of functioning and reserves of system, controlling movements with different coordination structure of special health group girl students (low health level in physical education process. Material: in the research special health group girl students (n=136, age 17-19 participated. They were divided into 2 groups - control and experimental. The program, directed to increase reliability and reserves of system controlling movements, was realized. It was based on physical exercises of complicated coordination with novelty elements, which were fulfilled under musical accompaniment. The research continued one academic year. Results: in girl students with health problems we registered higher differential thresholds, when reproducing local movements in complicated conditions. They used visual and hearing feedback channels for informing brain’s programming areas about made mistakes. They were worse teachable in training accurate movements. These girl students have less expressed compensation reserves under impact of hindering factors and interferences. It can be interpreted as non-specific crisscross negative response to motor functional system in case of health problems. All these determine reduction of reserve potentials of motor control system. Conclusions: The main reserve potentials’ criteria of control over different coordination structure movements are: quickness of passing to program mechanism of fine movements’ regulation in stable conditions of functioning; power and effectiveness of compensatory reactions, ensuring interference immunity of system, controlling movements under interfering factors; reliability of maintaining movements’ qualitative parameters in optimal range under interfering factors; reduction of sensor interconnections in stable functioning conditions.
Distributed Coordination of Fractional Dynamical Systems with Exogenous Disturbances
Directory of Open Access Journals (Sweden)
Hongyong Yang
2014-01-01
Full Text Available Distributed coordination of fractional multiagent systems with external disturbances is studied. The state observer of fractional dynamical system is presented, and an adaptive pinning controller is designed for a little part of agents in multiagent systems without disturbances. This adaptive pinning controller with the state observer can ensure multiple agents' states reaching an expected reference tracking. Based on disturbance observers, the controllers are composited with the pinning controller and the state observer. By applying the stability theory of fractional order dynamical systems, the distributed coordination of fractional multiagent systems with external disturbances can be reached asymptotically.
Coordination of size-control, reproduction and generational memory in freshwater planarians
Yang, Xingbo; Kaj, Kelson J.; Schwab, David J.; Collins, Eva-Maria S.
2017-06-01
Uncovering the mechanisms that control size, growth, and division rates of organisms reproducing through binary division means understanding basic principles of their life cycle. Recent work has focused on how division rates are regulated in bacteria and yeast, but this question has not yet been addressed in more complex, multicellular organisms. We have, over the course of several years, assembled a unique large-scale data set on the growth and asexual reproduction of two freshwater planarian species, Dugesia japonica and Girardia tigrina, which reproduce by transverse fission and succeeding regeneration of head and tail pieces into new planarians. We show that generation-dependent memory effects in planarian reproduction need to be taken into account to accurately capture the experimental data. To achieve this, we developed a new additive model that mixes multiple size control strategies based on planarian size, growth, and time between divisions. Our model quantifies the proportions of each strategy in the mixed dynamics, revealing the ability of the two planarian species to utilize different strategies in a coordinated manner for size control. Additionally, we found that head and tail offspring of both species employ different mechanisms to monitor and trigger their reproduction cycles. Thus, we find a diversity of strategies not only between species but between heads and tails within species. Our additive model provides two advantages over existing 2D models that fit a multivariable splitting rate function to the data for size control: firstly, it can be fit to relatively small data sets and can thus be applied to systems where available data is limited. Secondly, it enables new biological insights because it explicitly shows the contributions of different size control strategies for each offspring type.
Adaptive leg coordination with a biologically inspired neurocontroller
Braught, Grant; Thomopoulos, Stelios C.
1996-10-01
Natural selection is responsible for the creation of robust and adaptive control systems. Nature's control systems are created only from primitive building blocks. Using insect neurophysiology as a guide, a neural architecture for leg coordination in a hexapod robot has been developed. Reflex chains and sensory feedback mechanisms from various insects and crustacea form the basis of a pattern generator for intra-leg coordination. The pattern generator contains neural oscillators which learn from sensory feedback to produce stepping patterns. Using sensory feedback as the source of learning information allows the pattern generator to adapt to changes in the leg dynamics due to internal or external causes. A coupling between six of the single leg pattern generators is used to produce the inter-leg coordination necessary to establish stable gaits.
Directory of Open Access Journals (Sweden)
Hua-Ming Song
2011-01-01
Full Text Available This paper investigates the ordering decisions and coordination mechanism for a distributed short-life-cycle supply chain. The objective is to maximize the whole supply chain's expected profit and meanwhile make the supply chain participants achieve a Pareto improvement. We treat lead time as a controllable variable, thus the demand forecast is dependent on lead time: the shorter lead time, the better forecast. Moreover, optimal decision-making models for lead time and order quantity are formulated and compared in the decentralized and centralized cases. Besides, a three-parameter contract is proposed to coordinate the supply chain and alleviate the double margin in the decentralized scenario. In addition, based on the analysis of the models, we develop an algorithmic procedure to find the optimal ordering decisions. Finally, a numerical example is also presented to illustrate the results.
Formation flying for electric sails in displaced orbits. Part II: Distributed coordinated control
Wang, Wei; Mengali, Giovanni; Quarta, Alessandro A.; Yuan, Jianping
2017-09-01
We analyze a cooperative control framework for electric sail formation flying around a heliocentric displaced orbit, aiming at observing the polar region of a celestial body. The chief spacecraft is assumed to move along an elliptic displaced orbit, while each deputy spacecraft adjusts its thrust vector (that is, both its sail attitude and characteristic acceleration) in order to track a prescribed relative trajectory. The relative motion of the electric sail formation system is formulated in the chief rotating frame, where the control inputs of each deputy are the relative sail attitude angles and the relative lightness number with respect to those of the chief. The information exchange among the spacecraft, characterized by the communication topology, is represented by a weighted graph. Two typical cases, according to whether the communication graph is directed or undirected, are discussed. For each case, a distributed coordinated control law is designed in such a way that each deputy not only tracks the chief state, but also makes full use of information from its neighbors, thus increasing the redundancy and robustness of the formation system in case of failure among the communication links. Illustrative examples show the effectiveness of the proposed approach.
Developing Efficient Coordination Schemes to Control Over-Pumping in the Heihe River Basin, China
Pedrazzini, G.
2015-12-01
Many wicked water resources problems are approached in a social planner perspective. This not always matches the real institutional and policy-making context, where, rather, multiple decision-makers (DMs) can act independently, or weakly cooperate, ultimately producing system-wide inefficient trade-offs. The idea in this work is to adopt a more realistic approach, where the multi-DMs nature of the problem is preserved and the uncoordinated DMs are driven, thorough coordination mechanisms, towards a more system-wide efficient solution. An agent-based modelling framework linked to a surface and groundwater model is used to design these coordination mechanisms as constraints to the independent agents (i.e., DMs) behaviour. In the Heihe Basin the ongoing introduction of smart meter IC-card systems on farmers' pumping wells will soon allow monitoring and control of abstractions with the goal of preventing further depletion of the resource. The major interest of policy makers in the region concerns the development of new and the improvement of existing legislation on pricing schemes and/or groundwater quotas. The model outcome where agents act rationally but selfishly is compared to the optimal solution at system-level assuming perfect coordination and cooperation. The optimal solutions with respect to the given utility functions are computed using nonlinear optimization with a rolling out time horizon. The Pareto-Frontier is synthesized through an exhaustive sampling of the weight coefficient space and related to the current and to the historical management of the last 4 decades. The best parameter values for the proposed coordination mechanisms are determined and the alternatives are compared with respect to their efficiency and acceptability. Preliminary results suggest that a regulatory tax on groundwater of about a factor 10 of the current resource fee is required to increase the elasticity of the groundwater demand curve such that reducing consumption becomes
Lanthanide co-ordination frameworks: Opportunities and diversity
International Nuclear Information System (INIS)
Hill, Robert J.; Long, De-Liang; Hubberstey, Peter; Schroeder, Martin; Champness, Neil R.
2005-01-01
Significant successes have been made over recent years in preparing co-ordination framework polymers that show macroscopic material properties, but in the vast majority of cases this has been achieved with d-block metal-based systems. Lanthanide co-ordination frameworks also offer attractive properties in terms of their potential applications as luminescent, non-linear optical and porous materials. However, lanthanide-based systems have been far less studied to date than their d-block counterparts. One possible reason for this is that the co-ordination spheres of lanthanide cations are more difficult to control and, in the absence of design strategies for lanthanide co-ordination frameworks, it is significantly more difficult to target materials with specific properties. However, this article highlights some of the exciting possibilities that have emerged from the earliest investigations in this field with new topological families of compounds being discovered from relatively simple framework components, including unusual eight, seven and five-connected framework systems. Our own research, as well as others, is leading to a much greater appreciation of the factors that control framework formation and the resultant observed topologies of these polymers. As this understanding develops targeting particular framework types will become more straightforward and the development of designed polyfunctional materials more accessible. Thus, it can be seen that lanthanide co-ordination frameworks have the potential to open up previously unexplored directions for materials chemistry. This article focuses on the underlying concepts for the construction of these enticing and potentially highly important materials
Li, Xian-Ying; Hu, Shi-Min
2013-02-01
Harmonic functions are the critical points of a Dirichlet energy functional, the linear projections of conformal maps. They play an important role in computer graphics, particularly for gradient-domain image processing and shape-preserving geometric computation. We propose Poisson coordinates, a novel transfinite interpolation scheme based on the Poisson integral formula, as a rapid way to estimate a harmonic function on a certain domain with desired boundary values. Poisson coordinates are an extension of the Mean Value coordinates (MVCs) which inherit their linear precision, smoothness, and kernel positivity. We give explicit formulas for Poisson coordinates in both continuous and 2D discrete forms. Superior to MVCs, Poisson coordinates are proved to be pseudoharmonic (i.e., they reproduce harmonic functions on n-dimensional balls). Our experimental results show that Poisson coordinates have lower Dirichlet energies than MVCs on a number of typical 2D domains (particularly convex domains). As well as presenting a formula, our approach provides useful insights for further studies on coordinates-based interpolation and fast estimation of harmonic functions.
Liu, Xiaodan; Yang, Gang; Fan, Qiuling; Wang, Lining
2014-12-17
Diabetic nephropathy (DN) is a leading cause of end-stage renal disease. To search for glomerular proteins associated with early-stage DN, glomeruli of spontaneous type 2 diabetic KKAy mice were analyzed by 2-dimensional differential gel electrophoresis (2D-DIGE). Glomeruli of 20-week spontaneous type 2 diabetic KKAy mice and age-matched C57BL/6 mice were isolated by kidney perfusion with magnetic beads. Proteomic profiles of glomeruli were investigated by using 2D-DIGE and matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) mass spectrometry. Western blot analysis was used to confirm the results of proteomics. Immunohistochemical and semi-quantitative analysis were used to confirm the differential expression of prohibitin and annexin A2 in glomeruli. We identified 19 differentially expressed proteins - 17 proteins were significantly up-regulated and 2 proteins were significantly down-regulated in glomeruli of diabetic KKAy mice. Among them, prohibitin and annexin A2 were up-regulated and Western blot analysis validated the same result in proteomics. Immunohistochemical analysis also revealed up-regulation of prohibitin and annexin A2 in glomeruli of KKAy mice. Our findings suggest that prohibitin and annexin A2 may be associated with early-stage DN. Further functional research might help to reveal the pathogenesis of DN.
WIDE-AREA BASED ON COORDINATED TUNING OF FUZZY PSS AND FACTS CONTROLLER IN MULTI-MACHINE ENVIRONMENT
Directory of Open Access Journals (Sweden)
Homayoun Ebrahimian
2016-03-01
Full Text Available In this paper coordination of fuzzy power system stabilizer (FPSS and flexible ac transmission systems (FACTS have been considered in a multi-machine power system. The proposed model, has been applied for a wide-area power system. The proposed FPSS presented with local, nonlinear feedbacks, and the corresponding control synthesis conditions are given in terms of solutions to a set of linear matrix inequalities (LMIs. For this model, in fuzzy control synthesis, the new proposed control design method is based on fewer fuzzy rules and less computational burden. Also, the parameters of FACTS controller have been evaluated by improved honey bee mating optimization (IHBMO. The effectiveness of the proposed method has been applied over two case studies of single-machine infinite-bus (SMIB and two areas four machine (TAFM Kundur’s power system. The obtained results demonstrate the superiority of proposed strategy.
Optimization of Control Points Number at Coordinate Measurements based on the Monte-Carlo Method
Korolev, A. A.; Kochetkov, A. V.; Zakharov, O. V.
2018-01-01
Improving the quality of products causes an increase in the requirements for the accuracy of the dimensions and shape of the surfaces of the workpieces. This, in turn, raises the requirements for accuracy and productivity of measuring of the workpieces. The use of coordinate measuring machines is currently the most effective measuring tool for solving similar problems. The article proposes a method for optimizing the number of control points using Monte Carlo simulation. Based on the measurement of a small sample from batches of workpieces, statistical modeling is performed, which allows one to obtain interval estimates of the measurement error. This approach is demonstrated by examples of applications for flatness, cylindricity and sphericity. Four options of uniform and uneven arrangement of control points are considered and their comparison is given. It is revealed that when the number of control points decreases, the arithmetic mean decreases, the standard deviation of the measurement error increases and the probability of the measurement α-error increases. In general, it has been established that it is possible to repeatedly reduce the number of control points while maintaining the required measurement accuracy.
Group Coordination Support in Networked Multimedia Systems
National Research Council Canada - National Science Library
Dommel, Hans-Peter
1999-01-01
.... In this dissertation, we address network control and coordination functions to orchestrate synchronous multimedia groupwork, establishing a sharing discipline on multimedia resources and guaranteeing...
Distributed sensor coordination for advanced energy systems
Energy Technology Data Exchange (ETDEWEB)
Tumer, Kagan [Oregon State Univ., Corvallis, OR (United States). School of Mechanical, Industrial and Manufacturing Engineering
2015-03-12
Motivation: The ability to collect key system level information is critical to the safe, efficient and reliable operation of advanced power systems. Recent advances in sensor technology have enabled some level of decision making directly at the sensor level. However, coordinating large numbers of sensors, particularly heterogeneous sensors, to achieve system level objectives such as predicting plant efficiency, reducing downtime or predicting outages requires sophisticated coordination algorithms. Indeed, a critical issue in such systems is how to ensure the interaction of a large number of heterogenous system components do not interfere with one another and lead to undesirable behavior. Objectives and Contributions: The long-term objective of this work is to provide sensor deployment, coordination and networking algorithms for large numbers of sensors to ensure the safe, reliable, and robust operation of advanced energy systems. Our two specific objectives are to: 1. Derive sensor performance metrics for heterogeneous sensor networks. 2. Demonstrate effectiveness, scalability and reconfigurability of heterogeneous sensor network in advanced power systems. The key technical contribution of this work is to push the coordination step to the design of the objective functions of the sensors, allowing networks of heterogeneous sensors to be controlled. By ensuring that the control and coordination is not specific to particular sensor hardware, this approach enables the design and operation of large heterogeneous sensor networks. In addition to the coordination coordination mechanism, this approach allows the system to be reconfigured in response to changing needs (e.g., sudden external events requiring new responses) or changing sensor network characteristics (e.g., sudden changes to plant condition). Impact: The impact of this work extends to a large class of problems relevant to the National Energy Technology Laboratory including sensor placement, heterogeneous sensor
An Infant Development-inspired Approach to Robot Hand-eye Coordination
Directory of Open Access Journals (Sweden)
Fei Chao
2014-02-01
Full Text Available This paper presents a novel developmental learning approach for hand-eye coordination in an autonomous robotic system. Robotic hand-eye coordination plays an important role in dealing with real-time environments. Under the approach, infant developmental patterns are introduced to build our robot's learning system. The method works by first constructing a brain-like computational structure to control the robot, and then by using infant behavioural patterns to build a hand-eye coordination learning algorithm. This work is supported by an experimental evaluation, which shows that the control system is implemented simply, and that the learning approach provides fast and incremental learning of behavioural competence.
Energy Technology Data Exchange (ETDEWEB)
Baker, Kyri; Guo, Junyao; Hug, Gabriela; Li, Xin
2016-03-01
In electric power systems, multiple entities are responsible for ensuring an economic and reliable way of delivering power from producers to consumers. With the increase of variable renewable generation it is becoming increasingly important to take advantage of the individual entities' (and their areas') capabilities for balancing variability. Hence, in this paper, we employ and extend the approximate Newton directions method to optimally coordinate control areas leveraging storage available in one area to balance variable resources in another area with only minimal information exchange among the areas. The problem to be decomposed is a model predictive control problem including generation constraints, energy storage constraints, and AC power flow constraints. Singularity issues encountered when formulating the respective Newton-Raphson steps due to intertemporal constraints are addressed and extensions to the original decomposition method are proposed to improve the convergence rate and required communication of the method.
Postural Coordination during Socio-motor Improvisation.
Gueugnon, Mathieu; Salesse, Robin N; Coste, Alexandre; Zhao, Zhong; Bardy, Benoît G; Marin, Ludovic
2016-01-01
Human interaction often relies on socio-motor improvisation. Creating unprepared movements during social interaction is not a random process but relies on rules of synchronization. These situations do not only involve people to be coordinated, but also require the adjustment of their posture in order to maintain balance and support movements. The present study investigated posture in such a context. More precisely, we first evaluated the impact of amplitude and complexity of arm movements on posture in solo situation. Then, we assessed the impact of interpersonal coordination on posture using the mirror game in which dyads performed improvised and synchronized movements (i.e., duo situation). Posture was measured through ankle-hip coordination in medio-lateral and antero-posterior directions (ML and AP respectively). Our results revealed the spontaneous emergence of in-phase pattern in ML direction and antiphase pattern in AP direction for solo and duo situations. These two patterns respectively refer to the simultaneous flexion/extension of the ankles and the hips in the same or opposite direction. It suggests different functional roles of postural coordination patterns in each direction, with in-phase supporting task performance in ML (dynamical stability) and antiphase supporting postural control in AP (mechanical stability). Although amplitude of movement did not influence posture, movement complexity disturbed postural stability in both directions. Conversely, interpersonal coordination promoted postural stability in ML but not in AP direction. These results are discussed in terms of the difference in coupling strength between ankle-hip coordination and interpersonal coordination.
Postural coordination during socio-motor improvisation
Directory of Open Access Journals (Sweden)
Mathieu Gueugnon
2016-08-01
Full Text Available Human interaction often relies on socio-motor improvisation. Creating unprepared movements during social interaction is not a random process but relies on rules of synchronization. These situations do not only involve people to be coordinated, but also require the adjustment of their posture in order to maintain balance and support movements. The present study investigated posture in such a context. More precisely, we first evaluated the impact of amplitude and complexity of arm movements on posture in solo situation. Then, we assessed the impact of interpersonal coordination on posture using the mirror game in which dyads performed improvised and synchronized movements (i.e., duo situation. Posture was measured through ankle-hip coordination in medio-lateral and antero-posterior directions (ML and AP respectively. Our results revealed the spontaneous emergence of in-phase pattern in ML direction and anti-phase pattern in AP direction for solo and duo situations. These two patterns respectively refer to the simultaneous flexion/extension of the ankles and the hips in the same or opposite direction. It suggests different functional roles of postural coordination patterns in each direction, with in-phase supporting task performance in ML (dynamical stability and antiphase supporting postural control in AP (mechanical stability. Although amplitude of movement did not influence posture, movement complexity disturbed postural stability in both directions. Conversely, interpersonal coordination promoted postural stability in ML but not in AP direction. These results are discussed in terms of the difference in coupling strength between ankle-hip coordination and interpersonal coordination.
Liu, Zhi; Chen, Ci; Zhang, Yun; Chen, C L P
2015-03-01
To achieve an excellent dual-arm coordination of the humanoid robot, it is essential to deal with the nonlinearities existing in the system dynamics. The literatures so far on the humanoid robot control have a common assumption that the problem of output hysteresis could be ignored. However, in the practical applications, the output hysteresis is widely spread; and its existing limits the motion/force performances of the robotic system. In this paper, an adaptive neural control scheme, which takes the unknown output hysteresis and computational efficiency into account, is presented and investigated. In the controller design, the prior knowledge of system dynamics is assumed to be unknown. The motion error is guaranteed to converge to a small neighborhood of the origin by Lyapunov's stability theory. Simultaneously, the internal force is kept bounded and its error can be made arbitrarily small.
Dynamic wake model with coordinated pitch and torque control of wind farms for power tracking
Shapiro, Carl; Meyers, Johan; Meneveau, Charles; Gayme, Dennice
2017-11-01
Control of wind farm power production, where wind turbines within a wind farm coordinate to follow a time-varying power set point, is vital for increasing renewable energy participation in the power grid. Previous work developed a one-dimensional convection-diffusion equation describing the advection of the velocity deficit behind each turbine (wake) as well the turbulent mixing of the wake with the surrounding fluid. Proof-of-concept simulations demonstrated that a receding horizon controller built around this time-dependent model can effectively provide power tracking services by modulating the thrust coefficients of individual wind turbines. In this work, we extend this model-based controller to include pitch angle and generator torque control and the first-order dynamics of the drive train. Including these dynamics allows us to investigate control strategies for providing kinetic energy reserves to the grid, i.e. storing kinetic energy from the wind in the rotating mass of the wind turbine rotor for later use. CS, CM, and DG are supported by NSF (ECCS-1230788, CMMI 1635430, and OISE-1243482, the WINDINSPIRE project). JM is supported by ERC (ActiveWindFarms, 306471). This research was conducted using computational resources at MARCC.
75 FR 69573 - Export Enforcement Coordination Center
2010-11-15
... Export Enforcement Coordination Center By the authority vested in me as President by the Constitution and... enforcement of United States export control laws and enhanced intelligence exchange in support of such enforcement efforts, it is hereby ordered as follows: Section 1. Policy. Export controls are critical to...
Directory of Open Access Journals (Sweden)
Filipiak-Kowszyk Daria
2018-01-01
Full Text Available Geodetic control measurements play an important part because they provide information about the current state of repair of the construction, which has a direct impact on the safety assessment of its exploitation. Authors in this paper have focused on control measurements of the elevator shaft. The article discusses the problem of determining the deviation of elevator shaft walls from the vertical plane in the local 3D coordinate system. It presents a concept of estimation of measurements results base on the parametric method with conditions on parameters. The simulated measurement results were used to verify the concept presented in the paper.
Hybrid Architecture for Coordination of AGVs in FMS
Directory of Open Access Journals (Sweden)
Eduardo G. Hernandez-Martinez
2014-03-01
Full Text Available This paper presents a hybrid control architecture that coordinates the motion of groups of automated guided vehicles in flexible manufacturing systems. The high-level control is based on a Petri net model, using the industrial standard ISA-95, obtaining a task-based coordination of equipment and storage considering process restrictions, logical precedences, shared resources and the assignment of robots to move workpieces individually or in subgroups. On the other hand, in the low-level control, three basic control laws are designed for unicycle-type robots in order to achieve desired formation patterns and marching behaviours, avoiding inter-robot collisions. The control scheme combines the task assignment for the robots obtained from the discrete-event model and the implementation of formation and marching continuous control laws applied to the motion of the mobile robots. The hybrid architecture is implemented and validated for the case of a flexible manufacturing system and four mobile robots using a virtual reality platform.
Cignetti, Fabien; Vaugoyeau, Marianne; Fontan, Aurelie; Jover, Marianne; Livet, Marie-Odile; Hugonenq, Catherine; Audic, Frédérique; Chabrol, Brigitte; Assaiante, Christine
2018-05-01
Feedforward and online controls are two facets of predictive motor control from internal models, which is suspected to be impaired in learning disorders. We examined whether the feedforward component is affected in children (8-12 years) with developmental dyslexia (DD) and/or with developmental coordination disorder (DCD) compared to typically developing (TD) children. Children underwent a bimanual unloading paradigm during which a load supported to one arm, the postural arm, was either unexpectedly unloaded by a computer or voluntary unloaded by the subject with the other arm. All children showed a better stabilization (lower flexion) of the postural arm and an earlier inhibition of the arm flexors during voluntary unloading, indicating anticipation of unloading. Between-group comparisons of kinematics and electromyographic activity of the postural arm revealed that the difference during voluntary unloading was between DD-DCD children and the other groups, with the former showing a delayed inhibition of the flexor muscles. Deficit of the feedforward component of motor control may particularly apply to comorbid subtypes, here the DD-DCD subtype. The development of a comprehensive framework for motor performance deficits in children with learning disorders will be achieved only by dissociating key components of motor prediction and focusing on subtypes and comorbidities. Copyright © 2018 Elsevier Ltd. All rights reserved.
Neilson, James R; Schwenzer, Birgit; Seshadri, Ram; Morse, Daniel E
2009-12-07
We report the synthesis and characterization of new structural variants of the isotypic compound with the generic chemical formula, Co(1-0.5x)(oct) Co(x)(tet) (OH)2 (Cl)x (H2O)n, all modifications of an alpha-Co(OH)2 lattice. We show that the occupancy of tetrahedrally coordinated cobalt sites and associated chloride ligands, x, is modulated by the rate of formation of the respective layered hydroxide salts from kinetically controlled aqueous hydrolysis at an air-water interface. This new level of structural control is uniquely enabled by the slow diffusion of a hydrolytic catalyst, a simple technique. Independent structural characterizations of the compounds separately describe various attributes of the materials on different length scales, revealing details hidden by the disordered average structures. The precise control over the population of distinct octahedrally and tetrahedrally coordinated cobalt ions in the lattice provides a gentle, generic method for modulating the coordination geometry of cobalt in the material without disturbing the lattice or using additional reagents. A mechanism is proposed to reconcile the observation of the kinetic control of the structure with competing interactions during the initial stages of hydrolysis and condensation.
Low-Voltage Consumption Coordination for Loss Minimization and Voltage Control
DEFF Research Database (Denmark)
Juelsgaard, Morten; Sloth, Christoffer; Wisniewski, Rafal
2014-01-01
This work presents a strategy for minimizing active power losses in low-voltage grids, by coordinating the consumption of electric vehicles and power generation from solar panels. We show that minimizing losses, also reduces voltage variations, and illustrate how this may be employed for increasing...
Kilonzo, B S
1994-07-01
Human health, agriculture, including livestock, energy, education, wildlife, construction, forestry and trade sectors are inter-related and their co-ordination is an important pre-requisite for successful control of most communicable diseases including plague. Similar linkage between research, policy, training and extension activities in each sector are essential for any successful control strategy. Inadequate agricultural produce, inaccessibility of people to the available food and ignorance on proper preparation and usage of available food materials are responsible for malnutrition, and malnourished people are very vulnerable to disease. Irrigation schemes facilitate breeding of various disease vectors and transmission of some communicable diseases. Forests are ecologically favourable for some disease vectors and reservoirs for tsetse flies and rodents, while deforestation leads to soil erosion, lack of rainfall and consequently reduced productivity in agriculture which may result in poor nutrition of the population. Wildlife and livestock serve as reservoirs and/or carriers of various zoonoses including plague, trypanosomiasis and rabies. Lack of proper co-ordination of these sectors in communicable disease control programmes can result in serious and undesirable consequences. Indiscriminate killing of rodents in order to minimize food damage by these vermin forces their flea ectoparasites to seek alternative hosts, including man, a development which may result in transmission of plague from rodents to man. Similarly, avoidance of proper quarantine during plague epidemics, an undertaking which is usually aimed at maintaining economic and social links with places outside the affected focus, can result in the disease becoming widespread and consequently make any control strategies more difficult and expensive.(ABSTRACT TRUNCATED AT 250 WORDS)
Unraveling interlimb interactions underlying bimanual coordination
Ridderikhoff, A.; Daffertshofer, A.; Peper, C.E.; Beek, P.J.
2005-01-01
Three sources of interlimb interactions have been postulated to underlie the stability characteristics of bimanual coordination but have never been evaluated in conjunction: integrated timing of feedforward control signals, phase entrainment by contralateral afference, and timing corrections based
Coordinated frequency regulation by offshore wind farms and VSC-HVDC transmission
DEFF Research Database (Denmark)
Liu, Hongzhi; Chen, Zhe
2014-01-01
converter-based HVDC (VSC-HVDC) transmission system to participate in power system frequency regulation. The strategy explores the frequency support capability of offshore wind farms and VSC-HVDC. By implementing the proposed coordinated control, the VSCHVDC link is able to provide quick virtual inertial...... are presented to demonstrate the frequency regulation capability of VSC-HVDC and validate the effectiveness of the proposed coordinated control strategy....
On the Impact of Cyberattacks on Voltage Control Coordination by ReGen Plants in Smart Grids
DEFF Research Database (Denmark)
Shahid, Kamal; Kidmose, Egon; Olsen, Rasmus Løvenstein
2017-01-01
are crucial step stones towards a future resilient power system. The ability to provide online voltage stability support from Renewable Generation plants highly depends on the communication infrastructure that allows an exchange of information between different grid assets. Any attempt to attack...... this communication system can lead to an unstable grid and in worst case, a complete blackout. Therefore, this paper illustrates the impact of cyberattacks on the voltage control coordination between the renewable generation plants and the system operator in microgrid settings. More specifically, this work focuses...
Li, Zhijun; Su, Chun-Yi
2013-09-01
In this paper, adaptive neural network control is investigated for single-master-multiple-slaves teleoperation in consideration of time delays and input dead-zone uncertainties for multiple mobile manipulators carrying a common object in a cooperative manner. Firstly, concise dynamics of teleoperation systems consisting of a single master robot, multiple coordinated slave robots, and the object are developed in the task space. To handle asymmetric time-varying delays in communication channels and unknown asymmetric input dead zones, the nonlinear dynamics of the teleoperation system are transformed into two subsystems through feedback linearization: local master or slave dynamics including the unknown input dead zones and delayed dynamics for the purpose of synchronization. Then, a model reference neural network control strategy based on linear matrix inequalities (LMI) and adaptive techniques is proposed. The developed control approach ensures that the defined tracking errors converge to zero whereas the coordination internal force errors remain bounded and can be made arbitrarily small. Throughout this paper, stability analysis is performed via explicit Lyapunov techniques under specific LMI conditions. The proposed adaptive neural network control scheme is robust against motion disturbances, parametric uncertainties, time-varying delays, and input dead zones, which is validated by simulation studies.
