WorldWideScience

Sample records for programma che risponde

  1. Programma Wettelijke Onderzoek Taken Visserijonderzoek DLO-programma 406

    NARCIS (Netherlands)

    Beek, van F.A.

    2004-01-01

    In het DLO-programma 406: “Wettelijke Onderzoek Taken Visserijonderzoek” worden een aantal taken uitgevoerd die betrekking hebben op de visserij. Het programma omvat een aantal uiteenlopende onderzoeksonderwerpen, met als belangrijkste gezamenlijk element “een vereist zijn op grond van enigerlei

  2. Saussure chiama, pascoli risponde. Nuove prospettive sulla ricerca anagrammatica

    Directory of Open Access Journals (Sweden)

    Giovanni Palmieri

    2016-07-01

    Full Text Available Dopo un’ampia e aggiornata ricostruzione storico-filologica della corrispondenza tra Saussure e Pascoli, l’articolo suggerisce nuove prospettive sulla ricerca ana-grammatica negando che esista uno iato insanabile tra il Saussure degli anagrammi e quello del Cours. Per dimostrare ciò, l’autore si avvale anche degli scritti saussuriani ritrovati nel 1996. In particolare, Saussure avrebbe ‘scoperto’ il significante (elemento linguistico individuato in contrapposizione alla figure vocale e le serie paradigmatiche proprio a partire dalla sua ricerca sulle associazioni foniche presenti nelle strutture anagrammatiche del linguaggio (poetico. Inoltre, a partire da una riflessione sul principio di similarità fonica, il confronto tra le due ricerche saussuriane consente di limitare il preteso dogma dell’arbitrarietà del segno. Ciò in perfetto accordo con Jakobson. Sviluppando poi un’intuizione di Meillet, viene analizzato il rapporto che esiste tra anagrammi e musica (dodecafonica, nel caso in questione. Chiude l’articolo una lettera immaginaria, ma non troppo, con la quale Pascoli avrebbe potuto rispondere a Saussure sulla questione degli anagrammi presenti nel testo poetico.

  3. Che Guevara

    DEFF Research Database (Denmark)

    Cristoffanini, Pablo Rolando

    2014-01-01

    made Che Guevara a political, religious and cultural icon and an object of consumption, despite his total political and military failure in Bolivia and his violent death. Finally the article contrasts the meanings of his image in the original context with new research that calls into question...... with the achievements and connotations of the Cuban Revolution in the context of the Cold War. The current meanings of the image must be read in the context of the global consumer culture. The article analyzes and explains how a conjunction of factors such as communication strategies and the connotations of his image...

  4. Programma Wettelijke Onderzoek Taken Visserijonderzoek DLO-programma 406 werkplan 2004

    NARCIS (Netherlands)

    Beek, van F.A.

    2003-01-01

    In het DLO-programma 406: “Wettelijke Onderzoek Taken Visserijonderzoek” worden een aantal taken uitgevoerd die betrekking hebben op de visserij. Het programma omvat een aantal uiteenlopende on-derzoeksonderwerpen, met als belangrijkste gezamenlijk element “een vereist zijn op grond van eni-gerlei

  5. Microfinanza: analisi d’impatto di un programma in India

    Directory of Open Access Journals (Sweden)

    Tommaso Rondinella

    2005-03-01

    Full Text Available L’analisi d’impatto dei programmi di microfinanza è uno strumento utile sia per migliorare i servizi offerti sia per garantire ai donatori che il denaro concesso sia utilizzato per programmi efficaci nell’alleviare la povertà. Il presente lavoro è costituito da due parti: la prima è dedicata all’analisi d’impatto, la seconda all’analisi empirica sul campo. L’indagine è stata condotta attraverso l’utilizzo di uno strumento in grado di dare una indicazione chiara dei cambiamenti avvenuti nelle condizioni di vita dei beneficiari e con il pregio di essere applicabile a costi molto ridotti. I risultati ottenuti mostrano in che misura l’accesso al credito cambi le condizioni di vita dei più poveri inducendo consistenti aumenti del reddito familiare, dei risparmi, della diversificazione delle attività produttive e del consumo di cibo. Inoltre si osserva, all’interno dei nuclei familiari, un miglioramento della condizione femminile chiaramente dipendente dalla partecipazione al programma di microcredito

  6. Uitvoering Kennisbasis Wettelijke Onderzoeks Taken programma 406 in 2006

    NARCIS (Netherlands)

    Grift, R.E.; Beek, van F.A.

    2006-01-01

    LNV programma 406 omvat de wettelijke taken die door DLO uitgevoerd worden en betrekking hebben op de visserij. Binnen dit programma is er een Kennisbasis budget dat bedoeld is voor het ontwikkelen en onderhouden van expertise om dit programma uit te kunnen voeren. Dit rapport beschrijft hoe het

  7. Rapportage Kennisbasis Wettelijke Onderzoekstaken: programma 406 in 2005

    NARCIS (Netherlands)

    Grift, R.E.; Beek, van F.A.

    2006-01-01

    Ten behoeve van het WOT programma 406 (Wettelijke Taken Visserijonderzoek) is financiering uit de zogenaamde Kennisbasis beschikbaar voor het ontwikkelen van kennis nodig voor het uitvoeren van de wettelijke taken in dit programma. Het Kennisbasis programma moet in een kennisbehoefte voor het

  8. El humanismo del Che Che's Humanism

    OpenAIRE

    Avelino Fernández Espert; Cristina Fernández Rivero

    2004-01-01

    Los autores, estudiosos de la raigal influencia del pensamiento y la obra del Comandante Dr. Ernesto Guevara de la Serna (Che) en Cuba y América, proyectan la estampa humanista de este revolucionario médico, con el empleo de las más trascendentes pinceladas históricas de un amplia hoja de vida en distintas latitudes del mundo. El Che, joven estudiante, médico graduado con prometedoras dotes que sabe ubicar al ser humano y sus valores por encima de un promisorio futuro como científico y profes...

  9. El humanismo del Che Che's Humanism

    Directory of Open Access Journals (Sweden)

    Avelino Fernández Espert

    2004-08-01

    Full Text Available Los autores, estudiosos de la raigal influencia del pensamiento y la obra del Comandante Dr. Ernesto Guevara de la Serna (Che en Cuba y América, proyectan la estampa humanista de este revolucionario médico, con el empleo de las más trascendentes pinceladas históricas de un amplia hoja de vida en distintas latitudes del mundo. El Che, joven estudiante, médico graduado con prometedoras dotes que sabe ubicar al ser humano y sus valores por encima de un promisorio futuro como científico y profesional de la medicina. El artículo dedica atención especial a sus conceptos sobre el hombre, su vida e historia y a su proverbial apego a una ética revolucionaria de elevado calibre. El artículo contribuye al enriquecimiento de los conocimientos sobre el desarrollo histórico del humanismo médico cubano, al proyectarlo en la figura de uno de sus más míticos modelosThe authors, studious of the extraordinary influence of Commandant and Dr. Ernesto Guevara de la Serna 's thought in Cuba and America, unveil the humanist perspective of this revolutionary doctor, through the most transcendental historical events in this man's life in different latitudes of the world. Che, young student, medicine doctor with promising gifts that knew how to place the human being and his values above his promissory future as scientific and medicine professional. The article dedicates special attention to his concepts about men, as well as his life and history and to his proverbial attachment to valuable revolutionary ethics. The article contributes to the enrichment of knowledge on the historical development of Cuban medical humanism, by reflecting this in the figure of one of its most mythical models

  10. Notas sobre el che

    Directory of Open Access Journals (Sweden)

    Virginia Bertolotti

    2010-06-01

    Full Text Available In the present work, I review, in the first place, the bibliography that summarizes the discussion surrounding the etymology of the word che. Then, I analyze the uses of this term in the diachrony as in the synchrony of the Río de la Plata Spanish, which allows me to propose a classification of the uses of the word che in this region. In the third part of the article, I discuss the categorial adscrption of the word che. Finally, the categorial analysis of the diachronic and synchronic empirical evidence allows me to conclude that the vocative uses of the term are a loan from the nominal determinant of the guaraní language, and not a phonic change in the Spanish interjection, thus resolving the etymological issues.

  11. DLO-programma 406: Wettelijke Onderzoek Taken Visserijonderzoek Voortgangsrapportage over 2005

    NARCIS (Netherlands)

    Beek, van F.A.

    2006-01-01

    In het WOT-programma 406 worden Wettelijke Onderzoeks Taken uitgevoerd die betrekking hebben op het beheer van de visserij en aquacultuur in Nederland. Het programma wordt uitgevoerd voor het Ministerie van Landbouw, Natuur en Voedselkwaliteit (LNV). De inhoud van het programma is in 2004 bij de

  12. Lojalitātes programmas mazumtirdzniecībā.

    OpenAIRE

    Magone, Laura

    2014-01-01

    Bakalaura darba mērķis ir izpētīt klientu lojalitātes būtību un veidošanos, izmantojot mārketinga literatūrā piedāvātās koncepcijas, izpētīt mazumtirdzniecību lojalitātes programmas, salīdzināt uzņēmumu Prisma, Rimi un Maxima lojalitātes programmas un izstrādāt priekšlikumus kā uzlabot to darbību. Bakalaura darbs sastāv no trijām daļām. Pirmajā nodaļā ir raksturota un analizēta lojalitāte mārketinga teorijā. Otrajā nodaļā ir analizētas lojalitātes programmas kā mārketinga instruments. Tre...

  13. Analisi dell'efficacia di un programma di prevenzione secondaria del carcinoma orale

    Directory of Open Access Journals (Sweden)

    S. Iannazzo

    2003-05-01

    Full Text Available

    In Italia i carcinomi del cavo orale (KCO sono diagnosticati
    prevalentemente al II-IV stadio TNM con conseguenti basse sopravvivenza a 5 anni e qualità della vita. Una maggior frequenza di diagnosi allo stadio I porterebbe a migliorare ampiamente i valori medi dei suddetti parametri.
    Scopo del presente lavoro è stato valutare l’efficacia di un programma di prevenzione secondaria del KCO in termini di aumento di diagnosi allo stadio I e di vite salvate.

    Abbiamo stimato la prevalenza di casi istopatologicamente
    accertati (livello C3 di leucoplachia, principale lesione precancerosa del KCO, nella ASL/RMA come prodotto tra la prevalenza stimata di leucoplachia diagnosticata clinicamente (livello C2 (2989,2Ĩ13077,7 e la proporzione, scelta arbitrariamente, di C3 tra i C2 (0,50.

    Tenendo presente che nel campione studiato nella ASL/RMA la proporzione di KCO allo stadio I tra i C3 era 0,03, abbiamo stimato il numero di KCO.

    Abbiamo stimato quanti KCO verrebbero diagnosticati allo stadio I se venisse attuato un programma di prevenzione secondaria, considerando diversi livelli di compliance, e sulla base di una sopravvivenza media a 5 anni, in Italia, del 53% per tutti gli stadi e del 79% per i KCO allo stadio I, abbiamo calcolato il numero di vite salvate. I valori sono stati espressi come IC95.

    Le prevalenze di leucoplachia C3 e KCO sono risultate,
    rispettivamente, 1494,6Ĩ6538,8 e 44,8Ĩ196,2. Con compliance del 10%, 40% e 75% verrebbero diagnosticati, rispettivamente, 4,5Ĩ19,6, 17,9Ĩ78,5 e 33,6Ĩ147,2 casi di KCO e le vite salvate sarebbero 1,1Ĩ5,1, 4,6Ĩ20,4 e 8,7Ĩ38,3 rispettivamente.
    In termini di vite salvate i dati evidenziano la necessita di attuare programmi di screening del KCO, anche nell' eventualità di uno scarso coinvolgimento della popolazione a rischio.

  14. Voortgangsrapportage van het WOT programma 406: Wettelijke Onderzoek Taken Visserijonderzoek voor LNV in 2004

    NARCIS (Netherlands)

    Beek, van F.A.

    2005-01-01

    Voortgangsrapportage van het WOT programma 406, Wettelijke Onderzoek Taken Visserijonderzoek van LNV in 2004. In het WOT-programma 406 worden Wettelijke Onderzoeks Taken uitgevoerd die betrekking hebben op het visserijonderzoek. Dit rapport bevat de rapportage en verantwoording van de activiteiten

  15. DLO-programma 406 : Wettelijke Onderzoekstaken voor LNV, visserijonderzoek : voortgangsrapportage over 2006

    NARCIS (Netherlands)

    Beek, van F.A.

    2007-01-01

    In het WOT-programma 406 worden Wettelijke Onderzoeks Taken uitgevoerd die betrekking hebben op het beheer van de visserij en aquacultuur in Nederland. Het programma wordt uitgevoerd voor het Ministerie van Landbouw, Natuur en Voedselkwaliteit (LNV). Dit rapport bevat de rapportage en verantwoording

  16. Che: His Own Worst Enemy

    Science.gov (United States)

    2015-04-01

    comprised of Green Berets, to go to Bolivia and train a Ranger battalion 40 in counter-insurgency operations. Leading this 16-man team was Maj...York: Routledge & Kegan Ltd., 1987. Sinclair, Andrew. Che Guevara. New York: The Viking Press, 1970. Study of the “Diary of ‘Che’ Guevara in

  17. Veikala lojalitātes programmas iOS lietotne

    OpenAIRE

    Freibergs, Kristaps

    2013-01-01

    Pasaulē izmantoto tehnoloģiju klāstam augot, ir pieaudzis arī mobilo ierīču piedāvājums un to iespējas. Salīdzinoši lielu daļu tirgus ir iekarojusi Apple Inc. ar savu produkciju, tai skaitā iPhone viedtālruņiem. Šajā kvalifikācijas darbā tiek aprakstīta un izstrādāta iPhone ierīces lietotne veikala lojalitātes programmas realizācijai. Lietotnes mērķis ir popularizēt konkrēto veikalu, piedāvājot dažādas lietotājam saistošas funkcijas, tai skaitā, apskatīt tuvākos veikalus, izveidot iepirkumu g...

  18. Cholinesterase (ChE) response and related mortality among birds fed ChE inhibitors

    Science.gov (United States)

    Ludke, J.L.; Hill, E.F.; Dieter, M.P.

    1975-01-01

    Patterns of mortality and inhibition of brain and plasma ChE in birds treated with ChE inhibitors were studied in an attempt to determine the validity of using ChE activity as a monitoring and diagnostic technique. Analysis of brain ChE activity proved to be reliable for diagnosing and monitoring effects of selected ChE inhibitors in birds. Brain ChE inhibition exceeding 20% indicated exposure, and inhibition greater than 50% was sufficient for diagnosing cause of death. Individuals that died from dietary exposure to parathion or carbofuran had brain ChE activities below 55% of normal; although individuals could survive with brain ChE activity lower than 50%. Problems associated with collection, storage, and analysis of tissues for ChE activity are discussed.

  19. Introduzione. Donne che portano la parrucca

    Directory of Open Access Journals (Sweden)

    Claudia Mattalucci-Yılmaz

    2013-07-01

    Full Text Available Peruk takan kadınlar è l’opera che nel 1999 l’artista e cineasta turco Kutlug Ataman ha presentato alla Biennale di Venezia curata da Harald Szeemann. Quattro schermi giustapposti proiettano le testimonianze di donne che, per un periodo della loro vita, hanno portato una parrucca: un’attivista politica di sinistra che nel 1971, dopo il colpo di stato militare, utilizzava un nome in codice, una divisa delle Turkish Airlines e una parrucca per sfuggire al controllo della polizia; una giornalista, colpita da un tumore al seno, che ha portato una parrucca per mascherare gli effetti della chemioterapia; una studentessa musulmana che indossa una parrucca per frequentare l’università, in un contesto – quello turco – che in nome della laicità dello Stato, interdice l’uso nel foulard nelle scuole, nelle università e nella pubblica amministrazione; e infine un transessuale.

  20. Voortgangsrapportage van het WOT programma 406: Wettelijke Onderzoek Taken Visserijonderzoek voor LNV in 2002

    NARCIS (Netherlands)

    Beek, van F.A.

    2003-01-01

    Dit is de eerste jaarrapportage van WOT-programma 406. Het onderzoeksprogramma WOT 406 loopt gedurende de periode 2002-2005 en is de opvolger van WDT programma’s 212 en 339. Dit rapport bevat de rapportage en verantwoording van de activiteiten in 2002.

  1. Voortgangsrapportage van het WOT programma 406: Wettelijke Onderzoek Taken Visserijonderzoek voor LNV in 2003

    NARCIS (Netherlands)

    Beek, van F.A.

    2004-01-01

    Het WOT-programma 406 heeft betrekking op Wettelijke Onderzoeks Taken die betrekking hebben op het visserijonderzoek. Het onderzoeksprogramma WOT 406 loopt gedurende de periode 2002-2005 en is een voortzetting van WDT programma’s 212 en 339. Dit rapport bevat de rapportage en verantwoording van de

  2. Argentina chiama Italia: Friuli risponde

    Directory of Open Access Journals (Sweden)

    Silvana Serafin

    2010-03-01

    Full Text Available The study analyzes the migratory waves from Friuli which, from the 1870s up to the post-World War II years, extensively moved towards Argentina, settling in the areas around the cities of Santa Fe, Cordoba, Entre Ríos, Chaco and Buenos Aires, but reaching also regions as far away as Patagonia. The accurate and well diffused net of the Fogolār Furlan, besides its function as friendly society, also provides to the promulgation of ancient traditions and mores among the new generations, transmitting on to them the cultural, linguistic and ethnic memory of the motherland. Epistles, tales, novels and poems form a paideia which is thus constantly being enlivened, eveng among those who assumed Argentinian nationality or were born in the country. Of utmost interest is, therefore, the resulting literary corpus, representing as it does a renewed search for identity in the form of a dialogue with the world, extending itself well beyond the contingency of boundaries and transmitting the universal essence of logos.

  3. Dicty_cDB: CHE636 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE636 (Link to dictyBase) - - - Contig-U11696-1 CHE636P (Link... to Original site) CHE636F 174 CHE636Z 123 CHE636P 277 - - Show CHE636 Library CH (Link to library) Clone ID CHE636 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11696-1 Original site URL http://dict...ne RP11-15H22, WORKING DRAFT SEQUENCE, 23 unordered pieces. 40 0.19 3 AC149612 |AC149612.1 Ictalurus punctat... %: cytoskeletal 4.0 %: mitochondrial >> prediction for CHE636 is nuc 5' end seq. ID CHE636F 5' end seq. >CH

  4. Structural Insight inot the low Affinity Between Thermotoga maritima CheA and CheB Compared to their Escherichia coli/Salmonella typhimurium Counterparts

    Energy Technology Data Exchange (ETDEWEB)

    S Park; B Crane

    2011-12-31

    CheA-mediated CheB phosphorylation and the subsequent CheB-mediated demethylation of the chemoreceptors are important steps required for the bacterial chemotactic adaptation response. Although Escherichia coli CheB has been reported to interact with CheA competitively against CheY, we have observed that Thermotoga maritima CheB has no detectable CheA-binding. By determining the CheY-like domain crystal structure of T. maritima CheB, and comparing against the T. maritima CheY and Salmonella typhimurium CheB structures, we propose that the two consecutive glutamates in the {beta}4/{alpha}4 loop of T. maritima CheB that is absent in T. maritima CheY and in E. coli/S. typhimurium CheB may be one factor contributing to the low CheA affinity.

  5. Crèche and School

    CERN Multimedia

    EVE et École

    2018-01-01

    IMPORTANT DATES Enrolments 2018-2019 Enrolments to the Crèche and School for the school year 2018-2019 will take place on 5, 6 and 7 March 2018 from 10 am to 1 pm at the Crèche and School of the CERN Staff Association. Registration forms will be available from Thursday 1st March 2018. For more information, please visit the website: http://nurseryschool.web.cern.ch/. * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * Saturday 3 March 2018 Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Wednesd...