Tenailleau, Christophe; Allix, Mathieu; Claridge, John B; Hervieu, Maryvonne; Thomas, Michael F; Hirst, James P; Rosseinsky, Matthew J
2008-06-18
The effects of reaction temperature and pO2 were investigated on a series of (Ba,Ca,Nd)FeO3-delta perovskite systems in order to isolate phases containing ordered arrangements of the distinct vacancy and cation ordering patterns identified in less compositionally complex iron oxide systems. Initial synthesis in air at high temperature yields cubic perovskite phases (I) with average iron oxidation states higher than 3; selected area electron diffraction together with diffuse features observed in the synchrotron X-ray diffraction (SXRD) patterns of these materials show evidence of small domains of short-range cation and vacancy order. Annealing these materials in nitrogen or in a sealed tube in the presence of an NiO/Ni buffer yielded the Fe(3+) phase Ca2Ba2Nd2Fe6O16 (II), closely related to Sr2LaFe3O8 but with partial cation order as well as anion order present the larger Ba cations are largely present in the 12-coordinate site between the octahedral iron layers, and Ca is largely present in 10-coordinate sites between octahedral and tetrahedral sites. Further reduction of Ca2Ba2Nd2Fe6O16 using a Zr getter yields the mixed-valence phase Ca2Ba2Nd2Fe6O15.6 (III). The structure of III was solved by maximum entropy analysis of XRD data coupled with analysis of high-temperature neutron diffraction data and refined against combined SXRD and high-Q ambient-temperature neutron data. This material crystallizes in a 20-fold perovskite super cell (Imma, a approximately square root(2 x a(p), b approximately 10 x a(p), c approximately square root(x 2a(p)) and can be visualized as an intergrowth between brownmillerite (Ca2Fe2O5) and the YBa2Fe3O8 structure. There are three distinct iron coordination environments, octahedral (O), square-pyramidal (Sp), and trigonal planar (Tp, formed by distorting the tetrahedral site in brownmillerite), which form a Sp-O-Tp-O-Sp repeat. Bond valence calculations indicate that Tp is an Fe(2+) site, while the O and Sp sites are Fe(3+). The A
Pesyna, Colin; Pundi, Krishna; Flanders, Martha
2011-03-09
The neural control of hand movement involves coordination of the sensory, motor, and memory systems. Recent studies have documented the motor coordinates for hand shape, but less is known about the corresponding patterns of somatosensory activity. To initiate this line of investigation, the present study characterized the sense of hand shape by evaluating the influence of differences in the amount of grasping or twisting force, and differences in forearm orientation. Human subjects were asked to use the left hand to report the perceived shape of the right hand. In the first experiment, six commonly grasped items were arranged on the table in front of the subject: bottle, doorknob, egg, notebook, carton, and pan. With eyes closed, subjects used the right hand to lightly touch, forcefully support, or imagine holding each object, while 15 joint angles were measured in each hand with a pair of wired gloves. The forces introduced by supporting or twisting did not influence the perceptual report of hand shape, but for most objects, the report was distorted in a consistent manner by differences in forearm orientation. Subjects appeared to adjust the intrinsic joint angles of the left hand, as well as the left wrist posture, so as to maintain the imagined object in its proper spatial orientation. In a second experiment, this result was largely replicated with unfamiliar objects. Thus, somatosensory and motor information appear to be coordinated in an object-based, spatial-coordinate system, sensitive to orientation relative to gravitational forces, but invariant to grasp forcefulness.
Directory of Open Access Journals (Sweden)
Xinlei Liu
2012-08-01
Full Text Available On the basis of the shifting process of automated mechanical transmissions (AMTs for traditional hybrid electric vehicles (HEVs, and by combining the features of electric machines with fast response speed, the dynamic model of the hybrid electric AMT vehicle powertrain is built up, the dynamic characteristics of each phase of shifting process are analyzed, and a control strategy in which torque and speed of the engine and electric machine are coordinatively controlled to achieve AMT shifting control for a plug-in hybrid electric vehicle (PHEV without clutch is proposed. In the shifting process, the engine and electric machine are well controlled, and the shift jerk and power interruption and restoration time are reduced. Simulation and real car test results show that the proposed control strategy can more efficiently improve the shift quality for PHEVs equipped with AMTs.
Computation at a coordinate singularity
Prusa, Joseph M.
2018-05-01
Coordinate singularities are sometimes encountered in computational problems. An important example involves global atmospheric models used for climate and weather prediction. Classical spherical coordinates can be used to parameterize the manifold - that is, generate a grid for the computational spherical shell domain. This particular parameterization offers significant benefits such as orthogonality and exact representation of curvature and connection (Christoffel) coefficients. But it also exhibits two polar singularities and at or near these points typical continuity/integral constraints on dependent fields and their derivatives are generally inadequate and lead to poor model performance and erroneous results. Other parameterizations have been developed that eliminate polar singularities, but problems of weaker singularities and enhanced grid noise compared to spherical coordinates (away from the poles) persist. In this study reparameterization invariance of geometric objects (scalars, vectors and the forms generated by their covariant derivatives) is utilized to generate asymptotic forms for dependent fields of interest valid in the neighborhood of a pole. The central concept is that such objects cannot be altered by the metric structure of a parameterization. The new boundary conditions enforce symmetries that are required for transformations of geometric objects. They are implemented in an implicit polar filter of a structured grid, nonhydrostatic global atmospheric model that is simulating idealized Held-Suarez flows. A series of test simulations using different configurations of the asymptotic boundary conditions are made, along with control simulations that use the default model numerics with no absorber, at three different grid sizes. Typically the test simulations are ∼ 20% faster in wall clock time than the control-resulting from a decrease in noise at the poles in all cases. In the control simulations adverse numerical effects from the polar
Strength training for a child with suspected developmental coordination disorder.
Menz, Stacy M; Hatten, Kristin; Grant-Beuttler, Marybeth
2013-01-01
Children with developmental coordination disorder (DCD) demonstrate difficulty with feedforward motor control and use varied compensatory strategies. To examine gross motor function changes following strength training in a child with motor control difficulties. A girl aged 6 years 11 months, with apraxia and hypotonia, and demonstrating motor delays consistent with DCD. Twenty-four strength training sessions were completed using a universal exercise unit. Postintervention scores significantly improved on the Bruininks-Oseretsky test of motor proficiency, second edition, and the Canadian occupational performance measure scores and raised the developmental coordination disorder questionnaire, revised 2007, scores above the range where DCD is suspected. Nonsignificant changes in strength were observed. Improved function and significant gains in manual coordination were observed following blocked practice of isolated, simple joint movements during strength training. Improved motor skills may be because of effective use of feedforward control and improved stabilization. Strength training does not rehearse skills using momentum, explaining nonsignificant changes in locomotor or locomotion areas.
Directory of Open Access Journals (Sweden)
Yi Tang
2017-11-01
Full Text Available The inherent variability and randomness of large-scale wind power integration have brought great challenges to power flow control and dispatch. The distributed power flow controller (DPFC has the higher flexibility and capacity in power flow control in the system with wind generation. This paper proposes a multi-time scale coordinated scheduling model with DPFC to minimize wind power spillage. Configuration of DPFCs is initially determined by stochastic method. Afterward, two sequential procedures containing day-head and real-time scales are applied for determining maximum schedulable wind sources, optimal outputs of generating units and operation setting of DPFCs. The generating plan is obtained initially in day-ahead scheduling stage and modified in real-time scheduling model, while considering the uncertainty of wind power and fast operation of DPFC. Numerical simulation results in IEEE-RTS79 system illustrate that wind power is maximum scheduled with the optimal deployment and operation of DPFC, which confirms the applicability and effectiveness of the proposed method.
DEFF Research Database (Denmark)
Sakamuri, Jayachandra N.; Cutululis, Nicolaos Antonio; Rather, Zakir Hussain
2015-01-01
This paper proposes a coordinated voltage control scheme (CVCS) which enhances the voltage ride through (VRT) capability of an offshore AC grid comprised of a cluster of offshore wind power plants (WPP) connected through AC cables to the offshore voltage source converter based high voltage DC (VSC......-HVDC) converter station. Due to limited short circuit power contribution from power electronic interfaced variable speed wind generators and with the onshore main grid decoupled by the HVDC link, the offshore AC grid becomes more vulnerable to dynamic voltage events. Therefore, a short circuit fault...... in the offshore AC Grid is likely to have significant implications on the voltage of the offshore AC grid, hence on the power flow to the onshore mainland grid. The proposed CVCS integrates individual local reactive power control of wind turbines and of the HVDC converter with the secondary voltage controller...
[Evaluation of coordination and balance in preterm children].
Rodríguez Fernández, Cristina; Mata Zubillaga, Daniel; Rodríguez Fernández, Luis Miguel; Regueras Santos, Laura; Reguera García, Maria Mercedes; de Paz Fernández, José Antonio; Lapeña López de Armentia, Santiago
2016-08-01
Recent studies show that many preterm children without apparent neurological sequelae present some difficulties in different areas, such as coordination or balance during their school years. The Movement Assessment Battery for Children-2 (MABC-2) has demonstrated to be a useful tool to validate the coordination, while the stabilometric platform was the reference standard test for validating the balance. Case-control study carried out on preterm children from 7 to 10 years old and healthy term infant controls of the same ages. The same age band of MABC-2 was applied and the static balance by the stabilometric platform was analysed. A total of 89 subjects were included, 30 preterm children≤1,500g birthweight, 29 preterm children>1,500g birthweight, and 30 controls. Preterm children obtained the lowest scores on an overall basis in hand dexterity and balance tests in MABC-2, regardless of their birthweight. Lower gestational age was associated with poorer outcomes in hand dexterity and total scores in MABC-2. Balance results were similar using the stabilometric platform, regardless of prematurity. A little more than 10% preterm and term children could have coordination disorders or be at risk of developing them using the MABC-2. Despite the visual-motor coordination being similar, preterm children could face greater difficulties in hand dexterity while, in the absence of neurological comorbidity, preterm and term children balance could be comparable. Copyright © 2015 Asociación Española de Pediatría. Publicado por Elsevier España, S.L.U. All rights reserved.
Robotic Exoskeletons: A Perspective for the Rehabilitation of Arm Coordination in Stroke Patients
Jarrassé, Nathanaël; Proietti, Tommaso; Crocher, Vincent; Robertson, Johanna; Sahbani, Anis; Morel, Guillaume; Roby-Brami, Agnès
2014-01-01
Upper-limb impairment after stroke is caused by weakness, loss of individual joint control, spasticity, and abnormal synergies. Upper-limb movement frequently involves abnormal, stereotyped, and fixed synergies, likely related to the increased use of sub-cortical networks following the stroke. The flexible coordination of the shoulder and elbow joints is also disrupted. New methods for motor learning, based on the stimulation of activity-dependent neural plasticity have been developed. These include robots that can adaptively assist active movements and generate many movement repetitions. However, most of these robots only control the movement of the hand in space. The aim of the present text is to analyze the potential of robotic exoskeletons to specifically rehabilitate joint motion and particularly inter-joint coordination. First, a review of studies on upper-limb coordination in stroke patients is presented and the potential for recovery of coordination is examined. Second, issues relating to the mechanical design of exoskeletons and the transmission of constraints between the robotic and human limbs are discussed. The third section considers the development of different methods to control exoskeletons: existing rehabilitation devices and approaches to the control and rehabilitation of joint coordinations are then reviewed, along with preliminary clinical results available. Finally, perspectives and future strategies for the design of control mechanisms for rehabilitation exoskeletons are discussed. PMID:25520638
Coordination of KSHV Latent and Lytic Gene Control by CTCF-Cohesin Mediated Chromosome Conformation
Kang, Hyojeung; Wiedmer, Andreas; Yuan, Yan; Robertson, Erle; Lieberman, Paul M.
2011-01-01
Herpesvirus persistence requires a dynamic balance between latent and lytic cycle gene expression, but how this balance is maintained remains enigmatic. We have previously shown that the Kaposi's Sarcoma-Associated Herpesvirus (KSHV) major latency transcripts encoding LANA, vCyclin, vFLIP, v-miRNAs, and Kaposin are regulated, in part, by a chromatin organizing element that binds CTCF and cohesins. Using viral genome-wide chromatin conformation capture (3C) methods, we now show that KSHV latency control region is physically linked to the promoter regulatory region for ORF50, which encodes the KSHV immediate early protein RTA. Other linkages were also observed, including an interaction between the 5′ and 3′ end of the latency transcription cluster. Mutation of the CTCF-cohesin binding site reduced or eliminated the chromatin conformation linkages, and deregulated viral transcription and genome copy number control. siRNA depletion of CTCF or cohesin subunits also disrupted chromosomal linkages and deregulated viral latent and lytic gene transcription. Furthermore, the linkage between the latent and lytic control region was subject to cell cycle fluctuation and disrupted during lytic cycle reactivation, suggesting that these interactions are dynamic and regulatory. Our findings indicate that KSHV genomes are organized into chromatin loops mediated by CTCF and cohesin interactions, and that these inter-chromosomal linkages coordinate latent and lytic gene control. PMID:21876668
Chowdhury, Indrajit; Thompson, Winston E; Welch, Crystal; Thomas, Kelwyn; Matthews, Roland
2013-12-01
Mammalian ovarian follicular development is tightly regulated by crosstalk between cell death and survival signals, which include both endocrine and intra-ovarian regulators. Whether the follicle ultimately ovulates or undergoes atresia is dependent on the expression and actions of factors promoting follicular cell proliferation, differentiation or apoptosis. Prohibitin (PHB) is a highly conserved, ubiquitous protein that is abundantly expressed in granulosa cells (GCs) and associated with GC differentiation and apoptosis. The current study was designed to characterize the regulation of anti-apoptotic and pro-apoptotic factors in undifferentiated rat GCs (gonadotropin independent phase) governed by PHB. Microarray technology was initially employed to identify potential apoptosis-related genes, whose expression levels within GCs were altered by either staurosporine (STS) alone or STS in presence of ectopically over-expressed PHB. Next, immunoblot studies were performed to examine the expression patterns of selective Bcl-2 family members identified by the microarray analysis, which are commonly regulated in the intrinsic-apoptotic pathway. These studies were designed to measure protein levels of Bcl2 family in relation to expression of the acidic isoform (phosphorylated) PHB and the components of MEK-Erk1/2 pathway. These studies indicated that over-expression of PHB in undifferentiated GCs inhibit apoptosis which concomitantly results in an increased level of the anti-apoptotic proteins Bcl2 and Bclxl, reduced release of cytochrome c from mitochondria and inhibition of caspase-3 activity. In contrast, silencing of PHB expression resulted in change of mitochondrial morphology from the regular reticular network to a fragmented form, which enhanced sensitization of these GCs to the induction of apoptosis. Collectively, these studies have provided new insights on the PHB-mediated anti-apoptotic mechanism, which occurs in undifferentiated GCs through a PHB → Mek-Erk1
Intersectoral coordination in Aedes aegypti control. A pilot project in Havana City, Cuba.
Sanchez, L; Perez, D; Pérez, T; Sosa, T; Cruz, G; Kouri, G; Boelaert, M; Van der Stuyft, P
2005-01-01
Background The 55th World Health Assembly declared dengue prevention and control a priority and urged Member States to develop sustainable intersectoral strategies to this end. To provide evidence for the reorientation of the dengue prevention policy in Cuba, we launched an intervention study to document the effectiveness of a local-level intersectoral approach. We used a quasi-experimental design. Social scientists introduced participatory methods to facilitate dialogue in the biweekly meetings of the intersectoral Health Council of the intervention area. This council subsequently developed an intersectoral plan for dengue prevention, of which the core objective was to design and implement activities for communication and social mobilization. In the control area, routine dengue control activities continued without additional input. Knowledge, attitudes and perceptions of dengue, and entomological indices were compared inside and between the areas before and after the 1-year intervention period. In the intervention area the Health Council elaborated an intersectoral plan for dengue prevention focused on source reduction. The Aedes aegypti control methods consisted in eliminating useless containers in the houses and surroundings, covering tanks, and cleaning public and inhabited areas. It was implemented through communication and social mobilization. The Health Council in the control area occasionally discussed dengue issues but did not develop a coordinated action plan. Good knowledge about breeding sites and disease symptoms increased significantly (by 49.7% and 17.1% respectively) in the intervention area as well as the proportion of respondents eliminating containers in and around their houses (by 44%). No changes were observed in the control area. The House Index in the intervention area was 3.72% at baseline and decreased to 0.61% after 1 year. In the control area it remained stable throughout the study period (1.31% and 1.65% respectively). The introduction
DEFF Research Database (Denmark)
Liu, Yao; Hou, Xiaochao; Wang, Xiaofeng
2016-01-01
The increasing penetration of renewable generators can be a significant challenge due to the fluctuation of their power generation. Energy storage (ES) units are one solution to improve power supply quality and guarantee system stability. In this paper, a hybrid microgrid is built based...... on photovoltaic (PV) generator and ES; and coordinated control is proposed and developed to achieve power management in a decentralized manner. This control scheme contains three different droop strategies according to characteristics of PV and ES. First, the modified droop control is proposed for PV, which can...... take full utilization of renewable energy and avoid regulating output active power frequently. Second, to maintain the direct current (DC) bus voltage stability, a novel droop control incorporating a constant power band is presented for DC-side ES. Third, a cascade droop control is designed...
DEFF Research Database (Denmark)
Cao, Qian; Song, Y. D.; Guerrero, Josep M.
2016-01-01
This paper proposes a distributed algorithm for coordination of flywheel energy storage matrix system (FESMS) cooperated with wind farm. A simple and distributed ratio consensus algorithm is proposed to solve FESMS dispatch problem. The algorithm is based on average consensus for both undirected...... and unbalanced directed graphs. Average consensus is guaranteed in unbalanced digraphs by updating the weight matrix with both its row sums and column sums being 1. Simulation examples illustrate the effectiveness of the proposed control method....
Directory of Open Access Journals (Sweden)
Bernard Dan
2013-01-01
Full Text Available Botulinum toxin injections may significantly improve lower limb kinematics in gait of children with spastic forms of cerebral palsy. Here we aimed to analyze the effect of lower limb botulinum toxin injections on trunk postural control and lower limb intralimb (intersegmental coordination in children with spastic diplegia or spastic hemiplegia (GMFCS I or II. We recorded tridimensional trunk kinematics and thigh, shank and foot elevation angles in fourteen 3–12 year-old children with spastic diplegia and 14 with spastic hemiplegia while walking either barefoot or with ankle-foot orthoses (AFO before and after botulinum toxin infiltration according to a management protocol. We found significantly greater trunk excursions in the transverse plane (barefoot condition and in the frontal plane (AFO condition. Intralimb coordination showed significant differences only in the barefoot condition, suggesting that reducing the degrees of freedom may limit the emergence of selective coordination. Minimal relative phase analysis showed differences between the groups (diplegia and hemiplegia but there were no significant alterations unless the children wore AFO. We conclude that botulinum toxin injection in lower limb spastic muscles leads to changes in motor planning, including through interference with trunk stability, but a combination of therapies (orthoses and physical therapy is needed in order to learn new motor strategies.
DEFF Research Database (Denmark)
Wu, Dan; Tang, Fen; Dragicevic, Tomislav
2015-01-01
Coordinated operation of microgrids requires that energy management system takes into account both the available power in renewable energy sources (RES) and storage capacity of energy storage systems (ESS). In this paper, a coordinated architecture of islanded AC microgrids with smooth switching...
Straker, L; Howie, E; Smith, A; Jensen, L; Piek, J; Campbell, A
2015-08-01
Impaired motor development can significantly affect a child's life and may result in an increased risk of a range of physical and psychological disorders. Active video game (AVG) interventions have been demonstrated to enhance motor skills in children with Developmental Coordination Disorder (DCD); however a home-based intervention has not been assessed. The primary aim of this study was to compare the changes in motor coordination between a 16 week period of AVG use, with 16 weeks of normal activities (NAG). The secondary aim was to compare the child and parent perceptions of their physical performance between the AVG and NAG conditions. Twenty-one 9-12 year olds (10 males) were confirmed to be at risk of DCD (⩽ 16th percentile Movement Assessment Battery for Children-2nd edition (MABC-2) and ⩽ 15th percentile Developmental Coordination Disorder Questionnaire (DCDQ)) and participated in this crossover randomised and controlled trial. Data was collected at study entry, after the first 16 week condition and following the final 16 week condition, including; (1) the MABC-2, (2) three-dimensional motion analysis of single leg balance and finger-nose tasks, and (3) parent perception of physical skills. Participant perception of physical skills was collected only after the first and second conditions. There was no significant difference between AVG and NAG for any of the primary variables including the MABC-2, balance centre-of-mass path distance and finger-nose path distance. There was no significant intervention effect for secondary measures of motor coordination; however the children perceived their motor skills to be significantly enhanced as a result of the AVG intervention in comparison to the period of no intervention. A 16 week home based AVG intervention did not enhance motor skills in children with DCD, although they perceived their physical skills to be significantly improved. Australia and New Zealand Clinical trials Registry (ACTRN 12611000400965
International Nuclear Information System (INIS)
1991-09-01
The Co-ordinated Research Programme (CRP) on ''Labelling, quality control and clinical evaluation of monoclonal antibodies for scintigraphy'' arose from the deliberations at an IAEA Consultants' Meeting (CM) on ''Radiolabelling techniques of monoclonal antibodies'' held in Vienna on 22-24 August 1988. The following is a brief description of the relevant recommendations arising from said meeting. A more detailed description of the proceedings may be found in the summary report issued on 8 December 1989. This report incorporates the results of the first Research Co-ordination Meeting (RCM) of subject CRP held in Kuala Lumpur, Malaysia on 9-13 September 1991. 9 refs
Coordinated Control of a Planar Dual-Crane Non-Fully Restrained System
2008-12-01
Support Over-The-Shore (HSOTS) 2007 in Puerto Quetzal , Guatemala. . . . . . . . . . . . . . 30 Figure 27. Reference frame and coordinate definitions...2007 in Puerto Quetzal , Guatemala. 30 require the construction an inverse of the Jacobian, but rather the transpose only. It is noted that the effector
Attentional Demands on Motor-Respiratory Coordination
Hessler, Eric E.; Amazeen, Polemnia G.
2009-01-01
Athletic performance requires the pacing of breathing with exercise, known as motor-respiratory coordination (MRC). In this study, we added cognitive and physical constraints while participants intentionally controlled their breathing locations during rhythmic arm movement. This is the first study to examine a cognitive constraint on MRC.…
DEFF Research Database (Denmark)
De Chiffre, Leonardo
This document is used in connection with three exercises of 2 hours duration as a part of the course GEOMETRICAL METROLOGY AND MACHINE TESTING. The exercises concern three aspects of coordinate measuring: 1) Measuring and verification of tolerances on coordinate measuring machines, 2) Traceabilit...... and uncertainty during coordinate measurements, 3) Digitalisation and Reverse Engineering. This document contains a short description of each step in the exercise and schemes with room for taking notes of the results.......This document is used in connection with three exercises of 2 hours duration as a part of the course GEOMETRICAL METROLOGY AND MACHINE TESTING. The exercises concern three aspects of coordinate measuring: 1) Measuring and verification of tolerances on coordinate measuring machines, 2) Traceability...
Coordinated Frequency Control of Wind Turbines in Power Systems with High Wind Power Penetration
DEFF Research Database (Denmark)
Tarnowski, Germán Claudio
The integration of large amounts of wind power in power systems presents huge challenges. In particular, with the increase of wind power generation, more regulation reserves would be necessary, the capability of the power system to offer conventional regulating power would be reduced...... particular views. These models were developed and verified during this work, basedaround a particular manufacturer’s wind turbine and on said isolated power system withwind power. The capability of variable speed wind turbines for providing Inertial Response is analysed. To perform this assessment, a control...... generation were studied considering a large share of wind power in the system. Results show the abilities of the architectures to manage the variability of the generated wind power, reducing the impact on the grid frequency and providing suitable frequency regulation service when required. The coordination...
Polyoxometalate coordination induced controllable release of quinolone in hybrid film
Yang, Fan; Li, Yang; Lv, Yu-Guang; Zhou, Shu-Jing; Li, Si; Gao, Guang-Gang; Liu, Hong
2018-05-01
Due to some side effects of quinolones in vivo, it is an urgent issue to extend their new applications in vitro. In this paper, structure-determined vanadium-quinolone functionalized polymolybdates of (NH4)2 [(γ-Mo8O26){VO(CF)2}2] (1) and (NH4)2 [(γ-Mo8O26){VO(NF)2}2] (2) (CF = ciprofloxacin; NF = norfloxacin) have been designed and synthesized. Complex 1 or 2 features a γ-type [Mo8O26]4- polyanion functionalized by two monocapped vanadium-quinolone complexes. Different H-bonds and π···π interactions allow 1 or 2 to form a 2D layered structure at solid state. When complex 1 or 2 is transferred into polyvinyl alcohol (PVA) film, its release rate in solution is lower than that of CF- or NF-PVA film and thus forming a novel quinolone delivery system. This is the first time that slow release effect of quinolone is achieved by polyoxometalate coordination effect. The slow release of 1 or 2 in PVA film is mainly ascribed to the coordination of quinolone with polyoxometalate anions.
Optimal Coordinated Control of Power Extraction in LES of a Wind Farm with Entrance Effects
Directory of Open Access Journals (Sweden)
Jay P. Goit
2016-01-01
Full Text Available We investigate the use of optimal coordinated control techniques in large eddy simulations of wind farm boundary layer interaction with the aim of increasing the total energy extraction in wind farms. The individual wind turbines are considered as flow actuators, and their energy extraction is dynamically regulated in time, so as to optimally influence the flow field. We extend earlier work on wind farm optimal control in the fully-developed regime (Goit and Meyers 2015, J. Fluid Mech. 768, 5–50 to a ‘finite’ wind farm case, in which entrance effects play an important role. For the optimal control, a receding horizon framework is employed in which turbine thrust coefficients are optimized in time and per turbine. Optimization is performed with a conjugate gradient method, where gradients of the cost functional are obtained using adjoint large eddy simulations. Overall, the energy extraction is increased 7% by the optimal control. This increase in energy extraction is related to faster wake recovery throughout the farm. For the first row of turbines, the optimal control increases turbulence levels and Reynolds stresses in the wake, leading to better wake mixing and an inflow velocity for the second row that is significantly higher than in the uncontrolled case. For downstream rows, the optimal control mainly enhances the sideways mean transport of momentum. This is different from earlier observations by Goit and Meyers (2015 in the fully-developed regime, where mainly vertical transport was enhanced.
A Robot-Soccer-Coordination Inspired Control Architecture Applied to Islanded Microgrids
DEFF Research Database (Denmark)
Aldana, Nelson Leonardo Diaz; Guarnizo, Jose Guillermo; Mellado, Martin
2017-01-01
of the energy storage systems, may ensure proper and reliable operation of the microgrid. This paper proposes a structured architecture based on tactics, roles and behaviors for a coordinated operation of islanded microgrids. The architecture is inspired on a robot soccer strategy with global perception...
Co-ordinated traffic control in freeway corridors : A proposed evaluation approach
Hoogendoorn, S.P.; Bovy, P.H.L.; Van der Zijpp, N.J.
1997-01-01
In the course of the Telematics implications Programme Transport of the European Commission Fourth Framework Research Programme much attention is devoted to evaluation and demonstration. This report is part of the DACCORD project TR1017, devoted to the development and application of co-ordinated
Design, synthesis, and characterization of 0-D, 1-D, and 2-D Zinc–Adeninate coordination assemblies
Energy Technology Data Exchange (ETDEWEB)
An, Ji Hyun [Dept. of Chemistry Education, Seoul National University, Seoul (Korea, Republic of); Geib, Steven J. [Dept. of Chemistry, University of Pittsburgh, Pittsburgh (United States); Kim, Myung Gil [Dept. of Chemistry, Chungang University, Seoul (Korea, Republic of)
2015-08-15
In this study, we demonstrate the synthesis and characterization of zinc– adeninate coordination polymers with 0-D, 1-D, and 2-D structures. We describe methods for controlling the structure of these materials by applying different synthetic conditions and discuss their structural relationships. 0-D, 1-D, and 2-D zinc–adeninate coordination polymers with the same metal–adeninate coordination mode were synthesized and characterized. By controlling the temperature, a material with 0-D macrocycle or 1-D chain coordination polymer was prepared. A replacement of pyridine with bipyridine formed 2-D sheet structure by connecting 1-D chains with each other. They exhibited an interesting relationship between synthetic methods and structures. Further study of metal–adeninate coordination chemistry will render a precise control of the structure in synthesis and will open a new venue to new materials with fascinating properties.
Coordinated Control of Multi-Agent Systems in Rapidly Varying Environments, Phase I
National Aeronautics and Space Administration — In this STTR project Scientific Systems Company, Inc. (SSCI) and Brigham Young University (BYU) propose to design, implement, and test an Autonomous Coordinated...
Pediatric Asthma Care Coordination in Underserved Communities: A Quasiexperimental Study.
Janevic, Mary R; Stoll, Shelley; Wilkin, Margaret; Song, Peter X K; Baptist, Alan; Lara, Marielena; Ramos-Valencia, Gilberto; Bryant-Stephens, Tyra; Persky, Victoria; Uyeda, Kimberly; Lesch, Julie Kennedy; Wang, Wen; Malveaux, Floyd J
2016-11-01
To assess the effect of care coordination on asthma outcomes among children in underserved urban communities. We enrolled children, most of whom had very poorly or not well-controlled asthma, in medical-social care coordination programs in Los Angeles, California; Chicago, Illinois; Philadelphia, Pennsylvania; and San Juan, Puerto Rico in 2011 to 2014. Participants (n = 805; mean age = 7 years) were 60% male, 50% African American, and 42% Latino. We assessed asthma symptoms and health care utilization via parent interview at baseline and 12 months. To prevent overestimation of intervention effects, we constructed a comparison group using bootstrap resampling of matched control cases from previous pediatric asthma trials. At follow-up, intervention participants had 2.2 fewer symptom days per month (SD = 0.3; P < .01) and 1.9 fewer symptom nights per month (SD = 0.35; P < .01) than did the comparison group. The relative risk in the past year associated with the intervention was 0.63 (95% confidence interval [CI] = 0.45, 0.89) for an emergency department visit and 0.69 (95% CI = 0.47, 1.01) for hospitalization. Care coordination may improve pediatric asthma symptom control and reduce emergency department visits. Expanding third-party reimbursement for care coordination services may help reduce pediatric asthma disparities.