  6. Che cos’è l’antiziganismo?

    Directory of Open Access Journals (Sweden)

    Leonardo Piasere

    2012-01-01

    Full Text Available Abstract – IT Chi è zingaro? Colui che chiamo zingaro, che assegno a questa identità e che costituisco come "altro" dal resto della società. In questo senso, la storia degli zingari si confonde con quella dell'"antiziganismo", un neologismo che denota una pratica antica. Ma si può dire che la comparsa della nuova parola è legata agliodierni intrecci tra politiche multiculturali da un lato e politiche neoliberiste dall’altro?Abstract – FRQui est Tsigane? Celui que je nomme Tsigane, que j'assigne à cette identité et que je constitue en "autre" du reste de la société. Dans ce sens, l'histoire des Tsiganes se confond avec celle de l'"antitsiganisme", un néologisme qui recouvre une pratique ancienne. Mais peut-on dire que l'apparition de ce nouveau mot estliée aux croisements actuels entre les politiques multiculturelles d'une part, et les politiques néolibéralesde l'autre? Abstract – EN Who is Gypsy? The person I call Gypsy, to whom I assign this identity, is that I establish as "other" than the rest of society. In this sense, the history of Gypsies merges with that of "antigypsism", a neologism that denotes an ancient practice. But can it be said that the appearance ofthis new word is linked to the current entanglement between multi-cultural politics on one side and neo-liberalist politics on the other?

  7. Dicty_cDB: CHE687 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE687 (Link to dictyBase) - - - Contig-U16336-1 - (Link to Or...iginal site) CHE687F 622 - - - - - - Show CHE687 Library CH (Link to library) Clone ID CHE687 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dictycdb.b...KFINQCINEIKEELKGDMQKKTVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICT...LGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIF

  8. Che legend elab ka 40 aastat hiljem / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 9. okt. lk. 10. Argentinas sündinud ja 1967. aastal hukatud revolutsionääri Ernesto Che Guevara poliitikukarjäärist, tema panusest Kuuba revolutsiooni ja poliitikasse. Ernesto Che Guevara mälestamisest Ladina-Ameeerika riikides. Lisa: Kuuba revolutsioon; Che Guevara elu

  9. Studiju programmas direktora informatīvā sistēma

    OpenAIRE

    Gūtmanis, Matīss

    2012-01-01

    Šajā kvalifikācijas darbā tiek izstrādāta atbalsta sistēma studiju programmas direktoram pamata informācijas glabāšanai. Sistēma tiek plānota kā tīmekļa lietotne, kas ir brīvi pieejama ikvienam. Lietotne ir izstrādāta izmantojot JAVA, HTML, JavaScript, MySQL tehnoloģijas. Sistēma paredzēta Latvijas Universitātes Datorikas Fakultātes programmu direktoriem.

  10. Program management for air quality projects; Programma's geven lucht voor projecten

    Energy Technology Data Exchange (ETDEWEB)

    Busscher, T.; Tillema, T.; Arts, J. [Rijksuniversiteit Groningen, Groningen (Netherlands)

    2011-04-15

    The Dutch Air Quality Collaboration program (NSL) is introducing a new approach to complex issues. This programmatic approach may offer a solution, but is still relatively new in spatial policymaking. What can we learn about the success and failure aspects of programs from the approach at NSL?. [Dutch] Het Nationaal Samenwerkingsprogramma Luchtkwaliteit (NSL) introduceert een nieuwe aanpak voor complexe problemen. Deze programmatische aanpak kan hiervoor een oplossing zijn, maar is relatief nieuw in de ruimtelijke beleidspraktijk. Wat leert de aanpak bij het NSL ons over succes- en faalfactoren van programma's?.

  11. (CRA)Ervaringen met een terugvalpreventie programma gecombineerd met naltrexon bij opiaatafhankelijken: effect op verslavingsgedrag en predictieve waarde van psychiatrische comorbiditeit

    NARCIS (Netherlands)

    Roozen, H.G.

    2000-01-01

    achtergrond Naltrexon, een opiaatantagonist, raakt steeds meer in de belangstelling bij de behandeling van verslaafden aan opiaatpreparaten. De effecten van dit medicijn lijken het best te beklijven wanneer het als adjuvans bij een psychosociaal programma wordt voorgeschreven, zoals in een

  12. l'italiano che cambia: apocalisse o palingenesi? alcune riflessioni ...

    African Journals Online (AJOL)

    User

    idea that a real linguistic apocalypse is to be found on one hand, in what. Calvino ... nell'italiano contemporaneo da una prospettiva che, audacemente, definiamo ...... 'terrore semantico', cioè la fuga di fronte a ogni vocabolo che abbia di.

  13. Natural gas prices in Italy. Tariffs geographical distribution; Metano. Paese che vai, prezzo che trovi

    Energy Technology Data Exchange (ETDEWEB)

    Marrocchelli, A. [ENEA, Rome (Italy). Centro Ricerche Casaccia

    2000-11-01

    The annual report on services and activity carries at some evaluations of data concerned the natural gas market: total consumption, costs and prices in Italy and comparative evaluations with other european countries. [Italian] La relazione annuale sullo stato dei servizi e sull'attivita' svolta, presentata dal Presidente dell'Autorita' per l'energia elettrica e il gas, porta ad alcune considerazioni sui dati che riguardano il mercato del gas naturale: i consumi totali, i costi e i prezzi in Italia, il confronto con i costi e i prezzi praticati negli altri paesi europei.

  14. CheMentor Software System by H. A. Peoples

    Science.gov (United States)

    Reid, Brian P.

    1997-09-01

    CheMentor Software System H. A. Peoples. Computerized Learning Enhancements: http://www.ecis.com/~clehap; email: clehap@ecis.com; 1996 - 1997. CheMentor is a series of software packages for introductory-level chemistry, which includes Practice Items (I), Stoichiometry (I), Calculating Chemical Formulae, and the CheMentor Toolkit. The first three packages provide practice problems for students and various types of help to solve them; the Toolkit includes "calculators" for determining chemical quantities as well as the Practice Items (I) set of problems. The set of software packages is designed so that each individual product acts as a module of a common CheMentor program. As the name CheMentor implies, the software is designed as a "mentor" for students learning introductory chemistry concepts and problems. The typical use of the software would be by individual students (or perhaps small groups) as an adjunct to lectures. CheMentor is a HyperCard application and the modules are HyperCard stacks. The requirements to run the packages include a Macintosh computer with at least 1 MB of RAM, a hard drive with several MB of available space depending upon the packages selected (10 MB were required for all the packages reviewed here), and the Mac operating system 6.0.5 or later.

  15. ISS-NIH Collaborative Programme: final report of the projects; Programma di collaborazione ISS-NIH: relazioni conclusive dei progetti

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2009-07-01

    In July 2003, the National Institutes of Health (NIH) of the United States of America and the Istituto Superiore di Sanita (ISS) of Italy signed an agreement aimed at strengthening the ongoing research cooperation between USA and Italy. Over the years, the programme was able to create new partnerships and to foster the establishment of innovative synergies, the exchange of young researcher, and the merging of the best available skills, talents and know-how in different fields of biomedical sciences. This book contains the final report of the projects of the scientific cooperation between the two Countries. The report consists of two parts (in Italian and English) divided into four sections: Cancer, Neuroscience, Cardiovascular diseases, Infectious diseases. [Italian] Nel luglio 2003, i National Institutes of Health (NIH) americani e l'Istituto Superiore di Sanita (ISS) hanno firmato un accordo mirato a rafforzare la cooperazione scientifica tra Italia e USA. Nel corso degli anni il programma ha permesso di ampliare le collaborazioni e di promuovere nuove sinergie attraverso lo scambio di giovani ricercatori e la condivisione delle migliori competenze, conoscenze e capacita in diversi campi delle scienze biomediche. Questo volume contiene le relazioni finali dei progetti del programma di cooperazione scientifica tra i due Paesi. Il rapporto e articolato in due parti (in italiano e inglese) divise in quattro sezioni: Tumori, Neuroscienze, Malattie cardiovascolari, Malattie infettive.

  16. A crèche on the Meyrin CERN site

    CERN Multimedia

    Association du personnel

    2013-01-01

    A few months ago (see Echo 175) we announced the opening, at the end of August, of a crèche at the CERN Staff Association’s nursery school. After a very active summer, where a new floor was added to the canteen building, the new school year started in excellent conditions and, as expected, the new crèche opened on Tuesday 27 August. This crèche, with 13 full-time equivalent places, can accept 18 children aged between three months and two years in a space fully refitted to care for the little ones. A specially designed space for breastfeeding helps mothers working on the site to respect their baby's rhythm. In compliance with the standards of supervision in the canton of Geneva six educators take care of the children in shifts. This new space is fully integrated in the nursery school so that now the crèche, Kindergarten and school of the CERN Staff Association can welcome children aged from three months to six years, from Monday to Friday, and...

  17. à l'encoche sèche

    African Journals Online (AJOL)

    Chez Hevea brasiliensis, la production de latex est affectée par l'encoche sèche qui se manifeste par l'arrêt de l'écoulement de ... coagulation pour donner le caoutchouc naturel. ..... relationship between latex sugar content, the metabolic ...

  18. Crèche and School - Important dates

    CERN Multimedia

    Staff Association

    2018-01-01

    Enrolments 2018-2019 Enrolments to the Crèche and School for the school year 2018-2019 will take place on 5, 6 and 7 March 2018 from 10 am to 1 pm at the Crèche and School of the CERN Staff Association. Registration forms will be available from Thursday 1st March 2018. For more information, please visit the website: http://nurseryschool.web.cern.ch/. * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * Saturday 3 March 2018 Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Friday 2 March 2018: htt...

  19. Che cos'è la vita ?, Scienza e umanesimo

    CERN Document Server

    Schrödinger, Erwin

    1988-01-01

    A cento anni dalla nascita di Erwin Schrödinger (Viena 1887), il suo pensiero e il suo lavoro mantengono inalterati la loro attualità, come dimostra la nuova pubblicazione di molti dei suoi testi e i numerosi convegni che gli vengono dedicati.

  20. Discorso globale e contesti locali. Quale futuro per il programma di riforma agraria in Ruanda?

    Directory of Open Access Journals (Sweden)

    Johan Pottier

    2013-07-01

    Full Text Available La maggior parte degli sforzi per trasformare l’economia sub-sahariana negli anni Ottanta e Novanta faceva seguito ai cosiddetti “accordi di Washington”; questi sforzi avevano l’obiettivo di ridimensionare il ruolo dello Stato e liberalizzare i prezzi agricoli. La strategia prescritta funzionò per alcuni, ma non per la maggioranza dei produttori agricoli; all’inizio del XXI secolo è necessario, ancora una volta, un “momento di ripensamento”. I responsabili delle politiche agricole suggeriscono ora che,per indurre un cambiamento efficace, il nuovo modo di pensare deve fare i conti con modelli inappropriati di coltivazione, cogliere le dimensioni sociali e politiche dei cambiamenti indotti dalle moderne tecniche di coltivazione e venire a patti con i locali modi di comprensione dei contesti complessi (Scoones, Devereux, Haddad 2005, p. 3.

  1. Care and education in the Danish Créche

    DEFF Research Database (Denmark)

    Broström, Stig; Hansen, Ole Henrik

    2010-01-01

    This article seeks to identify the relation between policy and lived life, for the small child in the Danish crèche. To accomplish this, the article integrates demography, traditions, national curriculum and psychological, educational, and recent developments in research. It is an attempt to reveal...... research articles. It is used in the exploration of meanings of political, social, and cultural phenomena as experienced by the involved individuals themselves, in their natural context. It is a presumption that the child’s development is a consequence of emotional and cognitive stimulation. To outline...... that, it is vital to emphasize the influence that policy causes on educational practice in the crèche, e.g., the conceptualization of education and care....

  2. La Pubblica Amministrazione in uno scenario che cambia

    Directory of Open Access Journals (Sweden)

    Renzo Carlucci

    2009-03-01

    Full Text Available Questo numero, mirato alle implicazioni dell'utilizzo del dato territoriale nel contesto delle PA, le Pubbliche Amministrazioni, si arricchisce di un contenuto ulteriore, particolarmente spaziale; GEOmedia esce infatti in coincidenza con una manifestazione che possiamo considerare la vetrina mediterranea privilegiata per la promozione culturale, scientifica e commerciale delle istituzioni e del segmento dell’industria aerospaziale europea ed italiana.

  3. Programme Energy and CO2 and Year Plan 2013; Programma Energie en CO2 en Jaarplan 2013

    Energy Technology Data Exchange (ETDEWEB)

    Broekharst, P.; Medema, D.; Dijkshoorn, A.

    2012-10-15

    Less energy, less CO2 emissions and use of renewable energy sources,are important aspects in the sustainable development of horticulture, strengthening its competitiveness and image. Carbon neutral production and transport is needed to really be sustainable. The program describes an approach for the period 2013-2016, giving concrete results for the year 2013 [Dutch] Minder energiegebruik, minder CO2 uitstoten en meer hernieuwbare energiebronnen inzetten; dat zijn belangrijke aspecten in een duurzame ontwikkeling van de tuinbouw, het versterken van haar concurrentiekracht en imago. Klimaatneutraal produceren en vervoeren is uiteindelijke nodig om echt duurzaam te zijn. Het programma beschrijft een aanpak voor 2013 t/m 2016, waarbij voor 2013 de gewenste resultaten concreet worden benoemd.

  4. Che-1 gene silencing induces osteosarcoma cell apoptosis by inhibiting mutant p53 expression

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Ming; Wang, Dan, E-mail: danwangwdd@163.com; Li, Ning

    2016-04-22

    The transcriptional cofactor Che-1 is an RNA polymerase II (Pol II) which is involved in tumorigenesis, such as breast cancer and multiple myeloma. Che-1 can also regulate mutant p53 expression, which plays roles in many types of cancer. In this study, we aimed to investigate the effects and specific mechanism of Che-1 in the regulation of osteosarcoma (OS) cell growth. We found that Che-1 is highly expressed in several kinds of OS cells compared with osteoblast hFOB1.19 cells. MTT and flow cytometry assays showed that Che-1 depletion by siRNA markedly suppressed MG-63 and U2OS cell proliferation and promoted apoptosis. The chromatin immunoprecipitation (ChIP) assay verified the presence of Che-1 on the p53 promoter in MG-63 and U2OS cells carrying mutant p53. Further studies showed that Che-1 depletion inhibited mutant p53 expression. Notably, our study showed that the loss of Che-1 inhibits proliferation and promotes apoptosis in MG-63 cells by decreasing the level of mutant p53. Therefore, these findings open the possibility that silencing of Che-1 will have therapeutic benefit in OS. - Highlights: • Che-1 is highly expressed in several kinds of OS cells. • Che-1 depletion suppressed MG-63 and U2OS cell growth. • Che-1 is existed in the p53 promoter in MG-63 and U2OS cells. • Che-1 depletion inhibited mutant p53 expression. • Che-1 depletion inhibits cell growth by decreasing the level of mutant p53.

  5. Crystallization and preliminary X-ray crystallographic analysis of Thermotoga maritima CheA P3-P4-P5 domains in complex with CheW

    International Nuclear Information System (INIS)

    Park, SangYoun; Kim, Keon Young; Kim, Sunmin; Crane, Brian R.

    2012-01-01

    T. maritima CheA P3-P4-P5 domains were crystallized in complex with CheW. Low-resolution diffraction data were collected to ∼8 Å using synchrotron X-ray radiation. The CheA–CheW complex plays a key role in bacterial chemotaxis signal transduction by initiating phosphotransfer to response regulators via coupling to the chemoreceptors. CheA (P3-P4-P5 domains) and CheW from Thermotoga maritima were overexpressed in Escherichia coli and crystallized as a complex at 298 K using ammonium dihydrogen phosphate as a precipitant. X-ray diffraction data were collected to ∼8 Å resolution at 100 K using synchrotron radiation. The crystal belonged to space group I222 or I2 1 2 1 2 1 , with unit-cell parameters a = 184.2, b = 286.4, c = 327.7 Å. The asymmetric unit may contain six to ten CheA–CheW molecules

  6. Crystallization and preliminary X-ray crystallographic analysis of CheW from Thermotoga maritima: a coupling protein of CheA and the chemotaxis receptor

    International Nuclear Information System (INIS)

    Park, SangYoun; Crane, Brian R.

    2011-01-01

    CheW from T. maritima has been crystallized (space group P6 3 , unit-cell parameters a = b = 61.265, c = 361.045 Å). Diffraction data have been collected to 3.1 Å resolution using synchrotron X-ray radiation. The CheW protein plays a key role in bacterial chemotaxis signal transduction by coupling CheA to chemotaxis receptors. CheW from Thermotoga maritima has been overexpressed in Escherichia coli and crystallized at 298 K using ammonium sulfate as a salt precipitant. X-ray diffraction data have been collected to 3.10 Å resolution at 100 K using synchrotron radiation. The crystal belonged to space group P6 3 , with unit-cell parameters a = b = 61.265, c = 361.045 Å. The asymmetric unit may contain four to six CheW molecules

  7. Finally, a crèche at CERN!

    CERN Multimedia

    Anaïs Schaeffer

    2013-01-01

    After many years of discussion, the CERN Staff Association’s first crèche will open its doors in September to welcome up to 20 babies and toddlers.   A delicate operation: the installation of 11 modules above the Nursery's School canteen. Image: Sigrid Knoops. The CERN Staff Association’s Nursery School, which will soon turn 50, is pleased to announce the establishment of CERN’s first crèche. This project, which has come to fruition over the past academic year with the support of the CERN Management, meets an established and growing need among the Laboratory’s personnel and users. As a modular construction, the Nursery School’s new second floor was assembled above the existing canteen in a matter of days. Its 11 modules are ultra-modern – they’re even equipped with underfloor heating. “Thanks to this extension, we will be able to accept around twenty babies at the start of the academ...

  8. Perché io credo in colui che ha fatto il mondo

    CERN Document Server

    Zichichi, Antonino

    1999-01-01

    Fin troppo spesso si sente dire che il mondo della scienza e quello della religione sono in completa opposizione e che non condividono alcuna esperienza o caratteristica in comune. Nulla potrebbe essere più falso di queste affermazioni secondo Antonino Zichichi, che in quest'opera afferma come la ricerca scientifica e l'esperienza religiosa abbiano in comune molto più di quanto si possa pensare.

  9. Heterozygous Che-1 KO mice show deficiencies in object recognition memory persistence.

    Science.gov (United States)

    Zalcman, Gisela; Corbi, Nicoletta; Di Certo, Maria Grazia; Mattei, Elisabetta; Federman, Noel; Romano, Arturo

    2016-10-06

    Transcriptional regulation is a key process in the formation of long-term memories. Che-1 is a protein involved in the regulation of gene transcription that has recently been proved to bind the transcription factor NF-κB, which is known to be involved in many memory-related molecular events. This evidence prompted us to investigate the putative role of Che-1 in memory processes. For this study we newly generated a line of Che-1(+/-) heterozygous mice. Che-1 homozygous KO mouse is lethal during development, but Che-1(+/-) heterozygous mouse is normal in its general anatomical and physiological characteristics. We analyzed the behavioral characteristic and memory performance of Che-1(+/-) mice in two NF-κB dependent types of memory. We found that Che-1(+/-) mice show similar locomotor activity and thigmotactic behavior than wild type (WT) mice in an open field. In a similar way, no differences were found in anxiety-like behavior between Che-1(+/-) and WT mice in an elevated plus maze as well as in fear response in a contextual fear conditioning (CFC) and object exploration in a novel object recognition (NOR) task. No differences were found between WT and Che-1(+/-) mice performance in CFC training and when tested at 24h or 7days after training. Similar performance was found between groups in NOR task, both in training and 24h testing performance. However, we found that object recognition memory persistence at 7days was impaired in Che-1(+/-) heterozygous mice. This is the first evidence showing that Che-1 is involved in memory processes. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  10. Altruisti, cooperativi e morali: Perché è più facile esserlo domani che oggi

    NARCIS (Netherlands)

    Giacomantonio, M.; de Dreu, C.K.W.

    2013-01-01

    Un portafogli smarrito e ritrovato. Una donazione ad un ente che si occupa di ricerca sulle malattie degenerative. Una tangente non accettata. Un divorzio che si conclude senza il ricorso al tribunale. Alla base di tutti questi eventi vi è la tendenza umana a cooperare, ad essere altruisti e ad

  11. Discovering Che-1/AATF: a new attractive target for cancer therapy

    Directory of Open Access Journals (Sweden)

    Simona eIezzi

    2015-04-01

    Full Text Available The transcriptional cofactor Che-1/AATF is currently emerging as an important component of the DNA damage response machinery, the complex signaling network that maintains genome integrity and prevents tumorigenesis. Moreover this protein is involved in a wide range of cellular pathways, regulating proliferation and survival in both physiological and pathological conditions. Notably, some evidence indicates that dysregulation of Che-1/AATF levels are associated with the transformation process and elevated levels of Che-1/AATF are required for tumor cell survival. It is for these reasons that Che-1/AATF has been regarded as an attractive, still theoretical, therapeutic target for cancer treatments. In this review, we will provide an updated overview of Che-1/AATF activities, from transcriptional regulation to DNA damage response.

  12. Nuclear program of Iran. Towards de-escalation of a nuclear crisis. Advisory letter; Nucleair programma van Iran. Naar de-escalatie van een nucleaire crisis. Briefadvies

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-04-15

    The Dutch government, partly at the request of the House of Representatives (Second Chamber), the AIV asked to give an opinion about the position of Iran in the region and the role of the nuclear program of Iran in the geopolitical relations, in view of the most recent developments [Dutch] De Nederlandse regering heeft, mede op verzoek van de Tweede Kamer der Staten-Generaal, de AIV gevraagd advies uit te brengen over de positie van Iran in de regio en de rol van het nucleaire programma van Iran in de geopolitieke verhoudingen hierin, mede gelet op de meest recente ontwikkelingen.

  13. His Excellency Professor Dr Che-Ho Wei, Chairman, National Science Council Executive Yuan, Republic of China

    CERN Multimedia

    Patrice Loïez

    2002-01-01

    Photo 01: Professor Dr. Che-Ho Wei signing the Guest Book with CERN Director-General, L. Maiani. Photo 02: Professor Dr. Che-Ho Wei. Photo 03::Professor Dr. Che-Ho Wei shaking hands with CERN Director-General, L. Maiani.

  14. Los marcadores che y boludo: ¿un caso de rivalidad conversacional?

    Directory of Open Access Journals (Sweden)

    Markéta Šmídová

    2016-11-01

    Full Text Available It has been recently suggested that the Argentinian conversational marker che is being replaced by another typical expression, boludo. The purpose of the present paper is to provide a pilot comparative study of these two Argentinian markers in order to examine their free interchangeability and to refute it eventually. A commutation test has been used as a basic tool to compare the behavior and functions of che and boludo and the results have helped to reveal contexts in which it would be inadmissible or inappropriate to employ boludo instead of che due to the possible violation of politeness norms. In the article, che and boludo are considered mainly from the sociolinguistic and pragmatic approaches although some important cultural phenomena are discussed as well.

  15. I sei numeri dell'universo le forze profonde che spiegano il cosmo

    CERN Document Server

    Rees, Martin

    2002-01-01

    È possibile che sei semplici numeri, sei costanti universali, diano conto dell'infinita varietà e della stupefacente complessità del cosmo? L'astrofisico Martin Rees ci mostra che non soltano ciò è possibile, ma in quei sei numeri sono scritti la storia, la struttura e il futuro dell'universo, e che perfino la comparsa della vita sulla terra, e dunque la nostra stessa esistenza, non sarebbe concepibile se uno solo di quei valori numerici, definiti nell'istante che segnò la nascita del mondo, fosse differente. I sei numeri dell'universo ci introducono così ad alcune delle questioni più profonde su cui si interroga oggi la scienza.

  16. Award ceremony for the "Crèche and School" competition

    CERN Multimedia

    Staff Association

    2018-01-01

    Whenever there is a competition, there are obviously participants – and especially winners! The awards ceremony for the competition to find a new name for the CERN Staff Association's Crèche and School took place on 15 May. During the ceremony, jointly led by Céline Grobon (President of the Crèche and School Steering Committee), Carole Dargagnon (Headmistress of the Crèche and School) and Jean-Baptiste Zenner (Staff Association delegate), the proposals selected by the jury were rewarded. The first place went to Marie-Luz Cavagna for her proposal "Le jardin des petits chercheurs", and the second place to Sarah Palluel for her proposal "Le Jardin des Zélectrons". Finally, Aude Mourey and Sandra Fleury tied for third place with their respective proposals "Les petits atomes" and "La crèche des particules". Can we find the winning name of the competition among...

  17. MSL Chemistry and Mineralogy X-Ray Diffraction X-Ray Fluorescence (CheMin) Instrument

    Science.gov (United States)

    Zimmerman, Wayne; Blake, Dave; Harris, William; Morookian, John Michael; Randall, Dave; Reder, Leonard J.; Sarrazin, Phillipe

    2013-01-01

    This paper provides an overview of the Mars Science Laboratory (MSL) Chemistry and Mineralogy Xray Diffraction (XRD), X-ray Fluorescence (XRF) (CheMin) Instrument, an element of the landed Curiosity rover payload, which landed on Mars in August of 2012. The scientific goal of the MSL mission is to explore and quantitatively assess regions in Gale Crater as a potential habitat for life - past or present. The CheMin instrument will receive Martian rock and soil samples from the MSL Sample Acquisition/Sample Processing and Handling (SA/SPaH) system, and process it utilizing X-Ray spectroscopy methods to determine mineral composition. The Chemin instrument will analyze Martian soil and rocks to enable scientists to investigate geophysical processes occurring on Mars. The CheMin science objectives and proposed surface operations are described along with the CheMin hardware with an emphasis on the system engineering challenges associated with developing such a complex instrument.

  18. Che a 1: recombinant expression, purification and correspondence to the natural form.

    Science.gov (United States)

    Barderas, Rodrigo; Villalba, Mayte; Rodríguez, Rosalía

    2004-12-01

    Pollinosis to chenopods is one of the main causes of allergy in desertic regions and it is increasing in the South of Europe and Western USA. Che a 1 is a major allergen for chenopod-allergic subjects and belongs to the Ole-e-1-like family of proteins. Pichia pastoris yeast has been used as expression system to produce the recombinant form of Che a 1 (rChe a 1). The allergen was isolated using a gel permeation column and reverse-phase/high-performance liquid chromatography. Molecular characterization was performed using Edman degradation, mass spectrometry and concanavalin A staining. Sera from patients allergic to chenopod pollen, as well as polyclonal and monoclonal antibodies raised against Ole e 1, were used in immunoblotting, ELISA and inhibition assays for immunological characterization of rChe a 1. The allergen was purified to homogeneity with a final yield of 15 mg/l of cell culture and showed a glycosylated character. N-terminal amino acid sequence of rChe a 1 and molecular mass were according to those of the protein isolated from chenopod pollen. The recombinant allergen maintained the IgG and IgE epitopes of the natural allergen deduced from the immunological assays. Structural and in vitro immunological properties of rChe a 1 produced in P. pastoris were equivalent to those of the natural form of the allergen and, thus, it could be used in testing patients allergic to chenopods. 2004 S. Karger AG, Basel.

  19. Overexpression, purification, crystallization and preliminary X-ray analysis of CheY4 from Vibrio cholerae O395

    International Nuclear Information System (INIS)

    Biswas, Maitree; Khamrui, Susmita; Sen, Udayaditya; Dasgupta, Jhimli

    2011-01-01

    The chemotaxis response regulator CheY4 from V. cholerae has been cloned, overexpressed, purified and crystallized in monoclinic and hexagonal space groups; the crystals diffracted to 1.67 and 1.9 Å resolution, respectively. Chemotaxis and motility greatly influence the infectivity of Vibrio cholerae, although the role of chemotaxis genes in V. cholerae pathogenesis is poorly understood. In contrast to the single copy of CheY found in Escherichia coli and Salmonella typhimurium, four CheYs (CheY1–CheY4) are present in V. cholerae. While insertional disruption of the cheY4 gene results in decreased motility, insertional duplication of this gene increases motility and causes enhanced expression of the two major virulence genes. Additionally, cheY3/cheY4 influences the activation of the transcription factor NF-κB, which triggers the generation of acute inflammatory responses. V. cholerae CheY4 was cloned, overexpressed and purified by Ni–NTA affinity chromatography followed by gel filtration. Crystals of CheY4 grown in space group C2 diffracted to 1.67 Å resolution, with unit-cell parameters a = 94.4, b = 31.9, c = 32.6 Å, β = 96.5°, whereas crystals grown in space group P3 2 21 diffracted to 1.9 Å resolution, with unit-cell parameters a = b = 56.104, c = 72.283 Å, γ = 120°

  20. Programma Socialnych Issledovanii - 1999

    Czech Academy of Sciences Publication Activity Database

    Hamplová, Dana

    2002-01-01

    Roč. 29, č. 7 (2002), s. 78-86 ISSN 0132-1625 R&D Projects: GA ČR GA403/99/1129 Institutional research plan: CEZ:AV0Z7028912 Keywords : religion * christianity * occultism Subject RIV: AO - Sociology, Demography Impact factor: 0.184, year: 2002

  1. The Azospirillum brasilense Che1 chemotaxis pathway controls swimming velocity, which affects transient cell-to-cell clumping.

    Science.gov (United States)

    Bible, Amber; Russell, Matthew H; Alexandre, Gladys

    2012-07-01

    The Che1 chemotaxis-like pathway of Azospirillum brasilense contributes to chemotaxis and aerotaxis, and it has also been found to contribute to regulating changes in cell surface adhesive properties that affect the propensity of cells to clump and to flocculate. The exact contribution of Che1 to the control of chemotaxis and flocculation in A. brasilense remains poorly understood. Here, we show that Che1 affects reversible cell-to-cell clumping, a cellular behavior in which motile cells transiently interact by adhering to one another at their nonflagellated poles before swimming apart. Clumping precedes and is required for flocculation, and both processes appear to be independently regulated. The phenotypes of a ΔaerC receptor mutant and of mutant strains lacking cheA1, cheY1, cheB1, or cheR1 (alone or in combination) or with che1 deleted show that Che1 directly mediates changes in the flagellar swimming velocity and that this behavior directly modulates the transient nature of clumping. Our results also suggest that an additional receptor(s) and signaling pathway(s) are implicated in mediating other Che1-independent changes in clumping identified in the present study. Transient clumping precedes the transition to stable clump formation, which involves the production of specific extracellular polysaccharides (EPS); however, production of these clumping-specific EPS is not directly controlled by Che1 activity. Che1-dependent clumping may antagonize motility and prevent chemotaxis, thereby maintaining cells in a metabolically favorable niche.

  2. A CheR/CheB fusion protein is involved in cyst cell development and chemotaxis in Azospirillum brasilense Sp7.

    Science.gov (United States)

    Wu, Lixian; Cui, Yanhua; Hong, Yuanyuan; Chen, Sanfeng

    2011-12-20

    We here report the sequence and functional analysis of cstB of Azospirillum brasilense Sp7. The predicted cstB contains C-terminal two PAS domains and N-terminal part which has similarity with CheB-CheR fusion protein. cstB mutants had reduced swarming ability compared to that of A. brasilense wild-type strain, implying that cstB was involved in chemotaxis in A. brasilense. A microscopic analysis revealed that cstB mutants developed mature cyst cells more quickly than wild type, indicating that cstB is involved in cyst formation. cstB mutants were affected in colony morphology and the production of exopolysaccharides (EPS) which are essential for A. brasilense cells to differentiate into cyst-like forms. These observations suggested that cstB was a multi-effector involved in cyst development and chemotaxis in A. brasilense. Copyright © 2010 Elsevier GmbH. All rights reserved.

  3. Il lungo freddo storia di Bruno Pontecorvo, lo scienziato che scelse l'URSS

    CERN Document Server

    Mafai, Miriam

    2012-01-01

    Nelle parole della grande giornalista recentemente scomparsa, la documentata narrazione della storia di Bruno Pontecorvo, fisico nucleare di fama mondiale che, nel pieno della Guerra fredda, scelse di abbandonare l'Occidente e di lavorare e vivere nell'Unione Sovietica. Grazie alla capacità della Mafai nel ricostruire gli eventi cruciali della vita di Pontecorvo in un nuovo quadro rivelatore, "Il lungo freddo" non offre solo un'inedita prospettiva sulla drammatica corsa alla bomba atomica - dalle decisive scoperte del Progetto Manhattan alla tragica esplosione di Hiroshima, dalla prima atomica sovietica alla bomba all'idrogeno - ma rappresenta soprattutto la memoria collettiva di una generazione che ha posto la politica al centro delle proprie scelte di vita. E svela i drammi umani di un conflitto che per più di quarant'anni ha diviso il mondo.

  4. The new Meyrin crèche takes its first steps

    CERN Multimedia

    2008-01-01

    The new Meyrin crèche was inaugurated on 10 October and already caters for 16 children of CERN personnel. Copyright: Laurent Barlier. Copyright: Robert Tillmann. At the end of August, the new Meyrin crèche in Champs-Fréchets, the Espace de Vie Enfantine (EVE), welcomed its first intake of infants. They included 16 children of members of the CERN personnel who are benefiting from the agreement signed in 2007 with the commune of Meyrin (see Bulletin n°43&44/2007). The crèche was officially inaugurated on 10 October with several CERN representatives in attendance, including HR Department Head, Enrico Chiaveri, and Head of the Relations with the Host States Service, Friedmann Eder. The following day, EVE held an open day for the inhabitants of Meyrin and interested members of the CERN personnel. The new 1516 m2 building ‘s spaces have very clean and ...

  5. Storie ‘vere’ ed eroine dei romanzi. Rappresentare la Somalia in 'Ilaria Alpi. La ragazza che voleva raccontare l’inferno' e 'Non dirmi che hai paura'

    Directory of Open Access Journals (Sweden)

    Simone Brioni

    2016-09-01

    Full Text Available ‘True’ Stories and Heroines in Novels: The Representation of Somalia in Ilaria Alpi: The Young Woman Who Wanted to Narrate Hell and Don’t Tell Me You Are AfraidThis article analyses Gigliola Alvisi’s Ilaria Alpi: La ragazza che voleva raccontare l’inferno [Ilaria Alpi: The Young Woman Who Wanted to Narrate the Hell] (2014 and Giuseppe Catozzella’s Non dirmi che hai paura [Don’t Tell Me You Are Afraid] (2014, two novels that deal with two recent events in Somali and Italian history, the killing of the journalist Ilaria Alpi in Mogadishu in 1994 and the death of Samia Yosuf Omar while she was trying to reach the Italian shores from Libya by boat. Alvisi’s text is analysed in comparison with other fictional and journalistic representations of Ilaria Alpi, while Non dirmi che hai paura is examined through what Catozzella considers the two constitutive dimensions of the novel: documentation and identification. Drawing on Stefano Jossa’s reflections on the construction of literary heroes, the article challenges Alvisi’s and Catozzella’s claims that they represent ‘true stories’. The article also argues that the main characters of these literary works are portrayed as heroines and role models for the emancipation of Muslim women.

  6. Crèche and School: Open Day on Saturday, 3 March

    CERN Multimedia

    EVE et École

    2018-01-01

    Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Wednesday 28 February 2018: https://doodle.com/poll/3qvrb6m73pktqbft

  7. Il fantasma dell'universo che cos'è il neutrino

    CERN Document Server

    Votano, Lucia

    2015-01-01

    Ben prima della luce, a un decimillesimo di secondo dal Big Bang, i neutrini sono apparsi nell'universo. Dopo un secondo il brodo primordiale si era raffreddato abbastanza da consentire loro di muoversi liberi e ancora oggi, dopo quasi quattordici miliardi di anni, sono numerosissimi. Ma che cosa sono i neutrini? Elusivi come fantasmi, camaleontici, viaggiano indenni attraverso la materia arrivando dritti sino a noi dagli angoli più remoti e nascosti dell'universo. Per saperne di più seguiremo i fisici che li studiano in laboratori sotterranei o in luoghi estremi come i ghiacciai polari o le profondità marine.

  8. A crèche for CERN staff The Staff Association project

    CERN Multimedia

    Association du personnel

    2006-01-01

    For many years, the Staff Association has supported the demand for the creation of a crèche for the children of CERN staff. Several studies have been carried out without leading to a concrete plan. The fact that the CERN population is getting younger and the shortage of local facilities have led to a more urgent demand for this type of social service over the past few years. Furthermore, the Equal Opportunities Panel had already recommended that crèche places be made available.

  9. Final report SmartProofS. Results of projects of the SmartProofS program; Eindrapport SmartProofS. Projectresultaten van het SmartProofS programma

    Energy Technology Data Exchange (ETDEWEB)

    Van Hoorik, P.; Westerga, R. [Energy Valley, Groningen (Netherlands)

    2011-05-15

    The SmartProofs program aims to develop tools which must show that the principle of a Smart Power System (SPS) works and how. An SPS can ensure that the supply and demand of electricity in the grid is balanced, even in case more decentralized energy techniques will be put into use. This final report summarizes the main results and conclusions of the SmartProofs program. As part of the SPS program attention is paid to the impacts on the girds, the effects of centralized and decentralized management, disaster resilience, pricing models, potential benefits of control and new business models [Dutch] Het SmartProofs programma heeft tot doel om een concept van een Smart Power System (SPS) te ontwikkelen waarmee kan worden aangetoond dat het principe van een SPS werkt en op welke manier. Een SPS kan zorgen dat het aanbod van elektriciteit op het net op elk moment van de dag overeenkomt met de vraag, ook als er straks veel meer decentrale energietechnieken gebruikt worden waarmee zowel de vraag als het aanbod van elektriciteit onvoorspelbaar wordt. Dit eindrapport geeft een overzicht van de belangrijkste resultaten en conclusies van het SmartProofs programma. Het programma heeft in de werkpakketten deelvraagstukken rondom SmartProofS onderzocht rondom de effecten op onze energienetten, de effecten van zowel centrale- als decentrale aansturing, disaster resilience, prijsmodellen, mogelijke baten van aansturing en nieuwe business modellen.

  10. Final report of the NIDO-programme 'Growing old in your own home'; Eindrapportage NIDO-programma 'In eigen omgeving oud worden'

    Energy Technology Data Exchange (ETDEWEB)

    Kester, J.; Bakker, E.J. [ECN Duurzame Energie in de Gebouwde Omgeving DEGO, Petten (Netherlands)

    2005-01-01

    The aim of the title programme (EOW, abbreviated in Dutch) of the National Initiative Sustainable Development (NIDO, abbreviated in Dutch) was to initiate and stimulate the development of sustainable houses for elderly people with more comfort and safety and low use of energy and materials, focusing on information and communication technology applications, also know as domotics. In this report an overview is given of the EOW programme, its contents and results. [Dutch] Met het programma 'In Eigen Omgeving Oud Worden' (EOW) heeft NIDO (Nationaal Initiatief Duurzame Ontwikkeling) zich gericht op het wonen en de zorg voor ouderen. Doelstelling van het programma is om een impuls te geven aan de ontwikkeling van duurzame woningen voor ouderen, met meer comfort en veiligheid en een zo laag mogelijk energie- en materiaalgebruik. Hierbij wordt gefocust op de rol die ICT-toepassingen in en om de woning en bijbehorende diensten - ook wel 'domotica' genoemd - kunnen spelen. Het gaat om extra voorzieningen in woningen op het gebied van veiligheid, comfort en zorg. Duurzaam domotica toepassen betekent vraaggericht aanbieden, diensten combineren, veiligheid optimaliseren en extra energiegebruik in woningen beperken. Dit rapport beschrijft de opzet, de inhoud en de resultaten van dit programma.

  11. Demonstrating the Open Data Repository's Data Publisher: The CheMin Database

    Science.gov (United States)

    Stone, N.; Lafuente, B.; Bristow, T.; Pires, A.; Keller, R. M.; Downs, R. T.; Blake, D.; Dateo, C. E.; Fonda, M.

    2018-04-01

    The Open Data Repository's Data Publisher aims to provide an easy-to-use software tool that will allow researchers to create and publish database templates and related data. The CheMin Database developed using this framework is shown as an example.

  12. Trent'anni che sconvolsero la fisica la storia della teoria dei quanti

    CERN Document Server

    Gamow, George

    1993-01-01

    Gli anni dal 1900 al 1930 hanno portato un profondo mutamento nella visione che l'uomo aveva dell'universo: tra la prima idea di Max Planck dei quanti di luce nel 1900, e la previsione dell'esistenza delle antiparticelle formulata da P. A. M. Dirac nel 1929, corre un periodo di emozionanti progressi nel campo della fisica teorica.