Comparative eye-tracking evaluation of scatterplots and parallel coordinates
Directory of Open Access Journals (Sweden)
Rudolf Netzel
2017-06-01
Full Text Available We investigate task performance and reading characteristics for scatterplots (Cartesian coordinates and parallel coordinates. In a controlled eye-tracking study, we asked 24 participants to assess the relative distance of points in multidimensional space, depending on the diagram type (parallel coordinates or a horizontal collection of scatterplots, the number of data dimensions (2, 4, 6, or 8, and the relative distance between points (15%, 20%, or 25%. For a given reference point and two target points, we instructed participants to choose the target point that was closer to the reference point in multidimensional space. We present a visual scanning model that describes different strategies to solve this retrieval task for both diagram types, and propose corresponding hypotheses that we test using task completion time, accuracy, and gaze positions as dependent variables. Our results show that scatterplots outperform parallel coordinates significantly in 2 dimensions, however, the task was solved more quickly and more accurately with parallel coordinates in 8 dimensions. The eye-tracking data further shows significant differences between Cartesian and parallel coordinates, as well as between different numbers of dimensions. For parallel coordinates, there is a clear trend toward shorter fixations and longer saccades with increasing number of dimensions. Using an area-of-interest (AOI based approach, we identify different reading strategies for each diagram type: For parallel coordinates, the participants’ gaze frequently jumped back and forth between pairs of axes, while axes were rarely focused on when viewing Cartesian coordinates. We further found that participants’ attention is biased: toward the center of the whole plotfor parallel coordinates and skewed to the center/left side for Cartesian coordinates. We anticipate that these results may support the design of more effective visualizations for multidimensional data.
Learning alternative movement coordination patterns using reinforcement feedback.
Lin, Tzu-Hsiang; Denomme, Amber; Ranganathan, Rajiv
2018-05-01
One of the characteristic features of the human motor system is redundancy-i.e., the ability to achieve a given task outcome using multiple coordination patterns. However, once participants settle on using a specific coordination pattern, the process of learning to use a new alternative coordination pattern to perform the same task is still poorly understood. Here, using two experiments, we examined this process of how participants shift from one coordination pattern to another using different reinforcement schedules. Participants performed a virtual reaching task, where they moved a cursor to different targets positioned on the screen. Our goal was to make participants use a coordination pattern with greater trunk motion, and to this end, we provided reinforcement by making the cursor disappear if the trunk motion during the reach did not cross a specified threshold value. In Experiment 1, we compared two reinforcement schedules in two groups of participants-an abrupt group, where the threshold was introduced immediately at the beginning of practice; and a gradual group, where the threshold was introduced gradually with practice. Results showed that both abrupt and gradual groups were effective in shifting their coordination patterns to involve greater trunk motion, but the abrupt group showed greater retention when the reinforcement was removed. In Experiment 2, we examined the basis of this advantage in the abrupt group using two additional control groups. Results showed that the advantage of the abrupt group was because of a greater number of practice trials with the desired coordination pattern. Overall, these results show that reinforcement can be successfully used to shift coordination patterns, which has potential in the rehabilitation of movement disorders.
Impaired Visual Motor Coordination in Obese Adults.
LENUS (Irish Health Repository)
Gaul, David
2016-09-01
Objective. To investigate whether obesity alters the sensory motor integration process and movement outcome during a visual rhythmic coordination task. Methods. 88 participants (44 obese and 44 matched control) sat on a chair equipped with a wrist pendulum oscillating in the sagittal plane. The task was to swing the pendulum in synchrony with a moving visual stimulus displayed on a screen. Results. Obese participants demonstrated significantly (p < 0.01) higher values for continuous relative phase (CRP) indicating poorer level of coordination, increased movement variability (p < 0.05), and a larger amplitude (p < 0.05) than their healthy weight counterparts. Conclusion. These results highlight the existence of visual sensory integration deficiencies for obese participants. The obese group have greater difficulty in synchronizing their movement with a visual stimulus. Considering that visual motor coordination is an essential component of many activities of daily living, any impairment could significantly affect quality of life.
Coordinated School Health and the Contribution of a District Wellness Coordinator
Westrich, Lisa; Sanchez, Monika; Strobel, Karen
2015-01-01
Background: A San Francisco Bay Area school health initiative was established in fall 2010 to improve wellness programs in 4 local school districts using the Coordinated School Health (CSH) model. This study examines the role of district-wide wellness coordinators and the ways in which they contribute to intentional coordination of health and…
Balance Training Enhances Motor Coordination During a Perturbed Sidestep Cutting Task.
Oliveira, Anderson Souza; Silva, Priscila Brito; Lund, Morten Enemark; Farina, Dario; Kersting, Uwe Gustav
2017-11-01
Study Design Controlled laboratory study. Background Balance training may improve motor coordination. However, little is known about the changes in motor coordination during unexpected perturbations to postural control following balance training. Objectives To study the effects of balance training on motor coordination and knee mechanics during perturbed sidestep cutting maneuvers in healthy adults. Methods Twenty-six healthy men were randomly assigned to a training group or a control group. Before balance training, subjects performed unperturbed, 90° sidestep cutting maneuvers and 1 unexpected perturbed cut (10-cm translation of a movable platform). Participants in the training group participated in a 6-week balance training program, while those in the control group followed their regular activity schedule. Both groups were retested after a 6-week period. Surface electromyography was recorded from 16 muscles of the supporting limb and trunk, as well as kinematics and ground reaction forces. Motor modules were extracted from electromyography by nonnegative matrix factorization. External knee abduction moments were calculated using inverse dynamics equations. Results Balance training reduced the external knee abduction moment (33% ± 25%, PBalance training also increased burst duration for the motor module related to landing early in the perturbation phase (23% ± 11%, PBalance training resulted in altered motor coordination and a reduction in knee abduction moment during an unexpected perturbation. The previously reported reduction in injury incidence following balance training may be linked to changes in dynamic postural stability and modular neuromuscular control. J Orthop Sports Phys Ther 2017;47(11):853-862. Epub 23 Sep 2017. doi:10.2519/jospt.2017.6980.
Stability of Phase Relationships While Coordinating Arm Reaches with Whole Body Motion.
Directory of Open Access Journals (Sweden)
Romy S Bakker
Full Text Available The human movement repertoire is characterized by the smooth coordination of several body parts, including arm movements and whole body motion. The neural control of this coordination is quite complex because the various body parts have their own kinematic and dynamic properties. Behavioral inferences about the neural solution to the coordination problem could be obtained by examining the emerging phase relationship and its stability. Here, we studied the phase relationships that characterize the coordination of arm-reaching movements with passively-induced whole-body motion. Participants were laterally translated using a vestibular chair that oscillated at a fixed frequency of 0.83 Hz. They were instructed to reach between two targets that were aligned either parallel or orthogonal to the whole body motion. During the first cycles of body motion, a metronome entrained either an in-phase or an anti-phase relationship between hand and body motion, which was released at later cycles to test phase stability. Results suggest that inertial forces play an important role when coordinating reaches with cyclic whole-body motion. For parallel reaches, we found a stable in-phase and an unstable anti-phase relationship. When the latter was imposed, it readily transitioned or drifted back toward an in-phase relationship at cycles without metronomic entrainment. For orthogonal reaches, we did not find a clear difference in stability between in-phase and anti-phase relationships. Computer simulations further show that cost models that minimize energy expenditure (i.e. net torques or endpoint variance of the reach cannot fully explain the observed coordination patterns. We discuss how predictive control and impedance control processes could be considered important mechanisms underlying the rhythmic coordination of arm reaches and body motion.
Designs for thermal harvesting with nonlinear coordinate transformation
Ji, Qingxiang; Fang, Guodong; Liang, Jun
2018-04-01
In this paper a thermal concentrating design method was proposed based on the concept of generating function without knowing the needed coordinate transformation beforehand. The thermal harvesting performance was quantitatively characterized by heat concentrating efficiency and external temperature perturbation. Nonlinear transformations of different forms were employed to design high order thermal concentrators, and corresponding harvesting performances were investigated by numerical simulations. The numerical results shows that the form of coordinate transformation directly influences the distributions of heat flows inside the concentrator, consequently, influences the thermal harvesting behaviors significantly. The concentrating performance can be actively controlled and optimized by changing the form of coordinate transformations. The analysis in this paper offers a beneficial method to flexibly tune the harvesting performance of the thermal concentrator according to the requirements of practical applications.
Jeong, Nak Cheon; Samanta, Bappaditya; Lee, Chang Yeon; Farha, Omar K; Hupp, Joseph T
2012-01-11
HKUST-1, a metal-organic framework (MOF) material containing Cu(II)-paddlewheel-type nodes and 1,3,5-benzenetricarboxylate struts, features accessible Cu(II) sites to which solvent or other desired molecules can be intentionally coordinated. As part of a broader investigation of ionic conductivity in MOFs, we unexpectedly observed substantial proton conductivity with the "as synthesized" version of this material following sorption of methanol. Although HKUST-1 is neutral, coordinated water molecules are rendered sufficiently acidic by Cu(II) to contribute protons to pore-filling methanol molecules and thereby enhance the alternating-current conductivity. At ambient temperature, the chemical identities of the node-coordinated and pore-filling molecules can be independently varied, thus enabling the proton conductivity to be reversibly modulated. The proton conductivity of HKUST-1 was observed to increase by ~75-fold, for example, when node-coordinated acetonitrile molecules were replaced by water molecules. In contrast, the conductivity became almost immeasurably small when methanol was replaced by hexane as the pore-filling solvent. © 2011 American Chemical Society
Directory of Open Access Journals (Sweden)
E. N. Dotsenko
2013-08-01
Full Text Available Purpose. To analyze the problem of motor abilities development and health of students of special medical group in the process of physical education in technical universities. Determine the major factors, characteristics, and the relationship of physical development, physical fitness and coordination abilities of female students in special medical group. Establish regularities in precise movements mastering of different coordination structure and develop model characteristics of the relationship of coordination abilities and motor characteristics of students in special medical group. To substantiate and verify efficiency of coordination abilities development method of female students with regard to their functional status in the course of physical education in higher school. Methodology. Theoretical and methodological argument, characteristic of the experimental program in physical education teaching process of students in special medical group was shown. Findings. Research is to develop the training content in special medical groups with the use of coordinating elements and exercises to enhance the motor abilities of female students. Their influence on the level of physical development, functional training, as well as regularities in mastering and movement control of different coordinating structure at the female students of special medical group was studied. The comparative characteristic of female students athletic ability in the dynamics of the educational process, differentiated into groups according to nosology was presented. The criterion of spare capacities upgrade of the motor system in controlling the movements of different coordination structure was determined. Originality. The method of coordination abilities development of female students in special medical group, that aims on the formation and correction of motor control system of different coordination structure, a sense of body position and its individual parts in space, improving
Two-Stage Electric Vehicle Charging Coordination in Low Voltage Distribution Grids
DEFF Research Database (Denmark)
Bhattarai, Bishnu Prasad; Bak-Jensen, Birgitte; Pillai, Jayakrishnan Radhakrishna
2014-01-01
). Being a sizable rated element, electric vehicles (EVs) can offer a great deal of demand flexibility in future intelligent grids. This paper first investigates and analyzes driving pattern and charging requirements of EVs. Secondly, a two-stage charging algorithm, namely local adaptive control...... encompassed by a central coordinative control, is proposed to realize the flexibility offered by EV. The local control enables adaptive charging; whereas the central coordinative control prepares optimized charging schedules. Results from various scenarios show that the proposed algorithm enables significant......Increased environmental awareness in the recent years has encouraged rapid growth of renewable energy sources (RESs); especially solar PV and wind. One of the effective solutions to compensate intermittencies in generation from the RESs is to enable consumer participation in demand response (DR...
Coordinate transformations and matter waves cloaking
International Nuclear Information System (INIS)
Mohammadi, G.R.; Moghaddam, A.G.; Mohammadkhani, R.
2016-01-01
Transformation method provides an efficient tool to control wave propagation inside the materials. Using the coordinate transformation approach, we study invisibility cloaks with sphere, cylinder and ellipsoid structures for electronic waves propagation. The underlying physics behind this investigation is the fact that Schrödinger equation with position dependent mass tensor and potentials has a covariant form which follows the coordinate transformation. Using this technique we obtain the exact spatial form of the mass tensor and potentials for a variety of cloaks with different shapes. - Highlights: • Invisibility cloaks for matter waves with three different geometries. • Exact analytical form of the effective mass tensor and potential. • Analogy between cloaking for quantum mechanical waves with classical electromagnetic waves. • Possible experimental realization in engineered semiconducting structures.
Rand, Miya K; Shimansky, Yury P
2013-03-01
A quantitative model of optimal transport-aperture coordination (TAC) during reach-to-grasp movements has been developed in our previous studies. The utilization of that model for data analysis allowed, for the first time, to examine the phase dependence of the precision demand specified by the CNS for neurocomputational information processing during an ongoing movement. It was shown that the CNS utilizes a two-phase strategy for movement control. That strategy consists of reducing the precision demand for neural computations during the initial phase, which decreases the cost of information processing at the expense of lower extent of control optimality. To successfully grasp the target object, the CNS increases precision demand during the final phase, resulting in higher extent of control optimality. In the present study, we generalized the model of optimal TAC to a model of optimal coordination between X and Y components of point-to-point planar movements (XYC). We investigated whether the CNS uses the two-phase control strategy for controlling those movements, and how the strategy parameters depend on the prescribed movement speed, movement amplitude and the size of the target area. The results indeed revealed a substantial similarity between the CNS's regulation of TAC and XYC. First, the variability of XYC within individual trials was minimal, meaning that execution noise during the movement was insignificant. Second, the inter-trial variability of XYC was considerable during the majority of the movement time, meaning that the precision demand for information processing was lowered, which is characteristic for the initial phase. That variability significantly decreased, indicating higher extent of control optimality, during the shorter final movement phase. The final phase was the longest (shortest) under the most (least) challenging combination of speed and accuracy requirements, fully consistent with the concept of the two-phase control strategy. This paper
Kitazono, Tomohiro; Hara-Kuge, Sayuri; Matsuda, Osamu; Inoue, Akitoshi; Fujiwara, Manabi; Ishihara, Takeshi
2017-10-18
Forgetting memories is important for animals to properly respond to continuously changing environments. To elucidate the mechanisms of forgetting, we used one of the behavioral plasticities of Caenorhabditis elegans hermaphrodite, olfactory adaptation to an attractive odorant, diacetyl, as a simple model of learning. In C. elegans, the TIR-1/JNK-1 pathway accelerates forgetting of olfactory adaptation by facilitating neural secretion from AWC sensory neurons. In this study, to identify the downstream effectors of the TIR-1/JNK-1 pathway, we conducted a genetic screen for suppressors of the gain-of-function mutant of tir-1 ( ok1052 ), which shows excessive forgetting. Our screening showed that three proteins-a membrane protein, MACO-1; a receptor tyrosine kinase, SCD-2; and its putative ligand, HEN-1-regulated forgetting downstream of the TIR-1/JNK-1 pathway. We further demonstrated that MACO-1 and SCD-2/HEN-1 functioned in parallel genetic pathways, and only MACO-1 regulated forgetting of olfactory adaptation to isoamyl alcohol, which is an attractive odorant sensed by different types of sensory neurons. In olfactory adaptation, odor-evoked Ca 2+ responses in olfactory neurons are attenuated by conditioning and recovered thereafter. A Ca 2+ imaging study revealed that this attenuation is sustained longer in maco-1 and scd-2 mutant animals than in wild-type animals like the TIR-1/JNK-1 pathway mutants. Furthermore, temporal silencing by histamine-gated chloride channels revealed that the neuronal activity of AWC neurons after conditioning is important for proper forgetting. We propose that distinct signaling pathways, each of which has a specific function, may coordinately and temporally regulate forgetting by controlling sensory responses. SIGNIFICANCE STATEMENT Active forgetting is an important process to understand the whole mechanisms of memories. Recent papers have reported that the noncell autonomous regulations are required for proper forgetting in
Noe, Frank
To efficiently simulate and generate understanding from simulations of complex macromolecular systems, the concept of slow collective coordinates or reaction coordinates is of fundamental importance. Here we will introduce variational approaches to approximate the slow coordinates and the reaction coordinates between selected end-states given MD simulations of the macromolecular system and a (possibly large) basis set of candidate coordinates. We will then discuss how to select physically intuitive order paremeters that are good surrogates of this variationally optimal result. These result can be used in order to construct Markov state models or other models of the stationary and kinetics properties, in order to parametrize low-dimensional / coarse-grained model of the dynamics. Deutsche Forschungsgemeinschaft, European Research Council.
Improving Information Exchange and Coordination Amongst Homeland Security Organizations
National Research Council Canada - National Science Library
Goan, Terrance; Mayk, Israel
2005-01-01
Command and Control for coordinated response to domestic terrorist attack will require the ability of Federal, state, and local agencies to maintain awareness of the status, capabilities, requirements...
Directory of Open Access Journals (Sweden)
Petarpa Boonserm
2018-05-01
Full Text Available Geodesics (by definition have an intrinsic 4-acceleration zero. However, when expressed in terms of coordinates, the coordinate acceleration d 2 x i / d t 2 can very easily be non-zero, and the coordinate velocity d x i / d t can behave unexpectedly. The situation becomes extremely delicate in the near-horizon limit—for both astrophysical and idealised black holes—where an inappropriate choice of coordinates can quite easily lead to significant confusion. We shall carefully explore the relative merits of horizon-penetrating versus horizon-non-penetrating coordinates, arguing that in the near-horizon limit the coordinate acceleration d 2 x i / d t 2 is best interpreted in terms of horizon-penetrating coordinates.
Investigation of a coupling model of coordination between urbanization and the environment.
Li, Yangfan; Li, Yi; Zhou, Yan; Shi, Yalou; Zhu, Xiaodong
2012-05-15
China's coastal cities are experiencing rapid urbanization, which has resulted in many challenges. This paper presents a comprehensive index system for assessment of the level of urbanization based on four aspects: demographic urbanization, economic urbanization, social urbanization and spatial urbanization. The developed index system also characterizes the environment based on three factors: environmental pressure, environmental level and environmental control. Furthermore, a coupling coordination degree model (CCDM) focusing on the degree of coordination between urbanization and the environment was established using panel data collected from 2000 to 2008 for Lianyungang, China. The results showed that: (1) the dynamic of coordination between urbanization and the environment showed a U-shaped curve, and both sub-systems evolved into a superior balance during rapid urbanization; (2) social urbanization and environmental control make the greatest contribution to the coupling system, indicating that they are the critical factors to consider when adjusting coordination development during decision-making; and (3) the two parameters (α-urbanization, β-environment) that have been widely used in previous studies had less of an effect on the coupling coordinated system than the other factors considered herein. Copyright © 2012 Elsevier Ltd. All rights reserved.
John G. Michopoulos; Tomonari Furukawa; John C. Hermanson; Samuel G. Lambrakos
2011-01-01
The goal of this paper is to propose and demonstrate a multi level design optimization approach for the coordinated determination of a material constitutive model synchronously to the design of the experimental procedure needed to acquire the necessary data. The methodology achieves both online (real-time) and offline design of optimum experiments required for...
Coordination of two robot manipulators based on position measurements only
Rodriguez Angeles, A.; Nijmeijer, H.
2001-01-01
In this note we propose a controller that solves the problem of coordination of two (or more) robots, under a master-slave scheme, in the case when only position measurements are available. The controller consists of a feedback control law, and two non-linear observers. It is shown that the
International Nuclear Information System (INIS)
Tfouni, E.; Giesbrecht, E.
1983-01-01
The coordination or not of the perchlorate anions in the previously reported Ln(CLO 4 ) 3 .6 dmba is discussed. The analysis of the infrared spectral data and molar conductance data indicate that they may be formulated as [Ln(dmba) 6 (CLO 4 )n] (CLO 4 ) sub(3-n), n=0,1,2. The individual compounds may be a mixture of species with different n values and/or pure compounds with semi-coordinated and non-coordinated perchlorates. (Author) [pt
Laundal, K. M.; Richmond, A. D.
2017-03-01
Geospace phenomena such as the aurora, plasma motion, ionospheric currents and associated magnetic field disturbances are highly organized by Earth's main magnetic field. This is due to the fact that the charged particles that comprise space plasma can move almost freely along magnetic field lines, but not across them. For this reason it is sensible to present such phenomena relative to Earth's magnetic field. A large variety of magnetic coordinate systems exist, designed for different purposes and regions, ranging from the magnetopause to the ionosphere. In this paper we review the most common magnetic coordinate systems and describe how they are defined, where they are used, and how to convert between them. The definitions are presented based on the spherical harmonic expansion coefficients of the International Geomagnetic Reference Field (IGRF) and, in some of the coordinate systems, the position of the Sun which we show how to calculate from the time and date. The most detailed coordinate systems take the full IGRF into account and define magnetic latitude and longitude such that they are constant along field lines. These coordinate systems, which are useful at ionospheric altitudes, are non-orthogonal. We show how to handle vectors and vector calculus in such coordinates, and discuss how systematic errors may appear if this is not done correctly.
Dynamic Routing and Coordination in Multi-Agent Networks
2016-06-10
epidemics spreading . Bibliography (J1) F. Pasqualetti, S. Zampieri, and F. Bullo. Controllability metrics, limitations and algorithms for complex networks ...controllability properties of the clusters and on their coupling strength. We validate our results with examples from power networks , social networks , and...SECURITY CLASSIFICATION OF: Supported by this project, we designed innovative routing, planning and coordination strategies for robotic networks and
Niu, Xiaoliang; Yuan, Fen; Huang, Shanguo; Guo, Bingli; Gu, Wanyi
2011-12-01
A Dynamic clustering scheme based on coordination of management and control is proposed to reduce network congestion rate and improve the blocking performance of hierarchical routing in Multi-layer and Multi-region intelligent optical network. Its implement relies on mobile agent (MA) technology, which has the advantages of efficiency, flexibility, functional and scalability. The paper's major contribution is to adjust dynamically domain when the performance of working network isn't in ideal status. And the incorporation of centralized NMS and distributed MA control technology migrate computing process to control plane node which releases the burden of NMS and improves process efficiently. Experiments are conducted on Multi-layer and multi-region Simulation Platform for Optical Network (MSPON) to assess the performance of the scheme.
Motor coordination uses external spatial coordinates independent of developmental vision.
Heed, Tobias; Röder, Brigitte
2014-07-01
The constraints that guide bimanual movement coordination are informative about the processing principles underlying movement planning in humans. For example, symmetry relative to the body midline benefits finger and hand movements independent of hand posture. This symmetry constraint has been interpreted to indicate that movement coordination is guided by a perceptual code. Although it has been assumed implicitly that the perceptual system at the heart of this constraint is vision, this relationship has not been tested. Here, congenitally blind and sighted participants made symmetrical and non-symmetrical (that is, parallel) bimanual tapping and finger oscillation movements. For both groups, symmetrical movements were executed more correctly than parallel movements, independent of anatomical constraints like finger homology and hand posture. For the blind, the reliance on external spatial factors in movement coordination stands in stark contrast to their use of an anatomical reference frame in perceptual processing. Thus, the externally coded symmetry constraint evident in bimanual coordination can develop in the absence of the visual system, suggesting that the visual system is not critical for the establishment of an external-spatial reference frame in movement coordination. Copyright © 2014 Elsevier B.V. All rights reserved.
The Influence of Setting on Care Coordination for Childhood Asthma
Kelly, R. Patrick; Stoll, Shelley C.; Bryant-Stephens, Tyra; Janevic, Mary R.; Lara, Marielena; Ohadike, Yvonne U.; Persky, Victoria; Ramos-Valencia, Gilberto; Uyeda, Kimberly; Malveaux, Floyd J.
2015-01-01
Asthma affects 7.1 million children in the United States, disproportionately burdening African American and Latino children. Barriers to asthma control include insufficient patient education and fragmented care. Care coordination represents a compelling approach to improve quality of care and address disparities in asthma. The sites of The Merck Childhood Asthma Network Care Coordination Programs implemented different models of care coordination to suit specific settings—school district, clinic or health care system, and community—and organizational structures. A variety of qualitative data sources were analyzed to determine the role setting played in the manifestation of care coordination at each site. There were inherent strengths and challenges of implementing care coordination in each of the settings, and each site used unique strategies to deliver their programs. The relationship between the lead implementing unit and entities that provided (1) access to the priority population and (2) clinical services to program participants played a critical role in the structure of the programs. The level of support and infrastructure provided by these entities to the lead implementing unit influenced how participants were identified and how asthma care coordinators were integrated into the clinical care team. PMID:26232778
Vidal, Anthony; Wu, Will; Nakajima, Mimi; Becker, James
2017-09-19
The purpose of this study was to examine the effects of focus of attention cues on movement coordination and coordination variability in the lower extremity. Twenty participants performed the standing long jump under both internal and external focus of attention conditions. A modified vector coding technique was used to evaluate the influence of attentional focus cues on lower extremity coordination patterns and coordination variability during the jumps. Participants jumped significantly further under an external focus of attention condition compared with an internal focus of attention condition (p = .035, effect size = .29). Focus of attention also influenced coordination between the ankle and knee, F(6, 19) = 2.87, p = .012, effect size = .388, with participants primarily using their knees under the internal focus of attention, and using both their ankles and knees under the external focus of attention. Attentional focus cues did not influence ankle-knee, F(1, 19) = 0.02, p = .98, effect size = .02, or hip-knee, F(1, 19) = 5.00, p = .49, effect size = .16, coordination variability. Results suggest that while attentional focus may not directly influence movement coordination condition, there is still a change in movement strategy resulting in greater jump distances following an external focus of attention.
IAEA co-ordinated technical support programme to the NIS
International Nuclear Information System (INIS)
Olsen, R.; Murakami, K.; Blacker, C.; Sharma, S.K.
1999-01-01
With most Newly Independent States (NIS) of the former Soviet Union becoming parties to the Non-Proliferation Treaty as Non-Nuclear Weapon States, there has been an acute need in these states for considerable assistance for the establishment of the necessary structure and resources to ensure that their commitments to non-proliferation are fully implemented in a timely manner. A number of IAEA Member States have offered and are now providing assistance to the NIS on a bilateral level to set up an appropriate State System of Accounting and Control (SSAC) which includes Import/Export Control and Physical Protection of Nuclear Material in each state. The IAEA and these Member States established the Co-ordinated Technical Support Programme (CTSP) to ensure that the support given to the NIS was done in a co-ordinated and transparent manner and to avoid duplication of effort. The IAEA has played a coordinating role for the past 5 years by helping to identify detailed needs in individual States, by providing a platform for Member States to identify areas where they could provide the optimum support, and in developing and preparing the Co-ordinated Technical Support Plans. The IAEA organises annual meetings in Vienna attended by all donor and recipient countries to review the focus and implementation status of the co-ordinated technical support activities. A position statement is made by each donor and recipient country, and views and experiences are exchanged. The contents of the CTSPs and the role of the Agency in monitoring the progress of the individual tasks are reviewed in this paper. A summary comparing the implementation status of the Programme by each country is presented. (author)
Distributed formation tracking using local coordinate systems
DEFF Research Database (Denmark)
Yang, Qingkai; Cao, Ming; Garcia de Marina, Hector
2018-01-01
This paper studies the formation tracking problem for multi-agent systems, for which a distributed estimator–controller scheme is designed relying only on the agents’ local coordinate systems such that the centroid of the controlled formation tracks a given trajectory. By introducing a gradient...... descent term into the estimator, the explicit knowledge of the bound of the agents’ speed is not necessary in contrast to existing works, and each agent is able to compute the centroid of the whole formation in finite time. Then, based on the centroid estimation, a distributed control algorithm...
Rafique, Sara A; Northway, Nadia
2015-08-01
Ocular accommodation provides a well-focussed image, feedback for accurate eye movement control, and cues for depth perception. To accurately perform visually guided motor tasks, integration of ocular motor systems is essential. Children with motor coordination impairment are established to be at higher risk of accommodation anomalies. The aim of the present study was to examine the relationship between ocular accommodation and motor tasks, which are often overlooked, in order to better understand the problems experienced by children with motor coordination impairment. Visual function, gross and fine motor skills were assessed in children with developmental coordination disorder (DCD) and typically developing control children. Children with DCD had significantly poorer accommodation facility and amplitude dynamics compared to controls. Results indicate a relationship between impaired accommodation and motor skills. Specifically, accommodation anomalies correlated with visual motor, upper limb and fine dexterity task performance. Consequently, we argue accommodation anomalies influence the ineffective coordination of action and perception in DCD. Furthermore, reading disabilities were related to poorer motor performance. We postulate the role of the fastigial nucleus as a common pathway for accommodation and motor deficits. Implications of the findings and recommended visual screening protocols are discussed. Copyright © 2015 Elsevier B.V. All rights reserved.
Experimental substantiation of methodic of 11-13 years old boxers’ coordination development
Directory of Open Access Journals (Sweden)
Yong Qiang Liu
2015-06-01
Full Text Available Purpose: experimental substantiation of methodic of junior boxers’ coordination training. Material: in the research 18 boxers of 11-13 year old age participated. In total, during 4 months 42 trainings were conducted. Total time of coordination load’s fulfillment at each training was 15-45 minutes. Results: dynamic of results in control tests was statistically confident in the tested parameters of movements. It proves effectiveness of usage the tasks with complex-coordination orientation, accented on impact on sensor-informational and motor systems of movements in junior boxers’ trainings. Conclusions: coordination training in boxing at initial stage shall include specialized varied means and methods, which would facilitate formation of motor condition and skills’ basis. Motor condition and skills are a reserve for further rising of coordination abilities’ level of junior sportsmen.
Encoding of coordination complexes with XML.
Vinoth, P; Sankar, P
2017-09-01
An in-silico system to encode structure, bonding and properties of coordination complexes is developed. The encoding is achieved through a semantic XML markup frame. Composition of the coordination complexes is captured in terms of central atom and ligands. Structural information of central atom is detailed in terms of electron status of valence electron orbitals. The ligands are encoded with specific reference to the electron environment of ligand centre atoms. Behaviour of ligands to form low or high spin complexes is accomplished by assigning a Ligand Centre Value to every ligand based on the electronic environment of ligand centre atom. Chemical ontologies are used for categorization purpose and to control different hybridization schemes. Complexes formed by the central atoms of transition metal, non-transition elements belonging to s-block, p-block and f-block are encoded with a generic encoding platform. Complexes of homoleptic, heteroleptic and bridged types are also covered by this encoding system. Utility of the encoded system to predict redox electron transfer reaction in the coordination complexes is demonstrated with a simple application. Copyright © 2017 Elsevier Inc. All rights reserved.