  13. Reading Strategies: Issues in the Computerization of Machiavelli's "Il demonio che prese moglie".

    Science.gov (United States)

    Morgan, Leslie Zarker

    1994-01-01

    The ideal computer-based foreign language reading program must include cognitive background, a learning taxonomy, sound computer design, and knowledge of what is needed for the specific language. Machiavelli's "Il demonia che prese moglie" is chosen for study due to its historical interest. (63 references) (CK)

  14. Inwentarz fary chełmińskiej i jej biblioteki z XV wieku

    Directory of Open Access Journals (Sweden)

    Mateusz Superczyński

    2017-07-01

    Full Text Available Artykuł niniejszy prezentuje edycję nieznanego szerzej dotychczas inwentarza fary chełmińskiej i wykazu księgozbioru biblioteki farnej z XV w., które znajdują się w księdze miejskiej Chełmna – kopiariuszu przywilejów i dokumentów, założonej przez pisarza Konrada Bitschina w 1431 r. Przekaz źródłowy daje obraz biblioteki fary chełmińskiej jako ośrodka kultury w XV-wiecznym Chełmnie. Pozwala także na porównanie trzech zachowanych spisów księgozbiorów średniowiecznego Chełmna, a więc z klasztoru Franciszkanów z XIII wieku, biblioteki farnej i zrekonstruowanego spisu biblioteki Braci Wspólnego Życia z końca XV stulecia, które pochodzą z różnych okresów i odzwierciedlają przemiany w duchowości, teologii i zainteresowaniach naukowych ówczesnych elit intelektualnych miasta. Podczas gdy księgozbiory biblioteki franciszkanów czy farnej oddają ducha średniowiecznej scholastyki czy nominalizmu, to wydania, które posiadali Bracia Wspólnego Życia, zwiastują nadejście humanizmu. Odnotowane przez pisarza miejskiego tytuły, mimo zniekształceń,pozwalają także na identyfikację i odnalezienie wśród nich fundamentalnych dla średniowiecznej teologii, liturgii, historii i filozofii dzieł.

  15. The Emotional Communication in Hearing Questionnaire (EMO-CHeQ): Development and Evaluation.

    Science.gov (United States)

    Singh, Gurjit; Liskovoi, Lisa; Launer, Stefan; Russo, Frank

    2018-06-11

    The objectives of this research were to develop and evaluate a self-report questionnaire (the Emotional Communication in Hearing Questionnaire or EMO-CHeQ) designed to assess experiences of hearing and handicap when listening to signals that contain vocal emotion information. Study 1 involved internet-based administration of a 42-item version of the EMO-CHeQ to 586 adult participants (243 with self-reported normal hearing [NH], 193 with self-reported hearing impairment but no reported use of hearing aids [HI], and 150 with self-reported hearing impairment and use of hearing aids [HA]). To better understand the factor structure of the EMO-CHeQ and eliminate redundant items, an exploratory factor analysis was conducted. Study 2 involved laboratory-based administration of a 16-item version of the EMO-CHeQ to 32 adult participants (12 normal hearing/near normal hearing (NH/nNH), 10 HI, and 10 HA). In addition, participants completed an emotion-identification task under audio and audiovisual conditions. In study 1, the exploratory factor analysis yielded an interpretable solution with four factors emerging that explained a total of 66.3% of the variance in performance the EMO-CHeQ. Item deletion resulted in construction of the 16-item EMO-CHeQ. In study 1, both the HI and HA group reported greater vocal emotion communication handicap on the EMO-CHeQ than on the NH group, but differences in handicap were not observed between the HI and HA group. In study 2, the same pattern of reported handicap was observed in individuals with audiometrically verified hearing as was found in study 1. On the emotion-identification task, no group differences in performance were observed in the audiovisual condition, but group differences were observed in the audio alone condition. Although the HI and HA group exhibited similar emotion-identification performance, both groups performed worse than the NH/nNH group, thus suggesting the presence of behavioral deficits that parallel self

  16. Uzņēmumu "Circle K", "Neste" un "Virši-A" lojalitātes programmas un to novērtējums

    OpenAIRE

    Stabrovska, Viktorija

    2017-01-01

    Bakalaura darba tēma ir „Uzņēmumu "Circle K", "Neste" un "Virši-A" lojalitātes programmas un to novērtējums”. Darba mēr is ir veikt uzņēmuma «Circle K», “Neste” un «Virši-A» komunikācijas analīzi par lojalitātes programmām un klientu vērtējumu par uzņēmumu veiktajām klientu lojalitātes veicināšanas aktivitātēm. Darbs sastāv no trīs da ām: teorētiskās, metodolo iskās un empīriskās da as. Darba teorētiskājā da ā izmantota literatūra par zīmolu, mārketingu, mārketinga kompleksu, mārketinga komun...

  17. A cheZ-Like Gene in Azorhizobium caulinodans Is a Key Gene in the Control of Chemotaxis and Colonization of the Host Plant.

    Science.gov (United States)

    Liu, Xiaolin; Liu, Wei; Sun, Yu; Xia, Chunlei; Elmerich, Claudine; Xie, Zhihong

    2018-02-01

    Chemotaxis can provide bacteria with competitive advantages for survival in complex environments. The CheZ chemotaxis protein is a phosphatase, affecting the flagellar motor in Escherichia coli by dephosphorylating the response regulator phosphorylated CheY protein (CheY∼P) responsible for clockwise rotation. A cheZ gene has been found in Azorhizobium caulinodans ORS571, in contrast to other rhizobial species studied so far. The CheZ protein in strain ORS571 has a conserved motif similar to that corresponding to the phosphatase active site in E. coli The construction of a cheZ deletion mutant strain and of cheZ mutant strains carrying a mutation in residues of the putative phosphatase active site showed that strain ORS571 participates in chemotaxis and motility, causing a hyperreversal behavior. In addition, the properties of the cheZ deletion mutant revealed that ORS571 CheZ is involved in other physiological processes, since it displayed increased flocculation, biofilm formation, exopolysaccharide (EPS) production, and host root colonization. In particular, it was observed that the expression of several exp genes, involved in EPS synthesis, was upregulated in the cheZ mutant compared to that in the wild type, suggesting that CheZ negatively controls exp gene expression through an unknown mechanism. It is proposed that CheZ influences the Azorhizobium -plant association by negatively regulating early colonization via the regulation of EPS production. This report established that CheZ in A. caulinodans plays roles in chemotaxis and the symbiotic association with the host plant. IMPORTANCE Chemotaxis allows bacteria to swim toward plant roots and is beneficial to the establishment of various plant-microbe associations. The level of CheY phosphorylation (CheY∼P) is central to the chemotaxis signal transduction. The mechanism of the signal termination of CheY∼P remains poorly characterized among Alphaproteobacteria , except for Sinorhizobium meliloti , which

  18. Open Day at Crèche and School of the CERN Staff Association

    CERN Multimedia

    Staff Association

    2018-01-01

    In the morning of Saturday, 3 March 2018, the Crèche and School of the CERN Staff Association opened its doors for parents who wished to visit the establishment. Once again, the Open Day was a great success and brought together more than 50 families for two information sessions, which included: a general presentation of the establishment by the Headmistress, and a visit of the facilities led by the Headmistress and her deputy. At the end of the visit, parents were invited for a drink. This was an opportunity for both parents and professionals to have interesting discussions regarding the general conditions of the establishment and the pedagogical approach applied in the crèche and the school. The management team was delighted to offer the parents the opportunity to participate in this event, where everyone could express their views, ask questions and find answers in a friendly and relaxed atmosphere.

  19. Sulle ipotesi che stanno alla base della geometria e altri scritti scientifici e filosofici

    CERN Document Server

    Riemann, Bernhard

    1994-01-01

    Il volume raccoglie, oltre al testo della lezione del 1854 che dà il titolo all'opera, alcuni scritti di carattere scientifico e filosofico di Riemann. A saggi di argomento scientifico si affiancano scritti di argomento più direttamente metodologico. La concezione della scienza che ci viene offerta da questi scritti è assai significativa del personaggio e della sua epoca. Per Riemann la matematica non è un mero strumento esteriore da applicare, appunto dall'esterno, ai fenomeni. Al contrario, essa consente di spingersi con il rigore necessario oltre alla superficie dei fenomeni e di penetrare sempre più a fondo nella realtà, nell'ottica di un sistema unitario e quasi metafisico del sapere scientifico.

  20. Il museo che non c’è. Note sulla dispersione del patrimonio in Gran Bretagna

    Directory of Open Access Journals (Sweden)

    Caroline Patey

    2011-03-01

    Full Text Available Indifferente alla loro recente moltiplicazione come al sodalizio che vi si celebra con l’architettura di grido, un fantasma si aggira per i musei. Sordo al nome di Jean Nouvel (Reina Sofia, Louvre quanto a quelli di Herzog & De Meuron (Tate Modern, impermeabile ai fasti del British Museum (Norman Foster come ai restauri della Tate Britain (James Stirling, disinteressato alle fortune del ‘nuovo’ Victoria and Albert Museum e malinconico come si addice alla sua natura, il fantasma invita a interrogare tanta luccicante spettacolarità e forse a non dimenticare che, per quanto custode di memoria e guardiano di culture, il museo è anche il luogo dove vengono consumate, direttamente o meno, amnesie e damnatio memoriae e in nome del quale continuano a perpetrarsi non poche violazioni e disseminazioni.

  1. Site-specific and synergistic stimulation of methylation on the bacterial chemotaxis receptor Tsr by serine and CheW

    Directory of Open Access Journals (Sweden)

    Weis Robert M

    2005-03-01

    Full Text Available Abstract Background Specific glutamates in the methyl-accepting chemotaxis proteins (MCPs of Escherichia coli are modified during sensory adaptation. Attractants that bind to MCPs are known to increase the rate of receptor modification, as with serine and the serine receptor (Tsr, which contributes to an increase in the steady-state (adapted methylation level. However, MCPs form ternary complexes with two cytoplasmic signaling proteins, the kinase (CheA and an adaptor protein (CheW, but their influences on receptor methylation are unknown. Here, the influence of CheW on the rate of Tsr methylation has been studied to identify contributions to the process of adaptation. Results Methyl group incorporation was measured in a series of membrane samples in which the Tsr molecules were engineered to have one available methyl-accepting glutamate residue (297, 304, 311 or 493. The relative rates at these sites (0.14, 0.05, 0.05 and 1, respectively differed from those found previously for the aspartate receptor (Tar, which was in part due to sequence differences between Tar and Tsr near site four. The addition of CheW generated unexpectedly large and site-specific rate increases, equal to or larger than the increases produced by serine. The increases produced by serine and CheW (added separately were the largest at site one, ~3 and 6-fold, respectively, and the least at site four, no change and ~2-fold, respectively. The rate increases were even larger when serine and CheW were added together, larger than the sums of the increases produced by serine and CheW added separately (except site four. This resulted in substantially larger serine-stimulated increases when CheW was present. Also, CheW enhanced methylation rates when either two or all four sites were available. Conclusion The increase in the rate of receptor methylation upon CheW binding contributes significantly to the ligand specificity and kinetics of sensory adaptation. The synergistic effect of

  2. LA LINGUA FILMATA: "L'UOMO CHE VERRÀ" DI GIORGIO DIRITTI

    Directory of Open Access Journals (Sweden)

    Marta Idini

    2016-02-01

    Full Text Available La lingua filmata appare oggi uno dei campi linguistici in cui il dialetto torna ad essere scelta registica e veicolo di nuove istanze comunicative, in stretta relazione con un nuovo modo di intendere e praticare il cinema. Il presente articolo introduce il lettore alla consuetudine cinematografica del dialetto, analizzandone la presenza e le funzioni che gli sono state attribuite nei decenni trascorsi e presenti, e guarda a L’Uomo che verrà quale espressione attuale di una nuova risorgenza dialettale all’interno delle pellicole nostrane. Attraverso un’analisi attenta dei fenomeni vernacolari in esso presenti, l’indagine si sofferma sulle motivazioni e l’efficacia comunicativa cui perviene l’uso del dialetto e si interroga su quale grado di realismo o mimesi linguistica Diritti abbia raggiunto. Language of film: "L’uomo che verrà" by Giorgio DirittiLanguage in films is one of the fields where dialect becomes a choice and a vehicle for new communicative demands, closely related the new way of understanding and practicing the cinema. This article introduces the reader to the use of dialect in films, analyzing the presence and functions that have been attributed to it in the past and present decades, and looks at L’Uomo che verrà as an expression of the new resurgence of dialect in Italian films. Through careful analysis of the vernacular, the paper focuses on the motivations and the communicative effectiveness of the use of dialect and questions the degree of realism or linguistic mimesis that Diritti was able to reach.

  3. CheShift-2 resolves a local inconsistency between two X-ray crystal structures

    International Nuclear Information System (INIS)

    Vila, Jorge A.; Sue, Shih-Che; Fraser, James S.; Scheraga, Harold A.; Dyson, H. Jane

    2012-01-01

    Since chemical shifts provide important and relatively accessible information about protein structure in solution, a Web server, CheShift-2, was developed for structure interrogation, based on a quantum mechanics database of 13 C α chemical shifts. We report the application of CheShift-2 to a local inconsistency between two X-ray crystal structures (PDB IDs 1IKN and 1NFI) of the complex between the p65/p50 heterodimer of NFκB and its inhibitor IκBα. The availability of NMR resonance assignments that included the region of the inconsistency provided an opportunity for independent validation of the CheShift-2 server. Application of the server showed that the 13 C α chemical shifts measured for the Gly270-Pro281 sequence close to the C-terminus of IκBα were unequivocally consistent with the backbone structure modeled in the 1IKN structure, and were inconsistent with the 1NFI structure. Previous NOE measurements had demonstrated that the position of a tryptophan ring in the region immediately N-terminal in this region was not consistent with either structure. Subsequent recalculation of the local structure in this region, based on the electron density of the deposited structure factors for 1IKN, confirmed that the local backbone structure was best modeled by 1IKN, but that the rotamer of Trp258 is consistent with the 1NFI structure, including the presence of a hydrogen bond between the ring NεH of Trp258 and the backbone carbonyl group of Gln278. The consensus between all of these measures suggests that the CheShift-2 server operates well under circumstances in which backbone chemical shifts are available but where local plasticity may render X-ray structural data ambiguous.

  4. Report to EuCheMS Division of Analytical Chemistry on CITAC Activity

    DEFF Research Database (Denmark)

    Andersen, Jens Enevold Thaulov; Wegsheider, Wolfhard

    Although the CITAC organisation [1] was founded on traceability, it embraces a variety of concepts allocated specifically to quality assurance. Collaboration with other organisations that promote practices and procedures of quality assurance is essential, and appointed liaison persons...... are encouraged to support this effort. In continuation of this aim a close contact to EuCheMS is desired together with contacts to IUPAC, ISO/REMCO, BIPM/CCQM, ILAC, EA, APLAC, EUROMET, SIM, APMP, AOACI, IAEA, IFCC and SADCMET....

  5. La macchina che cerca Dio. Nasce LHC forse scoprira' Higgs elusiva particella della creazione

    CERN Multimedia

    Bianucci, P

    2003-01-01

    "LEON Lederman, premio Nobel per la fisica, l'ha misticamente definita la particella di Dio perche' sarebbe il pilastro sul quale si appoggia tutta la materia dell'universo che conosciamo. Piu' tecnicamente, e' la "particella di Higgs", un bosone previsto dal Modello Standard del microcosmo la cui esistenza sarebbe necessaria per giustificare, anche quantitativamente, la massa di tutte le particelle" (1/2 page).

  6. The Pseudomonas aeruginosa chemotaxis methyltransferase CheR1 impacts on bacterial surface sampling.

    Directory of Open Access Journals (Sweden)

    Juliane Schmidt

    Full Text Available The characterization of factors contributing to the formation and development of surface-associated bacterial communities known as biofilms has become an area of intense interest since biofilms have a major impact on human health, the environment and industry. Various studies have demonstrated that motility, including swimming, swarming and twitching, seems to play an important role in the surface colonization and establishment of structured biofilms. Thereby, the impact of chemotaxis on biofilm formation has been less intensively studied. Pseudomonas aeruginosa has a very complex chemosensory system with two Che systems implicated in flagella-mediated motility. In this study, we demonstrate that the chemotaxis protein CheR1 is a methyltransferase that binds S-adenosylmethionine and transfers a methyl group from this methyl donor to the chemoreceptor PctA, an activity which can be stimulated by the attractant serine but not by glutamine. We furthermore demonstrate that CheR1 does not only play a role in flagella-mediated chemotaxis but that its activity is essential for the formation and maintenance of bacterial biofilm structures. We propose a model in which motility and chemotaxis impact on initial attachment processes, dispersion and reattachment and increase the efficiency and frequency of surface sampling in P. aeruginosa.

  7. X-Ray Diffraction on Mars: Scientific Discoveries Made by the CheMin Instrument

    Science.gov (United States)

    Rampe, E. B.; Blake, D. F.; Ming, D. W.; Bristow, T. F.

    2017-01-01

    The Mars Science Laboratory Curiosity landed in Gale crater in August 2012 with the goal to identify and characterize habitable environments on Mars. Curiosity has been studying a series of sedimentary rocks primarily deposited in fluviolacustrine environments approximately 3.5 Ga. Minerals in the rocks and soils on Mars can help place further constraints on these ancient aqueous environments, including pH, salinity, and relative duration of liquid water. The Chemistry and Mineralogy (CheMin) X-ray diffraction and X-ray fluorescence instrument on Curiosity uses a Co X-ray source and charge-coupled device detector in transmission geometry to collect 2D Debye-Scherrer ring patterns of the less than 150 micron size fraction of drilled rock powders or scooped sediments. With an angular range of approximately 2.52deg 20 and a 20 resolution of approximately 0.3deg, mineral abundances can be quantified with a detection limit of approximately 1-2 wt. %. CheMin has returned quantitative mineral abundances from 16 mudstone, sandstone, and aeolian sand samples so far. The mineralogy of these samples is incredibly diverse, suggesting a variety of depositional and diagenetic environments and different source regions for the sediments. Results from CheMin have been essential for reconstructing the geologic history of Gale crater and addressing the question of habitability on ancient Mars.

  8. Pretreatment with P-Nitrophenyl Phosphoramides: Spontaneous Reactivation of Blood ChE after Oral Administration to Guinea Pigs

    National Research Council Canada - National Science Library

    Polhuijs, M

    1997-01-01

    ... and of the reference compounds pyridostigmine and physostigmine has been studied in the guinea pig, as determined by measuring spontaneous reactivation of blood ChE inhibited by these pretreatment compounds...

  9. State Supervision of Mines. Strategy and Programme for 2012-2016; Staatstoezicht op de Mijnen. Strategie en Programma voor 2012-2016

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-11-15

    State Supervision of Mines (SodM) supervises the observance of legal regulations that apply to the search for, extraction of and storage of minerals. The SodM focuses on aspects of safety, health, environment, efficient extraction and soil movements. Every five years, the SodM draws up a strategic document. This third strategic document concerns the period 2012-2016. The report provides an overview of the realizations of the last five years. Moreover an analysis is included of the policy developments in the fields of mineral extraction, safety, health and environment. Subsequently the consequences of these developments for SodM are examined. Based on these developments an elaboration is provided of the initiatives taken by SodM and an outlook of the programme of supervision projects for the next five years. This document also includes a communication plan, which illustrates when and how SodM goes public [Dutch] Staatstoezicht op de Mijnen (SodM) houdt toezicht op de naleving van wettelijke regelingen die van toepassing zijn op het opsporen, winnen, opslaan en transporteren van delfstoffen. De dienst richt zich hierbij op de aspecten veiligheid, gezondheid, milieu, doelmatige winning en bodembewegingen. Elke vijf jaar stelt SodM een strategiedocument op. Dit derde strategiedocument betreft de periode 2012-2016. In dit rapport wordt uiteengezet wat er de afgelopen vijf jaar is gerealiseerd. Tevens wordt een analyse geboden van de beleidsontwikkelingen op het terrein van delfstofwinning, veiligheid, gezondheid en milieu. Vervolgens wordt nagegaan, wat die ontwikkelingen betekenen voor SodM. Op basis van die ontwikkelingen wordt uiteengezet welke initiatieven SodM neemt en hoe het programma van toezichtprojecten er de komende vijf jaar uitziet. In het document is tevens een communicatieplan opgenomen, waaruit blijkt wanneer en hoe SodM naar buiten treedt.