Email for the coordination of healthcare appointments and attendance reminders.
Atherton, Helen; Sawmynaden, Prescilla; Meyer, Barbara; Car, Josip
2012-08-15
Email is a popular and commonly-used method of communication, but its use in health care is not routine. Where email communication has been utilised in health care, its purposes have included the coordination of healthcare appointments and attendance reminders, but the effects of using email in this way are not known. This review considers the use of email for the coordination of healthcare appointments and reminders for attendance; particularly scheduling, rescheduling and cancelling healthcare appointments, and providing prompts/reminders for attendance at appointments. To assess the effects of using email for the coordination of healthcare appointments and attendance reminders, compared to other forms of coordinating appointments and reminders, on outcomes for health professionals, patients and carers, and health services, including harms. We searched: the Cochrane Consumers and Communication Review Group Specialised Register, the Cochrane Central Register of Controlled Trials (CENTRAL, The Cochrane Library, Issue 1 2010), MEDLINE (OvidSP) (1950 to January 2010), EMBASE (OvidSP) (1980 to January 2010), PsycINFO (OvidSP) (1967 to January 2010), CINAHL (EbscoHOST) (1982 to February 2010),and ERIC (CSA) (1965 to January 2010). We searched grey literature: theses/dissertation repositories, trials registers and Google Scholar (searched July 2010). We used additional search methods: examining reference lists and contacting authors. Randomised controlled trials, quasi-randomised trials, controlled before and after studies and interrupted time series studies of interventions that use email for scheduling health appointments, for reminders for a scheduled health appointment or for ongoing coordination of health appointments and that took the form of 1) unsecured email 2) secure email or 3) web messaging. All healthcare professionals, patients and caregivers in all settings were considered. Two review authors independently assessed the titles and abstracts of retrieved
Architecture for novel energy infrastructures. Multi-agent based coordination patterns
International Nuclear Information System (INIS)
Kamphuis, I.G.; Kok, J.K.; Warmer, C.J.; Hommelberg, M.P.F.
2009-01-01
Due to the increased proportion of small renewable energy sources in a distributed setting (DG-RES), active control of small distributed energy producing and consuming systems will play an important role in future electricity grids. These distributed energy resources have production patterns, which are either partially stochastic (e.g. wind, solar cells) or are coupled to the primary user process (e.g. co-generation of heat and electricity). Furthermore, on the demand-side, and increasingly on the electricity storage side, opportunities exist for actively serving stability applications in the grid by real-time supply/demand coordination. In the future, an information and communication layer for grid coordination could serve a portfolio of ICT-applications on timescales running from seconds to hours. To get a grip on these (r)evolutionary developments, possibly toppling the electricity grid, in this paper, architecture requirements for future high proportion DG-RES electricity grids are collected from a Power Electronics System point of view as well as from an ICT point of view using an inventory of business models in the power grid that focus on coordination of multiple small-scale DG-RES resources. Modeled from an ICT point-of-view, these give rise to architectures for applications that can successively be implemented in hardware and software as active components in the distribution grid. A number of possible grid control strategy coordination patterns (GCPs), which are defined in a generic, reusable manner, can be seen to emerge. GCPs, connected and intertwined to one another on several layers (physical, commercial) of the grid, together, can provide the framework for coordination in the overall intelligent grid. Bottom-up approaches of implementing coordination in future active grids appear to be the method of choice to use in implementing the GCPs. Software agents coordinating primary processes using market algorithms, as implemented in the Power
Halliwell, George R.
Vertical coordinate and vertical mixing algorithms included in the HYbrid Coordinate Ocean Model (HYCOM) are evaluated in low-resolution climatological simulations of the Atlantic Ocean. The hybrid vertical coordinates are isopycnic in the deep ocean interior, but smoothly transition to level (pressure) coordinates near the ocean surface, to sigma coordinates in shallow water regions, and back again to level coordinates in very shallow water. By comparing simulations to climatology, the best model performance is realized using hybrid coordinates in conjunction with one of the three available differential vertical mixing models: the nonlocal K-Profile Parameterization, the NASA GISS level 2 turbulence closure, and the Mellor-Yamada level 2.5 turbulence closure. Good performance is also achieved using the quasi-slab Price-Weller-Pinkel dynamical instability model. Differences among these simulations are too small relative to other errors and biases to identify the "best" vertical mixing model for low-resolution climate simulations. Model performance deteriorates slightly when the Kraus-Turner slab mixed layer model is used with hybrid coordinates. This deterioration is smallest when solar radiation penetrates beneath the mixed layer and when shear instability mixing is included. A simulation performed using isopycnic coordinates to emulate the Miami Isopycnic Coordinate Ocean Model (MICOM), which uses Kraus-Turner mixing without penetrating shortwave radiation and shear instability mixing, demonstrates that the advantages of switching from isopycnic to hybrid coordinates and including more sophisticated turbulence closures outweigh the negative numerical effects of maintaining hybrid vertical coordinates.
Coordinated control for low voltage ride-through of a PMSG-based wind power plant
Directory of Open Access Journals (Sweden)
Khagendra Thapa
2016-01-01
Full Text Available Wind turbine generators should be kept connected to a power grid, while supporting the voltage recovery in the case of a grid fault to meet low voltage ride-through requirement in some grid codes. This paper proposes a coordinated control scheme that prevents the increase in the DC-link voltage by reducing the active power in the machine side converter of permanent magnet synchronous generators (PMSGs in proportion to the voltage dip at the terminal of PMSGs. The proposed scheme changes the current priorities from the active current to the reactive current to inject more reactive power for a severe fault depending on the voltage dip. In addition, the grid-side converter operates in a voltage control mode with the slope, which is the ratio of reactive current capability to the voltage tolerance around a rated value. Moreover, during the fault, the slope is changed depending on the voltage dip to inject more reactive current. The performance of the proposed scheme is validated for a wind power plant consisting of 20 units of 5-MW PMSGs using an EMTP-RV simulator. The results demonstrate that the scheme enables the PMSGs not only to survive during the fault, but also to provide a dynamic reactive power support.
Directory of Open Access Journals (Sweden)
Lingguo Kong
2015-01-01
Full Text Available An AC-linked large scale wind/photovoltaic (PV/energy storage (ES hybrid energy conversion system for grid-connected application was proposed in this paper. Wind energy conversion system (WECS and PV generation system are the primary power sources of the hybrid system. The ES system, including battery and fuel cell (FC, is used as a backup and a power regulation unit to ensure continuous power supply and to take care of the intermittent nature of wind and photovoltaic resources. Static synchronous compensator (STATCOM is employed to support the AC-linked bus voltage and improve low voltage ride through (LVRT capability of the proposed system. An overall power coordinated control strategy is designed to manage real-power and reactive-power flows among the different energy sources, the storage unit, and the STATCOM system in the hybrid system. A simulation case study carried out on Western System Coordinating Council (WSCC 3-machine 9-bus test system for the large scale hybrid energy conversion system has been developed using the DIgSILENT/Power Factory software platform. The hybrid system performance under different scenarios has been verified by simulation studies using practical load demand profiles and real weather data.
Imidazole and Triazole Coordination Chemistry for Antifouling Coatings
Directory of Open Access Journals (Sweden)
Markus Andersson Trojer
2013-01-01
Full Text Available Fouling of marine organisms on the hulls of ships is a severe problem for the shipping industry. Many antifouling agents are based on five-membered nitrogen heterocyclic compounds, in particular imidazoles and triazoles. Moreover, imidazole and triazoles are strong ligands for Cu2+ and Cu+, which are both potent antifouling agents. In this review, we summarize a decade of work within our groups concerning imidazole and triazole coordination chemistry for antifouling applications with a particular focus on the very potent antifouling agent medetomidine. The entry starts by providing a detailed theoretical description of the azole-metal coordination chemistry. Some attention will be given to ways to functionalize polymers with azole ligands. Then, the effect of metal coordination in azole-containing polymers with respect to material properties will be discussed. Our work concerning the controlled release of antifouling agents, in particular medetomidine, using azole coordination chemistry will be reviewed. Finally, an outlook will be given describing the potential for tailoring the azole ligand chemistry in polymers with respect to Cu2+ adsorption and Cu2+→Cu+ reduction for antifouling coatings without added biocides.
2010-07-21
... DEPARTMENT OF HEALTH AND HUMAN SERVICES Centers for Disease Control and Prevention Board of Scientific Counselors, Coordinating Office for Terrorism Preparedness and Emergency Response; Notice of..., 1972, that the Board of Scientific Counselors, Coordinating Office for Terrorism Preparedness and...
Explicitly computing geodetic coordinates from Cartesian coordinates
Zeng, Huaien
2013-04-01
This paper presents a new form of quartic equation based on Lagrange's extremum law and a Groebner basis under the constraint that the geodetic height is the shortest distance between a given point and the reference ellipsoid. A very explicit and concise formulae of the quartic equation by Ferrari's line is found, which avoids the need of a good starting guess for iterative methods. A new explicit algorithm is then proposed to compute geodetic coordinates from Cartesian coordinates. The convergence region of the algorithm is investigated and the corresponding correct solution is given. Lastly, the algorithm is validated with numerical experiments.
ORF Alignment: NC_003074 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... prohibitin, putative [Arabidopsis thaliana] ... Length = 132 ... Query: 67 ... QTPHIYDIRTKPHTFSSKS...GTKDLQMVNLTLRVLFRPEVSRLPYIFQTLGLEYDEKVLPS 126 ... QTPHIYDIRTKPHTFSSKSGTKDL...QMVNLTLRVLFRPEVSRLPYIFQTLGLEYDEKVLPS Sbjct: 1 ... QTPHIYDIRTKPHTFSSKSGTKDLQMVNLTLRVLFRPEVSRLPYIFQTLGLEYDEKVLPS 60 ...
Directory of Open Access Journals (Sweden)
Åsmund H Eikenes
2015-01-01
Full Text Available Abscission is the final step of cytokinesis that involves the cleavage of the intercellular bridge connecting the two daughter cells. Recent studies have given novel insight into the spatiotemporal regulation and molecular mechanisms controlling abscission in cultured yeast and human cells. The mechanisms of abscission in living metazoan tissues are however not well understood. Here we show that ALIX and the ESCRT-III component Shrub are required for completion of abscission during Drosophila female germline stem cell (fGSC division. Loss of ALIX or Shrub function in fGSCs leads to delayed abscission and the consequent formation of stem cysts in which chains of daughter cells remain interconnected to the fGSC via midbody rings and fusome. We demonstrate that ALIX and Shrub interact and that they co-localize at midbody rings and midbodies during cytokinetic abscission in fGSCs. Mechanistically, we show that the direct interaction between ALIX and Shrub is required to ensure cytokinesis completion with normal kinetics in fGSCs. We conclude that ALIX and ESCRT-III coordinately control abscission in Drosophila fGSCs and that their complex formation is required for accurate abscission timing in GSCs in vivo.
Giagazoglou, Paraskevi; Sidiropoulou, Maria; Mitsiou, Maria; Arabatzi, Fotini; Kellis, Eleftherios
2015-01-01
The present study aimed to examine movement difficulties among typically developing 8- to 9-year-old elementary students in Greece and to investigate the possible effects of a balance training program to those children assessed with Developmental Coordination Disorder (DCD). The Body Coordination Test for Children (BCTC; Körperkoordinationstest fur Kinder, KTK, Kiphard & Schilling, 1974) was chosen for the purposes of this study and 20 children out of the total number of 200, exhibited motor difficulties indicating a probable DCD disorder. The 20 students diagnosed with DCD were equally separated into two groups where each individual of the experimental group was paired with an individual of the control group. The intervention group attended a 12-week balance training program while students of the second - control group followed the regular school schedule. All participants were tested prior to the start and after the end of the 12-week period by performing static balance control tasks while standing on an EPS pressure platform and structured observation of trampoline exercises while videotaping. The results indicated that after a 12-week balance training circuit including a trampoline station program, the intervention group improved both factors that were examined. In conclusion, balance training with the use of attractive equipment such as trampoline can be an effective intervention for improving functional outcomes and can be recommended as an alternative mode of physical activity. Copyright © 2014 Elsevier Ltd. All rights reserved.
Study on portable optical 3D coordinate measuring system
Ren, Tongqun; Zhu, Jigui; Guo, Yinbiao
2009-05-01
A portable optical 3D coordinate measuring system based on digital Close Range Photogrammetry (CRP) technology and binocular stereo vision theory is researched. Three ultra-red LED with high stability is set on a hand-hold target to provide measuring feature and establish target coordinate system. Ray intersection based field directional calibrating is done for the intersectant binocular measurement system composed of two cameras by a reference ruler. The hand-hold target controlled by Bluetooth wireless communication is free moved to implement contact measurement. The position of ceramic contact ball is pre-calibrated accurately. The coordinates of target feature points are obtained by binocular stereo vision model from the stereo images pair taken by cameras. Combining radius compensation for contact ball and residual error correction, object point can be resolved by transfer of axes using target coordinate system as intermediary. This system is suitable for on-field large-scale measurement because of its excellent portability, high precision, wide measuring volume, great adaptability and satisfying automatization. It is tested that the measuring precision is near to +/-0.1mm/m.
Functional coordination of muscles underlying changes in behavioural dynamics.
Vernooij, Carlijn A; Rao, Guillaume; Perdikis, Dionysios; Huys, Raoul; Jirsa, Viktor K; Temprado, Jean-Jacques
2016-06-10
The dynamical systems approach addresses Bernstein's degrees of freedom problem by assuming that the neuro-musculo-skeletal system transiently assembles and dismantles its components into functional units (or synergies) to meet task demands. Strikingly, little is known from a dynamical point of view about the functioning of the muscular sub-system in this process. To investigate the interaction between the dynamical organisation at muscular and behavioural levels, we searched for specific signatures of a phase transition in muscular coordination when a transition is displayed at the behavioural level. Our results provide evidence that, during Fitts' task when behaviour switches to a different dynamical regime, muscular activation displays typical signatures of a phase transition; a reorganisation in muscular coordination patterns accompanied by a peak in the variability of muscle activation. This suggests that consistent changes occur in coordination processes across the different levels of description (i.e., behaviour and muscles). Specifically, in Fitts' task, target size acts as a control parameter that induces a destabilisation and a reorganisation of coordination patterns at different levels of the neuro-musculo-skeletal system.
Studies on the coordinated operation and autonomous control for multi-modular nuclear power plants
International Nuclear Information System (INIS)
Hui Chao; Huang Xiaojin; Wang Jie
2011-01-01
The tendency has always been to build ever larger single-modular reactor plants with the objective of benefiting from economies of scale. These plants have compiled admirable safety records. Nevertheless, there is concern that conventional large single reactors have become too complex by reason of placing too much reliance on engineered safeguards. The multi-modular approach offers a solution in that its use of many small reactors in conjunction with several shared turbines permits a simpler core design while, at the same time, at least partially retaining economies of scale by increasing the number of modules. Specific advantages to the multi-modular approach are as follows. First, the small-sized of the reactor core may allow the incorporation of passive safety features such as natural circulation cooling on loss of off-site electricity. Second, the individual modules are to be sized so that components related to nuclear safety can be factory-fabricated. Moreover, once the major components are made, they are to be transported to the site for rapid installation. This construction method is expected to reduce the licensing effort because the modules will be pre-licensed, and only site-specific issues will have to be considered in the final licensing process. At present, related studies show that the multi-modular approach for Generation IV can retain both the inherent safety and good economies of scale. However, the unbalanced load operation of the multi-modular power plant in which each module operates at a different power level and strong coupling between multi modules creates a complex control challenge to safe operation and control. Firstly, this paper summarizes the unbalanced load operation characteristics and challenges faced by operation and control of multi-modular power plant in the dynamic operational characteristics and requirements of coordinated control between multi modules. Secondly, detailed analysis and comparison are given in the integral
Yu, Jie; Sit, Cindy H P; Capio, Catherine M; Burnett, Angus; Ha, Amy S C; Huang, Wendy Y J
2016-01-01
The purpose of this study was to (1) examine differences in fundamental movement skills (FMS) proficiency, physical self-concept, and physical activity in children with and without developmental coordination disorder (DCD), and (2) determine the association of FMS proficiency with physical self-concept while considering key confounding factors. Participants included 43 children with DCD and 87 age-matched typically developing (TD) children. FMS proficiency was assessed using the Test of Gross Motor Development - second edition. Physical self-concept and physical activity were assessed using self-report questionnaires. A two-way (group by gender) ANCOVA was used to determine whether between-group differences existed in FMS proficiency, physical self-concept, and physical activity after controlling for age and BMI. Partial correlations and hierarchical multiple regression models were used to examine the relationship between FMS proficiency and physical self-concept. Compared with their TD peers, children with DCD displayed less proficiency in various components of FMS and viewed themselves as being less competent in physical coordination, sporting ability, and physical health. Physical coordination was a significant predictor of ability in object control skills. DCD status and gender were significant predictors of FMS proficiency. Future FMS interventions should target children with DCD and girls, and should emphasize improving object control skills proficiency and physical coordination. Children with DCD tend to have not only lower FMS proficiency than age-matched typically developing children but also lower physical self-concept. Self-perceptions of physical coordination by children with DCD are likely to be valuable contributors to development of object control skills. This may then help to develop their confidence in performing motor skills. Children with DCD need supportive programs that facilitate the development of object control skills. Efficacy of training
Convergent microRNA actions coordinate neocortical development.
Barca-Mayo, Olga; De Pietri Tonelli, Davide
2014-08-01
Neocortical development is a complex process that, at the cellular level, involves tight control of self-renewal, cell fate commitment, survival, differentiation and delamination/migration. These processes require, at the molecular level, the precise regulation of intrinsic signaling pathways and extrinsic factors with coordinated action in a spatially and temporally specific manner. Transcriptional regulation plays an important role during corticogenesis; however, microRNAs (miRNAs) are emerging as important post-transcriptional regulators of various aspects of central nervous system development. miRNAs are a class of small, single-stranded noncoding RNA molecules that control the expression of the majority of protein coding genes (i.e., targets). How do different miRNAs achieve precise control of gene networks during neocortical development? Here, we critically review all the miRNA-target interactions validated in vivo, with relevance to the generation and migration of pyramidal-projection glutamatergic neurons, and for the initial formation of cortical layers in the embryonic development of rodent neocortex. In particular, we focus on convergent miRNA actions, which are still a poorly understood layer of complexity in miRNA signaling, but potentially one of the keys to disclosing how miRNAs achieve the precise coordination of complex biological processes such as neocortical development.
Joint action coordination in 2½- and 3-year old children
Directory of Open Access Journals (Sweden)
Marlene eMeyer
2010-12-01
Full Text Available When acting jointly with others, adults can be as proficient as when acting individually. However how young children coordinate their actions with another person and how their action coordination develops during early childhood is not well understood. By means of a sequential button-pressing game, which could be played jointly or individually, the action coordination of 2½- and 3-year-old children was examined. Performance accuracy and variability of response timing were taken as indicators of coordination ability. Results showed substantial improvement in joint action coordination between the age of 2½- and 3, but both age groups performed equally well when acting individually. Interestingly, 3-year-olds performed equally well in the joint and the individual condition, whereas 2½-year-olds did not yet show this adult-like pattern as indicated by less accurate performance in the joint action. The findings suggest that in contrast to 3-year-olds, 2½-year-olds still have difficulties in establishing well-coordinated joint action with an adult partner. Possible underlying cognitive abilities such as action planning and action control are discussed.
Two-coordinate scintillation hodoscope based on hodoscopical photomultipliers
International Nuclear Information System (INIS)
Vishnevskij, N.K.; Ronzhin, A.I.; Semenov, V.K.; Khachaturov, B.A.
1982-01-01
The results of investigations of scintillation hodoscope on the basis of hodoscopic photomultipliers (HPM) for simultaneous measuring two coordinates (x and y) of a particle. The hodoscope consists of scintillation electrodes bent at the angle of 135 deg C and made an angle of 90 deg with each other. For measuring X-coordinate the half part of the photocathode is used, the second part is used for measuring Y-coordinate. HPM provides for simultaneous measuring two coordinates of a particle in the working region of 90 mm at using the photocathode with 180 mm long working region along the photocathode. The discrete separation of neighbouring positions in relation to the photocathode is possible at the minimum size of scintillation electrode being equil to >= 2 mm. For suppression of multiparticle background at the information output from the hodoscope as well as for simultaneous observation at the amplitude analyser of spectra of reference signals or X and Y profiles a fast processor cicuit has been developed. High detecting efficiency (about 90%) and low background level have been observed at the processor operation where the presence only of one signal in each of X- or Y projections is required. The two-coordinate hodoscope based on HPM due to its compactness and mobility may be used for expedient and precision beam guidance onto a target, its position control, shape and dimensions directly in the region of a polarized target location
Muscle recruitment and coordination with an ankle exoskeleton.
Steele, Katherine M; Jackson, Rachel W; Shuman, Benjamin R; Collins, Steven H
2017-07-05
Exoskeletons have the potential to assist and augment human performance. Understanding how users adapt their movement and neuromuscular control in response to external assistance is important to inform the design of these devices. The aim of this research was to evaluate changes in muscle recruitment and coordination for ten unimpaired individuals walking with an ankle exoskeleton. We evaluated changes in the activity of individual muscles, cocontraction levels, and synergistic patterns of muscle coordination with increasing exoskeleton work and torque. Participants were able to selectively reduce activity of the ankle plantarflexors with increasing exoskeleton assistance. Increasing exoskeleton net work resulted in greater reductions in muscle activity than increasing exoskeleton torque. Patterns of muscle coordination were not restricted or constrained to synergistic patterns observed during unassisted walking. While three synergies could describe nearly 95% of the variance in electromyography data during unassisted walking, these same synergies could describe only 85-90% of the variance in muscle activity while walking with the exoskeleton. Synergies calculated with the exoskeleton demonstrated greater changes in synergy weights with increasing exoskeleton work versus greater changes in synergy activations with increasing exoskeleton torque. These results support the theory that unimpaired individuals do not exclusively use central pattern generators or other low-level building blocks to coordinate muscle activity, especially when learning a new task or adapting to external assistance, and demonstrate the potential for using exoskeletons to modulate muscle recruitment and coordination patterns for rehabilitation or performance. Copyright © 2017 Elsevier Ltd. All rights reserved.
Emergent coordination underlying learning to reach to grasp with a brain-machine interface.
Vaidya, Mukta; Balasubramanian, Karthikeyan; Southerland, Joshua; Badreldin, Islam; Eleryan, Ahmed; Shattuck, Kelsey; Gururangan, Suchin; Slutzky, Marc; Osborne, Leslie; Fagg, Andrew; Oweiss, Karim; Hatsopoulos, Nicholas G
2018-04-01
The development of coordinated reach-to-grasp movement has been well studied in infants and children. However, the role of motor cortex during this development is unclear because it is difficult to study in humans. We took the approach of using a brain-machine interface (BMI) paradigm in rhesus macaques with prior therapeutic amputations to examine the emergence of novel, coordinated reach to grasp. Previous research has shown that after amputation, the cortical area previously involved in the control of the lost limb undergoes reorganization, but prior BMI work has largely relied on finding neurons that already encode specific movement-related information. In this study, we taught macaques to cortically control a robotic arm and hand through operant conditioning, using neurons that were not explicitly reach or grasp related. Over the course of training, stereotypical patterns emerged and stabilized in the cross-covariance between the reaching and grasping velocity profiles, between pairs of neurons involved in controlling reach and grasp, and to a comparable, but lesser, extent between other stable neurons in the network. In fact, we found evidence of this structured coordination between pairs composed of all combinations of neurons decoding reach or grasp and other stable neurons in the network. The degree of and participation in coordination was highly correlated across all pair types. Our approach provides a unique model for studying the development of novel, coordinated reach-to-grasp movement at the behavioral and cortical levels. NEW & NOTEWORTHY Given that motor cortex undergoes reorganization after amputation, our work focuses on training nonhuman primates with chronic amputations to use neurons that are not reach or grasp related to control a robotic arm to reach to grasp through the use of operant conditioning, mimicking early development. We studied the development of a novel, coordinated behavior at the behavioral and cortical level, and the neural
On-surface synthesis of covalent coordination polymers on micrometer scale
Institute of Scientific and Technical Information of China (English)
Mathieu Koudia; Elena Nardi; Olivier Siri; Mathieu Abel
2017-01-01
On-surface synthesis under ultrahigh vacuum provides a promising strategy to control matter at the atomic level,with important implications for the design of new two-dimensional materials having remarkable electronic,magnetic,or catalytic properties.This strategy must address the problem of limited extension of the domains due to the irreversible nature of covalent bonds,which prevents the ripening of defects.We show here that extended materials can be produced by a controlled co-deposition process.In particular,co-deposition of quinoid zwitterion molecules with iron atoms on a Ag(111) surface held at 570 K allows the formation of micrometer-sized domains based on covalent coordination bonds.This work opens up the construction of micrometer-scale single-layer covalent coordination materials under vacuum conditions.
PHB Associates with the HIRA Complex to Control an Epigenetic-Metabolic Circuit in Human ESCs.
Zhu, Zhexin; Li, Chunliang; Zeng, Yanwu; Ding, Jianyi; Qu, Zepeng; Gu, Junjie; Ge, Laixiang; Tang, Fan; Huang, Xin; Zhou, Chenlin; Wang, Ping; Zheng, Deyou; Jin, Ying
2017-02-02
The chromatin landscape and cellular metabolism both contribute to cell fate determination, but their interplay remains poorly understood. Using genome-wide siRNA screening, we have identified prohibitin (PHB) as an essential factor in self-renewal of human embryonic stem cells (hESCs). Mechanistically, PHB forms protein complexes with HIRA, a histone H3.3 chaperone, and stabilizes the protein levels of HIRA complex components. Like PHB, HIRA is required for hESC self-renewal. PHB and HIRA act together to control global deposition of histone H3.3 and gene expression in hESCs. Of particular note, PHB and HIRA regulate the chromatin architecture at the promoters of isocitrate dehydrogenase genes to promote transcription and, thus, production of α-ketoglutarate, a key metabolite in the regulation of ESC fate. Our study shows that PHB has an unexpected nuclear role in hESCs that is required for self-renewal and that it acts with HIRA in chromatin organization to link epigenetic organization to a metabolic circuit. Copyright © 2017 Elsevier Inc. All rights reserved.
ORF Alignment: NC_003076 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 48603 ... prohibitin-like protein - Arabidopsis thaliana ... Length = 107 ... Query: 58 ... VQKPYIFDIRT...KPYKINTDSGTKDLQMVNLTLRVMFRPDVVKAVVAQFNADELLTERPQV 117 ... VQKPYIFDIRTKP...YKINTDSGTKDLQMVNLTLRVMFRPDVVKAVVAQFNADELLTERPQV Sbjct: 1 ... VQKPYIFDIRTKPYKINTDSGTKDLQMVNLTLRVMFRPDVVKAVVAQFNADELLTERPQV 60 ...
Coordinated Control of Vehicle Groups
National Research Council Canada - National Science Library
Kumar, Vijay
2004-01-01
.... There are three main objectives: (1) to develop a theoretical paradigm for formalizing the concepts of a group, a team, and control of groups, with specified tasks such as exploring, mapping, searching, and transporting objects; (2...
Coordinated Feeding Behavior in Trichoplax, an Animal without Synapses.
Directory of Open Access Journals (Sweden)
Carolyn L Smith
Full Text Available Trichoplax is a small disk-shaped marine metazoan that adheres to substrates and locomotes by ciliary gliding. Despite having only six cell types and lacking synapses Trichoplax coordinates a complex sequence of behaviors culminating in external digestion of algae. We combine live cell imaging with electron microscopy to show how this is accomplished. When Trichoplax glides over a patch of algae, its cilia stop beating so it ceases moving. A subset of one of the cell types, lipophils, simultaneously secretes granules whose content rapidly lyses algae. This secretion is accurately targeted, as only lipophils located near algae release granules. The animal pauses while the algal content is ingested, and then resumes gliding. Global control of gliding is coordinated with precise local control of lipophil secretion suggesting the presence of mechanisms for cellular communication and integration.
International Nuclear Information System (INIS)
2001-03-01
Irradiation to control insect infestation of food is increasingly accepted and applied, especially as a phytosanitary treatment of food as an alternative to fumigation. However, unlike other processes for insect control, irradiation does not always result in immediate insect death. Thus, it is conceivable that fresh and dried fruits and tree nuts, which have been correctly irradiated to meet insect disinfestation/quarantine requirements, may still contain live insects at the time of importation. There is, however, a movement by plant quarantine authorities away from inspecting to ensure the absence of live insects in imported consignments towards examining through administrative procedures that a treatment required by law has been given. Nevertheless, there is a need to provide plant quarantine inspectors with a reliable objective method to verify that a minimum absorbed dose of radiation was given to supplement administrative procedures. Such an objective method is expected to bolster the confidence of the inspectors in clearing the consignment without delay and to facilitate trade in irradiated commodities. The Joint FAO/IAEA Division of Nuclear Techniques in Food and Agriculture initiated a co-ordinated research project (CRP) in 1994 to generate data on the verification of absorbed dose of irradiation in fresh, dried fruits and tree nuts for insect disinfestation/quarantine purposes. A standardized label dose indicator available commercially was used to verify the minimum/maximum absorbed dose of the irradiated commodities for these purposes as required by regulations in certain countries. It appears that such a label dose indicator with certain modifications could be made available to assist national authorities and the food industry to verify the absorbed dose of irradiation to facilitate trade in such irradiated commodities. This TECDOC reports on the accomplishments of this co-ordinated research project and includes the papers presented by the participants
Acquisition and Retention of Team Coordination in Command-and-Control
2007-05-15
transitioning from a trot to a gallop is identical to the transition from anti-phase to in-phase finger tapping , when considered from a dynamical systems...Team Coordination conserved and mixing taps extant information in new ways. The latter interpretation seems more plausible given that the relations of...5OC1~AA To e IoumatbJfoa ee b~ei b ROZ euuy (K(M) is t(W4 DU~ V 4W~f rQ~shI1JWIIX~rI~~al ft~l~f ~ DFMPC reiorys S-STR rrsnvukis to AVO 0 Eft twos
Energy Technology Data Exchange (ETDEWEB)
Zuk, David
2012-11-01
The book investigates the role of energy coordination centres for communal energy turnaround. The investigations were carried out in the Erzgebirge energy region, which comprises 13 member communities. It was found that the influence of an energy coordination centre on a community is parallel to the community's awareness of the necessity of local energy turnaround measures. Energy control centres can sharpen this awareness of communities by outlining individual advantages of engagement with these issues and by making concrete suggestions for projects. Here, it becomes clear that communities will be more interested especially in bigger investment projects of an (external)financially strong investor. Most of the communities under investigation were in the range of 1,000 to 7,000 inhabitants; it must be assumed that in this case the opinions of the highest-ranked person of communal authority. This consideration should influence the scope of action of energy coordination centres. The example of a 'pioneering community' in the energy region showed that the consulting services of the energy coordination centre not only led to lower energy consumption (and, in consequence, lower energy expenses) on a medium-term basis but also helped to coordinate the activities of initiatives, e.g. initiatives promoting citizens-owned solar power stations. As the book shows, energy coordination centres take care of communities in general but are also actively supporting initiatives within the community and have a coordinating function when it comes to intercommunity projects. While energy coordination centres are not a 'heal-all' for implementation of the energy turnaround at community level or regional level, they must be viewed as a powerful instrument to achieve it. (orig.)
Optimal Control of Wind Farms for Coordinated TSO-DSO Reactive Power Management
Directory of Open Access Journals (Sweden)
David Sebastian Stock
2018-01-01
Full Text Available The growing importance of renewable generation connected to distribution grids requires an increased coordination between transmission system operators (TSOs and distribution system operators (DSOs for reactive power management. This work proposes a practical and effective interaction method based on sequential optimizations to evaluate the reactive flexibility potential of distribution networks and to dispatch them along with traditional synchronous generators, keeping to a minimum the information exchange. A modular optimal power flow (OPF tool featuring multi-objective optimization is developed for this purpose. The proposed method is evaluated for a model of a real German 110 kV grid with 1.6 GW of installed wind power capacity and a reduced order model of the surrounding transmission system. Simulations show the benefit of involving wind farms in reactive power support reducing losses both at distribution and transmission level. Different types of setpoints are investigated, showing the feasibility for the DSO to fulfill also individual voltage and reactive power targets over multiple connection points. Finally, some suggestions are presented to achieve a fair coordination, combining both TSO and DSO requirements.
Directory of Open Access Journals (Sweden)
Ravi Shankar
2016-06-01
Full Text Available This paper deals with the modelling and small signal stability analysis for the two areas interconnected power system using a load frequency controller. The eigenvalues and the participation factor analysis are used to examine the small signal stability and contribution of different states in a particular eigenvalue of the system, respectively. A load frequency controller is designed to stabilize the frequency deviations which occur due to the small perturbation in the system. In this paper, the proposed control scheme consists of an integral controller in coordination with the Redox Flow Energy Storage System (RFESS and the Static Synchronous Series Compensator (SSSC. The dynamic responses of the overall system have been improved by the proposed controller, which is also verified with the help of eigenvalue and participation factor analysis. This analysis shows that overall system oscillation has been reduced through a proposed controller.
Unique sensor fusion system for coordinate-measuring machine tasks
Nashman, Marilyn; Yoshimi, Billibon; Hong, Tsai Hong; Rippey, William G.; Herman, Martin
1997-09-01
This paper describes a real-time hierarchical system that fuses data from vision and touch sensors to improve the performance of a coordinate measuring machine (CMM) used for dimensional inspection tasks. The system consists of sensory processing, world modeling, and task decomposition modules. It uses the strengths of each sensor -- the precision of the CMM scales and the analog touch probe and the global information provided by the low resolution camera -- to improve the speed and flexibility of the inspection task. In the experiment described, the vision module performs all computations in image coordinate space. The part's boundaries are extracted during an initialization process and then the probe's position is continuously updated as it scans and measures the part surface. The system fuses the estimated probe velocity and distance to the part boundary in image coordinates with the estimated velocity and probe position provided by the CMM controller. The fused information provides feedback to the monitor controller as it guides the touch probe to scan the part. We also discuss integrating information from the vision system and the probe to autonomously collect data for 2-D to 3-D calibration, and work to register computer aided design (CAD) models with images of parts in the workplace.
Energy Technology Data Exchange (ETDEWEB)
NONE
2003-07-01
Placed under the MIES control, the Committee of scientific expertise coordination defines the needs, the contain and the planing of expertises realized in function of Climate national and international decisions and negotiations calendars. The Committee verifies the different expertises and offers the administrations, scientific tools and techniques useful for the negotiations. It can also define long-dated research needs which require the scientific community mobilization. This paper provides some document of the Committee: objectives, operating and priorities of the Committee, scenarios ''Factor 4'' and ''crack technology'', perceptions and practices, developing countries (China, India...), Euromed. (A.L.B.)
Doherty, Cailbhe; Bleakley, Chris; Hertel, Jay; Caulfield, Brian; Ryan, John; Sweeney, Kevin; Delahunt, Eamonn
2015-07-01
This investigation combined measures of inter-joint coordination and stabilometry to evaluate eyes-open (condition 1) and eyes-closed (condition 2) static unilateral stance performance in a group of participants with an acute, first-time lateral ankle sprain injury in comparison to a control group. Sixty-six participants with an acute first-time lateral ankle sprain and 19 non-injured controls completed three 20-second unilateral stance task trials in conditions 1 and 2. An adjusted coefficient of multiple determination statistic was used to compare stance limb 3-D kinematic data for similarity in the aim of establishing patterns of inter-joint coordination for these groups. Between-group analyses revealed significant differences in stance limb inter-joint coordination strategies for conditions 1 and 2. Injured participants displayed increases in ankle-hip linked coordination compared to controls in condition 1 (sagittal/frontal plane: 0.12 [0.09] vs 0.06 [0.04]; η(2)=.16) and condition 2 (sagittal/frontal plane: 0.18 [0.13] vs 0.08 [0.06]; η(2)=0.37). Participants with acute first-time lateral ankle sprain exhibit a hip-dominant coordination strategy for static unilateral stance compared to non-injured controls. Copyright © 2015 Elsevier Ltd. All rights reserved.
Luminescent lanthanide coordination polymers
Energy Technology Data Exchange (ETDEWEB)
Ma, L.; Evans, O.R.; Foxman, B.M.; Lin, W.
1999-12-13
One-dimensional lanthanide coordination polymers with the formula Ln(isonicotinate){sub 3}(H{sub 2}O){sub 2} (Ln = Ce, Pr, Nd, Sm, Eu, Tb; 1a-f) were synthesized by treating nitrate or perchlorate salts of Ln(III) with 4-pyridinecarboxaldehyde under hydro(solvo)thermal conditions. Single-crystal and powder X-ray diffraction studies indicate that these lanthanide coordination polymers adopt two different structures. While Ce(III), Pr(III), and Nd(III) complexes adopt a chain structure with alternating Ln-(carboxylate){sub 2}-Ln and Ln-(carboxylate){sub 4}-Ln linkages, Sm(III), Eu(III), and Tb(III) complexes have a doubly carboxylate-bridged infinite-chain structure with one chelating carboxylate group on each metal center. In both structures, the lanthanide centers also bind to two water molecules to yield an eight-coordinate, square antiprismatic geometry. The pyridine nitrogen atoms of the isonicotinate groups do not coordinate to the metal centers in these lanthanide(III) complexes; instead, they direct the formation of Ln(III) coordination polymers via hydrogen bonding with coordinated water molecules. Photoluminescence measurements show that Tb(isonicotinate){sub 3}(H{sub 2}O){sub 2} is highly emissive at room temperature with a quantum yield of {approximately}90%. These results indicate that highly luminescent lanthanide coordination polymers can be assembled using a combination of coordination and hydrogen bonds. Crystal data for 1a: monoclinic space group P2{sub 1}/c, a = 9.712(2) {angstrom}, b = 19.833(4) {angstrom}, c = 11.616(2) {angstrom}, {beta} = 111.89(3){degree}, Z = 4. Crystal data for 1f: monoclinic space group C2/c, a = 20.253(4) {angstrom}, b = 11.584(2) {angstrom}, c = 9.839(2) {angstrom}, {beta} = 115.64(3){degree}, Z = 8.
Coordination of Conditional Poisson Samples
Directory of Open Access Journals (Sweden)
Grafström Anton
2015-12-01
Full Text Available Sample coordination seeks to maximize or to minimize the overlap of two or more samples. The former is known as positive coordination, and the latter as negative coordination. Positive coordination is mainly used for estimation purposes and to reduce data collection costs. Negative coordination is mainly performed to diminish the response burden of the sampled units. Poisson sampling design with permanent random numbers provides an optimum coordination degree of two or more samples. The size of a Poisson sample is, however, random. Conditional Poisson (CP sampling is a modification of the classical Poisson sampling that produces a fixed-size πps sample. We introduce two methods to coordinate Conditional Poisson samples over time or simultaneously. The first one uses permanent random numbers and the list-sequential implementation of CP sampling. The second method uses a CP sample in the first selection and provides an approximate one in the second selection because the prescribed inclusion probabilities are not respected exactly. The methods are evaluated using the size of the expected sample overlap, and are compared with their competitors using Monte Carlo simulation. The new methods provide a good coordination degree of two samples, close to the performance of Poisson sampling with permanent random numbers.
Keep Meaning in Conversational Coordination
Directory of Open Access Journals (Sweden)
Elena Clare Cuffari
2014-12-01
Full Text Available Coordination is a widely employed term across recent quantitative and qualitative approaches to intersubjectivity, particularly approaches that give embodiment and enaction central explanatory roles. With a focus on linguistic and bodily coordination in conversational contexts, I review the operational meaning of coordination in recent empirical research and related theorizing of embodied intersubjectivity. This discussion articulates what must be involved in treating linguistic meaning as dynamic processes of coordination. The coordination approach presents languaging as a set of dynamic self-organizing processes and actions on multiple timescales and across multiple modalities that come about and work in certain domains (those jointly constructed in social, interactive, high-order sense-making. These processes go beyond meaning at the level that is available to first-person experience. I take one crucial consequence of this to be the ubiquitously moral nature of languaging with others. Languaging coordinates experience, among other levels of behavior and event. Ethical effort is called for by the automatic autonomy-influencing forces of languaging as coordination.
Coordinate measurement machines as an alignment tool
International Nuclear Information System (INIS)
Wand, B.T.
1991-03-01
In February of 1990 the Stanford Linear Accelerator Center (SLAC) purchased a LEITZ PM 12-10-6 CMM (Coordinate measurement machine). The machine is shared by the Quality Control Team and the Alignment Team. One of the alignment tasks in positioning beamline components in a particle accelerator is to define the component's magnetic centerline relative to external fiducials. This procedure, called fiducialization, is critical to the overall positioning tolerance of a magnet. It involves the definition of the magnetic center line with respect to the mechanical centerline and the transfer of the mechanical centerline to the external fiducials. To perform the latter a magnet coordinate system has to be established. This means defining an origin and the three rotation angles of the magnet. The datum definition can be done by either optical tooling techniques or with a CMM. As optical tooling measurements are very time consuming, not automated and are prone to errors, it is desirable to use the CMM fiducialization method instead. The establishment of a magnet coordinate system based on the mechanical center and the transfer to external fiducials will be discussed and presented with 2 examples from the Stanford Linear Collider (SLC). 7 figs
Porphyrin coordination polymer nanospheres and nanorods
Wang, Zhongchun; Shelnutt, John A.; Medforth, Craig J.
2012-12-04
A porphyrin coordination polymer nanostructure comprising a network of pyridyl porphyrin molecules and coordinating metal ions coordinatively bound through the pyridyl groups. In some embodiments, the porphyrins are metalloporphyrins. A variety of nanostructures are formed by the network polymer, including nanospheres, polygonal nanostructures, nanorods, and nanofibers, depending on a variety of factors including coordination metal ion, porphyrin type, metal of the metalloporphyrin, and degree of agitation during nanostructure formation. Reduction of coordinating metal ions may be used to form metal nanoparticles on the coordination polymer nanostructure.
Energy Technology Data Exchange (ETDEWEB)
Simoes Costa, A J.A.; Silva, A S; Freitas, F D [Santa Catarina Univ., Florianopolis, SC (Brazil). Dept. de Engenharia Eletrica
1994-12-31
Two distinct approaches for the coordinated setting of multimachine power system controllers are presented. The first strategy is based on the re-allocation of the poles related to the electromechanical modes of the system through decentralized control. The second method is a coordinated global procedure based on structurally constrained optimal control. Both approaches considered power system stabilizers and supplementary signals for static var compensators as the controllers to be adjusted. Other types of controllers, such as FACTS devices, can also be tuned by using the proposed techniques. A 13-machine, 77-bus power system which is based on the Brazilian South-Southeast interconnected network is employed to assess the performance of the proposed methods. (author) 14 refs., 1 fig., 7 tabs.
Alibeji, Naji A; Molazadeh, Vahidreza; Dicianno, Brad E; Sharma, Nitin
2018-01-01
A hybrid walking neuroprosthesis that combines functional electrical stimulation (FES) with a powered lower limb exoskeleton can be used to restore walking in persons with paraplegia. It provides therapeutic benefits of FES and torque reliability of the powered exoskeleton. Moreover, by harnessing metabolic power of muscles via FES, the hybrid combination has a potential to lower power consumption and reduce actuator size in the powered exoskeleton. Its control design, however, must overcome the challenges of actuator redundancy due to the combined use of FES and electric motor. Further, dynamic disturbances such as electromechanical delay (EMD) and muscle fatigue must be considered during the control design process. This ensures stability and control performance despite disparate dynamics of FES and electric motor. In this paper, a general framework to coordinate FES of multiple gait-governing muscles with electric motors is presented. A muscle synergy-inspired control framework is used to derive the controller and is motivated mainly to address the actuator redundancy issue. Dynamic postural synergies between FES of the muscles and the electric motors were artificially generated through optimizations and result in key dynamic postures when activated. These synergies were used in the feedforward path of the control system. A dynamic surface control technique, modified with a delay compensation term, is used as the feedback controller to address model uncertainty, the cascaded muscle activation dynamics, and EMD. To address muscle fatigue, the stimulation levels in the feedforward path were gradually increased based on a model-based fatigue estimate. A Lyapunov-based stability approach was used to derive the controller and guarantee its stability. The synergy-based controller was demonstrated experimentally on an able-bodied subject and person with an incomplete spinal cord injury.
Directory of Open Access Journals (Sweden)
Naji A. Alibeji
2018-04-01
Full Text Available A hybrid walking neuroprosthesis that combines functional electrical stimulation (FES with a powered lower limb exoskeleton can be used to restore walking in persons with paraplegia. It provides therapeutic benefits of FES and torque reliability of the powered exoskeleton. Moreover, by harnessing metabolic power of muscles via FES, the hybrid combination has a potential to lower power consumption and reduce actuator size in the powered exoskeleton. Its control design, however, must overcome the challenges of actuator redundancy due to the combined use of FES and electric motor. Further, dynamic disturbances such as electromechanical delay (EMD and muscle fatigue must be considered during the control design process. This ensures stability and control performance despite disparate dynamics of FES and electric motor. In this paper, a general framework to coordinate FES of multiple gait-governing muscles with electric motors is presented. A muscle synergy-inspired control framework is used to derive the controller and is motivated mainly to address the actuator redundancy issue. Dynamic postural synergies between FES of the muscles and the electric motors were artificially generated through optimizations and result in key dynamic postures when activated. These synergies were used in the feedforward path of the control system. A dynamic surface control technique, modified with a delay compensation term, is used as the feedback controller to address model uncertainty, the cascaded muscle activation dynamics, and EMD. To address muscle fatigue, the stimulation levels in the feedforward path were gradually increased based on a model-based fatigue estimate. A Lyapunov-based stability approach was used to derive the controller and guarantee its stability. The synergy-based controller was demonstrated experimentally on an able-bodied subject and person with an incomplete spinal cord injury.
[Civilian-military coordination].
de Montravel, G
2002-01-01
Current humanitarian emergencies create complex, mutidimensional situations that stimulate simultaneous responses from a wide variety of sources including governments, non-governmental organizations (NGO), United Nations agencies, and private individuals. As a result, it has become essential to establish a coherent framework in which each actor can contribute promptly and effectively to the overall effort. This is the role of the United Nations Office for the Coordination of Humanitarian Affairs. Regardless of the circumstances and level of coordination, cooperation and collaboration between humanitarian and military personnel, it is necessary to bear in mind their objectives. The purpose of humanitarian action is to reduce human suffering. The purpose of military intervention is to stop warfare. The author of this article will discuss the three major obstacles to civilian-military coordination (strategic, tactical, and operational). Operations cannot be conducted smoothly and differences cannot be ironed out without mutual respect between the two parties, an explicit definition of their respective duties and responsibilities, a clear understanding of their cultural differences, and the presence of an organization and facilities for coordination and arbitrage by a neutral referee.
Zeng, Xiaohua; Li, Guanghan; Yin, Guodong; Song, Dafeng; Li, Sheng; Yang, Nannan
2018-02-01
Equipping a hydraulic hub-motor auxiliary system (HHMAS), which mainly consists of a hydraulic variable pump, a hydraulic hub-motor, a hydraulic valve block and hydraulic accumulators, with part-time all-wheel-drive functions improves the power performance and fuel economy of heavy commercial vehicles. The coordinated control problem that occurs when HHMAS operates in the auxiliary drive mode is addressed in this paper; the solution to this problem is the key to the maximization of HHMAS. To achieve a reasonable distribution of the engine power between mechanical and hydraulic paths, a nonlinear control scheme based on model predictive control (MPC) is investigated. First, a nonlinear model of HHMAS with vehicle dynamics and tire slip characteristics is built, and a controller-design-oriented model is simplified. Then, a steady-state feedforward + dynamic MPC feedback controller (FMPC) is designed to calculate the control input sequence of engine torque and hydraulic variable pump displacement. Finally, the controller is tested in the MATLAB/Simulink and AMESim co-simulation platform and the hardware-in-the-loop experiment platform, and its performance is compared with that of the existing proportional-integral-derivative controller and the feedforward controller under the same conditions. Simulation results show that the designed FMPC has the best performance, and control performance can be guaranteed in a real-time environment. Compared with the tracking control error of the feedforward controller, that of the designed FMPC is decreased by 85% and the traction efficiency performance is improved by 23% under a low-friction-surface condition. Moreover, under common road conditions for heavy commercial vehicles, the traction force can increase up to 13.4-15.6%.
National Research Council Canada - National Science Library
Goan, Terrance; Mayk, Israel
2005-01-01
Command and Control for coordinated response to domestic terrorist attack will require the ability of Federal, state, and local agencies to maintain awareness of the status, capabilities, requirements...
Directory of Open Access Journals (Sweden)
Timothy D Wiggin
Full Text Available The cellular and network basis for most vertebrate locomotor central pattern generators (CPGs is incompletely characterized, but organizational models based on known CPG architectures have been proposed. Segmental models propose that each spinal segment contains a circuit that controls local coordination and sends longer projections to coordinate activity between segments. Unsegmented/continuous models propose that patterned motor output is driven by gradients of neurons and synapses that do not have segmental boundaries. We tested these ideas in the larval zebrafish, an animal that swims in discrete episodes, each of which is composed of coordinated motor bursts that progress rostrocaudally and alternate from side to side. We perturbed the spinal cord using spinal transections or strychnine application and measured the effect on fictive motor output. Spinal transections eliminated episode structure, and reduced both rostrocaudal and side-to-side coordination. Preparations with fewer intact segments were more severely affected, and preparations consisting of midbody and caudal segments were more severely affected than those consisting of rostral segments. In reduced preparations with the same number of intact spinal segments, side-to-side coordination was more severely disrupted than rostrocaudal coordination. Reducing glycine receptor signaling with strychnine reversibly disrupted both rostrocaudal and side-to-side coordination in spinalized larvae without disrupting episodic structure. Both spinal transection and strychnine decreased the stability of the motor rhythm, but this effect was not causal in reducing coordination. These results are inconsistent with a segmented model of the spinal cord and are better explained by a continuous model in which motor neuron coordination is controlled by segment-spanning microcircuits.
Movement patterns of limb coordination in infant rolling.
Kobayashi, Yoshio; Watanabe, Hama; Taga, Gentaro
2016-12-01
Infants must perform dynamic whole-body movements to initiate rolling, a key motor skill. However, little is known regarding limb coordination and postural control in infant rolling. To address this lack of knowledge, we examined movement patterns and limb coordination during rolling in younger infants (aged 5-7 months) that had just begun to roll and in older infants (aged 8-10 months) with greater rolling experience. Due to anticipated difficulty in obtaining measurements over the second half of the rolling sequence, we limited our analysis to the first half. Ipsilateral and contralateral limbs were identified on the basis of rolling direction and were classified as either a stationary limb used for postural stability or a moving limb used for controlled movement. We classified the observed movement patterns by identifying the number of stationary limbs and the serial order of combinational limb movement patterns. Notably, older infants performed more movement patterns that involved a lower number of stationary limbs than younger infants. Despite the wide range of possible movement patterns, a small group of basic patterns dominated in both age groups. Our results suggest that the fundamental structure of limb coordination during rolling in the early acquisition stages remains unchanged until at least 8-10 months of age. However, compared to younger infants, older infants exhibited a greater ability to select an effective rotational movement by positioning themselves with fewer stationary limbs and performing faster limb movements.
47 CFR 95.1113 - Frequency coordinator.
2010-10-01
... SERVICES Wireless Medical Telemetry Service (WMTS) General Provisions § 95.1113 Frequency coordinator. (a) The Commission will designate a frequency coordinator(s) to manage the usage of the frequency bands for the operation of medical telemetry devices. (b) The frequency coordinator shall (1) Review and...
2010-07-01
... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Coordination. 109.6 Section 109.6 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS CRITERIA FOR STATE, LOCAL AND REGIONAL OIL REMOVAL CONTINGENCY PLANS § 109.6 Coordination. For the purposes of coordination...
ITER co-ordinated technical activities
International Nuclear Information System (INIS)
2001-01-01
As agreed upon between the ITER Engineering Design Activities (EDA) Parties 'Co-ordinated Technical Activities' (CTA) means technical activities which are deemed necessary to maintain the integrity of the international project, so as to prepare for the ITER joint implementation. The scope of these activities includes design adaptation to the specific site conditions, safety analysis and licensing preparation that are based on specific site offers, evaluation of cost and construction schedule, preparation of procurement documents and other issues raised by the Parties collectively, whilst assuring the coherence of the ITER project including design control
Directory of Open Access Journals (Sweden)
Aylin Ataay
2016-04-01
Full Text Available Maman (1999 proposed that, in countries in which business groups are dominant forms for organizing economic activities, the interlocking directorate is a managerial tool that can be prioritized to control and coordinate activities of their affiliated firms within the same groups and align their business objectives. This organizational connection appears to be an intentional strategy on the part of the groups‟ headquarters. In order to study the interlocking ties in Turkish family business groups (FBG, this study focused on interlocking directorates among listed firms in Turkey. The findings of preliminary study reveal that almost all of the interlocking ties were within the business groups (BG in our sample. This is the result of assignment of familyaffiliated and/or professional inside directors to the various boards of companies in the BG. We also found that compare to vertical ties; business groups are using more horizontal interlocking connections to bond their affiliated companies together.
Multipole structure and coordinate systems
International Nuclear Information System (INIS)
Burko, Lior M
2007-01-01
Multipole expansions depend on the coordinate system, so that coefficients of multipole moments can be set equal to zero by an appropriate choice of coordinates. Therefore, it is meaningless to say that a physical system has a nonvanishing quadrupole moment, say, without specifying which coordinate system is used. (Except if this moment is the lowest non-vanishing one.) This result is demonstrated for the case of two equal like electric charges. Specifically, an adapted coordinate system in which the potential is given by a monopole term only is explicitly found, the coefficients of all higher multipoles vanish identically. It is suggested that this result can be generalized to other potential problems, by making equal coordinate surfaces adapt to the potential problem's equipotential surfaces
Possibility of extending space-time coordinates
International Nuclear Information System (INIS)
Wang Yongcheng.
1993-11-01
It has been shown that one coordinate system can describe a whole space-time region except some supersurfaces on which there are coordinate singularities. The conditions of extending a coordinate from real field to complex field are studied. It has been shown that many-valued coordinate transformations may help us to extend space-time regions and many-valued metric functions may make one coordinate region to describe more than one space-time regions. (author). 11 refs
A framework of manufacturer-retailer coordination process
DEFF Research Database (Denmark)
Wong, Chee Yew; Johansen, John
2008-01-01
Purpose - Triggered by perceived inefficiency and inequality, buyers and suppliers coordinate with each other. The purpose of this paper is to develop a framework of coordination process based on theoretical review and verifications from three case studies. Design/methodology/approach - The appro......Purpose - Triggered by perceived inefficiency and inequality, buyers and suppliers coordinate with each other. The purpose of this paper is to develop a framework of coordination process based on theoretical review and verifications from three case studies. Design...... there was disagreement. Third, closer mode of coordination, which involved joint evaluation and derivation of coordination solutions, reduced the numbers of iterative coordination cycles. These empirical findings verified the presupposed framework of coordination process. Research limitations/implications - Three...... qualitative case studies may not be highly generalisable and multiple dyadic coordination processes may occur. However, the findings form a foundation for further understanding of the coordination process. Originality/value - The proposed framework of the coordination process further expands the theories...
Keller, Peter E.; Novembre, Giacomo; Hove, Michael J.
2014-01-01
Human interaction often requires simultaneous precision and flexibility in the coordination of rhythmic behaviour between individuals engaged in joint activity, for example, playing a musical duet or dancing with a partner. This review article addresses the psychological processes and brain mechanisms that enable such rhythmic interpersonal coordination. First, an overview is given of research on the cognitive-motor processes that enable individuals to represent joint action goals and to anticipate, attend and adapt to other's actions in real time. Second, the neurophysiological mechanisms that underpin rhythmic interpersonal coordination are sought in studies of sensorimotor and cognitive processes that play a role in the representation and integration of self- and other-related actions within and between individuals' brains. Finally, relationships between social–psychological factors and rhythmic interpersonal coordination are considered from two perspectives, one concerning how social-cognitive tendencies (e.g. empathy) affect coordination, and the other concerning how coordination affects interpersonal affiliation, trust and prosocial behaviour. Our review highlights musical ensemble performance as an ecologically valid yet readily controlled domain for investigating rhythm in joint action. PMID:25385772
29 CFR 42.8 - Coordination plan.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Coordination plan. 42.8 Section 42.8 Labor Office of the Secretary of Labor COORDINATED ENFORCEMENT § 42.8 Coordination plan. (a) Based upon, among other things, the... coordination plan concerning farm labor-related responsibilities of the Department, including migrant housing...
Edinger, Janick; Pai, Dinesh K; Spering, Miriam
2017-01-01
The neural control of pursuit eye movements to visual textures that simultaneously translate and rotate has largely been neglected. Here we propose that pursuit of such targets-texture pursuit-is a fully three-dimensional task that utilizes all three degrees of freedom of the eye, including torsion. Head-fixed healthy human adults (n = 8) tracked a translating and rotating random dot pattern, shown on a computer monitor, with their eyes. Horizontal, vertical, and torsional eye positions were recorded with a head-mounted eye tracker. The torsional component of pursuit is a function of the rotation of the texture, aligned with its visual properties. We observed distinct behaviors between those trials in which stimulus rotation was in the same direction as that of a rolling ball ("natural") in comparison to those with the opposite rotation ("unnatural"): Natural rotation enhanced and unnatural rotation reversed torsional velocity during pursuit, as compared to torsion triggered by a nonrotating random dot pattern. Natural rotation also triggered pursuit with a higher horizontal velocity gain and fewer and smaller corrective saccades. Furthermore, we show that horizontal corrective saccades are synchronized with torsional corrective saccades, indicating temporal coupling of horizontal and torsional saccade control. Pursuit eye movements have a torsional component that depends on the visual stimulus. Horizontal and torsional eye movements are separated in the motor periphery. Our findings suggest that translational and rotational motion signals might be coordinated in descending pursuit pathways.
Coordinating decentralized optimization of truck and shovel mining operations
Energy Technology Data Exchange (ETDEWEB)
Cheng, R.; Fraser Forbes, J. [Alberta Univ., Edmonton, AB (Canada). Dept. of Chemical and Materials Engineering; San Yip, W. [Suncor Energy, Fort McMurray, AB (Canada)
2006-07-01
Canada's oil sands contain the largest known reserve of oil in the world. Oil sands mining uses 3 functional processes, ore hauling, overburden removal and mechanical maintenance. The industry relies mainly on truck-and-shovel technology in its open-pit mining operations which contributes greatly to the overall mining operation cost. Coordination between operating units is crucial for achieving an enterprise-wide optimal operation level. Some of the challenges facing the industry include multiple or conflicting objectives such as minimizing the use of raw materials and energy while maximizing production. The large sets of constraints that define the feasible domain pose as challenge, as does the uncertainty in system parameters. One solution lies in assigning truck resources to various activities. This fully decentralized approach would treat the optimization of ore production, waste removal and equipment maintenance independently. It was emphasized that mine-wide optimal operation can only be achieved by coordinating ore hauling and overburden removal processes. For that reason, this presentation proposed a coordination approach for a decentralized optimization system. The approach is based on the Dantzig-Wolfe decomposition and auction-based methods that have been previously used to decompose large-scale optimization problems. The treatment of discrete variables and coordinator design was described and the method was illustrated with a simple truck and shovel mining simulation study. The approach can be applied to a wide range of applications such as coordinating decentralized optimal control systems and scheduling. 16 refs., 3 tabs., 2 figs.
Zlatkina, O. Yu
2018-04-01
There is a relationship between the service properties of component parts and their geometry; therefore, to predict and control the operational characteristics of parts and machines, it is necessary to measure their geometrical specifications. In modern production, a coordinate measuring machine is the advanced measuring instrument of the products geometrical specifications. The analysis of publications has shown that during the coordinate measurements the problems of choosing locating chart of parts and coordination have not been sufficiently studied. A special role in the coordination of the part is played by the coordinate axes informational content. Informational content is the sum of the degrees of freedom limited by the elementary item of a part. The coordinate planes of a rectangular coordinate system have different informational content (three, two, and one). The coordinate axes have informational content of four, two and zero. The higher the informational content of the coordinate plane or axis, the higher its priority for reading angular and linear coordinates is. The geometrical model production of the coordinate measurements object taking into account the information content of coordinate planes and coordinate axes allows us to clearly reveal the interrelationship of the coordinates of the deviations in location, sizes and deviations of their surfaces shape. The geometrical model helps to select the optimal locating chart of parts for bringing the machine coordinate system to the part coordinate system. The article presents an algorithm the model production of geometrical specifications using the example of the piston rod of a compressor.