  10. State Supervision of Mines. Strategy and Programme for 2007-2011; Staatstoezicht op de Mijnen. Strategie en Programma 2007-2011

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-01-15

    State Supervision of Mines (SodM) supervises the observance of legal regulations that apply to the search for, extraction of and storage of minerals. The SodM focuses on aspects of safety, health, environment, efficient extraction and soil movements. Every five years, the SodM draws up a strategic document. This strategic document is a sequel to the report 'Strategic policy 2002 to 2007'. This report provides a short overview of the realizations of the last five years. Moreover an analysis is included of the policy developments in the fields of mineral extraction, safety, health and environment. Subsequently the consequences of these developments for SodM are examined. Based on these developments an elaboration is provided of the initiatives taken by SodM and an outlook of the programme of supervision projects for the next five years. This document also includes a communication plan, which illustrates when and how SodM goes public. [mk]. [Dutch] Staatstoezicht op de Mijnen (SodM) houdt toezicht op de naleving van wettelijke regelingen die van toepassing zijn op het opsporen, winnen, opslaan en transporteren van delfstoffen. De dienst richt zich hierbij op de aspecten veiligheid, gezondheid, milieu, doelmatige winning en bodembewegingen. Elke vijf jaar stelt SodM een strategiedocument op. Dit strategiedocument is een vervolg op het rapport 'Strategisch beleid 2002 tot 2007'. In dit rapport wordt kort uiteengezet wat er de afgelopen vijf jaar is gerealiseerd. Tevens wordt een analyse geboden van de beleidsontwikkelingen op het terrein van delfstofwinning, veiligheid, gezondheid en milieu. Vervolgens wordt nagegaan, wat die ontwikkelingen betekenen voor SodM. Op basis van die ontwikkelingen wordt uiteengezet welke initiatieven SodM neemt en hoe het programma van toezichtprojecten er de komende vijf jaar uitziet. In het document is tevens een communicatieplan opgenomen, waaruit blijkt wanneer en hoe SodM naar buiten treedt.

  11. Valdose program: methodologies for dose assessment in internal contamination, 1997 census; Programma valdose: metodologie di valutazione della dose da contaminazione interna, censimento 1997

    Energy Technology Data Exchange (ETDEWEB)

    Castellani, C.M.; Battisti, P.; Tarroni, G. [ENEA, Centro Ricerche `Ezio Clementel`, Bologna (Italy). Dip. Ambiente

    1998-12-31

    Dose assessment in internal dosimetry needs computational and interpretative tools that allow carrying out, as a first step, an evaluation of intake on the base of bioassay measurements or WBC measurements, and as a second step, dose evaluation on the base of estimated intake. In the frame of the MIDIA Co-ordination (WBC operating in Italy), in the first months of 1997 a census on methodologies for dose evaluation in internal contamination has been proposed. A technical form has been sent to all the WBC Centres allowing an accurate description of modalities used in each centre. 9 out of 17 centres sent the answers to the technical form in time. In this paper all the forms filled in are reported. A careful comparative evaluation of the answers has been made both for routine monitoring and for special monitoring. The various radionuclides present in the Italian reality, calculation methodologies both for intake and dose, hypotheses adopted for date, path and modalities of contaminations are also presented. Proposals for conforming to the methodology in Italy after the introduction of the models following ICRP 60 publication that are the base of the Euratom 96/29 Directive are also discussed. [Italiano] La valutazione di dose in contaminazione interna necessita di strumenti interpretativi che permettano di effettuare in una prima la valutazione dell`intake sulla base delle misure dei campioni biologici o del corpo intero (WBC), ed in una seconda fase la valutazione della dose sulla base dell`intake. All`interno del coordinamento MIDIA dei WBC operanti in Italia e` stato proposto, nel primo trimestre del 1997, un censimento sulle metodologie di valutazione di dose da contaminazione interna. Ai diversi centri e` stato inviato una scheda tecnica che, mediante un particolareggiato schema di domande, aiutava i diversi centri nella esposizione delle modalita` di valutazione di dose che ogni centro segue. 9 au 17 centri WBC operanti al momemnto in Italia hanno inviato la

  12. Distinct Domains of CheA Confer Unique Functions in Chemotaxis and Cell Length in Azospirillum brasilense Sp7.

    Science.gov (United States)

    Gullett, Jessica M; Bible, Amber; Alexandre, Gladys

    2017-07-01

    Chemotaxis is the movement of cells in response to gradients of diverse chemical cues. Motile bacteria utilize a conserved chemotaxis signal transduction system to bias their motility and navigate through a gradient. A central regulator of chemotaxis is the histidine kinase CheA. This cytoplasmic protein interacts with membrane-bound receptors, which assemble into large polar arrays, to propagate the signal. In the alphaproteobacterium Azospirillum brasilense , Che1 controls transient increases in swimming speed during chemotaxis, but it also biases the cell length at division. However, the exact underlying molecular mechanisms for Che1-dependent control of multiple cellular behaviors are not known. Here, we identify specific domains of the CheA1 histidine kinase implicated in modulating each of these functions. We show that CheA1 is produced in two isoforms: a membrane-anchored isoform produced as a fusion with a conserved seven-transmembrane domain of unknown function (TMX) at the N terminus and a soluble isoform similar to prototypical CheA. Site-directed and deletion mutagenesis combined with behavioral assays confirm the role of CheA1 in chemotaxis and implicate the TMX domain in mediating changes in cell length. Fluorescence microscopy further reveals that the membrane-anchored isoform is distributed around the cell surface while the soluble isoform localizes at the cell poles. Together, the data provide a mechanism for the role of Che1 in controlling multiple unrelated cellular behaviors via acquisition of a new domain in CheA1 and production of distinct functional isoforms. IMPORTANCE Chemotaxis provides a significant competitive advantage to bacteria in the environment, and this function has been transferred laterally multiple times, with evidence of functional divergence in different genomic contexts. The molecular principles that underlie functional diversification of chemotaxis in various genomic contexts are unknown. Here, we provide a molecular

  13. L’immaginazione al lavoro. Che cosa e come conosciamo dal romanzo

    Directory of Open Access Journals (Sweden)

    Gianluca Consoli

    2011-12-01

    Full Text Available L’articolo delinea i fondamenti di un’epistemologia del romanzo, rispondendo alle domande di base: che cosa e come possiamo conoscere attraverso il romanzo. A partire dalla definizione del romanzo come racconto di finzione, viene sviluppata  una posizione di cognitivismo radicale, per la quale il romanzo (a produce conoscenza modale; (b giustifica questa conoscenza in base al principio della verosimiglianza; (c favorisce l’apprendimento per esperienza in virtù dell’esemplificazione immaginativa. Le tesi proposte vengono corroborate in riferimento ai recenti dati sperimentali ottenuti dalle scienze cognitive, in particolare dalla psicologia cognitiva, sull’immaginazione, la finzione, la simulazione.

  14. Crew Health Care System (CHeCS) Design Research, Documentations, and Evaluations

    Science.gov (United States)

    CLement, Bethany M.

    2011-01-01

    The Crew Health Care System (CHeCS) is a group within the Space Life Science Directorate (SLSD) that focuses on the overall health of astronauts by reinforcing the three divisions - the Environmental Maintenance System (EMS), the Countermeasures System (CMS), and the Health Maintenance System (HMS). This internship provided opportunity to gain knowledge, experience, and skills in CHeCS engineering and operations tasks. Various and differing tasks allowed for occasions to work independently, network to get things done, and show leadership abilities. Specific exercises included reviewing hardware certification, operations, and documentation within the ongoing Med Kit Redesign (MKR) project, and learning, writing, and working various common pieces of paperwork used in the engineering and design process. Another project focused on the distribution of various pieces of hardware to off-site research facilities with an interest in space flight health care. The main focus of this internship, though, was on a broad and encompassing understanding of the engineering process as time was spent looking at each individual step in a variety of settings and tasks.

  15. Finally a crèche at CERN, thanks to the Staff Association

    CERN Multimedia

    Staff Association

    2013-01-01

    Setting up at CERN a collective structure to mind children younger than two years, a so-called “crèche”, has been discussed at least since the early 1990s. Then, in February 2001, the Equal Opportunities Advisory Panel produced a memo to the Director of Administration in which it “invites the CERN Management to re-consider the possibility of creating a crèche at CERN”. As a result an ad hoc task force (“Bethléem”) was set up, which based its work on an informal questionnaire sent to CERN families with small children. Its study came up with some relevant parameters for “should CERN Management intend to undertake a minimal effort toward solving the crèche problem for its staff members”. Nothing was undertaken at that time. In the framework of the 2005 five yearly review “Working Group 6: Crèche” made another study of public and private  cr&a...

  16. La chiesa che si fa presepe: visita al Presepe della Chiesa del Rosario di Mottola

    Directory of Open Access Journals (Sweden)

    Susy Bigontina

    2012-01-01

    Full Text Available Abstract – IT In occasione del Natale, la vie della città di Mottola (Ta, Italia fioriscono di presepi, che i visitatori possono liberamente ammirare. Quella del presepe è una tradizione molto sentita dagli abitanti della cittadina pugliese, nella quale viene allestito un grande presepe che occupa e cela l’intera navata della Chiesa del Ss. Sacramento e Rosario. Gli allestitori, appartenenti ad una storica Confraternita locale dedicano settimane a costruire un presepe plastico della Betlemme nella notte di Natale, che mescola icone della tradizione italiana della Natività – alcuni pezzi, ad esempio, sono preziosi manufatti di scuola napoletana – ed elementi naturali tipici della terra delle gravine. Il presepe del Rosario, inoltre, mostra un’interessante ricerca dell’effetto prospettico e forse un ancor più interessante cornice di ciclicità, ottenuta tramite l’alternanza del giorno e della notte, musica ed effetti sonori, che proietta la scena verso un orizzonte atemporale. Questo articolo nasce dalla visita degli autori a Mottola, in occasione della presentazione del libro La Settimana Santa a Mottola, di cui essi sono stati co-autori, e quindi rappresenta il frutto di un nuovo capitolo di lavoro con la viva comunità mottolese ed i suoi riti. Abstract – FR Pour l'occasion de Noël, les rues de la villes de Mottola (Ta, Italie sont embellies de crèches que les visiteurs peuvent admirer en toute liberté. La tradition de la crèche est une tradition très ressentie par les habitants de la petite ville pugliaise, dans laquelle on prépare une grande crèche qui occupe et cache tout le nef de l'église du très Ss. Sacramento e Rosario. Les préparateurs qui appartiennent à une Confrérie historique locale dédient plusieurs semaines pour la construction d'une crèche comme celle de Betleemme de la nuit de Noël - certaines pièces, par exemple, sont de précieux produits manufacturés provenant de l'école napolitaine - et

  17. Tempi che cambiano, luoghi che si trasformano: i mutamenti nei nuraghi fra l’età del Bronzo ed il Primo Ferro

    Directory of Open Access Journals (Sweden)

    Mauro Perra

    2017-01-01

    Full Text Available Riassunto: Il lungo percorso della Civiltà Nuragica, compreso fra XVII e X-IX secolo a.C., si caratterizza come un’epoca di grandi trasformazioni che si susseguono nel tempo e lasciano visibili tracce in un paesaggio mutevole, come in un succedersi di macroscopiche unità stratigrafiche. Si trasformano profondamente così non solo i monumenti ed il paesaggio, ma anche le stesse strutture sociali e politiche delle comunità nuragiche fino alla trasfigurazione del ricordo in mito nei centri cerimoniali o santuari. Abstract: The long trajectory of the Nuragic civilisation (17th - 10th/9th centuries B.C. is characterised by a succession of dramatic changes leaving visible traces in a varying landscape, like stratigraphy on a regional scale. These changes affect not only the Nuragic monuments and landscape but also the social and political institutions of Nuragic communities, culminating in a transfiguration of memory and a new mythology apparent in ceremonial centres and sanctuaries.

  18. Serum cholinesterase polymorphism (CHE1 and CHE2 loci) among several Indian groups from Amazon region of Brazil, and segregation of the C5 variant in families.

    Science.gov (United States)

    Guerreiro, J F; Santos, S E; Aguiar, G F

    1989-04-01

    Eight Indian tribes from the Amazon region of Brazil (Araweté, Arara, Yamamadi, Kararaô, Karitiana, Waiampi, Surui and Cinta Larga) were studied for the distribution of the atypical and C5 variants of serum cholinesterase. None of them presented the CHE1*A allele, but the C5 variant was found in the Araweté (20.4%), Kararaô (15.6%), Karitiana (50.5%), Surui (12.3%) and Cinta Larga (19.6%) tribes. The frequency of the C5+ phenotype in the Karitiana is the highest reported thus far in human populations. Segregation studies considering the C5 variant were made among the Karitiana, and also among the Urubu-Kaapor and Munduruku tribes previously studied by Guerreiro et al [1987a, 1987b]. Most of the data were in agreement with the genetic hypothesis, but they also revealed a significant lack of the C5+ phenotype in offspring from C5+ X C5+ matings, as well as the occurrence of two C5+ children from C5- X C5- unions, in the Urubu-Kaapor tribe.

  19. The new "Jardin de Capucine" crèche brings a breath of fresh air for young CERN parents

    CERN Multimedia

    HR Department

    2011-01-01

    On 19 January 2011, CERN's Director-General, Rolf Heuer, signed an agreement with the company "Le Jardin de Zébulon" for the provision of 40 places at the "Jardin de Capucine", a new private crèche due to open this autumn.   In 2008, the "Jardin de Zébulon", a private bilingual crèche for children aged 1 to 4, was opened by Ariane Boucheron at the Technoparc industrial estate in Saint-Genis Pouilly (France). The following year, the number of places was increased from 20 to 37 to meet demand. The "Jardin de Zébulon" has taken in a number of children of CERN personnel ever since it was created. With no let-up in the demand for new crèche places, Ariane Boucher is currently engaged in the construction of a new centre, the "Jardin de Capucine", next-door to the existing crèche. Forty places at the new crèche will...

  20. Data from the Mars Science Laboratory CheMin XRD/XRF Instrument

    Science.gov (United States)

    Vaniman, David; Blake, David; Bristow, Tom; DesMarais, David; Achilles, Cherie; Anderson, Robert; Crips, Joy; Morookian, John Michael; Spanovich, Nicole; Vasavada, Ashwin; hide

    2013-01-01

    The CheMin instrument on the Mars Science Laboratory (MSL) rover Curiosity uses a Co tube source and a CCD detector to acquire mineralogy from diffracted primary X-rays and chemical information from fluoresced X-rays. CheMin has been operating at the MSL Gale Crater field site since August 5, 2012 and has provided the first X-ray diffraction (XRD) analyses in situ on a body beyond Earth. Data from the first sample collected, the Rocknest eolian soil, identify a basaltic mineral suite, predominantly plagioclase (approx.An50), forsteritic olivine (approx.Fo58), augite and pigeonite, consistent with expectation that detrital grains on Mars would reflect widespread basaltic sources. Minor phases (each XRD. This amorphous component is attested to by a broad rise in background centered at approx.27deg 2(theta) (Co K(alpha)) and may include volcanic glass, impact glass, and poorly crystalline phases including iron oxyhydroxides; a rise at lower 2(theta) may indicate allophane or hisingerite. Constraints from phase chemistry of the crystalline components, compared with a Rocknest bulk composition from the APXS instrument on Curiosity, indicate that in sum the amorphous or poorly crystalline components are relatively Si, Al, Mg-poor and enriched in Ti, Cr, Fe, K, P, S, and Cl. All of the identified crystalline phases are volatile-free; H2O, SO2 and CO2 volatile releases from a split of this sample analyzed by the SAM instrument on Curiosity are associated with the amorphous or poorly ordered materials. The Rocknest eolian soil may be a mixture of local detritus, mostly crystalline, with a regional or global set of dominantly amorphous or poorly ordered components. The Rocknest sample was targeted by MSL for "first time analysis" to demonstrate that a loose deposit could be scooped, sieved to <150 microns, and delivered to instruments in the body of the rover. A drilled sample of sediment in outcrop is anticipated. At the time of writing this abstract, promising outcrops are

  1. Astrobiological Significance of Definitive Mineralogical Analysis of Martian Surface Samples Using the CheMin XRD/XRF Instrument

    Science.gov (United States)

    Feldman, S. M.; Blake, D. F.; Sarrazin, P.; Bish, D. L.; Chipera, S. J.; Vaniman, D. T.; Collins, S.

    2004-01-01

    The search for evidence of habitability, or of extant or extinct life on Mars, will initially be a search for evidence of past or present conditions supportive of life. The three key requirements for the emergence of life are thought to be liquid water; a suitable energy source; and chemical building blocks. CheMin is a miniaturized XRD/XRF (X-Ray diffraction / X-ray fluorescence) instrument which has been developed for definitive mineralogic analysis of soils and rocks on the Martian surface. The CheMin instrument can provide information that is highly relevant to each of these habitability requirements as summarized below.

  2. Fractional derivatives. An introduction; Derivate frazionarie. Che cosa sono, a cosa servono

    Energy Technology Data Exchange (ETDEWEB)

    Dattoli, G. [ENEA, Div. Fisica Applicata, Centro Ricerche Frascati, Rome (Italy)

    2001-07-01

    In this item is presented a brief survey of fractional calculus and of the relevant applications. In the work are discussed different points of view of the operation of fractional derivative and present a unifying definition. The role played by fractional derivatives and integrals within the framework of integral transform is analyzed. [Italian] In questo articolo si traccia un profilo del cosidetto calcolo frazionario e delle relative applicazioni a problemi di matematica pura ed applicata. Si discutono varie definizioni dell'operazione di derivata frazionaria, non tutte coincidenti fra loro, e si mostra come sia possibile proporre una definizione univoca che inglobi tutte le altre. Si analizza infine il ruolo giocato dalle derivate e dagli integrali frazionari e, piu' in generale, quello degli operatori differenziali ad esponente frazionario, nell'ambito della teoria delle rappresentazioni integrali.

  3. CheD: chemical database compilation tool, Internet server, and client for SQL servers.

    Science.gov (United States)

    Trepalin, S V; Yarkov, A V

    2001-01-01

    An efficient program, which runs on a personal computer, for the storage, retrieval, and processing of chemical information, is presented, The program can work both as a stand-alone application or in conjunction with a specifically written Web server application or with some standard SQL servers, e.g., Oracle, Interbase, and MS SQL. New types of data fields are introduced, e.g., arrays for spectral information storage, HTML and database links, and user-defined functions. CheD has an open architecture; thus, custom data types, controls, and services may be added. A WWW server application for chemical data retrieval features an easy and user-friendly installation on Windows NT or 95 platforms.

  4. Lessons Learned from the Crew Health Care System (CHeCS) Rack 1 Environmental Control and Life Support (ECLS) Design

    Science.gov (United States)

    Williams, David E.

    2006-01-01

    This paper will provide an overview of the International Space Station (ISS) Environmental Control and Life Support (ECLS) design of the Crew Health Care System (CHeCS) Rack 1 and it will document some of the lessons that have been learned to date for the ECLS equipment in this rack.

  5. Efficient Computation of Sparse Matrix Functions for Large-Scale Electronic Structure Calculations: The CheSS Library.

    Science.gov (United States)

    Mohr, Stephan; Dawson, William; Wagner, Michael; Caliste, Damien; Nakajima, Takahito; Genovese, Luigi

    2017-10-10

    We present CheSS, the "Chebyshev Sparse Solvers" library, which has been designed to solve typical problems arising in large-scale electronic structure calculations using localized basis sets. The library is based on a flexible and efficient expansion in terms of Chebyshev polynomials and presently features the calculation of the density matrix, the calculation of matrix powers for arbitrary powers, and the extraction of eigenvalues in a selected interval. CheSS is able to exploit the sparsity of the matrices and scales linearly with respect to the number of nonzero entries, making it well-suited for large-scale calculations. The approach is particularly adapted for setups leading to small spectral widths of the involved matrices and outperforms alternative methods in this regime. By coupling CheSS to the DFT code BigDFT, we show that such a favorable setup is indeed possible in practice. In addition, the approach based on Chebyshev polynomials can be massively parallelized, and CheSS exhibits excellent scaling up to thousands of cores even for relatively small matrix sizes.

  6. Il programma dell'universo

    CERN Document Server

    Lloyd, Seth

    2006-01-01

    Da quando l'universo ha avuto inizio, ha cominciato a calcolare il proprio comportamento. All'inizio il computer-universo produceva strutture semplici, particelle elementari e leggi elementari della fisica; col passare del tempo ha processato "informazioni" sempre più complesse, producendo strutture sempre più intricate (galassie, stelle, pianeti), ma sempre secondo leggi semplici. Ogni cosa deve quindi la propria esistenza alla capacità intrinseca della materia e dell'energia di processare informazione. Se si decifrasse fino in fondo si potrebbe, con un computer quantistico di dimensioni ridotte, comprendere l'universo nel suo insieme.

  7. Molecular Interaction and Cellular Location of RecA and CheW Proteins in Salmonella enterica during SOS Response and Their Implication in Swarming.

    Science.gov (United States)

    Irazoki, Oihane; Aranda, Jesús; Zimmermann, Timo; Campoy, Susana; Barbé, Jordi

    2016-01-01

    In addition to its role in DNA damage repair and recombination, the RecA protein, through its interaction with CheW, is involved in swarming motility, a form of flagella-dependent movement across surfaces. In order to better understand how SOS response modulates swarming, in this work the location of RecA and CheW proteins within the swarming cells has been studied by using super-resolution microscopy. Further, and after in silico docking studies, the specific RecA and CheW regions associated with the RecA-CheW interaction have also been confirmed by site-directed mutagenesis and immunoprecipitation techniques. Our results point out that the CheW distribution changes, from the cell poles to foci distributed in a helical pattern along the cell axis when SOS response is activated or RecA protein is overexpressed. In this situation, the CheW presents the same subcellular location as that of RecA, pointing out that the previously described RecA storage structures may be modulators of swarming motility. Data reported herein not only confirmed that the RecA-CheW pair is essential for swarming motility but it is directly involved in the CheW distribution change associated to SOS response activation. A model explaining not only the mechanism by which DNA damage modulates swarming but also how both the lack and the excess of RecA protein impair this motility is proposed.

  8. Molecular interaction and cellular location of RecA and CheW proteins in Salmonella enterica during SOS response and their implication in swarming

    Directory of Open Access Journals (Sweden)

    Oihane Irazoki

    2016-10-01

    Full Text Available In addition to its role in DNA damage repair and recombination, the RecA protein, through its interaction with CheW, is involved in swarming motility, a form of flagella-dependent movement across surfaces. In order to better understand how SOS response modulates swarming, in this work the location of RecA and CheW proteins within the swarming cells has been studied by using super-resolution microscopy. Further, and after in silico docking studies, the specific RecA and CheW regions associated with the RecA-CheW interaction have also been confirmed by site-directed mutagenesis and immunoprecipitation techniques. Our results point out that the CheW distribution changes, from the cell poles to foci distributed in a helical pattern along the cell axis when SOS response is activated or RecA protein is overexpressed. In this situation, the CheW presents the same subcellular location as that of RecA, pointing out that the previously described RecA storage structures may be modulators of swarming motility. Data reported herein not only confirmed that the RecA-CheW pair is essential for swarming motility but it is directly involved in the CheW distribution change associated to SOS response activation. A model explaining not only the mechanism by which DNA damage modulates swarming but also how both the lack and the excess of RecA protein impair this motility is proposed.

  9. European analytical column No. 36 from the Division of Analytical Chemistry (DAC) of the European Association for Chemical and Molecular Sciences (EuCheMS)

    DEFF Research Database (Denmark)

    Karlberg, Bo; Emons, Hendrik; Andersen, Jens Enevold Thaulov

    2008-01-01

    European analytical column no. 36 from the division of analytical chemistry (DAC) of the European association for chemical and molecular sciences (EuCheMS)......European analytical column no. 36 from the division of analytical chemistry (DAC) of the European association for chemical and molecular sciences (EuCheMS)...

  10. El Che - más que médico

    Directory of Open Access Journals (Sweden)

    Natalia I. Osorio Curbelo

    2015-12-01

    Full Text Available Revolucionario, dirigente político, comandante guerrillero, intelectual y médico.  Uno de los íconos del siglo XX.  Nació en Rosario, Argentina, el 14 de junio de 1928. En 1938, con apenas 10 años, el padre le enseñó a jugar Ajedrez en el transcurso del año, deporte que no dejaría de practicar nunca más y lo estudiaría por siempre. En 1939 supo de la existencia de Cuba, pues teniendo 11 años, cuando vivía en Alta Gracia, en Buenos Aires se desarrollaba la VII Olimpiada de Ajedrez y el más conocido de los ajedrecistas cubanos José Raúl Capablanca, obtuvo la medalla de Oro en el primer tablero, convirtiéndose en noticia mundial. La gran pasión por el juego ciencia  se puso de manifiesto durante toda su vida, jugó Ajedrez cuando estaba viajando en un avión, cuando  estuvo detenido en alguna estación policial o, simplemente, a las tres de la madrugada recibía una delegación mexicana para jugar una partida después de conversar sobre los temas generales comunes. Ernesto Guevara, eternamente Che, revolucionario integral y multifacético, sintió gran afición por los deportes y aunque por lo general se le cita como amante del ajedrez y el fútbol, también, desde niño, practicó con derroche de coraje y voluntad otros no tan divulgados. A sus prácticas deportivas también se entregó con la voluntad, coraje y pasión que lo caracterizaron a lo largo de su vida. Luego del triunfo de la Revolución cubana, en la que ganó  los grados de Comandante, hubo  un deporte priorizado  en la vida del Che: el Ajedrez.  Dos veces ganó en los campeonatos patrocinados por el Ministerio de Industria, que él presidía,  y participó, además, en los Torneos del INDER donde ascendió, por los resultados alcanzados, a la primera categoría. Se enfrentó en partidas simultáneas a varios de los mejores jugadores de esos días, entre ellos los grandes maestros soviéticos Victor Korchnoi y Mijail Tal y el argentino Miguel Najdorf, d

  11. Cherenkov and scintillation light separation on the CheSS experiment

    Science.gov (United States)

    Caravaca, Javier; Land, Benjamin; Descamps, Freija; Orebi Gann, Gabriel D.

    2016-09-01

    Separation of the scintillation and Cherenkov light produced in liquid scintillators enables outstanding capabilities for future particle detectors, the most relevant being: particle directionality information in a low energy threshold detector and improved particle identification. The CheSS experiment uses an array of small, fast photomultipliers (PMTs) and state-of-the-art electronics to demonstrate the reconstruction of a Cherenkov ring in liquid scintillator using two techniques: based on the photon density and using the photon hit time information. A charged particle ionizing a scintillation medium produces a prompt Cherenkov cone and late isotropic scintillation light, typically delayed by several ns. The fast response of our PMTs and DAQ provides a precision well below the ns level, making possible the time separation. Furthermore, the usage of the new developed water-based liquid scintillators (WbLS) enhances the separation since it allows tuning of the Cherenkov/Scintillation ratio. Latest results on the separation for pure liquid scintillators and WbLS will be presented.

  12. Start of enrolment for the Champs-Fréchets crèche (EVE)

    CERN Multimedia

    HR Department

    2008-01-01

    As announced in Bulletin 43/2007, CERN signed an agreement with the commune of Meyrin on 17 October 2007 under which 20 places will be reserved for the children of CERN personnel in the Champs-Fréchets day care centre (EVE), which will open on Monday, 25 August, and CERN will contribute to the funding. This agreement allows members of the CERN personnel (employees and associates) access to the crèche, for children aged between 4 months and 4 years, irrespective of where they are living. Applications for the school year starting autumn 2008 will be accepted from Monday 17 March until Monday 30 June 2008. Members of the personnel must complete the enrolment formalities with the Meyrin infant education service themselves: Mairie de Meyrin Service de la Petite Enfance 2 rue des Boudines Case postale 367 - 1217 Meyrin 1 - Tel. + 41 (0)22 782 21 21 mailto:meyrin@meyrin.ch http://www.meyrin.ch/petiteenfance Application forms (in PDF) can be downloaded from the website of the com...

  13. LE SOLUTRÉEN ANCIEN EN ARDÈCHE (FRANCE: UNE RÉVISION CRITIQUE DES INDUSTRIES LITHIQUES

    Directory of Open Access Journals (Sweden)

    Sophie Guegan

    2013-11-01

    Full Text Available S’inscrivant dans un travail de Doctorat sur les peuplements des deux rives de la vallée du Rhône au Maximum Glaciaire, cet article propose un état des connaissances sur la phase ancienne du Solutréen en Ardèche (rive droite du Rhône, donnant lieu à une révision critique des industries lithiques s’y rapportant. En effet, depuis les travaux de P.E.L. Smith et J. Combier, et plus récemment le travail d’A. Barbiero consacré aux pointes à face plance et pointes à cran d’une collection ancienne à la Baume d’Oullins (Gard-Ardèche, France, aucun réexamen global n’avait été entrepris. Trois gisements de référence pour cette phase ancienne, ont ainsi été sélectionnés: les grottes d’Oullins (Gard-Ardèche, France, de Chabot (Gard, France et de Granouly (Ardèche, France. Nous présentons ici les réslutats préliminaires à cette étude. En premier lieu, une approche typologique a été menée principalement autour de la pointe à face plane, objet emblématique de cette phase, permettant d’en préciser les principaux caractères. Dans un deuxième temps, une approche technologique a permis de confirmer l’homogénéité dans les choix techniques des Solutréens entre l’Ardèche et les régions du Sud-Ouest et du Bassin Parisien. Enfin, une étude des matières premières, a révélé pour l’heure des choix économiques étonnants pour le contexte paléo-climatique, avec des déplacements vers le nords et un franchissement du Rhône.In the frame of a doctoral dissertation on the Late Glacial Maximum occupations of both sides of the Rhône valley, this paper presents a state of the art and a critical reappraisal of the lithic assemblages from the early phases of the Solutrean in Ardeche (right bank of the Rhône river. Indeed, since the works of P.E.L. Smith and J. Combier, except the work of A. Barbiero, on the unifacial leaf-points and shouldered points from Baume d'Oullins, no complete study of these

  14. Méthodes de levée de dormance de la noix de cola fraîche ( Cola ...

    African Journals Online (AJOL)

    Cette étude avait pour objectif de proposer une méthode efficace de germination de la noix de cola fraîche, en vue d'une réduction significative du délai de germination à travers un test comparatif de traitement de la noix par blessure, humidification et chaleur. Méthodologie et résultats: L'étude a été mise en place selon un ...

  15. “Nell’occhio che riscopre la luce”: tempo, Storia e memoria nella poesia di Salvatore Quasimodo

    OpenAIRE

    Alessandro Martini

    2015-01-01

    La riflessione sul rapporto dell’uomo con il tempo e con la storia percorre senza soluzione di continuità l’opera poetica di Salvatore Quasimodo. Spesso a disagio in una dimensione temporale fissa e definita, schiacciato tra dolore dell’esilio, insensatezza della guerra e crisi del dopoguerra, il poeta interroga gli evi passati e le ere future in cerca di un’armonia che appare il più delle volte sfuggente.

  16. The chemotaxis-like Che1 pathway has an indirect role in adhesive cell properties of Azospirillum brasilense.

    Science.gov (United States)

    Siuti, Piro; Green, Calvin; Edwards, Amanda Nicole; Doktycz, Mitchel J; Alexandre, Gladys

    2011-10-01

    The Azospirillum brasilense chemotaxis-like Che1 signal transduction pathway was recently shown to modulate changes in adhesive cell surface properties that, in turn, affect cell-to-cell aggregation and flocculation behaviors rather than flagellar-mediated chemotaxis. Attachment to surfaces and root colonization may be functions related to flocculation. Here, the conditions under which A. brasilense wild-type Sp7 and che1 mutant strains attach to abiotic and biotic surfaces were examined using in vitro attachment and biofilm assays combined with atomic force microscopy and confocal microscopy. The nitrogen source available for growth is found to be a major modulator of surface attachment by A. brasilense and could be promoted in vitro by lectins, suggesting that it depends on interaction with surface-exposed residues within the extracellular matrix of cells. However, Che1-dependent signaling is shown to contribute indirectly to surface attachment, indicating that distinct mechanisms are likely underlying flocculation and attachment to surfaces in A. brasilense. © 2011 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

  17. Reconocimiento Mapu-Che de Chile: Tratado ante Constitución, Historia frente a Derecho

    Directory of Open Access Journals (Sweden)

    Bartolomé CLAVERO SALVADOR

    2011-04-01

    Full Text Available Desde el año 1991, el compromiso adquirido por los sucesivos gobiernos chilenos para reconocer a nivel constitucional la presencia indígena en el ordenamiento del Estado ha puesto de manifiesto el desconocimiento académico y jurídico mutuo por parte de Chile con respecto a las evidencias para una reposición de Mapu-Che. El presente trabajo hace un recorrido histórico y jurídico por las formas de relación entre el Estado chileno y el Estado Mapu, que hasta la conquista chilena de Mapu en la década de los ochenta del siglo XIX se manifestaron a través de Tratados y Parlamentos que implicaban un reconocimiento mutuo de ambas entidades en una esfera internacional. Las comisiones de estudios, informes oficiales e invocaciones de verdad para un nuevo trato, primero de las Naciones Unidas, y después de la República de Chile, han observado estas evidencias de la significación constitucional e internacional de los Tratados, pero Chile ha convertido su peculiar forma de reconocimiento constitucional de la presencia indígena en un alarde de unidad e indivisibilidad nacional. Este encubrimiento nace del deseo de mantener una Constitución exclusiva, al que se une la certeza de que otra forma de reconocimiento obligaría a un replanteamiento de las propias raíces de los fundamentos constitucionales de la República de Chile.

  18. SYM1, l’ortologo di lievito del gene umano MPV17, codifica per una proteina indotta da stress che modula lo stato bioenergetico e morfogenetico del mitocondrio

    OpenAIRE

    Dallabona, Cristina

    2010-01-01

    Mutazioni nel gene MPV17 causano l’insorgenza di una forma epatocerebrale della sindrome da deplezione del DNA mitocondriale. MPV17 codifica per una piccola proteina idrofobica localizzata nella membrana mitocondriale interna con funzione sconosciuta. Per cercare di chiarire le basi molecolari che causano la patologia, abbiamo utilizzato il lievito S. cerevisiae come organismo modello grazie alla presenza di un ortologo di MPV17: SYM1. Abbiamo dimostrato che la proteina Sym1 è essenziale per ...

  19. La nascita imperfetta delle cose la grande corsa alla particella di Dio e la nuova fisica che cambierà il mondo

    CERN Document Server

    AUTHOR|(CDS)2068901

    2016-01-01

    In quel preciso momento, un centesimo di miliardesimo di secondo dopo il Big Bang, si è deciso il nostro destino. In un universo in cui materia e antimateria si equivalevano, e che quindi avrebbe potuto, in ogni istante, tornare a essere pura energia, può essere bastata una leggerissima preferenza del bosone di Higgs per la materia anziché per l'antimateria ed ecco che si è prodotto il mondo che abbiamo sotto gli occhi. "Ecco qua il minuscolo difetto, la sottile imperfezione da cui è nato tutto. Un'anomalia che dà origine a un universo che può evolvere per miliardi di anni." Se tutto nasce da lì, dobbiamo capire in ogni dettaglio quel momento cruciale, ricostruirlo fotogramma per fotogramma, al rallentatore e da diverse angolature. Per questo al Cern di Ginevra è stato realizzato Lhc, l'acceleratore di particelle più potente del mondo, il posto più simile al primo istante di vita dell'universo che l'uomo sia stato in grado di costruire. Per questo da anni i migliori fisici del mondo lavorano giorno...

  20. The structure and dynamic properties of the complete histidine phosphotransfer domain of the chemotaxis specific histidine autokinase CheA from Thermotoga maritima

    International Nuclear Information System (INIS)

    Vu, Anh; Hamel, Damon J.; Zhou Hongjun; Dahlquist, Frederick W.

    2011-01-01

    The bacterial histidine autokinase CheA contains a histidine phosphotransfer (Hpt) domain that accepts a phosphate from the catalytic domain and donates the phosphate to either target response regulator protein, CheY or CheB. The Hpt domain forms a helix-bundle structure with a conserved four-helix bundle motif and a variable fifth helix. Observation of two nearly equally populated conformations in the crystal structure of a Hpt domain fragment of CheA from Thermotoga maritima containing only the first four helices suggests more mobility in a tightly packed helix bundle structure than previously thought. In order to examine how the structures of Hpt domain homologs may differ from each other particularly in the conformation of the last helix, and whether an alternative conformation exists in the intact Hpt domain in solution, we have solved a high-resolution, solution structure of the CheA Hpt from T. maritima and characterized the backbone dynamics of this protein. The structure contains a four-helix bundle characteristic of histidine phosphotransfer domains. The position and orientation of the fifth helix resembles those in known Hpt domain crystal and solution structures in other histidine kinases. The alternative conformation that was reported in the crystal structure of the CheA Hpt from T. maritima missing the fifth helix is not detected in the solution structure, suggesting a role for the fifth helix in providing stabilizing forces to the overall structure.

  1. Nebanku kredītdevēju ”SMScredit” un ”InCREDIT GROUP” lojalitātes programmas un to novērtējums

    OpenAIRE

    Birnbauma, Egija

    2016-01-01

    Bakalaura darba temats ir „Nebanku kredītdevēju ”SMScredit” un ”InCREDIT GROUP” lojalitātes programmas un to novērtējums.” Darba mērķis ir lojalitātes programmu komunikācijas kanālu vērtējums un klientu vērtējums par programmu noderīgumu, to priekšrocībām un vai programmu darbības principi klientiem ir saprotami. Darbs sastāv no trīs daļām: teorētiskās, metodoloģiskās un empīriskās daļas. Teorētiskajā daļā tiek pētīta literatūra par mārketingu, integrētā mārketinga komunikāciju, patērēt...

  2. Housing associations and ventilation. Program Requirements for Domestic Ventilation for new construction and renovation (version 2.0); Woningcorporaties en ventilatie. Programma van Eisen voor Woningventilatie voor nieuwbouw en renovatie (versie 2.0)

    Energy Technology Data Exchange (ETDEWEB)

    Balvers, J.; Boerstra, A. [BBA Binnenmilieu, Rotterdam (Netherlands)

    2011-11-15

    The aim of the title project is to develop a base of Program Requirements (PvE, abbreviated in Dutch) that employees of housing associations can use as a starting point to achieve ventilation systems in new construction and renovation of housing projects. The tool comprises of three parts: Instructions the for use of the PvE (Chapter 1); PvE for homes with balanced ventilation, including explanatory notes (Chapter 2); PvE for homes with natural ventilation and mechanical exhaust system, including explanatory notes (Chapter 3) [Dutch] Het doel van het project is het ontwikkelen van een basis Programma van Eisen (PvE) dat medewerkers van woningcorporaties als uitgangspunt kunnen gebruiken bij het realiseren van ventilatiesystemen in nieuwbouw en renovatie van woningbouwprojecten. Het instrument bestaat uit 3 delen: Aanwijzingen voor het gebruik van de PvE's (hoofdstuk 1); PvE voor woningen met balansventilatie, inclusief toelichting (hoofdstuk 2); PvE voor woningen met natuurlijke luchttoevoer en mechanische luchtafvoer, inclusief toelichting (hoofdstuk 3)

  3. The Crèche and School structure of the CERN Staff Association is looking for a new name

    CERN Multimedia

    Staff Association

    2018-01-01

    The CERN Staff Association is launching a competition to find a new name to replace the current acronym EVEE (Espace de Vie Enfantine et École). The competition is open to everyone from Thursday, 1 February 2018 to Thursday, 15 March. All participants can send their name suggestions via the form available on the websites of the Staff Association and the Crèche and School. Good luck to all – may the best one win! P.S. The Rules of the Competition are available on both websites

  4. Determination of the Index of Consumption of Petroleum of the Calcining Kiln of the Ernesto Che Guevara Commander Undertaking

    Directory of Open Access Journals (Sweden)

    Yarilys Gaínza-Delgado

    2016-07-01

    Full Text Available This work presents the results obtained in carrying out the mass and energy balances in the calcining kiln of the company commander Ernesto Che Guevara, for determining the consumption index of petroleum used for obtaining nickel oxide through thermal decomposition of the basic nickel carbonate. It was shown that for a production of basic nickel carbonate of              12 t / h with 69% moisture, it is necessary to feed about 1100 kg / h of fuel, for an consumption index of 91.67 kg of fuel per ton of load.