Vaidya spacetime in the diagonal coordinates
Energy Technology Data Exchange (ETDEWEB)
Berezin, V. A., E-mail: berezin@inr.ac.ru; Dokuchaev, V. I., E-mail: dokuchaev@inr.ac.ru; Eroshenko, Yu. N., E-mail: eroshenko@inr.ac.ru [Russian Academy of Sciences, Institute for Nuclear Research (Russian Federation)
2017-03-15
We have analyzed the transformation from initial coordinates (v, r) of the Vaidya metric with light coordinate v to the most physical diagonal coordinates (t, r). An exact solution has been obtained for the corresponding metric tensor in the case of a linear dependence of the mass function of the Vaidya metric on light coordinate v. In the diagonal coordinates, a narrow region (with a width proportional to the mass growth rate of a black hole) has been detected near the visibility horizon of the Vaidya accreting black hole, in which the metric differs qualitatively from the Schwarzschild metric and cannot be represented as a small perturbation. It has been shown that, in this case, a single set of diagonal coordinates (t, r) is insufficient to cover the entire range of initial coordinates (v, r) outside the visibility horizon; at least three sets of diagonal coordinates are required, the domains of which are separated by singular surfaces on which the metric components have singularities (either g{sub 00} = 0 or g{sub 00} = ∞). The energy–momentum tensor diverges on these surfaces; however, the tidal forces turn out to be finite, which follows from an analysis of the deviation equations for geodesics. Therefore, these singular surfaces are exclusively coordinate singularities that can be referred to as false fire-walls because there are no physical singularities on them. We have also considered the transformation from the initial coordinates to other diagonal coordinates (η, y), in which the solution is obtained in explicit form, and there is no energy–momentum tensor divergence.
A Game-Theoretic Response Strategy for Coordinator Attack in Wireless Sensor Networks
Liu, Jianhua; Yue, Guangxue; Shang, Huiliang; Li, Hongjie
2014-01-01
The coordinator is a specific node that controls the whole network and has a significant impact on the performance in cooperative multihop ZigBee wireless sensor networks (ZWSNs). However, the malicious node attacks coordinator nodes in an effort to waste the resources and disrupt the operation of the network. Attacking leads to a failure of one round of communication between the source nodes and destination nodes. Coordinator selection is a technique that can considerably defend against attack and reduce the data delivery delay, and increase network performance of cooperative communications. In this paper, we propose an adaptive coordinator selection algorithm using game and fuzzy logic aiming at both minimizing the average number of hops and maximizing network lifetime. The proposed game model consists of two interrelated formulations: a stochastic game for dynamic defense and a best response policy using evolutionary game formulation for coordinator selection. The stable equilibrium best policy to response defense is obtained from this game model. It is shown that the proposed scheme can improve reliability and save energy during the network lifetime with respect to security. PMID:25105171
Tanner, Jeremy A; Black, Betty S; Johnston, Deirdre; Hess, Edward; Leoutsakos, Jeannie-Marie; Gitlin, Laura N; Rabins, Peter V; Lyketsos, Constantine G; Samus, Quincy M
2015-04-01
To assess whether MIND at Home, a community-based, multicomponent, care coordination intervention, reduces unmet caregiving needs and burden in informal caregivers of persons with memory disorders. An 18-month randomized controlled trial of 289 community-living care recipient (CR)-caregiver (informal caregivers, i.e., unpaid individuals who regularly assisted the CR) dyads from 28 postal code areas of Baltimore, Maryland was conducted. All dyads and the CR's primary care physician received the written needs assessment results and intervention recommendations. Intervention dyads then received an 18-month care coordination intervention delivered by nonclinical community workers to address unmet care needs through individualized care planning, referral and linkage to dementia services, provision of caregiver dementia education and skill-building strategies, and care progress monitoring by an interdisciplinary team. Primary outcome was total percent of unmet caregiver needs at 18 months. Secondary outcomes included objective and subjective caregiver burden measures, quality of life (QOL), and depression. Total percent of unmet caregiver needs declined in both groups from baseline to 18 months, with no statistically significant between-group difference. No significant group differences occurred in most caregiver burden measures, depression, or QOL. There was a potentially clinically relevant reduction in self-reported number of hours caregivers spent with the CR for MIND participants compared with control subjects. No statistically significant impacts on caregiver outcomes were found after multiple comparison adjustments. However, MIND at Home appeared to have had a modest and clinically meaningful impact on informal caregiver time spent with CRs. Copyright © 2015 American Association for Geriatric Psychiatry. Published by Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Yao Liu
2016-08-01
Full Text Available The increasing penetration of renewable generators can be a significant challenge due to the fluctuation of their power generation. Energy storage (ES units are one solution to improve power supply quality and guarantee system stability. In this paper, a hybrid microgrid is built based on photovoltaic (PV generator and ES; and coordinated control is proposed and developed to achieve power management in a decentralized manner. This control scheme contains three different droop strategies according to characteristics of PV and ES. First, the modified droop control is proposed for PV, which can take full utilization of renewable energy and avoid regulating output active power frequently. Second, to maintain the direct current (DC bus voltage stability, a novel droop control incorporating a constant power band is presented for DC-side ES. Third, a cascade droop control is designed for alternating current (AC-side ES. Thus, the ES lifetime is prolonged. Moreover, interlinking converters (ICs provide a bridge between AC/DC buses in a hybrid microgrid. The power control of IC is enabled when the AC- or DC-side suffer from active power demand shortage. In particular, if the AC microgrid does not satisfy the reactive power demand, IC then acts as a static synchronous compensator (STATCOM. The effectiveness of the proposed strategies is verified by simulations.
Directory of Open Access Journals (Sweden)
Cristina Mottillo
2017-01-01
Full Text Available Controlling the formation of coordination bonds is pivotal to the development of a plethora of functional metal-organic materials, ranging from coordination polymers, metal-organic frameworks (MOFs to metallodrugs. The interest in and commercialization of such materials has created a need for more efficient, environmentally-friendly routes for making coordination bonds. Solid-state coordination chemistry is a versatile greener alternative to conventional synthesis, offering quantitative yields, enhanced stoichiometric and topological selectivity, access to a wider range of precursors, as well as to molecules and materials not readily accessible in solution or solvothermally. With a focus on mechanochemical, thermochemical and “accelerated aging” approaches to coordination polymers, including pharmaceutically-relevant materials and microporous MOFs, this review highlights the recent advances in solid-state coordination chemistry and techniques for understanding the underlying reaction mechanisms.
Coordinate-invariant regularization
International Nuclear Information System (INIS)
Halpern, M.B.
1987-01-01
A general phase-space framework for coordinate-invariant regularization is given. The development is geometric, with all regularization contained in regularized DeWitt Superstructures on field deformations. Parallel development of invariant coordinate-space regularization is obtained by regularized functional integration of the momenta. As representative examples of the general formulation, the regularized general non-linear sigma model and regularized quantum gravity are discussed. copyright 1987 Academic Press, Inc
A dynamical model of hierarchical selection and coordination in speech planning.
Directory of Open Access Journals (Sweden)
Sam Tilsen
Full Text Available studies of the control of complex sequential movements have dissociated two aspects of movement planning: control over the sequential selection of movement plans, and control over the precise timing of movement execution. This distinction is particularly relevant in the production of speech: utterances contain sequentially ordered words and syllables, but articulatory movements are often executed in a non-sequential, overlapping manner with precisely coordinated relative timing. This study presents a hybrid dynamical model in which competitive activation controls selection of movement plans and coupled oscillatory systems govern coordination. The model departs from previous approaches by ascribing an important role to competitive selection of articulatory plans within a syllable. Numerical simulations show that the model reproduces a variety of speech production phenomena, such as effects of preparation and utterance composition on reaction time, and asymmetries in patterns of articulatory timing associated with onsets and codas. The model furthermore provides a unified understanding of a diverse group of phonetic and phonological phenomena which have not previously been related.
Attitude coordination of multi-HUG formation based on multibody system theory
Xue, Dong-yang; Wu, Zhi-liang; Qi, Er-mai; Wang, Yan-hui; Wang, Shu-xin
2017-04-01
Application of multiple hybrid underwater gliders (HUGs) is a promising method for large scale, long-term ocean survey. Attitude coordination has become a requisite for task execution of multi-HUG formation. In this paper, a multibody model is presented for attitude coordination among agents in the HUG formation. The HUG formation is regarded as a multi-rigid body system. The interaction between agents in the formation is described by artificial potential field (APF) approach. Attitude control torque is composed of a conservative torque generated by orientation potential field and a dissipative term related with angular velocity. Dynamic modeling of the multibody system is presented to analyze the dynamic process of the HUG formation. Numerical calculation is carried out to simulate attitude synchronization with two kinds of formation topologies. Results show that attitude synchronization can be fulfilled based on the multibody method described in this paper. It is also indicated that different topologies affect attitude control quality with respect to energy consumption and adjusting time. Low level topology should be adopted during formation control scheme design to achieve a better control effect.
The coordinate transforming in geography information system
International Nuclear Information System (INIS)
Zhao Xiang; Chen Gang
2003-01-01
The coordinate transforming of geography information system includes two kinds of transforming, map projection and coordinate-transforming. This paper proposed a arithmetic of coordinate-transforming, it implement the transforming between the longitude-latitude coordinate and the screen coordinate and apply it in the GIS. The preferable effect was made. (authors)
Hybrid System Design for the Coordination of Multi-Modal Aerial Robots
DEFF Research Database (Denmark)
Koo, T. John; Quottrup, Michael Melholt; Clifton, C. A.
2006-01-01
In this paper we provide a framework for the coordination of a network of heterogeneous aerial robots by using temporal logic to formulate mission speci¯cations for the network of robots. The full dynamics of the aerial robots are considered, and multiple controllers that can cope with various......¯ed. These robots are coordinated by communicating through a single occupancy table. By using the model checker Uppaal, a discrete plan that satis¯es a given temporal logic formula, speci¯ed in CTL, is generated for the robot to execute. Finally, the discrete plan for each robot is re¯ned into a discrete control...... constraints are designed to ensure that desired reachability properties can be preserved by properly switching among the controllers. A timed automaton is then constructed for preserving the temporal properties of a given robot. For di®erent types of robots, unique temporal properties can be speci...
Report on July 2015 Additional Protocol Coordinators Best Practices Workshop
Energy Technology Data Exchange (ETDEWEB)
Gitau, Ernest T.N. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Burbank, Roberta L. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Finch, Valerie A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2016-07-31
After 10 years of implementation experience, the Office of Nonproliferation and Arms Control (NPAC) within the Department of Energy/National Nuclear Security Administration (DOE/NNSA) conducted the Additional Protocol (AP) Coordinators Best Practices Workshop at Oak Ridge National Laboratory from July 29-30, 2015. The goal of this workshop was to identify implementation best practices, lessons learned, and compliance challenges from the various Additional Protocol Coordinators (APCs) at each laboratory in the DOE/NNSA complex and associated sites. The workshop provided the opportunity for participants to share their insights and establish networks that APCs can utilize to continue to discuss challenges (new and old), identify best practices, and enhance communication and coordination for reporting multi-lab research projects during review activities. Workshop participants included DOE/NNSA HQ, laboratory and site APCs, seasoned experts, members of the original implementation outreach team, and Field Element and site security representatives.
On coordinates and coordinate transformation in Einstein's theory of gravitation
International Nuclear Information System (INIS)
Chou Peiyuan
1983-01-01
This investigation is a further exposition of the significance of coordinates and their transformation in Einstein's theory of gravitation. The author considers the static axisymmetric field as an example, starts with its metric in the cylindrical coordinates, transforms this metric and the field equations into the Weyl-Levi-Civita system of coordinates, and supplements them with the harmonic condition. Both of the field equations and the harmonic condition are then transformed back to the original Cartesian system. Solutions for the static fields of an infinite plane with uniform surface density and an infinite rod with uniform linear density of matter, and of a body with spherical symmetry, are obtained again to show the necessity of the harmonic condition in their solutions. The fact that under the harmonic condition the solutions of the field equations for these problems contain their corresponding Newtonian potentials as approximations, is a strong support to the argument that the harmonic condition should be a physical supplement to Einstein's theory of gravitation. (Auth.)
Kazennikov, Oleg; Wiesendanger, Mario
2009-07-01
Music performance is based on demanding motor control with much practice from young age onward. We have chosen to investigate basic bimanual movements played by violin amateurs and professionals. We posed the question whether position and string changes, two frequent mechanisms, may influence the time interval bowing (right)-fingering (left) coordination. The objective was to measure bimanual coordination, i.e., with or without position changes and string changes. The tendency was that the bimanual coordination was statistically only slightly increased or even unchanged but not perceptible. We conclude that the coordination index is limited up to 100 ms intervals, without any erroneous perception. Although the mentioned position changes and string changes are movements with their timing, they are executed in parallel rather than in series with the bow-fingering coordination.
Unpacking Coordination Benefits in Supply Networks
DEFF Research Database (Denmark)
Petrick, Irene J.; Maitland, Carleen; Pogrebnyakov, Nicolai
2016-01-01
This paper examines how coordination among firms in supply networks generates benefits in the short and long terms for firms. It focuses on information technology (IT) and process improvement coordination. Analysis was performed on quantitative and qualitative data from a sample of SMEs in plastics...... manufacturing in Pennsylvania. Results indicate that coordination on both IT and process improvement leads to short- and long-term benefits. These relationships were mediated by the adoption of innovations (when coordinating on IT) and access to new capabilities (in process improvement coordination......). These results extend the understanding of how participation in supply networks benefits individual firms....
Stigmergy based behavioural coordination for satellite clusters
Tripp, Howard; Palmer, Phil
2010-04-01
Multi-platform swarm/cluster missions are an attractive prospect for improved science return as they provide a natural capability for temporal, spatial and signal separation with further engineering and economic advantages. As spacecraft numbers increase and/or the round-trip communications delay from Earth lengthens, the traditional "remote-control" approach begins to break down. It is therefore essential to push control into space; to make spacecraft more autonomous. An autonomous group of spacecraft requires coordination, but standard terrestrial paradigms such as negotiation, require high levels of inter-spacecraft communication, which is nontrivial in space. This article therefore introduces the principals of stigmergy as a novel method for coordinating a cluster. Stigmergy is an agent-based, behavioural approach that allows for infrequent communication with decisions based on local information. Behaviours are selected dynamically using a genetic algorithm onboard. supervisors/ground stations occasionally adjust parameters and disseminate a "common environment" that is used for local decisions. After outlining the system, an analysis of some crucial parameters such as communications overhead and number of spacecraft is presented to demonstrate scalability. Further scenarios are considered to demonstrate the natural ability to deal with dynamic situations such as the failure of spacecraft, changing mission objectives and responding to sudden bursts of high priority tasks.
CROSS LAYER COORDINATED ENERGY SAVING STRATEGY IN MANET
Institute of Scientific and Technical Information of China (English)
Xu Li; Zheng Baoyu
2003-01-01
Mobile Ad hoc NETwork (MANET) consists of a set of mobile hosts which can operate independently without infrastructure base stations. Energy saving is a critical issue for MANET since most mobile hosts will operate on battery powers. A cross layer coordinated framework for energy saving is proposed in this letter. On-demand power management, physical layer and medium access control layer dialogue based multi-packet reception, mobile agent based topology discovery and topology control based transmit power-aware and battery power-aware dynamic source routing are some of new ideas in this framework.
Adams, I.L.J.; Lust, J.M.; Wilson, P.H.; Steenbergen, B.
2017-01-01
Children with impaired motor coordination (or Development Coordination Disorder - DCD) have difficulty with the predictive control of movements, evidenced by cross-sectional studies that show impaired motor imagery and action planning abilities. What remains unclear is whether this deficit in
Study protocol: identifying and delivering point-of-care information to improve care coordination.
Hysong, Sylvia J; Che, Xinxuan; Weaver, Sallie J; Petersen, Laura A
2015-10-19
feedback sessions. Control arm PACTs will receive no intervention. PACTs will be followed prospectively for up to 1 year. This project combines both action research and implementation science methods to address important gaps in the existing care coordination literature using a partnership-based research design. It will provide an evidence-based framework for care coordination by employing a structured methodology for a systematic approach to care coordination in PACT settings and identifying the information needs that produce the most successful coordination of care. ISRCTN15412521.
Directory of Open Access Journals (Sweden)
Dariusz Kołodziej
2012-06-01
Full Text Available This paper presents examples of coordination between automatic voltage and reactive power control systems (ARST covering adjacent and strongly related extra high voltage substations. Included are conclusions resulting from the use of these solutions. The Institute of Power Engineering, Gdańsk Division has developed and deployed ARST systems in the national power system for a dozen or so years.
Coordinated Reactive Power and Voltage Management for Offshore Wind Farms with AC-connection
DEFF Research Database (Denmark)
Heussen, Kai
2008-01-01
This paper analyzes voltage and reactive power in a wind farm in dependence on switchable shunt and tap-changer settings in connection with the control ranges of flexible reactive power sources. Attention is paid to their interdependent effects on central control variables, such as voltage...... in the collection grid, reactive power exported to the grid and internal active power losses. An aggregated steady-state model of an offshore wind farm is presented and a reduced mathematical representation suitable for symbolic analysis is developed. A coordination scheme is proposed to coordinate fast continuous...... control inputs with slow tap-changing devices using a short-term prediction. The proposed scheme is aimed at balancing cost factors such as wear of switching components, active power loss within the wind farm and STATCOM capacity....
Video game-based coordinative training improves ataxia in children with degenerative ataxia.
Ilg, Winfried; Schatton, Cornelia; Schicks, Julia; Giese, Martin A; Schöls, Ludger; Synofzik, Matthis
2012-11-13
Degenerative ataxias in children present a rare condition where effective treatments are lacking. Intensive coordinative training based on physiotherapeutic exercises improves degenerative ataxia in adults, but such exercises have drawbacks for children, often including a lack of motivation for high-frequent physiotherapy. Recently developed whole-body controlled video game technology might present a novel treatment strategy for highly interactive and motivational coordinative training for children with degenerative ataxias. We examined the effectiveness of an 8-week coordinative training for 10 children with progressive spinocerebellar ataxia. Training was based on 3 Microsoft Xbox Kinect video games particularly suitable to exercise whole-body coordination and dynamic balance. Training was started with a laboratory-based 2-week training phase and followed by 6 weeks training in children's home environment. Rater-blinded assessments were performed 2 weeks before laboratory-based training, immediately prior to and after the laboratory-based training period, as well as after home training. These assessments allowed for an intraindividual control design, where performance changes with and without training were compared. Ataxia symptoms were significantly reduced (decrease in Scale for the Assessment and Rating of Ataxia score, p = 0.0078) and balance capacities improved (dynamic gait index, p = 0.04) after intervention. Quantitative movement analysis revealed improvements in gait (lateral sway: p = 0.01; step length variability: p = 0.01) and in goal-directed leg placement (p = 0.03). Despite progressive cerebellar degeneration, children are able to improve motor performance by intensive coordination training. Directed training of whole-body controlled video games might present a highly motivational, cost-efficient, and home-based rehabilitation strategy to train dynamic balance and interaction with dynamic environments in a large variety of young-onset neurologic
Energy Technology Data Exchange (ETDEWEB)
NONE
2003-07-01
Placed under the MIES control, the Committee of scientific expertise coordination defines the needs, the contain and the planing of expertises realized in function of Climate national and international decisions and negotiations calendars. The Committee verifies the different expertises and offers the administrations, scientific tools and techniques useful for the negotiations. It can also define long-dated research needs which require the scientific community mobilization. This paper provides some document of the Committee: objectives, operating and priorities of the Committee, scenarios ''Factor 4'' and ''crack technology'', perceptions and practices, developing countries (China, India...), Euromed. (A.L.B.)
Facial Muscle Coordination in Monkeys During Rhythmic Facial Expressions and Ingestive Movements
Shepherd, Stephen V.; Lanzilotto, Marco; Ghazanfar, Asif A.
2012-01-01
Evolutionary hypotheses regarding the origins of communication signals generally, and primate orofacial communication signals in particular, suggest that these signals derive by ritualization of noncommunicative behaviors, notably including ingestive behaviors such as chewing and nursing. These theories are appealing in part because of the prominent periodicities in both types of behavior. Despite their intuitive appeal, however, there are little or no data with which to evaluate these theories because the coordination of muscles innervated by the facial nucleus has not been carefully compared between communicative and ingestive movements. Such data are especially crucial for reconciling neurophysiological assumptions regarding facial motor control in communication and ingestion. We here address this gap by contrasting the coordination of facial muscles during different types of rhythmic orofacial behavior in macaque monkeys, finding that the perioral muscles innervated by the facial nucleus are rhythmically coordinated during lipsmacks and that this coordination appears distinct from that observed during ingestion. PMID:22553017
Solfo, Alessandro; van Leeuwen, Cees
2018-01-01
Sense of agency can be defined as the self-awareness of bodily movement, whereas extended agency as the self-awareness of affecting, through movement, events concomitant with movement. As a distinctive manifestation of agency, we review Spizzo's effect. This effect arises when agents coordinate their rhythmic movements with visual pulses. Once coordination is established, agents feel controlling the onset or the offset of the pulses through their movements. Spizzo's effect, therefore, constitutes a manifest case of extended agency, in which agents are aware of controlling, through movement, the pulses temporally concomitant with movement. We propose that sense of agency requires continuity of kinesthesia, which in turn requires the continuity of selfhood. The continuity of kinesthesia is necessarily deduced from the consistent kinematics observed in movements, whereas the continuity of selfhood may stem from the patterns of rhythmic coordination that humans encounter ever since intrauterine life. The primacy of these patterns in adults is in accordance with phenomena such as Spizzo's effect, which require coordination to be induced. We, therefore, propose coordination as the fundamental interaction from which selfhood, kinesthesia, and agency arise. Copyright © 2017 Cognitive Science Society, Inc.
The curvature coordinate system
DEFF Research Database (Denmark)
Almegaard, Henrik
2007-01-01
The paper describes a concept for a curvature coordinate system on regular curved surfaces from which faceted surfaces with plane quadrangular facets can be designed. The lines of curvature are used as parametric lines for the curvature coordinate system on the surface. A new conjugate set of lin...
Dopamine D1 receptor activation maintains motor coordination and balance in rats.
Avila-Luna, Alberto; Gálvez-Rosas, Arturo; Durand-Rivera, Alfredo; Ramos-Languren, Laura-Elisa; Ríos, Camilo; Arias-Montaño, José-Antonio; Bueno-Nava, Antonio
2018-02-01
Dopamine (DA) modulates motor coordination, and its depletion, as in Parkinson's disease, produces motor impairment. The basal ganglia, cerebellum and cerebral cortex are interconnected, have functional roles in motor coordination, and possess dopamine D 1 receptors (D 1 Rs), which are expressed at a particularly high density in the basal ganglia. In this study, we examined whether the activation of D 1 Rs modulates motor coordination and balance in the rat using a beam-walking test that has previously been used to detect motor coordination deficits. The systemic administration of the D 1 R agonist SKF-38393 at 2, 3, or 4 mg/kg did not alter the beam-walking scores, but the subsequent administration of the D 1 R antagonist SCH-23390 at 1 mg/kg did produce deficits in motor coordination, which were reversed by the full agonist SKF-82958. The co-administration of SKF-38393 and SCH-23390 did not alter the beam-walking scores compared with the control group, but significantly prevented the increase in beam-walking scores induced by SCH-23390. The effect of the D 1 R agonist to prevent and reverse the effect of the D 1 R antagonist in beam-walking scores is an indicator that the function of D 1 Rs is necessary to maintain motor coordination and balance in rats. Our results support that D 1 Rs mediate the SCH-23390-induced deficit in motor coordination.
Coordinates in relativistic Hamiltonian mechanics
International Nuclear Information System (INIS)
Sokolov, S.N.
1984-01-01
The physical (covariant and measurable) coordinates of free particles and covariant coordinates of the center of inertia are found for three main forms of relativistic dynamics. In the point form of dynamics, the covariant coordinates of two directly interacting particles are found, and the equations of motion are brought to the explicitly covariant form. These equations are generalized to the case of interaction with an external electromagnetic field
Bonneaud, Nathalie; Layalle, Sophie; Colomb, Sophie; Jourdan, Christophe; Ghysen, Alain; Severac, Dany; Dantec, Christelle; Nègre, Nicolas; Maschat, Florence
2017-12-15
One way to better understand the molecular mechanisms involved in the construction of a nervous system is to identify the downstream effectors of major regulatory proteins. We previously showed that Engrailed (EN) and Gooseberry-Neuro (GsbN) transcription factors act in partnership to drive the formation of posterior commissures in the central nervous system of Drosophila. In this report, we identified genes regulated by both EN and GsbN through chromatin immunoprecipitation ("ChIP on chip") and transcriptome experiments, combined to a genetic screen relied to the gene dose titration method. The genomic-scale approaches allowed us to define 175 potential targets of EN-GsbN regulation. We chose a subset of these genes to examine ventral nerve cord (VNC) defects and found that half of the mutated targets show clear VNC phenotypes when doubly heterozygous with en or gsbn mutations, or when homozygous. This strategy revealed new groups of genes never described for their implication in the construction of the nerve cord. Their identification suggests that, to construct the nerve cord, EN-GsbN may act at three levels, in: (i) sequential control of the attractive-repulsive signaling that ensures contralateral projection of the commissural axons, (ii) temporal control of the translation of some mRNAs, (iii) regulation of the capability of glial cells to act as commissural guideposts for developing axons. These results illustrate how an early, coordinated transcriptional control may orchestrate the various mechanisms involved in the formation of stereotyped neuronal networks. They also validate the overall strategy to identify genes that play crucial role in axonal pathfinding. Copyright © 2017 Elsevier Inc. All rights reserved.
Doherty, Cailbhe; Bleakley, Chris; Hertel, Jay; Caulfield, Brian; Ryan, John; Sweeney, Kevin; Delahunt, Eamonn
2015-02-01
Longitudinal analyses of participants with a history of lateral ankle sprain are lacking. This investigation combined measures of inter-joint coordination and stabilometry to evaluate eyes-open (condition 1) and eyes-closed (condition 2) static unilateral stance performance in a group of participants, 6-months after they sustained an acute, first-time lateral ankle sprain in comparison to a control group. Sixty-nine participants with a 6-month history of first-time lateral ankle sprain and 20 non-injured controls completed three 20-second unilateral stance task trials in conditions 1 and 2. An adjusted coefficient of multiple determination statistic was used to compare stance limb 3-dimensional kinematic data for similarity in the aim of establishing patterns of lower-limb inter-joint coordination. The fractal dimension of the stance limb centre of pressure path was also calculated. Between-group analyses revealed significant differences in stance limb inter-joint coordination strategies for conditions 1 and 2, and in the fractal dimension of the centre-of-pressure path for condition 2 only. Injured participants displayed increases in ankle-hip linked coordination compared to controls in condition 1 (sagittal/frontal plane: 0.15 [0.14] vs 0.06 [0.04]; η(2)=.19; sagittal/transverse plane: 0.14 [0.11] vs 0.09 [0.05]; η(2)=0.14) and condition 2 (sagittal/frontal plane: 0.15 [0.12] vs 0.08 [0.06]; η(2)=0.23), with an associated decrease in the fractal dimension of the centre-of-pressure path (injured limb: 1.23 [0.13] vs 1.36 [0.13]; η(2)=0.20). Participants with a 6-month history of first-time lateral ankle sprain exhibit a hip-dominant coordination strategy for static unilateral stance compared to non-injured controls. Copyright © 2014 Elsevier Ltd. All rights reserved.
75 FR 22607 - Board of Scientific Counselors, Coordinating Center for Infectious Diseases (CCID)
2010-04-29
... DEPARTMENT OF HEALTH AND HUMAN SERVICES Centers for Disease Control and Prevention Board of Scientific Counselors, Coordinating Center for Infectious Diseases (CCID) In accordance with section 10(a)(2) of the Federal Advisory Committee Act (Pub. L. 92-463), the Centers for Disease Control and...
45 CFR 1310.23 - Coordinated transportation.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Coordinated transportation. 1310.23 Section 1310... START PROGRAM HEAD START TRANSPORTATION Special Requirements § 1310.23 Coordinated transportation. (a) Each agency providing transportation services must make reasonable efforts to coordinate transportation...
Directory of Open Access Journals (Sweden)
Eva Maria Hammer
2014-08-01
Full Text Available Modulation of sensorimotor rhythms (SMR was suggested as a control signal for brain-computer interfaces (BCI. Yet, there is a population of users estimated between 10 to 50% not able to achieve reliable control and only about 20% of users achieve high (80-100% performance. Predicting performance prior to BCI use would facilitate selection of the most feasible system for an individual, thus constitute a practical benefit for the user, and increase our knowledge about the correlates of BCI control. In a recent study, we predicted SMR-BCI performance from psychological variables that were assessed prior to the BCI sessions and BCI control was supported with machine-learning techniques. We described two significant psychological predictors, namely the visuo-motor coordination ability and the ability to concentrate on the task. The purpose of the current study was to replicate these results thereby validating these predictors within a neurofeedback based SMR-BCI that involved no machine learning. Thirty-three healthy BCI novices participated in a calibration session and three further neurofeedback training sessions. Two variables were related with mean SMR-BCI performance: (1 A measure for the accuracy of fine motor skills, i.e. a trade for a person’s visuo-motor control ability and (2 subject’s attentional impulsivity. In a linear regression they accounted for almost 20% in variance of SMR-BCI performance, but predictor (1 failed significance. Nevertheless, on the basis of our prior regression model for sensorimotor control ability we could predict current SMR-BCI performance with an average prediction error of M = 12.07%. In more than 50% of the participants, the prediction error was smaller than 10%. Hence, psychological variables played a moderate role in predicting SMR-BCI performance in a neurofeedback approach that involved no machine learning. Future studies are needed to further consolidate (or reject the present predictors.
Optimization of strong and weak coordinates
Swart, M.; Bickelhaupt, F.M.
2006-01-01
We present a new scheme for the geometry optimization of equilibrium and transition state structures that can be used for both strong and weak coordinates. We use a screening function that depends on atom-pair distances to differentiate strong coordinates from weak coordinates. This differentiation
Coordination of plant mitochondrial biogenesis: keeping pace with cellular requirements
Welchen, Elina; García, Lucila; Mansilla, Natanael; Gonzalez, Daniel H.