  5. Il mondo secondo la fisica quantistica segreti e meraviglie della scienza che sta cambiando la nostra vita

    CERN Document Server

    Fracas, Fabio

    2017-01-01

    Questo libro è un'avventura esclusiva e affascinante. Un viaggio, anche nel tempo, alla scoperta di qualcosa di nuovo e di straordinario: la Fisica Quantistica, nelle sue logiche, nelle sue potenzialità, nelle sue applicazioni e nei suoi possibili sviluppi. All'interno del volume vengono ricostruiti passo dopo passo i momenti fondamentali del pensiero quantistico, le questioni su cui si sono interrogati i più grandi scienziati degli ultimi decenni, e i diversi contesti nei quali si sono evoluti i principali modelli della Meccanica Quantistica. Sullo sfondo delle ricerche più attuali - come per esempio quella sulle onde gravitazionali che ha portato al Nobel per la Fisica 2017 -, vengono indagati anche i rapporti esistenti fra Fisica Quantistica, Relatività Einsteiniana e Teoria delle Stringhe. Inoltre, fra i tanti temi trattati nelle sue pagine, trovano spazio persino le incredibili ricadute che gli studi sulla Fisica Quantistica stanno avendo negli ambiti della medicina e delle ricerche sul cervello e s...

  6. Crèche and School of the Staff Association: a programme for children from 2 to 4 year old

    CERN Multimedia

    Staff Association

    2018-01-01

    Find out how children between the ages of two to four and their families can benefit from the Staff Association Crèche and School programme. Classes for children aged between two and four years have been set-up to ensure the initial transition from home to school is as smooth as possible. Children attend mornings only and are welcomed by the same group of teaching staff throughout the week, allowing the children to establish a link between their home life and the crèche/school. The challenge of these classes is to offer the children a happy environment where they can feel emotionally secure, and the teaching staff can create a harmonious atmosphere allowing them to learn by moving, manipulating, exchanging, making mistakes… playing. Creativity takes a central role as it enables the child to express him or herself and increase their ability to handle their emotions constructively. According to Albert Einstein ‘Play is the highest form of research’. &nbs...

  7. The Drosophila gene CheB42a is a novel modifier of Deg/ENaC channel function.

    Directory of Open Access Journals (Sweden)

    Yehuda Ben-Shahar

    2010-02-01

    Full Text Available Degenerin/epithelial Na(+ channels (DEG/ENaC represent a diverse family of voltage-insensitive cation channels whose functions include Na(+ transport across epithelia, mechanosensation, nociception, salt sensing, modification of neurotransmission, and detecting the neurotransmitter FMRFamide. We previously showed that the Drosophila melanogaster Deg/ENaC gene lounge lizard (llz is co-transcribed in an operon-like locus with another gene of unknown function, CheB42a. Because operons often encode proteins in the same biochemical or physiological pathway, we hypothesized that CHEB42A and LLZ might function together. Consistent with this hypothesis, we found both genes expressed in cells previously implicated in sensory functions during male courtship. Furthermore, when coexpressed, LLZ coprecipitated with CHEB42A, suggesting that the two proteins form a complex. Although LLZ expressed either alone or with CHEB42A did not generate ion channel currents, CHEB42A increased current amplitude of another DEG/ENaC protein whose ligand (protons is known, acid-sensing ion channel 1a (ASIC1a. We also found that CHEB42A was cleaved to generate a secreted protein, suggesting that CHEB42A may play an important role in the extracellular space. These data suggest that CHEB42A is a modulatory subunit for sensory-related Deg/ENaC signaling. These results are consistent with operon-like transcription of CheB42a and llz and explain the similar contributions of these genes to courtship behavior.

  8. Animals′ Role in Proper Behaviour: Cheŵa Women′s Instructions in South-Central Africa

    Directory of Open Access Journals (Sweden)

    Leslie F Zubieta

    2016-01-01

    Full Text Available The most common role of animals in the Cheŵa culture of south-central Africa is twofold: they are regarded as an important source of food, and they also provide raw materials for the creation of traditional medicines. Animals, however, also have a nuanced symbolic role that impacts the way people behave with each other by embodying cultural protocols of proper — and not so proper — behaviour. They appear repeatedly in storytelling and proverbs to reference qualities that people need to avoid or pursue and learn from the moral of the story in which animals interplay with each other, just as humans do. For example, someone who wants to prevent the consequences of greed is often advised to heed hyena stories and proverbs. My contribution elaborates on Brian Morris's instrumental work in south-central Africa, which has permitted us to elucidate the symbolism of certain animals and the perception of landscape for Indigenous populations in this region. I discuss some of the ways in which animals have been employed to teach and learn proper behaviour in a particular sacred ceremony of the Cheŵa people which takes place in celebration of womanhood: Chinamwali.

  9. Riflessioni critiche sulla prassi didattica contemporanea

    Directory of Open Access Journals (Sweden)

    Fabio Minazzi

    2016-02-01

    Full Text Available Secondo Klemperer la lingua pensa per noi. Ma anche le istituzioni pensano per noi. Col risultato che le prassi determinano spesso un pensiero diffuso che viene condiviso e fatto proprio senza rendersene conto. Quale pensiero ci comunica l’organizzazione attuale della prassi didattica delle scuole italiane? La relazione risponde a questa domanda mostrando come occorre rendersi consapevoli del preciso significato di tutte queste prassi didattiche.

  10. Tracce di sé: il rito del commiato laico tra commemorazione e narrazione

    Directory of Open Access Journals (Sweden)

    Marina Brancato

    2006-09-01

    Full Text Available Far risuonare la situazione luttuosa in un valore di memoria, in un valore morale: valorizzare le sfumature, la ricchezza e la pluralità delle esperienze e di insegnamenti che abbiamo ricevuto in quel meraviglioso e variegato percorso che è la nostra vita. La profonda esigenza di un rito volto a commemorare la persona quale era in vita risponde alla cultura della nostra epoca, attribuendo in tal modo un'importanza nodale all'individualità di ciascuno.

  11. Cloning, overexpression, purification, crystallization and preliminary X-ray analysis of CheY3, a response regulator that directly interacts with the flagellar ‘switch complex’ in Vibrio cholerae

    International Nuclear Information System (INIS)

    Khamrui, Susmita; Biswas, Maitree; Sen, Udayaditya; Dasgupta, Jhimli

    2010-01-01

    A chemotaxis response regulator CheY3 from V. cholerae has been cloned, overexpressed, purified and crystallized. The crystals of CheY3 diffracted to 1.86 Å resolution. Vibrio cholerae is the aetiological agent of the severe diarrhoeal disease cholera. This highly motile organism uses the processes of motility and chemotaxis to travel and colonize the intestinal epithelium. Chemotaxis in V. cholerae is far more complex than that in Escherichia coli or Salmonella typhimurium, with multiple paralogues of various chemotaxis genes. In contrast to the single copy of the chemotaxis response-regulator protein CheY in E. coli, V. cholerae contains four CheYs (CheY1–CheY4), of which CheY3 is primarily responsible for interacting with the flagellar motor protein FliM, which is one of the major constituents of the ‘switch complex’ in the flagellar motor. This interaction is the key step that controls flagellar rotation in response to environmental stimuli. CheY3 has been cloned, overexpressed and purified by Ni–NTA affinity chromatography followed by gel filtration. Crystals of CheY3 were grown in space group R3, with a calculated Matthews coefficient of 2.33 Å 3 Da −1 (47% solvent content) assuming the presence of one molecule per asymmetric unit

  12. A technician monitors the CHeX, a USMP-4 experiment which will be flown on STS-87, in the SSPF

    Science.gov (United States)

    1997-01-01

    United States Microgravity Payload-4 (USMP-4) experiments are prepared to be flown on Space Shuttle mission STS-87 in the Space Station Processing Facility at Kennedy Space Center (KSC). Here, a technician is monitoring the Confined Helium Experiment, or CHeX, that will use microgravity to study one of the basic influences on the behavior and properties of materials by using liquid helium confined between silicon disks. CHeX and several other experiments are scheduled for launch aboard STS-87 on Nov. 19 from KSC.

  13. Novel activation domain derived from Che-1 cofactor coupled with the artificial protein Jazz drives utrophin upregulation.

    Science.gov (United States)

    Desantis, Agata; Onori, Annalisa; Di Certo, Maria Grazia; Mattei, Elisabetta; Fanciulli, Maurizio; Passananti, Claudio; Corbi, Nicoletta

    2009-02-01

    Our aim is to upregulate the expression level of the dystrophin related gene utrophin in Duchenne muscular dystrophy, thus complementing the lack of dystrophin functions. To this end, we have engineered synthetic zinc finger based transcription factors. We have previously shown that the artificial three-zinc finger protein named Jazz fused with the Vp16 activation domain, is able to bind utrophin promoter A and to increase the endogenous level of utrophin in transgenic mice. Here, we report on an innovative artificial protein, named CJ7, that consists of Jazz DNA binding domain fused to a novel activation domain derived from the regulatory multivalent adaptor protein Che-1/AATF. This transcriptional activation domain is 100 amino acids in size and it is very powerful as compared to the Vp16 activation domain. We show that CJ7 protein efficiently promotes transcription and accumulation of the acetylated form of histone H3 on the genomic utrophin promoter locus.

  14. Review: Thomas Bierschenk and Eva Spies (eds, 50 Jahre Unabhängigkeit in Afrika: Kontinuitäten, Brüche, Perspektiven (2012

    Directory of Open Access Journals (Sweden)

    Geert Castryck

    2015-01-01

    Full Text Available Review of the edited volume: Thomas Bierschenk and Eva Spies (eds, 50 Jahre Unabhängigkeit in Afrika: Kontinuitäten, Brüche, Perspektiven, Cologne: Rüdiger Köppe Verlag, 2012, ISBN 9783896458292, 572 pages

  15. Noi siamo quello che ricordiamo - Le frazze di Crucoli: il teatro, il rito, il riscatto sociale

    Directory of Open Access Journals (Sweden)

    Tonia Mingrone

    2012-01-01

    Full Text Available Abstract - IT Questo lavoro nasce da una ricerca di campo sulle frazze, termine dialettale che indica le farse di Carnevale che si rappresentavano fino a cinquant’anni fa in molti paesi calabresi, tra cui il mio, Crucoli, in provincia di Crotone. Lo scopo di questo lavoro non è fare un resoconto esaustivo di tutto ciò che accadeva a Crucoli durante la celebrazione del Carnevale, impresa assai difficile dal momento che non ci sono documenti scritti e quindi bisogna affidarsi ai racconti orali delle persone intervistate, spesso non fedeli alla realtà, perché modificati dal tempo e dalla memoria. L’approccio con cui ho intrapreso questa ricerca è sicuramente legato all’aspetto teatrale e performativo dell’evento, senza trascurarne la rilevanza antropologica. Il materiale raccolto è frutto di interviste e colloqui con la gente del posto unito ad un grande lavoro di ricerca bibliografica di autori che avevano trattato di questo argomento in relazione ai loro paesi di origine.Lo scopo è quello di delineare l’organizzazione e lo svolgimento delle frazze, cercando di ricostruire la sua durata e le ripercussioni sulla comunità, nonché dimostrare ancora una volta come il teatro, messo a disposizione di alcuni eventi, diventi un mezzo forte di liberazione e di contestazione. Abstract - FR Cet article prend sa naissance par une recherche sur champ concernant les frazze, terme dialectal qui dénote les farces du Carnaval mises en scène jusqu'à il y a cinquante ans dans plusieurs villages en Calabria, entre eux le mien, Crucoli, dans la province de Crotone. La raison de ce travail n'est pas d'accomplir un compte rendu exhaustif de tout ce qui avait lieu à Crucoli pendant la célébration du Carnaval, l'exploit étant très difficile, du moment qu'aucun document écrit a été parvenu et par conséquence il est nécessaire de se remettre aux contes des témoins interviewés, souvent pas fidèles au réel, parce-que détournés par les

  16. RESISTENCIA MICROBIANA EN EL CARDIOCENTRO ERNESTO CHE GUEVARA. ESTUDIO DE 5 AÑOS / Microbial resistance at the “Ernesto Che Guevara” Cardiology Hospital. A five year study

    Directory of Open Access Journals (Sweden)

    Nérida Rodríguez Oliva

    2009-06-01

    Full Text Available Introduction and Objectives: The appearance of nosocomial bacterial resistance represents a problem of growing concern because it largely affects the evolution of patients and the health resources devoted to it. The objective of this work was to determine the most common germs and their microbial resistance. Methods: A descriptive retrospective study was carried out analyzing the result of the isolation of germs from all type of secretions and from the blood cultures of a group ofpatients hospitalized at the Ernesto Che Guevara Cardiology Hospital in a five year period. Results: A total of 397 strains were isolated, 77 Staphylococcus aureus and 320 Enterobacteriaceae. The former presented 100% resistance to penicillin. The Staphylococcus sensitive to methicillin presented 4.9 % resistance to cotrimoxazole and gentamicin. The strains resistant to methicillin or oxacillin had a high resistance to gentamicin (87.5 % and ciprofloxacin (81.2 %, a medium resistance to cefazolin and oxacilline (20.5 %, and just 12.5 percent resistance to cotrimoxazole. Conclusions: the Staphylococcus aureus and the Enterobacteriaceae were the most common germs. The preoperative prophylaxis in these patients must not be done with cefazolin as a routine because the staphylococci resistant to methicillin or oxacillin have influence on other antimicrobials.

  17. Atomistic structural ensemble refinement reveals non-native structure stabilizes a sub-millisecond folding intermediate of CheY

    International Nuclear Information System (INIS)

    Shi, Jade; Schwantes, Christian; Bilsel, Osman

    2017-01-01

    The dynamics of globular proteins can be described in terms of transitions between a folded native state and less-populated intermediates, or excited states, which can play critical roles in both protein folding and function. Excited states are by definition transient species, and therefore are difficult to characterize using current experimental techniques. We report an atomistic model of the excited state ensemble of a stabilized mutant of an extensively studied flavodoxin fold protein CheY. We employed a hybrid simulation and experimental approach in which an aggregate 42 milliseconds of all-atom molecular dynamics were used as an informative prior for the structure of the excited state ensemble. The resulting prior was then refined against small-angle X-ray scattering (SAXS) data employing an established method (EROS). The most striking feature of the resulting excited state ensemble was an unstructured N-terminus stabilized by non-native contacts in a conformation that is topologically simpler than the native state. We then predict incisive single molecule FRET experiments, using these results, as a means of model validation. Our study demonstrates the paradigm of uniting simulation and experiment in a statistical model to study the structure of protein excited states and rationally design validating experiments.

  18. Substitution of the burning PRIOR SSB 10 for SSB7 in the Furnace 10 of the Company Major Ernesto Che Guevara

    Directory of Open Access Journals (Sweden)

    Ivett María Ramírez-Pérez

    2017-01-01

    Full Text Available One of the fundamental causes of massive destruction of chambers and vaults in the Furnace of Reduction at the Ernesto Che Guevara Factory is due to operate the combustion chambers with excess of contribution of heat, causing that the flame of very high temperature penetrates into the homes, affecting the throats of the chambers, the vaults, teeth and arms. The burners current are Prior SSB10. In this paper is demonstrated that the burning Prior SSB 10 have double productivity that the SSB 7 with the same quantity of air to the burner. It is evaluated the substitution of the burning Prior SSB 10 by SSB 7 on the operation of the Furnace of Reduction No. 10 at the Ernesto Che Guevara (ECG Factory. Demonstrating that the change not produce variations in the operation.

  19. Effects of Kapton Sample Cell Windows on the Detection Limit of Smectite: Implications for CheMin on the Mars Science Laboratory Mission

    Science.gov (United States)

    Achilles, C. N.; Ming, Douglas W.; Morris, R. V.; Blake, D. F.

    2012-01-01

    The CheMin instrument on the Mars Science Laboratory (MSL) rover Curiosity is an X-ray diffraction (XRD) and X-ray fluorescence (XRF) instrument capable of providing the mineralogical and chemical compositions of rocks and soils on the surface of Mars. CheMin uses a microfocus X-ray tube with a Co target, transmission geometry, and an energy-discriminating X-ray sensitive CCD to produce simultaneous 2-D XRD patterns and energy-dispersive X-ray histograms from powdered samples. CheMin has two different window materials used for sample cells -- Mylar and Kapton. Instrument details are provided elsewhere. Fe/Mg-smectite (e.g., nontronite) has been identified in Gale Crater, the MSL future landing site, by CRISM spectra. While large quantities of phyllosilicate minerals will be easily detected by CheMin, it is important to establish detection limits of such phases to understand capabilities and limitations of the instrument. A previous study indicated that the (001) peak of smectite at 15 Ang was detectable in a mixture of 1 wt.% smectite with olivine when Mylar is the window material for the sample cell. Complications arise when Kapton is the window material because Kapton itself also has a diffraction peak near 15 Ang (6.8 deg 2 Theta). This study presents results of mineral mixtures of smectite and olivine to determine smectite detection limits for Kapton sample cells. Because the intensity and position of the smectite (001) peak depends on the hydration state, we also analyzed mixtures with "hydrated" and "dehydrated"h smectite to examine the effects of hydration state on detection limits.

  20. Il mito della precarietà: quando la precarietà è un valore che decostruisce l’immaginario della precarietà

    Directory of Open Access Journals (Sweden)

    Antonio Casillo

    2011-07-01

    Full Text Available Oggi la ricerca del posto “fisso” sembra essere il sogno irraggiungibile di molti giovani precari e la “flessibilità”, una parola d’ordine con cui si aspirava a riformare il mondo del lavoro e che tanto in voga sembrava essere negli anni ’90, è diventata sinonimo di incertezza, precarietà, se non addirittura sfruttamento. Ma c’era chi proprio nel lavoro che oggi definiremo precario, vedeva l’unica possibilità per restare libero dalle leggi di mercato e dai potenti poteri editoriali Newyorkesi. In questo articolo proviamo a gettare uno sguardo al mito letterario con cui, il rifiutare un posto fisso, significava rivendicare la propria libertà, un mito romantico certo, e sicuramente distante dalla realtà, ma che ha affascinato un’intera generazione di scrittori, poeti, musicisti. Da Jack London, passando attraverso la San Francisco Renaissance e la Beat Generation, fino ad arrivare al fenomeno della così detta generazione Hippy, il sogno americano sembrava essere quello di una frontiera mobile in cui, la strada, sembrava non avere mai fine.

  1. Onderwijs in het Nationaal Programma Ouderenzorg

    NARCIS (Netherlands)

    Oeseburg, Barth; Schols, Jos; Olde Rikkert, Marcel; van der Horst, Henriëtte; Smilde-van den Doel, Dini; de Rooij, Sophia; Buurman-van Es, Bianca; Schuurmans, Marieke; Gussekloo, Jacobijn

    2016-01-01

    The Netherlands Organisation of Health Research and Development started in 2008 the Dutch National Care for the Elderly Programme (in Dutch abbreviated as NPO) with the aim to improve the quality of life for the frail older people through better quality of care (health, social, community) which is

  2. Un uomo che valuta

    Directory of Open Access Journals (Sweden)

    Massimiliano Nicoli

    2015-12-01

    Full Text Available This article – written as a short story in the second-person narrative mode – focuses on the subjective, everyday experience of an individual concerned by some practices of evaluation. Through the telling of this concrete experience, it aims at giving substance to the idea that the practices of evaluation constitute an «environmental technology of government» typical of neoliberal governmentality as well as a self-disciplined technique of building one’s own «soul» as human capital.

  3. Department of Che

    African Journals Online (AJOL)

    USER

    2015-03-26

    Mar 26, 2015 ... watering, fish culturing and nursery of seedlings. Air is also very ... synthesized organic and inorganic fertilizers are made, synthesized pesticides and herbicides for ..... production and nutritional quality of grains. (Graham and ...