2014-01-01
Plant mitochondria are complex organelles that carry out numerous metabolic processes related with the generation of energy for cellular functions and the synthesis and degradation of several compounds. Mitochondria are semiautonomous and dynamic organelles changing in shape, number, and composition depending on tissue or developmental stage. The biogenesis of functional mitochondria requires the coordination of genes present both in the nucleus and the organelle. In addition, due to their central role, all processes held inside mitochondria must be finely coordinated with those in other organelles according to cellular demands. Coordination is achieved by transcriptional control of nuclear genes encoding mitochondrial proteins by specific transcription factors that recognize conserved elements in their promoter regions. In turn, the expression of most of these transcription factors is linked to developmental and environmental cues, according to the availability of nutrients, light–dark cycles, and warning signals generated in response to stress conditions. Among the signals impacting in the expression of nuclear genes, retrograde signals that originate inside mitochondria help to adjust mitochondrial biogenesis to organelle demands. Adding more complexity, several nuclear encoded proteins are dual localized to mitochondria and either chloroplasts or the nucleus. Dual targeting might establish a crosstalk between the nucleus and cell organelles to ensure a fine coordination of cellular activities. In this article, we discuss how the different levels of coordination of mitochondrial biogenesis interconnect to optimize the function of the organelle according to both internal and external demands. PMID:24409193
Coordination of plant mitochondrial biogenesis: keeping pace with cellular requirements.
Directory of Open Access Journals (Sweden)
Elina eWelchen
2014-01-01
Full Text Available Plant mitochondria are complex organelles that carry out numerous metabolic processes related with the generation of energy for cellular functions and the synthesis and degradation of several compounds. Mitochondria are semiautonomous and dynamic organelles changing in shape, number and composition depending on tissue or developmental stage. The biogenesis of functional mitochondria requires the coordination of genes present both in the nucleus and the organelle. In addition, due to their central role, all processes held inside mitochondria must be finely coordinated with those in other organelles according to cellular demands. Coordination is achieved by transcriptional control of nuclear genes encoding mitochondrial proteins by specific transcription factors that recognize conserved elements in their promoter regions. In turn, the expression of most of these transcription factors is linked to developmental and environmental cues, according to the availability of nutrients, light-dark cycles and warning signals generated in response to stress conditions. Among the signals impacting in the expression of nuclear genes, retrograde signals that originate inside mitochondria help to adjust mitochondrial biogenesis to organelle demands. Adding more complexity, several nuclear encoded proteins are dual localized to mitochondria and either chloroplasts or the nucleus. Dual targeting might establish a crosstalk between the nucleus and cell organelles to ensure a fine coordination of cellular activities. In this article, we discuss how the different levels of coordination of mitochondrial biogenesis interconnect to optimize the function of the organelle according to both internal and external demands.
Distributed EMPC of multiple microgrids for coordinated stochastic energy management
International Nuclear Information System (INIS)
Kou, Peng; Liang, Deliang; Gao, Lin
2017-01-01
Highlights: • Reducing the system wide operating cost compared to the no-cooperation energy management strategy. • Maintaining the supply and demand balance within each microgrid. • Handling the uncertainties in both supply and demand. • Converting the stochastic optimization problems to standard quadratic and linear programming problems. • Achieving a good balance between control performance and computationally feasibility. - Abstract: The concept of multi-microgrids has the potential to improve the reliability and economic performance of a distribution system. To realize this potential, a coordination among multiple microgrids is needed. In this context, this paper presents a new distributed economic model predictive control scheme for the coordinated stochastic energy management of multi-microgrids. By optimally coordinating the operation of individual microgrids, this scheme maintains the system-wide supply and demand balance in an economical manner. Based on the probabilistic forecasts of renewable power generation and microgrid load, this scheme effectively handles the uncertainties in both supply and demand. Using the Chebyshev inequality and the Delta method, the corresponding stochastic optimization problems have been converted to quadratic and linear programs. The proposed scheme is evaluated on a large-scale case that includes ten interconnected microgrids. The results indicated that the proposed scheme successfully reduces the system wide operating cost, achieves the supply-demand balance in each microgrid, and brings the energy exchange between DNO and main grid to a predefined trajectory.
Baughn, Daniel; Auerbach, Stephen M; Siminoff, Laura A
2010-09-01
Interpersonal relations with health care providers influence families' decisions to consent to solid-organ donation. However, previous research has been based on retrospective interviews with donation-eligible families and has not directly examined the interpersonal interactions between families and organ procurement coordinators. To increase understanding of the interpersonal interaction between procurement coordinators and families during the organ donation discussion, with special attention to the influence of the sex and race of the procurement coordinator and the race of the potential donor's family. A descriptive study in which standardized patients portrayed family members interacting with actual procurement coordinators in simulated donation request scenarios. Thirty-three videotaped interactions between standardized patients and 17 procurement coordinators involving 2 different scenarios depicting deceased donation were evaluated. Video recordings were rated by independent coders. Coders completed the Impact Message Inventory-Form C, the Participatory Style of Physician Scale, and the Siminoff Communication and Content and Affect Program-Global Observer Ratings scale. African American procurement coordinators, particularly African American women, were rated as more controlling and work-oriented than white procurement coordinators. Male procurement coordinators were more affiliative with the white family than the African American family, whereas female procurement coordinators were slightly less affiliative with the white family. African American procurement coordinators expressed more positive affect when interacting with the African American family than the white family, whereas the opposite was true for white procurement coordinators. Research is needed to cross-validate these exploratory findings and further examine cultural mistrust between procurement coordinators and families of ethnic minorities, especially given the negative attitudes of many
Energy Technology Data Exchange (ETDEWEB)
Yang, Rui; Zhang, Yingchen
2016-08-01
Distributed energy resources (DERs) and smart loads have the potential to provide flexibility to the distribution system operation. A coordinated optimization approach is proposed in this paper to actively manage DERs and smart loads in distribution systems to achieve the optimal operation status. A three-phase unbalanced Optimal Power Flow (OPF) problem is developed to determine the output from DERs and smart loads with respect to the system operator's control objective. This paper focuses on coordinating PV systems and smart loads to improve the overall voltage profile in distribution systems. Simulations have been carried out in a 12-bus distribution feeder and results illustrate the superior control performance of the proposed approach.
Service Coordination Policies and Models: National Status.
Harbin, Gloria L.; Bruder, M.; Mazzarella, C.; Gabbard, G.; Reynolds, C.
This report discusses the findings of a study that investigated state coordination of early intervention services for infants, toddlers, and young children with disabilities. State Part C coordinators participated in a survey that sought their perceptions of values under girding service coordination, approach to service coordination, policies,…
Directory of Open Access Journals (Sweden)
John eKiely
2016-04-01
Full Text Available Running is a pervasive activity across human cultures and a cornerstone of contemporary health, fitness and sporting activities. Yet for the overwhelming predominance of human existence running was an essential prerequisite for survival. A means to hunt, and a means to escape when hunted. In a very real sense humans have evolved to run. Yet curiously, perhaps due to running’s cultural ubiquity and the natural ease with which we learn to run, we rarely consider the uniqueness of human bipedal running within the animal kingdom. Our unique upright, single stance, bouncing running gait imposes a unique set of coordinative difficulties. Challenges demanding we precariously balance our fragile brains in the very position where they are most vulnerable to falling injury while simultaneously retaining stability, steering direction of travel, and powering the upcoming stride: all within the abbreviated time-frames afforded by short, violent ground contacts separated by long flight times. These running coordination challenges are solved through the tightly-integrated blending of primitive evolutionary legacies, conserved from reptilian and vertebrate lineages, and comparatively modern, more exclusively human, innovations. The integrated unification of these top-down and bottom-up control processes bestows humans with an agile control system, enabling us to readily modulate speeds, change direction, negotiate varied terrains and to instantaneously adapt to changing surface conditions. The seamless integration of these evolutionary processes is facilitated by pervasive, neural and biological, activity-dependent adaptive plasticity. Over time, and with progressive exposure, this adaptive plasticity shapes neural and biological structures to best cope with regularly imposed movement challenges. This pervasive plasticity enables the gradual construction of a robust system of distributed coordinated control, comprised of processes that are so deeply
Terkildsen, Morten Deleuran; Wittrup, Inge; Burau, Viola
2015-01-01
Many highly formalised approaches to coordination poorly fit public health and recent studies call for coordination based on complex adaptive systems. Our contribution is two-fold. Empirically, we focus on public health, and theoretically we build on the patient perspective and treat coordination as a process of contingent, two-level negotiations of user needs. The paper draws on the concept of user needs-based coordination and sees coordination as a process, whereby needs emerging from the life world of the user are made amenable to the health system through negotiations. The analysis is based on an explorative case study of a health promotion initiative in Denmark. It adopts an anthropological qualitative approach and uses a range of qualitative data. The analysis identifies four strategies of coordination: the coordinator focusing on the individual user or on relations with other professionals; and the manager coaching the coordinator or providing structural support. Crucially, the coordination strategies by management remain weak as they do not directly relate to specific user needs. In process of bottom-up negotiations user needs become blurred and this is especially a challenge for management. The study therefore calls for an increased focus on the level nature of negotiations to bridge the gap that currently weakens coordination strategies by management.
Hand/Eye Coordination For Fine Robotic Motion
Lokshin, Anatole M.
1992-01-01
Fine motions of robotic manipulator controlled with help of visual feedback by new method reducing position errors by order of magnitude. Robotic vision subsystem includes five cameras: three stationary ones providing wide-angle views of workspace and two mounted on wrist of auxiliary robot arm. Stereoscopic cameras on arm give close-up views of object and end effector. Cameras measure errors between commanded and actual positions and/or provide data for mapping between visual and manipulator-joint-angle coordinates.
A Note on the Dipole Coordinates
Kageyama, Akira; Sugiyama, Tooru; Watanabe, Kunihiko; Sato, Tetsuya
2004-01-01
A couple of orthogonal coordinates for dipole geometry are proposed for numerical simulations of plasma geophysics in the Earth's dipole magnetic field. These coordinates have proper metric profiles along field lines in contrast to the standard dipole coordinate system that is commonly used in analytical studies for dipole geometry.
47 CFR 27.57 - International coordination.
2010-10-01
... COMMUNICATIONS SERVICES Technical Standards § 27.57 International coordination. (a) WCS operations in the border areas shall be subject to coordination with those countries and provide protection to non-U.S... 47 Telecommunication 2 2010-10-01 2010-10-01 false International coordination. 27.57 Section 27.57...
49 CFR 214.325 - Train coordination.
2010-10-01
..., DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.325 Train coordination. Working limits established by a roadway worker through the use of train coordination shall comply with the... 49 Transportation 4 2010-10-01 2010-10-01 false Train coordination. 214.325 Section 214.325...
Quantization in rotating co-ordinates revisited
International Nuclear Information System (INIS)
Hussain, F.; Qadir, A.
1982-07-01
Recent work on quantization in rotating co-ordinates showed that no radiation would be seen by an observer rotating with a constant angular speed. This work used a Galilean-type co-ordinate transformation. We show that the same result holds for a Lorentz-type co-ordinate system, in spite of the fact that the metric has a co-ordinate singularity at rΩ = 1. Further, we are able to define positive and negative energy modes for a particular case of a non-static, non-stationary metric. (author)
Relational Coordination in Danish General Practice
DEFF Research Database (Denmark)
Lundstrøm, Sanne Lykke
. The dissertation present the research study and a collection of three research papers prepared during the period from May 2010 to June 2014. Relational coordination and organisational social capital are measures of novel aspects of an organisation's performance. Relational coordination analyse the communication...... and relationship networks through which work is coordinated across functional and organisational boundaries. Previous studies have shown that relational coordination is positively associated with delivery of care for patients with chronic illness. Organisational social capital is used when analysing...... the psychosocial work environment in organisations, and is seen as a powerful resources for improving organisational performance. Relational coordination and organisational social capital may oer new insight and opportunities for general practice to learn. General practice provides cost-efficient, first...
Emission and null coordinates: geometrical properties and physical construction
International Nuclear Information System (INIS)
Coll, Bartolome; Ferrando, Joan J; Morales-Lladosa, Juan A
2011-01-01
A Relativistic Positioning System is defined by four clocks (emitters) broadcasting their proper time. Then, every event reached by the signals is naturally labeled by these four times which are the emission coordinates of this event. The coordinate hypersurfaces of the emission coordinates are the future light cones based on the emitter trajectories. For this reason the emission coordinates have been also named null coordinates or light coordinates. Nevertheless, other coordinate systems used in different relativistic contexts have the own right to be named null or light coordinates. Here we analyze when one can say that a coordinate is a null coordinate and when one can say that a coordinate system is null. Moreover, we examine the physical construction and the geometrical properties of several n ull coordinate systems : the emission and the reception coordinates, the radar coordinates, and the Bondi-Sachs coordinates, among others.
The unified coordination language UnCL.
F.S. de Boer (Frank); J.V. Guillen Scholten (Juan); J.F. Jacob (Joost)
2005-01-01
textabstractIn this paper we show how to use a (subset) of UML as an Unified Coordination Language (UnCL) that is based on a separation of concerns between coordination and computation. As such UnCL provides a general language for the coordination of, in particular, object-oriented applications. The
Lie, Amund
2011-01-01
In 2004 Norway implemented a food safety reform programme aimed at enhancing inter-organizational coordination processes and outcomes. Has this programme affected inter-organizational coordination processes and outcomes, both vertically and horizontally – and if so how? This article employs the concept of inter-organizational coordination as an analytical tool, examining it in the light of two theoretical perspectives and coupling it with the empirical findings. The argument presented is that the chances of strong coordination outcomes may increase if inter-organizational processes feature a clear division of labour, arenas for coordination, active leadership, a lack of major conflicting goals, and shared obligations.
Partnering Against Cancer Today: A Blueprint for Coordinating Efforts Through Communication Science
2013-01-01
One of the hallmarks of the communication revolution over the past decade has been its support for participation, whether that be in the active engagement of patients searching the Web for answers to vital health questions, or in the collective energies of self-organizing communities through social media. At the same time, some of the major obstacles to achieving a full and equitable reach of evidence-based cancer control knowledge have been traced back to discontinuities in communication either within clinical care or the broader public awareness system. Communication scientists from the National Cancer Institute, the Centers for Disease Control and Prevention, and the American Cancer Society joined forces in 2010 to investigate ways in which communication science can be used to improve coordination and enhance participation in cancer control for the nation. From 2010 to 2013, the three organizations worked together in 1) convening two meetings designed to assess the status of funded research in communication science, 2) completing a systematic review of literature published over the previous 10 years, and 3) authoring a blueprint for coordinated efforts using the implications of communication science. The blueprint consists of three major goals: first, to identify high-yield targets of opportunity using the health impact pyramid articulated by Centers for Disease Control and Prevention Director, Thomas Frieden; second, to leverage opportunities within the new communication environment, including the opportunities catalyzed by national efforts to create an infrastructure for evidence implementation through health information technology; and third, to assist in coordinating efforts across collaborative entities through participative media. PMID:24395998
Interpersonal Coordination of Head Motion in Distressed Couples
Hammal, Zakia; Cohn, Jeffrey F.; George, David T.
2015-01-01
In automatic emotional expression analysis, head motion has been considered mostly a nuisance variable, something to control when extracting features for action unit or expression detection. As an initial step toward understanding the contribution of head motion to emotion communication, we investigated the interpersonal coordination of rigid head motion in intimate couples with a history of interpersonal violence. Episodes of conflict and non-conflict were elicited in dyadic interaction tasks and validated using linguistic criteria. Head motion parameters were analyzed using Student’s paired t-tests; actor-partner analyses to model mutual influence within couples; and windowed cross-correlation to reveal dynamics of change in direction of influence over time. Partners’ RMS angular displacement for yaw and RMS angular velocity for pitch and yaw each demonstrated strong mutual influence between partners. Partners’ RMS angular displacement for pitch was higher during conflict. In both conflict and non-conflict, head angular displacement and angular velocity for pitch and yaw were strongly correlated, with frequent shifts in lead-lag relationships. The overall amount of coordination between partners’ head movement was more highly correlated during non-conflict compared with conflict interaction. While conflict increased head motion, it served to attenuate interpersonal coordination. PMID:26167256
Photoactive devices including porphyrinoids with coordinating additives
Forrest, Stephen R; Zimmerman, Jeramy; Yu, Eric K; Thompson, Mark E; Trinh, Cong; Whited, Matthew; Diev, Vlacheslav
2015-05-12
Coordinating additives are included in porphyrinoid-based materials to promote intermolecular organization and improve one or more photoelectric characteristics of the materials. The coordinating additives are selected from fullerene compounds and organic compounds having free electron pairs. Combinations of different coordinating additives can be used to tailor the characteristic properties of such porphyrinoid-based materials, including porphyrin oligomers. Bidentate ligands are one type of coordinating additive that can form coordination bonds with a central metal ion of two different porphyrinoid compounds to promote porphyrinoid alignment and/or pi-stacking. The coordinating additives can shift the absorption spectrum of a photoactive material toward higher wavelengths, increase the external quantum efficiency of the material, or both.
Directory of Open Access Journals (Sweden)
Morten Deleuran Terkildsen
2015-09-01
Full Text Available Introduction: Many highly formalised approaches to coordination poorly fit public health and recent studies call for coordination based on complex adaptive systems. Our contribution is two-fold. Empirically, we focus on public health, and theoretically we build on the patient perspective and treat coordination as a process of contingent, two-level negotiations of user needs.Theory and Methods: The paper draws on the concept of user needs-based coordination and sees coordination as a process, whereby needs emerging from the life world of the user are made amenable to the health system through negotiations. The analysis is based on an explorative case study of a health promotion initiative in Denmark. It adopts an anthropological qualitative approach and uses a range of qualitative data.Results: The analysis identifies four strategies of coordination: the coordinator focusing on the individual user or on relations with other professionals; and the manager coaching the coordinator or providing structural support. Crucially, the coordination strategies by management remain weak as they do not directly relate to specific user needs.Discussion: In process of bottom-up negotiations user needs become blurred and this is especially a challenge for management. The study therefore calls for an increased focus on the level nature of negotiations to bridge the gap that currently weakens coordination strategies by management.
Yoo, Ji Won; Lee, Dong Ryul; Cha, Young Joo; You, Sung Hyun
2017-01-01
The purpose of the present study was to compare therapeutic effects of an electromyography (EMG) biofeedback augmented by virtual reality (VR) and EMG biofeedback alone on the triceps and biceps (T:B) muscle activity imbalance and elbow joint movement coordination during a reaching motor taskOBJECTIVE: To compare therapeutic effects of an electromyography (EMG) biofeedback augmented by virtual reality (VR) and EMG biofeedback alone on the triceps and biceps muscle activity imbalance and elbow joint movement coordination during a reaching motor task in normal children and children with spastic cerebral palsy (CP). 18 children with spastic CP (2 females; mean±standard deviation = 9.5 ± 1.96 years) and 8 normal children (3 females; mean ± standard deviation = 9.75 ± 2.55 years) were recruited from a local community center. All children with CP first underwent one intensive session of EMG feedback (30 minutes), followed by one session of the EMG-VR feedback (30 minutes) after a 1-week washout period. Clinical tests included elbow extension range of motion (ROM), biceps muscle strength, and box and block test. EMG triceps and biceps (T:B) muscle activity imbalance and reaching movement acceleration coordination were concurrently determined by EMG and 3-axis accelerometer measurements respectively. Independent t-test and one-way repeated analysis of variance (ANOVA) were performed at p augmented by virtual reality exercise games in children with spastic CP. The augmented EMG and VR feedback produced better neuromuscular balance control in the elbow joint than the EMG biofeedback alone.
Quantifying linguistic coordination
DEFF Research Database (Denmark)
Fusaroli, Riccardo; Tylén, Kristian
task (Bahrami et al 2010, Fusaroli et al. 2012) we extend to linguistic coordination dynamical measures of recurrence employed in the analysis of sensorimotor coordination (such as heart-rate (Konvalinka et al 2011), postural sway (Shockley 2005) and eye-movements (Dale, Richardson and Kirkham 2012......). We employ nominal recurrence analysis (Orsucci et al 2005, Dale et al 2011) on the decision-making conversations between the participants. We report strong correlations between various indexes of recurrence and collective performance. We argue this method allows us to quantify the qualities...
METHOD FOR DETERMINING THE SPATIAL COORDINATES IN THE ACTIVE STEREOSCOPIC SYSTEM
Directory of Open Access Journals (Sweden)
Valery V. Korotaev
2014-11-01
Full Text Available The paper deals with the structural scheme of active stereoscopic system and algorithm of its operation, providing the fast calculation of the spatial coordinates. The system includes two identical cameras, forming a stereo pair, and a laser scanner, which provides vertical scanning of the space before the system by the laser beam. A separate synchronizer provides synchronous operation of the two cameras. The developed algorithm of the system operation is implemented in MATLAB. In the proposed algorithm, the influence of background light is eliminated by interframe processing. The algorithm is based on precomputation of coordinates for epipolar lines and corresponding points in stereoscopic image. These data are used to quick calculation of the three-dimensional coordinates of points that form the three-dimensional images of objects. Experiment description on a physical model is given. Experimental results confirm the efficiency of the proposed active stereoscopic system and its operation algorithm. The proposed scheme of active stereoscopic system and calculating method for the spatial coordinates can be recommended for creation of stereoscopic systems, operating in real time and at high processing speed: devices for face recognition, systems for the position control of railway track, automobile active safety systems.
Coordinator, Translation Services | IDRC - International ...
International Development Research Centre (IDRC) Digital Library (Canada)
The Coordinator, Translation Services coordinates the overall operations of the ... services in IDRC by acting as the main resource person for internal clients ... all operational issues in order to ensure good quality products delivered on time.
Kostrubiec, Viviane; Huys, Raoul; Jas, Brunhilde; Kruck, Jeanne
2018-01-01
Abnormal perceptual-motor coordination is hypothesized here to be involved in social deficits of autism spectrum disorder (ASD). To test this hypothesis, high functioning children with ASD and typical controls, similar in age as well as verbal and perceptive performance, performed perceptual-motor coordination tasks and several social competence…
Predictive Analytics for Coordinated Optimization in Distribution Systems
Energy Technology Data Exchange (ETDEWEB)
Yang, Rui [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2018-04-13
This talk will present NREL's work on developing predictive analytics that enables the optimal coordination of all the available resources in distribution systems to achieve the control objectives of system operators. Two projects will be presented. One focuses on developing short-term state forecasting-based optimal voltage regulation in distribution systems; and the other one focuses on actively engaging electricity consumers to benefit distribution system operations.
Jian, Chongshu; Xu, Fengli; Hou, Tingting; Sun, Tao; Li, Jinghang; Cheng, Heping; Wang, Xianhua
2017-08-01
Prohibitins (PHBs; prohibitin 1, PHB1 or PHB, and prohibitin 2, PHB2) are evolutionarily conserved and ubiquitously expressed mitochondrial proteins. PHBs form multimeric ring complexes acting as scaffolds in the inner mitochondrial membrane. Mitochondrial flashes (mitoflashes) are newly discovered mitochondrial signaling events that reflect electrical and chemical excitations of the organelle. Here, we investigate the possible roles of PHBs in the regulation of mitoflash signaling. Downregulation of PHBs increases mitoflash frequency by up to 5.4-fold due to elevated basal reactive oxygen species (ROS) production in the mitochondria. Mechanistically, PHB deficiency impairs the formation of mitochondrial respiratory supercomplexes (RSCs) without altering the abundance of individual respiratory complex subunits. These impairments induced by PHB deficiency are effectively rescued by co-expression of PHB1 and PHB2, indicating that the multimeric PHB complex acts as the functional unit. Furthermore, downregulating other RSC assembly factors, including SCAFI (also known as COX7A2L), RCF1a (HIGD1A), RCF1b (HIGD2A), UQCC3 and SLP2 (STOML2), all activate mitoflashes through elevating mitochondrial ROS production. Our findings identify the PHB complex as a new regulator of RSC formation and mitoflash signaling, and delineate a general relationship among RSC formation, basal ROS production and mitoflash biogenesis. © 2017. Published by The Company of Biologists Ltd.
Hall effect in noncommutative coordinates
International Nuclear Information System (INIS)
Dayi, Oemer F.; Jellal, Ahmed
2002-01-01
We consider electrons in uniform external magnetic and electric fields which move on a plane whose coordinates are noncommuting. Spectrum and eigenfunctions of the related Hamiltonian are obtained. We derive the electric current whose expectation value gives the Hall effect in terms of an effective magnetic field. We present a receipt to find the action which can be utilized in path integrals for noncommuting coordinates. In terms of this action we calculate the related Aharonov-Bohm phase and show that it also yields the same effective magnetic field. When magnetic field is strong enough this phase becomes independent of magnetic field. Measurement of it may give some hints on spatial noncommutativity. The noncommutativity parameter θ can be tuned such that electrons moving in noncommutative coordinates are interpreted as either leading to the fractional quantum Hall effect or composite fermions in the usual coordinates
Coordinated Speed Oscillations in Schooling Killifish Enrich Social Communication
Swain, Daniel T.; Couzin, Iain D.; Leonard, Naomi Ehrich
2015-10-01
We examine the spatial dynamics of individuals in small schools of banded killifish ( Fundulus diaphanus) that exhibit rhythmic, oscillating speed, typically with sustained, coordinated, out-of-phase speed oscillations as they move around a shallow water tank. We show that the relative motion among the fish yields a periodically time-varying network of social interactions that enriches visually driven social communication. The oscillations lead to the regular making and breaking of occlusions, which we term "switching." We show that the rate of convergence to consensus (biologically, the capacity for individuals in groups to achieve effective coordinated motion) governed by the switching outperforms static alternatives, and performs as well as the less practical case of every fish sensing every other fish. We show further that the oscillations in speed yield oscillations in relative bearing between fish over a range that includes the angles previously predicted to be optimal for a fish to detect changes in heading and speed of its neighbors. To investigate systematically, we derive and analyze a dynamic model of interacting agents that move with oscillatory speed. We show that coordinated circular motion of the school leads to systematic cycling of spatial ordering of agents and possibilities for enriched spatial density of measurements of the external environment. Our results highlight the potential benefits of dynamic communication topologies in collective animal behavior, and suggest new, useful control laws for the distributed coordination of mobile robotic networks.
Directory of Open Access Journals (Sweden)
С. І. Марченко
2015-06-01
Full Text Available The research objective is to experimentally verify the effectiveness of the use of rhythmic gymnastics means that have been systematized to develop coordination abilities in girls of primary school age. Research methods: method of theoretical analysis and generalization of literary sources, method of control studies, pedagogical experiment, methods of mathematical statistics. Research results. The coordination readiness level evaluation demonstrated that at the beginning of the pedagogical experiment the level of the majority of the second-grade girls was low (22.85%, below average (39.97%, and average (11.42%; that of the third-grade girls was below average (57.1%, average (34.26%; and that of the fourth-grade — below average (29.3%, and average (62.06%. After the pedagogical experiment the number of the second-, third- and fourth-grade girls with the low level decreased by 19%, 13.4%, 10.4% in the experimental groups and by 16.3%, 11.8%, 9.8% in the control groups respectively; the number of the girls with the below-average level decreased by 14.7%, 32.7%, 23.1% in the experimental groups and by 12.4%, 21%, 19.1% in the control groups. The positive changes in the level of coordination abilities occurred both in the control and the experimental groups, with the results improved in favor of the experimental groups.
Tan, Heidi Siew Khoon; Yeo, Doreen Sai Ching; Giam, Joanna Yu Ting; Cheong, Florence Wai Fong; Chan, Kay Fei
2016-04-07
Return-to-work (RTW) programmes for injured workers have been prevalent in Western countries with established work injury management policies for decades. In recent years, more Asian countries have started to develop RTW programmes in the absence of work injury management policies. However, few studies have evaluated the effectiveness of RTW programmes in Asia. Return-to-work coordination has been found to be an important facilitator in RTW programmes. This study seeks to determine the effectiveness of a Return-to-work coordinator (RTWC) model of care in facilitating early RTW for injured workers in Singapore. A randomized controlled trial was used. 160 injured workers in a general hospital were randomly allocated to either control (receive usual hospital standard care) or intervention (assigned a RTWC) group. The RTWC closely supported RTW arrangements and proactively liaised with employers and healthcare professionals on RTW solutions for the injured workers. At three months post injury, workers in the intervention group RTW 10 days earlier than the control group, with a higher proportion of workers in the intervention group returning to modified jobs. There were no significant differences in the quality of life measures between the two groups. The addition of a RTWC into the hospital model of care is effective in facilitating early RTW for injured workers. This could be a potential model of care for injured workers in Asian countries where work injury management policies are not yet established.
Version II of the ISACS Intelligent Coordinator: object-oriented design and implementation
International Nuclear Information System (INIS)
Liholt, V.; Miazza, P.
1993-03-01
Within the Integrated Surveillance And Control System (ISACS-1)prototype coupled to the NORS PWR simulator, the Intelligent Coordinator (IC) is a central software module. It provides for example the operators with high-level knowledge on the overall plant status. This is performed through the integration of information fetched from the process and different Computerised Operator Support Systems. In 1991, the first version of ISACS and its associated Intelligent Information Coordinator came into operation. During initial ISACS-1 test runs, minor malfunctions were evidently detected in the IC software. At the same time, new reasoning capabilities were also required. A careful analysis of the IC software, implemented with the software shell G2, revealed that its software structure did not allow any easy extension. This report presents in detail the object-oriented redesign of the Intelligent Coordinator of ISACS-1 Firstly, the main capabilities of the Intelligent Coordinator are recalled. Then, the different object classes composing the application are commented in detail The implementation of this new design with the G2 software shell is illustrated through examples. This allows us at the same time to comment our experiences made with the G2 tool. Finally, a quantitative comparison between the successive versions of the Intelligent Coordinator shows clearly the improvements achieved by this object-oriented redesign. A drastic reduction of the number of production rules attests that a better representation of the plant expert knowledge embedded in the Intelligent Coordinator has been achieved. (author)
International Nuclear Information System (INIS)
2001-04-01
Vibrio spp. comprises an important group of pathogenic bacteria in food that often causes human illness and even death when the contaminated food is consumed raw or improperly cooked. The most dangerous member of this group, the El Tor strain of V. cholerae, was responsible for the cholera pandemic which started in Peru in 1991 and spread to nearby countries, resulting in hundreds of thousands of cases and thousands of deaths. Recognizing the role of irradiation to ensure the microbiological safety of food, the Pan American Health Organization of the World Health Organization and the Joint FAO/IAEA Division of Nuclear Techniques in Food and Agriculture jointly sponsored a Co-ordinated Research Project (CRP) on the Use of Irradiation as a Public Health Intervention Measure to Control Foodborne Diseases in Latin America and the Caribbean, to assess the efficacy of this technology for food protection. The CRP was initiated in 1993 and concluded in 1998. The results of this CRP demonstrated that irradiation is effective for ensuring the microbiological safety of food naturally contaminated by Vibrio spp. This process offers unique benefits for decontamination of seafood, often contaminated with this group of aquatic bacteria at the source, and fresh vegetables that may be contaminated during production and handling, especially when these products are consumed raw or not thoroughly cooked. Because of the sensitivity of this group of bacteria to radiation, the dose required to ensure microbiological safety of food against them is not more than 1 kGy. The CRP also generated data on the effectiveness of irradiation to control infection by pork tapeworm (Taenia solium metacestode). However, the results of these studies were not conclusive enough for publication. This publication presents the research results reported at the final Research Co-ordination meeting on this CRP held in Havana, Cuba, 16-20 November 1998
Energy Technology Data Exchange (ETDEWEB)
NONE
2001-04-01
Vibrio spp. comprises an important group of pathogenic bacteria in food that often causes human illness and even death when the contaminated food is consumed raw or improperly cooked. The most dangerous member of this group, the El Tor strain of V. cholerae, was responsible for the cholera pandemic which started in Peru in 1991 and spread to nearby countries, resulting in hundreds of thousands of cases and thousands of deaths. Recognizing the role of irradiation to ensure the microbiological safety of food, the Pan American Health Organization of the World Health Organization and the Joint FAO/IAEA Division of Nuclear Techniques in Food and Agriculture jointly sponsored a Co-ordinated Research Project (CRP) on the Use of Irradiation as a Public Health Intervention Measure to Control Foodborne Diseases in Latin America and the Caribbean, to assess the efficacy of this technology for food protection. The CRP was initiated in 1993 and concluded in 1998. The results of this CRP demonstrated that irradiation is effective for ensuring the microbiological safety of food naturally contaminated by Vibrio spp. This process offers unique benefits for decontamination of seafood, often contaminated with this group of aquatic bacteria at the source, and fresh vegetables that may be contaminated during production and handling, especially when these products are consumed raw or not thoroughly cooked. Because of the sensitivity of this group of bacteria to radiation, the dose required to ensure microbiological safety of food against them is not more than 1 kGy. The CRP also generated data on the effectiveness of irradiation to control infection by pork tapeworm (Taenia solium metacestode). However, the results of these studies were not conclusive enough for publication. This publication presents the research results reported at the final Research Co-ordination meeting on this CRP held in Havana, Cuba, 16-20 November 1998.
DEFF Research Database (Denmark)
Crone, Steven A.; Quinlan, Katharina A.; Zagoraiou, Laskaro
2008-01-01
The initiation and coordination of activity in limb muscles are the main functions of neural circuits that control locomotion. Commissural neurons connect locomotor circuits on the two sides of the spinal cord, and represent the known neural substrate for left-right coordination. Here we......-extensor coordination is unaffected. Anatomical tracing studies reveal a direct excitatory input of V2a interneurons onto commissural interneurons, including a set of molecularly defined V0 neurons that drive left-right alternation. Our findings imply that the neural substrate for left-right coordination consists...... of at least two components; commissural neurons and a class of ipsilateral interneurons that activate commissural pathways....
Three coordination compounds based on benzene tetracarboxylate ...
Indian Academy of Sciences (India)
YUNLONG WU
nescence, considerable attention has been focused on the construction of coordination .... measurements were performed on ground powder samples at .... Figure 2. (a) Coordination environment of Co1 ion in compound 2. (b) Coordination.
Constraint Handling within a Multi-blade Coordinate Framework of a Wind Turbine
DEFF Research Database (Denmark)
Henriksen, Lars Christian; Poulsen, Niels Kjølstad; Niemann, Hans Henrik
2011-01-01
In this paper the control of a horizontal axis pitch controlled wind turbine using Model Predictive Control is presented. The multi-blade coordinate transformation is utilized to turn the rotating frame time-varying system description into a time-invariant fixed frame system description. Constrai....... Constraints in the rotating frame of reference are not easily described in the fixed frame and a Model Predictive Control formulation accommodating this problem is presented. The presented method is tested with satisfactory results in a numerical simulation....
Transformation procedures in 3D terrestrial coordinate systems
Directory of Open Access Journals (Sweden)
Sedlák Vladimír
2001-12-01
Full Text Available Transformation procedures belong to the main tasks of surveyor working in a field of geodesy, for example in satellite geodesy or astronomical geodesy. It is necessary to know transformation procedures in 3D terrestrial (Earth coordinate systems. Increasingly a dynamic advance growth of application of satellite navigation systems, for example GPS (Global Positioning System into engineering surveying, real estate register and others spheres of applied geodesy and geo-surveying (mine surveying exacts knowledge of these transformation procedures between coordinates in various coordinate systems. These tasks are common for daily work for various practical surveyors too, not only for theoretical scientific working surveyors.Conventional Terrestrial System is 3D coordinate system what is the most important coordinate system in global geodesy. Conventional Terrestrial System is an approximation of the nature coordinate system of the Earth. The origin of this coordinate system is placed in the earth substantial centre of gravity and in the centre of geoid. Conventional Terrestrial System is the Cartesian right-handed coordinate system, i.e. positive one. The Local Astronomical System is 3D coordinate system too and it belongs to an important coordinate system in geodesy from its practical point of view. Many geodetic measurements are realized in this coordinate system. Designation of this coordinate system as astronomical system expresses its sticking to a normal line to an equipotential plane, i.e. to a vertical. Local Astronomical system is the left-handed cartesian coordinate system.Transformation procedures in 3D terrestrial coordinate systems with theory of these systems are presented in the paper. Transformation in the local astronomical coordinate system presents common transformation in a frame of an adjustment of various local geodetic networks. In a case of satellite measurements (GPS, satellite altimetry, etc. transformation between local and
On the Internal Model Principle in the Coordination of Nonlinear Systems
De Persis, C.; Jayawardhana, B.
2014-01-01
The role of the internal model principle is investigated in this paper for the coordination of relative-degree-one and relative-degree-two nonlinear systems. For relative-degree-one systems that are incrementally (output-feedback) passive, we propose internal-model-based distributed control laws
Impaired Interlimb Coordination of Voluntary Leg Movements in Poststroke Hemiparesis
Tseng, Shih-Chiao
2010-01-01
Appropriate interlimb coordination of the lower extremities is particularly important for a variety of functional human motor behaviors such as jumping, kicking a ball, or simply walking. Specific interlimb coordination patterns may be especially impaired after a lesion to the motor system such as stroke, yet this has not been thoroughly examined to date. The purpose of this study was to investigate the motor deficits in individuals with chronic stroke and hemiparesis when performing unilateral versus bilateral inphase versus bilateral antiphase voluntary cyclic ankle movements. We recorded ankle angular trajectories and muscle activity from the dorsiflexors and plantarflexors and compared these between subjects with stroke and a group of healthy age-matched control subjects. Results showed clear abnormalities in both the kinematics and EMG of the stroke subjects, with significant movement degradation during the antiphase task compared with either the unilateral or the inphase task. The abnormalities included prolonged cycle durations, reduced ankle excursions, decreased agonist EMG bursts, and reduced EMG modulation across movement phases. By comparison, the control group showed nearly identical performance across all task conditions. These findings suggest that stroke involving the corticospinal system projection to the leg specifically impairs one or more components of the neural circuitry involved in lower extremity interlimb coordination. The express susceptibility of the antiphase pattern to exaggerated motor deficits could contribute to functional deficits in a number of antiphase leg movement tasks, including walking. PMID:20463199
[Binocular coordination during reading].
Bassou, L; Granié, M; Pugh, A K; Morucci, J P
1992-01-01
Is there an effect on binocular coordination during reading of oculomotor imbalance (heterophoria, strabismus and inadequate convergence) and of functional lateral characteristics (eye preference and perceptually privileged visual laterality)? Recordings of the binocular eye-movements of ten-year-old children show that oculomotor imbalances occur most often among children whose left visual perceptual channel is privileged, and that these subjects can present optomotor dissociation and manifest lack of motor coordination. Close binocular motor coordination is far from being the norm in reading. The faster reader displays saccades of differing spatial amplitude and the slower reader an oculomotor hyperactivity, especially during fixations. The recording of binocular movements in reading appears to be an excellent means of diagnosing difficulties related to visual laterality and to problems associated with oculomotor imbalance.
Directory of Open Access Journals (Sweden)
Tran Thai Trung
2014-10-01
Full Text Available Since the penetration level of wind energy is continuously increasing, the negative impact caused by the fluctuation of wind power output needs to be carefully managed. This paper proposes a novel real-time coordinated control algorithm based on a wavelet transform to mitigate both short-term and long-term fluctuations by using a hybrid energy storage system (HESS. The short-term fluctuation is eliminated by using an electric double-layer capacitor (EDLC, while the wind-HESS system output is kept constant during each 10-min period by a Ni-MH battery (NB. State-of-charge (SOC control strategies for both EDLC and NB are proposed to maintain the SOC level of storage within safe operating limits. A ramp rate limitation (RRL requirement is also considered in the proposed algorithm. The effectiveness of the proposed algorithm has been tested by using real time simulation. The simulation model of the wind-HESS system is developed in the real-time digital simulator (RTDS/RSCAD environment. The proposed algorithm is also implemented as a user defined model of the RSCAD. The simulation results demonstrate that the HESS with the proposed control algorithm can indeed assist in dealing with the variation of wind power generation. Moreover, the proposed method shows better performance in smoothing out the fluctuation and managing the SOC of battery and EDLC than the simple moving average (SMA based method.
Zhu, Yi-Ching; Wu, Sheng K.; Cairney, John
2011-01-01
The purpose of this study was to investigate the associations between obesity and motor coordination ability in Taiwanese children with and without developmental coordination disorder (DCD). 2029 children (1078 boys, 951 girls) aged nine to ten years were chosen randomly from 14 elementary schools across Taiwan. We used bioelectrical impedance…
Sung, Paul S
2016-04-01
This study examined coordination of the spine and pelvis during lateral bending of the trunk in older adults. Thirty-four healthy subjects (17 young and 17 older adults) demonstrated lateral bending at a controlled speed while holding a bar at approximately 180 degrees of shoulder flexion. Kinematic data collection was completed on the thoracic spine, lumbar spine, and pelvis. The coupling angle was calculated to examine the thorax-lumbar, lumbar-pelvis, and thorax-pelvis coordination patterns. The older adults demonstrated a reduced range of motion (ROM) of the lumbar spine, while both groups revealed similar ROM in the thorax and in the pelvis. The coupling angle between the straightening and bending phases was different only for the older adults in the thorax-lumbar (23.4±8.0 vs. -1.6±4.4, p=0.004) and the lumbar-pelvis (65.4±7.2 vs. 86.1±7.8, p=0.001) coordination. However, there was no group difference in the thorax-pelvis coordination. These findings indicate that age-related changes in the lumbar region affect coordination patterns only during the bending phase. The older adults preserved a similar pattern of movement to the young adults during the straightening phase, but the coordination variability of the coupling angles was greater for the older adults than for the young adults. This movement pattern suggests that the older adults lacked consistent trunk control in an attempt to optimize lateral bending coordination. Copyright © 2016 Elsevier B.V. All rights reserved.
Coordination Devices in the Refurbishment Design Process: A Partial-Correlation Approach
Directory of Open Access Journals (Sweden)
Azlan Shah Ali
2009-12-01
Full Text Available Building refurbishment is an important sector in the Malaysian construction industry. The increase the number of building renovations, alterations, extensions and extensive repair works contributed to the high demand for refurbishment projects. However, refurbishment projects are more difficult to manage compared to new-built, due to uncertainty factors inherent in the projects. Therefore, this paper identifies factors that contributed to uncertainty and shows how it affects design performance of refurbishment projects. This paper was also extended to the used of coordination devices to improve design performance from the effect of uncertainty in the projects. Partial-correlation technique was used in data analysis to check any significant moderate effects of coordination devices to control the negative effect of uncertainty on design performance of refurbishment projects. Four (4 coordination devices involved in the partial-correlation tests. The results concluded that the use of lateral relations and architect’s characteristics are most likely reducing the uncertainty of client attributes towards design completeness before work started on site.
The committee of scientific expertise coordination
International Nuclear Information System (INIS)
2003-01-01
Placed under the MIES control, the Committee of scientific expertise coordination defines the needs, the contain and the planing of expertises realized in function of Climate national and international decisions and negotiations calendars. The Committee verifies the different expertises and offers the administrations, scientific tools and techniques useful for the negotiations. It can also define long-dated research needs which require the scientific community mobilization. This paper provides some document of the Committee: objectives, operating and priorities of the Committee, scenarios ''Factor 4'' and ''crack technology'', perceptions and practices, developing countries (China, India...), Euromed. (A.L.B.)
Parenting Coordinators' Practices Recommendations: A Qualitative Study
Hirsch, Barbara Phyllis
2016-01-01
This qualitative study used a phenomenological approach to understand the experiences of seven parenting coordinators in using parenting coordination practices that they have found to be effective and would recommend to other parenting coordinators to achieve the following goals: educating parents, increasing the quality of parenting and co-parenting, managing conflict, and involving children and other family members in the process of parenting coordination. Data were collected with semi-str...
Czech Academy of Sciences Publication Activity Database
Steiner, Jakub
-, č. 274 (2005), s. 1-26 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : coordination * crises * cycles and fluctuations Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp274.pdf
Coordinating Work with Groupware
DEFF Research Database (Denmark)
Pors, Jens Kaaber; Simonsen, Jesper
2003-01-01
One important goal of employing groupware is to make possible complex collaboration between geographically distributed groups. This requires a dual transformation of both technology and work practice. The challenge is to reduce the complexity of the coordination work by successfully inte....... Using the CSCW framework of coordination mechanisms, we have elicited six general factors influencing the integration of the groupware application in two situations....
Flexible Working and Couples' Coordination of Time Schedules
Bryan, Mark L.; Sevilla Sanz, Almudena
2014-01-01
Using previously unexploited data on time scheduling in the employment and household contexts, we investigate the effect of flexible working on couples' coordination of their daily work time schedules in the UK. We consider three distinct dimensions of flexible working: flexibility of daily start and finish times (flexitime), flexibility of work times over the year (annualised hours), and generalised control of working hours. We find that in couples with flexitime there is greater spouse sync...
International Nuclear Information System (INIS)
Kamphuis, I.G.; Hommelberg, M.P.F.; Warmer, C.J.; Kok, J.K.
2007-01-01
Different driving forces push the electricity production towards decentralization. The projected increase of distributed power generation on the residential level with an increasing proportion of intermittent renewable energy resources poses problems for continuously matching the energy balance when coordination takes place centrally. On the other hand, new opportunities arise by intelligent clustering of generators and demand in so-called Virtual Power Plants. Part of the responsibility for new coordination mechanisms, then, has to be laid locally. To achieve this, the current electricity infrastructure is expected to evolve into a network of networks (including ICT (Information and Communication Technology)-networks), in which all system parts communicate with one another, are aware of each other's context and may influence each other. In this paper, a multi-agent systems approach, using price signal-vectors from an electronic market is presented as an appropriate technology needed for massive control and coordination tasks in these future electricity networks. The PowerMatcher, a market-based control concept for supply and demand matching (SDM) in electricity networks, is discussed. The results within a simulation study show the ability to raise the simultaneousness of electricity production and consumption within (local) control clusters with cogeneration and heat-pumps by exchanging price signals and coordinated allocation using market algorithms. The control concept, however, can also be applied in other business cases like reduction of imbalance cost in commercial portfolios or virtual power plant operators, utilizing distributed generators. Furthermore, a PowerMatcher-based field test configuration with 15 Stirling-engine powered micro-CHP's is described, which is currently in operation within a field test in the Netherlands
2010-01-01
... 7 Agriculture 6 2010-01-01 2010-01-01 false Coordination. 624.5 Section 624.5 Agriculture Regulations of the Department of Agriculture (Continued) NATURAL RESOURCES CONSERVATION SERVICE, DEPARTMENT OF AGRICULTURE WATER RESOURCES EMERGENCY WATERSHED PROTECTION § 624.5 Coordination. (a) If the President declares...
The shallow water equations in Lagrangian coordinates
International Nuclear Information System (INIS)
Mead, J.L.
2004-01-01
Recent advances in the collection of Lagrangian data from the ocean and results about the well-posedness of the primitive equations have led to a renewed interest in solving flow equations in Lagrangian coordinates. We do not take the view that solving in Lagrangian coordinates equates to solving on a moving grid that can become twisted or distorted. Rather, the grid in Lagrangian coordinates represents the initial position of particles, and it does not change with time. We apply numerical methods traditionally used to solve differential equations in Eulerian coordinates, to solve the shallow water equations in Lagrangian coordinates. The difficulty with solving in Lagrangian coordinates is that the transformation from Eulerian coordinates results in solving a highly nonlinear partial differential equation. The non-linearity is mainly due to the Jacobian of the coordinate transformation, which is a precise record of how the particles are rotated and stretched. The inverse Jacobian must be calculated, thus Lagrangian coordinates cannot be used in instances where the Jacobian vanishes. For linear (spatial) flows we give an explicit formula for the Jacobian and describe the two situations where the Lagrangian shallow water equations cannot be used because either the Jacobian vanishes or the shallow water assumption is violated. We also prove that linear (in space) steady state solutions of the Lagrangian shallow water equations have Jacobian equal to one. In the situations where the shallow water equations can be solved in Lagrangian coordinates, accurate numerical solutions are found with finite differences, the Chebyshev pseudospectral method, and the fourth order Runge-Kutta method. The numerical results shown here emphasize the need for high order temporal approximations for long time integrations
Managing interteam coordination within and between organizations
de Vries, Thomas Arend
2015-01-01
To accomplish complex tasks and effectively respond to environmental contingencies, teams must coordinate task-related issues with other teams (i.e., interteam coordination). Regrettably, interteam coordination is often complicated by misunderstandings that can arise from differences in teams’
Mitochondrial nucleoid interacting proteins support mitochondrial protein synthesis.
He, J; Cooper, H M; Reyes, A; Di Re, M; Sembongi, H; Litwin, T R; Gao, J; Neuman, K C; Fearnley, I M; Spinazzola, A; Walker, J E; Holt, I J
2012-07-01
Mitochondrial ribosomes and translation factors co-purify with mitochondrial nucleoids of human cells, based on affinity protein purification of tagged mitochondrial DNA binding proteins. Among the most frequently identified proteins were ATAD3 and prohibitin, which have been identified previously as nucleoid components, using a variety of methods. Both proteins are demonstrated to be required for mitochondrial protein synthesis in human cultured cells, and the major binding partner of ATAD3 is the mitochondrial ribosome. Altered ATAD3 expression also perturbs mtDNA maintenance and replication. These findings suggest an intimate association between nucleoids and the machinery of protein synthesis in mitochondria. ATAD3 and prohibitin are tightly associated with the mitochondrial membranes and so we propose that they support nucleic acid complexes at the inner membrane of the mitochondrion.
Czech Academy of Sciences Publication Activity Database
Steiner, Jakub
2008-01-01
Roč. 63, č. 1 (2008), s. 308-327 ISSN 0899-8256 Institutional research plan: CEZ:AV0Z70850503 Keywords : global games * coordination * crises * cycles and fluctuations Subject RIV: AH - Economics Impact factor: 1.333, year: 2008
Lower Limb Interjoint Postural Coordination One Year after First-Time Lateral Ankle Sprain.
Doherty, Cailbhe; Bleakley, Chris; Hertel, Jay; Caulfield, Brian; Ryan, John; Sweeney, Kevin; Patterson, Matthew R; Delahunt, Eamonn
2015-11-01
Longitudinal analyses of participants with a history of lateral ankle sprain are lacking. This investigation combined measures of lower limb interjoint coordination and stabilometry to evaluate static unipedal stance with the eyes open (condition 1) and closed (condition 2) in a group of participants with chronic ankle instability (CAI) compared to lateral ankle sprain "copers" (both recruited 12 months after sustaining an acute first-time lateral ankle sprain) and a group of noninjured controls. Twenty-eight participants with CAI, 42 lateral ankle sprain "copers," and 20 noninjured controls completed three 20-s single-limb stance trials in conditions 1 and 2. An adjusted coefficient of multiple determination statistic was used to compare stance limb three-dimensional kinematic data for similarity to establish patterns of interjoint coordination. The fractal dimension of the stance limb center of pressure path was also calculated. Between-group analyses revealed that participants with CAI displayed notable increases in ankle-hip linked coordination compared with both lateral ankle sprain "copers" (-0.52 (1.05) vs 0.28 (0.9), P = 0.007) and controls (-0.52 (1.05) vs 0.63 (0.64), P = 0.006) in condition 1 and compared with controls only (0.62 (1.92) vs 0.1 (1.0) P = 0.002) in condition 2. Participants with CAI also exhibited a decrease in the fractal dimension of the center-of-pressure path during condition 2 compared with both controls and lateral ankle sprain "copers." Participants with CAI present with a hip-dominant strategy of eyes-open and eyes-closed static unipedal stance. This coincided with reduced complexity of the stance limb center of pressure path in the eyes-closed condition.
Modeling Coordination Problems in a Music Ensemble
DEFF Research Database (Denmark)
Frimodt-Møller, Søren R.
2008-01-01
This paper considers in general terms, how musicians are able to coordinate through rational choices in a situation of (temporary) doubt in an ensemble performance. A fictitious example involving a 5-bar development in an unknown piece of music is analyzed in terms of epistemic logic, more...... to coordinate. Such coordination can be described in terms of Michael Bacharach's theory of variable frames as an aid to solve game theoretic coordination problems....
Organization of left-right coordination in the mammalian locomotor network
DEFF Research Database (Denmark)
Butt, S. J B; Lebret, James M.; Kiehn, Ole
2002-01-01
in the spinal cords of a number of aquatic vertebrates including the Xenopus tadpole and the lamprey. However, their function in left-right coordination of limb movements in mammals is poorly understood. In this review we describe the present understanding of commissural pathways in the functioning of spinal......Neuronal circuits involved in left-right coordination are a fundamental feature of rhythmic locomotor movements. These circuits necessarily include commissural interneurons (CINs) that have axons crossing the midline of the spinal cord. The properties of CINs have been described in some detail....... Spinal CINs play an important role in the generation of locomotor output. Increased knowledge as to their function in producing locomotion is likely to provide valuable insights into the spinal networks required for postural control and walking....
Straker, Leon M; Campbell, Amity C; Jensen, Lyn M; Metcalf, Deborah R; Smith, Anne J; Abbott, Rebecca A; Pollock, Clare M; Piek, Jan P
2011-08-18
A healthy start to life requires adequate motor development and physical activity participation. Currently 5-15% of children have impaired motor development without any obvious disorder. These children are at greater risk of obesity, musculoskeletal disorders, low social confidence and poor mental health. Traditional electronic game use may impact on motor development and physical activity creating a vicious cycle. However new virtual reality (VR) game interfaces may provide motor experiences that enhance motor development and lead to an increase in motor coordination and better physical activity and mental health outcomes. VR games are beginning to be used for rehabilitation, however there is no reported trial of the impact of these games on motor coordination in children with developmental coordination disorder. This cross-over randomised and controlled trial will examine whether motor coordination is enhanced by access to active electronic games and whether daily activity, attitudes to physical activity and mental health are also enhanced. Thirty children aged 10-12 years with poor motor coordination (≤ 15th percentile) will be recruited and randomised to a balanced ordering of 'no active electronic games' and 'active electronic games'. Each child will participate in both conditions for 16 weeks, and be assessed prior to participation and at the end of each condition. The primary outcome is motor coordination, assessed by kinematic and kinetic motion analysis laboratory measures. Physical activity and sedentary behaviour will be assessed by accelerometry, coordination in daily life by parent report questionnaire and attitudes to physical activity, self-confidence, anxiety and depressed mood will be assessed by self report questionnaire. A sample of 30 will provide a power of > 0.9 for detecting a 5 point difference in motor coordination on the MABC-2 TIS scale (mean 17, sd = 5). This is the first trial to examine the impact of new virtual reality games on
Directory of Open Access Journals (Sweden)
Straker Leon M
2011-08-01
Full Text Available Abstract Background A healthy start to life requires adequate motor development and physical activity participation. Currently 5-15% of children have impaired motor development without any obvious disorder. These children are at greater risk of obesity, musculoskeletal disorders, low social confidence and poor mental health. Traditional electronic game use may impact on motor development and physical activity creating a vicious cycle. However new virtual reality (VR game interfaces may provide motor experiences that enhance motor development and lead to an increase in motor coordination and better physical activity and mental health outcomes. VR games are beginning to be used for rehabilitation, however there is no reported trial of the impact of these games on motor coordination in children with developmental coordination disorder. Methods This cross-over randomised and controlled trial will examine whether motor coordination is enhanced by access to active electronic games and whether daily activity, attitudes to physical activity and mental health are also enhanced. Thirty children aged 10-12 years with poor motor coordination (≤ 15th percentile will be recruited and randomised to a balanced ordering of 'no active electronic games' and 'active electronic games'. Each child will participate in both conditions for 16 weeks, and be assessed prior to participation and at the end of each condition. The primary outcome is motor coordination, assessed by kinematic and kinetic motion analysis laboratory measures. Physical activity and sedentary behaviour will be assessed by accelerometry, coordination in daily life by parent report questionnaire and attitudes to physical activity, self-confidence, anxiety and depressed mood will be assessed by self report questionnaire. A sample of 30 will provide a power of > 0.9 for detecting a 5 point difference in motor coordination on the MABC-2 TIS scale (mean 17, sd = 5. Discussion This is the first trial to
Coordinated Transportation: Problems and Promise?
Fickes, Michael
1998-01-01
Examines the legal, administrative, and logistical barriers that have prevented the wide acceptance of coordinating community and school transportation services and why these barriers may be breaking down. Two examples of successful implementation of coordinated transportation are examined: employing a single system to serve all transportation…
Coordination Processes in International Organisations
DEFF Research Database (Denmark)
Nedergaard, Peter
2008-01-01
The EU is not a member of the International Labour Organisation (ILO), but relatively elaborate EU coordination takes place anyway. This paper addresses two research questions: 1) How is it possible to evaluate the coordination of the EU in its specific observable configuration in the ILO?, and 2......-à-vis their principals, the Member States. The Commission is the leading agent in the phase leading up to the Conference; the Presidency then takes over. On the one hand, due to the Treaty obligations and their interpretations by the Court of Justice, both the Presidency and the Commission are kept within tight limits...... by the principals. On the other hand, both before and during the Conference, the Member States accept the so-called discursive coordination of the Commission, which seems to be of great (but often neglected) importance. Owing to the organisational set-up in which coordination takes place, the EU is able...
Future in actinoids coordination chemistry
International Nuclear Information System (INIS)
Kitazawa, Takafumi
2006-01-01
Actinoids coordination chemistry is concerned with spent nuclear fuel reprocessing, specifically with solid-state chemistry of nuclear fuels, separation process with radioactive substances, and geological disposal of high-level radioactive substances. In the 21st century, accumulation of minor actinides, Np, Am, Cm, and others will be realized according with the present program of nuclear energy development. The present article briefly introduces general properties of actinide elements, followed by their coordination chemistry compared with rare earths coordination chemistry. Special facility needed to treat actinoids as well as their chemistry is briefly explained, together with the specific experimental apparatus such as X-ray Absorption Fine Structure (XAFS) and time-resolved laser-induced fluorescence spectrometry (TRLFS) with synchrotron radiation facilities. The effect of coordination with actinoids in the environment chemistry is important in underground disposal of high-level radioactive wastes. For theoretical analysis of the results with actinoids chemistry, relativistic calculation is needed. (S. Ohno)
Coordinating distributed work : Exploring situated coordination with gaming-simulation
van Laere, J.
2003-01-01
Organizational work has become more and more distributed nowadays. Information and communication technologies (ICT) provide opportunities to improve coordination of distributed work, but in practice many organizations struggle with integrating new organizational structures, new work practices and
Monitoring of stability of ASG-EUPOS network coordinates
Figurski, M.; Szafranek, K.; Wrona, M.
2009-04-01
ASG-EUPOS (Active Geodetic Network - European Position Determination System) is the national system of precise satellite positioning in Poland, which increases a density of regional and global GNSS networks and is widely used by public administration, national institutions, entrepreneurs and citizens (especially surveyors). In near future ASG-EUPOS is to take role of main national network. Control of proper activity of stations and realization of ETRS'89 is a necessity. User of the system needs to be sure that observations quality and coordinates accuracy are high enough. Coordinates of IGS (International GNSS Service) and EPN (European Permanent Network) stations are precisely determined and any changes are monitored all the time. Observations are verified before they are archived in regional and global databases. The same applies to ASG-EUPOS. This paper concerns standardization of GNSS observations from different stations (uniform adjustment), examination of solutions correctness according to IGS and EPN standards and stability of solutions and sites activity
Correlation between three color coordinates of human teeth
Lee, Yong-Keun
2014-11-01
The objective was to determine whether there were significant correlations in the three color coordinates within each of two color coordinate systems, such as the Commission Internationale de l'Eclairage (CIE) L*a*b* system, and the lightness, chroma, and hue angle system, of human vital teeth. The color of six maxillary and six mandibular anterior teeth was measured by the Shade Vision System. Pearson correlations between each pair of the color coordinates were determined (α=0.01). The influence of two color coordinates on the other color coordinate was determined with a multiple regression analysis (α=0.01). Based on correlation analyses, all the color coordinate pairs showed significant correlations except for the chroma and hue angle pair. The CIE L* was negatively correlated with the CIE a*, b*, and chroma, but positively correlated with the hue angle. The CIE a* was positively correlated with the CIE b* and chroma. Tooth color coordinates were correlated each other. Lighter teeth were less chromatic both in the CIE a* and b* coordinates. Therefore, it was postulated that the three color coordinates of human teeth were harmonized within certain color attribute ranges, and a lack of correlations in these coordinates might indicate external/internal discolorations and/or anomalies of teeth.