  4. Structural studies of conformational changes of proteins upon phosphorylation: Structures of activated CheY, CheY-N16-FliM complex, and AAA + ATPase domain of NtrC1 in both inactive and active states

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seok-Yong [Univ. of California, Berkeley, CA (United States)

    2003-04-10

    Protein phosphorylation is a general mechanism for signal transduction as well as regulation of cellular function. Unlike phosphorylation in eukaryotic systems that uses Ser/Thr for the sites of modification, two-component signal transduction systems, which are prevalent in bacteria, archea, and lower eukaryotes, use an aspartate as the site of phosphorylation. Two-component systems comprise a histidine kinase and a receiver domain. The conformational change of the receiver domain upon phosphorylation leads to signal transfer to the downstream target, a process that had not been understood well at the molecular level. The transient nature of the phospho-Asp bond had made structural studies difficult. The discovery of an excellent analogue for acylphosphate, BeF3-, enabled structural study of activated receiver domains. The structure of activated Chemotaxis protein Y (CheY) was determined both by NMR spectroscopy and X-ray crystallography. These structures revealed the molecular basis of the conformational change that is coupled to phosphorylation. Phosphorylation of the conserved Asp residue in the active site allows hydrogen bonding of the T87 Oγ to phospho-aspartate, which in turn leads to the rotation of Y106 into the ''in'' position (termed Y-T coupling). The structure of activated CheY complexed with the 16 N-terminal residues of FliM (N16-FliM), its target, was also determined by X-ray crystallography and confirmed the proposed mechanism of activation (Y-T coupling). First, N16-FliM binds to the region on CheY that undergoes a significant conformational change. Second, the ''in'' position of Y106 presents a better binding surface for FliM because the sidechain of Y106 in the inactive form of CheY (''out'' position) sterically interferes with binding of N16-FliM. In addition to confirmation of Y-T coupling, the structure of the activated CheY-N16-FliM complex suggested that the

  5. The Technical Training Programme for Nuclear Power Station Personnel; Programme de formation technique du personnel des centrales nucleaires; Programma tekhnicheskoj podgotovki personala yadernoj ehlektrostantsii; El programa de formacion tecnica del personal de una central nucleoelectrica

    Energy Technology Data Exchange (ETDEWEB)

    Howey, G. R. [Hydro-Electric Power Commission of Ontario, Toronto, Ontario (Canada)

    1963-10-15

    ehnerdzhi of Kanada limited'', ehkspluatiruetsya i obsluzhivaetsya personalom Gidroehnergeticheskoj komissii Ontario, ona yavlyaetsya mestnym kommunal'nym predpriyatiem. Trudnost' v nabore i obuchenii personala stantsii zaklyuchalas' v tom, chto do nedavnego vremeni osnovnye potrebnosti v ehlektrichestve Ontario obespechivalis' gidroehlektrostantsiyami. Vozrosshee ispol'zovanie teplovoj ehnergii s nachala 1950 goda privelo k ostroj nekhvatke personala, obladayushchego opytom ehkspluatatsii teplovykh ehlektrostantsij. CHtoby vyjti, iz ehtogo polozheniya, byli predprinyaty sleduyushchie shagi dlya obespecheniya obsluzhivaniya atomnykh ehlektrostantsij opytnym personalom: (1) Pervonachal'no byla otobrana gruppa professional'nykh inzhenerov iz chisla lits, obladayushchikh znachitel'nym opytom v oblasti ehkspluatatsii yadernykh ustanovok, teplovykh ehlektrostantsij i v oblasti ehlektrotekhniki voobshche; (2) Byla otobrana eshche odna gruppa operatorov i ehkspluatatsionnikov, obladayushchikh bol'shim opytom raboty; (3) Dlya otobrannykh grupp byla sostavlena strogo ustanovlennaya uchebnaya programma podgotovki, zatragivayushchaya ehkspluatatsiya kak atomnykh stantsij, tak i stantsij, rabotayushchikh na ugle. Podgotovkoj rukovodili proektirovshchiki NPD. Zanyatiya prokhodili v auditoriyakh i po mestu raboty. (4) YAdernyj uchebnyj tsentr byl sozdan dlya togo, chtoby podobrat' i obuchit' dopolnitel'nyj personal, ustroit' ofitsial'nye ehkzameny i v posleduyushchem otvechat' za uroven' podgotovki personala. Personal sdaval ehkzameny, provodimye Byuro po upravleniyu atomnoj ehnergiej, kotoroe yavlyaetsya samostoyatel'nym federal'nym agentstvom, reguliruyushchim soblyudenie ustavnykh polozhenii. Podgotavlivayutsya pyat' obshchikh kategorij personala: (1) dozimetristy - inzhenery, otvetstvennye za ehkspluatatsiyu, ukhod i za administrativno-dozimetricheskij kontrol', smenyayushchiesya periodicheski s tsel'yu povysheniya ikh mnogostoronnej kvalifikatsii; (2) operatory - chetyre urovnya

  6. BOOK REVIEWS / RECENSIONI

    African Journals Online (AJOL)

    User

    armi da fuoco, Campanella risponde: “È la poesia l'arma che colpisce a distanza” e questa, lui dice d'aver perfezionato come Dante. Dopo il convegno del 1990 su “Poesia e Filosofia”, il romanziere ha messo in rilievo la titanica figura del suo corregionale sia come filosofo, sia come teorico in “Poetica”, sia come autore di ...

  7. Approccio dal basso, servizi alla persona e memorie interculturali

    Directory of Open Access Journals (Sweden)

    Orazio Maria Valastro

    2003-06-01

    Full Text Available Valorizzare le memorie dei migranti risponde ad una precisa esigenza di riconoscimento, nella storia collettiva e nello spazio politico nazionale, della memoria interculturale di intere collettività ... Queste condizioni implicano l'esigenza del riconoscimento della memoria dei migranti traducendosi in uno stimolo per lo sviluppo di nuove politiche sociali e culturali e di nuovi interventi focalizzati su questo stesso riconoscimento che interessa direttamente anche gli operatori sociali e culturali delle amministrazioni pubbliche e del terzo settore.

  8. Nouvelles fonctions de l'agriculture et dynamiques des exploitations: une analyse chorématique dans les monts d'Ardèche

    Directory of Open Access Journals (Sweden)

    Muriel Bonin

    2001-06-01

    Full Text Available Les modèles spatiaux sont utilisés pour l'analyse des trajectoires d'exploitations agricoles pour mettre en évidence les liens entre les transformations socio-économiques et les dynamiques de territoires. Les traits de dynamiques spatiales sont identifiés et utilisés pour analyser l'impact de l'introduction de l'agritourisme dans les exploitations dans le Parc naturel régional des monts d'Ardèche.

  9. Automatización del control del cálculo de extracciones en la mina de la empresa niquelera Ernesto Che Guevara

    Directory of Open Access Journals (Sweden)

    Arístides A. Legrá-Lobaina

    2010-03-01

    Full Text Available En el artículo se muestran los elementos fundamentales de un algoritmo cuyo objetivo es establecer el contenido y el orden de los procedimientos necesarios para realizar el control del cálculo de extracciones en la mina de la empresa Ernesto Che Guevara que explota, a cielo abierto, yacimientos lateríticos ferroniquelíferos en la región de Moa, Cuba. Asimismo se presenta el diseño de los diálogos informáticos que han automatizado el algoritmo en la aplicación informática Tierra.

  10. A 36,000-Year-Old Volcanic Eruption Depicted in the Chauvet-Pont d’Arc Cave (Ardèche, France)?

    Science.gov (United States)

    Nomade, Sébastien; Genty, Dominique; Sasco, Romain; Scao, Vincent; Féruglio, Valérie; Baffier, Dominique; Guillou, Hervé; Bourdier, Camille; Valladas, Hélène; Reigner, Edouard; Debard, Evelyne; Pastre, Jean–François; Geneste, Jean-Michel

    2016-01-01

    Among the paintings and engravings found in the Chauvet-Pont d’Arc cave (Ardèche, France), several peculiar spray-shape signs have been previously described in the Megaloceros Gallery. Here we document the occurrence of strombolian volcanic activity located 35 km northwest of the cave, and visible from the hills above the cave entrance. The volcanic eruptions were dated, using 40Ar/39Ar, between 29 ± 10 ka and 35 ± 8 ka (2σ), which overlaps with the 14C AMS and thermoluminescence ages of the first Aurignacian occupations of the cave in the Megaloceros Gallery. Our work provides the first evidence of an intense volcanic activity between 40 and 30 ka in the Bas-Vivarais region, and it is very likely that Humans living in the Ardèche river area witnessed one or several eruptions. We propose that the spray-shape signs found in the Chauvet-Pont d’Arc cave could be the oldest known depiction of a volcanic eruption, predating by more than 34 ka the description by Pliny the Younger of the Vesuvius eruption (AD 79) and by 28 ka the Çatalhöyük mural discovered in central Turkey. PMID:26745626

  11. A 36,000-Year-Old Volcanic Eruption Depicted in the Chauvet-Pont d'Arc Cave (Ardèche, France)?

    Science.gov (United States)

    Nomade, Sébastien; Genty, Dominique; Sasco, Romain; Scao, Vincent; Féruglio, Valérie; Baffier, Dominique; Guillou, Hervé; Bourdier, Camille; Valladas, Hélène; Reigner, Edouard; Debard, Evelyne; Pastre, Jean-François; Geneste, Jean-Michel

    2016-01-01

    Among the paintings and engravings found in the Chauvet-Pont d'Arc cave (Ardèche, France), several peculiar spray-shape signs have been previously described in the Megaloceros Gallery. Here we document the occurrence of strombolian volcanic activity located 35 km northwest of the cave, and visible from the hills above the cave entrance. The volcanic eruptions were dated, using 40Ar/39Ar, between 29 ± 10 ka and 35 ± 8 ka (2σ), which overlaps with the 14C AMS and thermoluminescence ages of the first Aurignacian occupations of the cave in the Megaloceros Gallery. Our work provides the first evidence of an intense volcanic activity between 40 and 30 ka in the Bas-Vivarais region, and it is very likely that Humans living in the Ardèche river area witnessed one or several eruptions. We propose that the spray-shape signs found in the Chauvet-Pont d'Arc cave could be the oldest known depiction of a volcanic eruption, predating by more than 34 ka the description by Pliny the Younger of the Vesuvius eruption (AD 79) and by 28 ka the Çatalhöyük mural discovered in central Turkey.

  12. Rachunek dochodów i wydatków budżetu jednostki samorządu terytorialnego na przykładzie gminy Chełmiec w latach 2011-2013

    OpenAIRE

    Rodak, Anna

    2015-01-01

    Przedłożona praca ma na celu wskazanie źródeł i struktury dochodów budżetowych oraz charakteru wydatkowania środków budżetowych gminy Chełmiec, a także dokonanie rzetelnej oceny sytuacji finansowej wymienionej powyżej jednostki. Analiza budżetu obejmuje zakres czasowy od 2011 do 2013 roku. Szczegółowe pytania, na które starano się w niniejszej pracy odpowiedzieć są następujące: Czy gmina Chełmiec jest gospodarna w wykorzystywaniu środków budżetowych? oraz jak gmina Chełmiec mając do dyspozycj...

  13. Evita Perón y el Che Guevara: De la historia a la construcción literaria del mito biográfico

    Directory of Open Access Journals (Sweden)

    Cecilia López Badano

    2014-06-01

    Full Text Available Eva Perón y el Che Guevara son dos de las figuras paradigmáticas argentinas, conocidas internacionalmente a través no sólo de sus vidas, que pueden reconstruirse a partir de documentos históricos, sino por el mito nacional - e internacional - que la muerte temprana ha configurado con ambos mediante la ayuda de la literatura y el cine, expandiendo ficcionalmente el matiz revolucionario de su accionar. El presente texto se propone, en consecuencia, dar cuenta de esas "capas" ficcionales que conforman la construcción estética de los dos mitos biográficos e inciden en la evaluación de sus protagonistas reales, modelando la percepción de ambos, particularmente, la considerada por el gran público más que por los especialistas.

  14. Nascita e destino della soggettività. Dai ruoli professionali ai processi di cura, attraverso una lettura di "Quel che resta del giorno" di Kazuo Ishiguro

    Directory of Open Access Journals (Sweden)

    Gabriele Profita

    2017-07-01

    Full Text Available Questa riflessione affronta un tema assai rilevante per le professioni di cura, con uno sguardo particolare alla psicoterapia. Per chiarire il ruolo della soggettività e della nascita e maturazione di un ruolo professionale riporterò un’analisi di un testo letterario attraverso il quale sarà più agevole scoprire come si forma l’identità di un ruolo professionale e come si avvia alla sua maturazione e alla sua codificazione. In particolare quali sono i rischi legati ad una sua rigida codificazione rivolta alla sua normatività tecnica? Mi propongo di tracciare un confronto con alcune forme di costruzione della soggettività che nel corso dei secoli hanno fondato il modello dell’uomo occidentale nelle sue articolazioni professionali.

  15. Changes of serum levels of prealbumin (PAB), cholinesterase (CHE), total bile acid (TBA) and ALT as related to the severity of inflammatory process and hepatic fibrosis in patients with chronic virus B hepatitis

    International Nuclear Information System (INIS)

    Chi Xiaoxia; Chen Jianxiong; Xiong Ying

    2005-01-01

    Objective: To study the correlationship between the serum levels of PAB, CHE, TBA, ALT and the severity of the disease process in patients with chronic virus B hepatitis. Methods: Serum levels of PAB, CHE, ALT (with biochemical methods) and TBA (with RIA) were examined in 93 patients with biopsy proven virus B hepatitis and 46 controls. Results: The 93 patients were of two groups: a less advanced group (n=51) and a more advanced group (n=42). Serum TBA, ALT levels were significnatly higher and serum PAB, CHE levels were significantly lower in the more advanced group than those in the less advanced group (P 0 to s 4 . Changes of levels of ALT were of no regular pattern, but serum levels of TBA regularly increased and levels of PAB, CHE regularly decreased as the fibrosis grading proceeded from s 0 to s 4 and the differences between the levels in s 4 and any other grading were significant (P<0.01). Conclusion: Combined determination of these serum markers might reflect the degree of inflammatory process and hepatic fibrosis in patients with virus B hepatitis, leading to earlier detection of cirrhosis. (authors)

  16. Conditions of concentration and composition of suspended load in the Vistula River between Wyszogród and Chełmno

    Science.gov (United States)

    Kaszubski, Michal

    2014-05-01

    The main objective of the study is to explain causes of variations of concentration, particle size distribution and composition of suspended load in the riverbed of the lower Vistula between Wyszogród and Chełmno. The study was conducted in seven bridge cross-sections (three above and four below the Włocławek reservoir). In each cross-section, three water samples were collected in the characteristic parts of the riverbed. Since July 2012 fifteen measurement series were carried out. During each measurement series 22 samples of water were collected. In each sample the overall concentration of suspended load, the proportion of the organic matter and particle size distribution of the mineral fraction were measured. Variation of concentration and characteristics of suspended load were studied both in the cross-sections of the Vistula riverbed and along its longitudinal profile. The study focus primarily on determining the qualitative and quantitative variation in the properties of suspended load in the cross-sections located in different morphological riverbed type, various level of its hydrotechnical management, including the operation on the Włocławek reservoir, and the diversity of the water flow conditions. The author tested the correlation occurring between the size of suspended load concentration as well as the flow rate and flow velocity at the water sampling sites. Moreover, the author determined the effect of morphological variation of the Vistula riverbed (the riverbed depth and the location of points of collecting water samples relative to the riverbed mesoforms) on the concentration size, composition structure and the particle size distribution of suspended load. Measurement sessions were chosen in such a way as to cover the widest possible spectrum of the water flow conditions in the riverbed of the Vistula. In addition to the low and medium flow the variability in concentration during flood flows of various types (ice jam, snowmelt and rainfall) were

  17. The CheMin XRD on the Mars Science Laboratory Rover Curiosity: Construction, Operation, and Quantitative Mineralogical Results from the Surface of Mars

    Science.gov (United States)

    Blake, David F.

    2015-01-01

    The Mars Science Laboratory mission was launched from Cape Canaveral, Florida on Nov. 26, 2011 and landed in Gale crater, Mars on Aug. 6, 2012. MSL's mission is to identify and characterize ancient "habitable" environments on Mars. MSL's precision landing system placed the Curiosity rover within 2 km of the center of its 20 X 6 km landing ellipse, next to Gale's central mound, a 5,000 meter high pile of laminated sediment which may contain 1 billion years of Mars history. Curiosity carries with it a full suite of analytical instruments, including the CheMin X-ray diffractometer, the first XRD flown in space. CheMin is essentially a transmission X-ray pinhole camera. A fine-focus Co source and collimator transmits a 50µm beam through a powdered sample held between X-ray transparent plastic windows. The sample holder is shaken by a piezoelectric actuator such that the powder flows like a liquid, each grain passing in random orientation through the beam over time. Forward-diffracted and fluoresced X-ray photons from the sample are detected by an X-ray sensitive Charge Coupled Device (CCD) operated in single photon counting mode. When operated in this way, both the x,y position and the energy of each photon are detected. The resulting energy-selected Co Kalpha Debye-Scherrer pattern is used to determine the identities and amounts of minerals present via Rietveld refinement, and a histogram of all X-ray events constitutes an X-ray fluorescence analysis of the sample.The key role that definitive mineralogy plays in understanding the Martian surface is a consequence of the fact that minerals are thermodynamic phases, having known and specific ranges of temperature, pressure and composition within which they are stable. More than simple compositional analysis, definitive mineralogical analysis can provide information about pressure/temperature conditions of formation, past climate, water activity and the like. Definitive mineralogical analyses are necessary to establish

  18. RELÉ ELECTRÓNICO PARA LA DETECCIÓN DEL MOVIMIENTO EN LOS TANQUES DE SEDIMENTACIÓN DE LA EMPRESA COMANDANTE ¨ERNESTO CHE GUEVARA¨

    Directory of Open Access Journals (Sweden)

    Orlys Ernesto Torres Breffe

    2011-02-01

    Full Text Available En este trabajo se muestran los resultados del diseño de un dispositivo electrónico para detectar el movimiento del tanquede sedimentación de la planta de lixiviación de la Empresa Ernesto Che Guevara.Estos tanque actualmente se encuentran sin esta protección y su parada por avería solo es detectada de forma visual por eloperario o cuando la densidad de la pulpa aumente a valores tan altos que sea reflejado en el sistema de monitoreo instalado(EROS. La parada inadvertida de estos tanque casi siempre sucede por razones fácilmente corregibles, pero si no se detectaa tiempo la sedimentación del minerales es casi inevitable y las pérdidas de recursos y materiales son cuantiosas.La propuesta electrónica en sustitución a las desechas electromagnéticas, es muy barata y su reproducción es fácilmenterealizable en la propia empresa, dado que los elementos que se utiliza son clásicos, sin exigencias de fabricación, tolerancias,etc.  The main goal of this research paper is to show the electronic device design results while dealing with the location of thesedimentation tank on the leaching plant located on Ernesto Che Guevara factory.Nowadays there is no protection for this tank, thus, if it stops working it can only be noticed by the engine sunner on avisual way or when the extremely high figures of the pulp density are reflected on the available monitor system (EROS.The unnoticed misfunctioning of this device is caused mainly to easily solved reasons. Nevertheless, when not detected ontime, the mineral sedimentation is almost unavoidable which results on the losses of resources.The electronic proposal to substitute the electromagnetic scraps is very cheap and easily to reproduce on the factory itself forthe needed elements are classic with no resistance and manufacture demands.

  19. Rock shelter occupation during isotopic stage 5: level D of the site of Payre (Ardèche, France. Territorial organisation and intra-site activities

    Directory of Open Access Journals (Sweden)

    Moncel, Marie-Hélène

    2007-06-01

    Full Text Available This paper presents the results obtained from an interdisciplinary study of the level D archaeological assemblages from Payre (Ardèche, France. This site is dated to the final of OIS 6 and the beginning of OIS 5. The combined analysis of the lithic and faunal assemblages accumulated and their management “into” and “out of” the site gives a better understanding of the behaviour of the Neanderthal groups that inhabited it. This study has allowed us to correlate the territorial exploitation for game hunting and for raw material procurement, within the context of seasonal short term occupations probably during the end of autumn and the beginning of winter.  

    Este artículo presenta los resultados obtenidos a través del estudio multidisciplinar del registro arqueológico del nivel D del yacimiento de Payre (Ardèche, Francia datado entre el final del OIS 6 y el comienzo del OIS 5. El análisis conjunto de la industria lítica y de los restos óseos recuperados en el yacimiento y de la gestión de dichos recursos dentro y fuera de él, ha hecho posible la comprensión de los comportamientos humanos de los grupos neandertales que lo ocuparon. Dicho estudio nos ha permitido poner en relación el tipo de explotación del territorio de caza y de captación de materias primas, dentro del marco de ocupaciones estacionales de corta duración desarrolladas probablemente entre el final del otoño y el principio del invierno.  

  20. LA DIAGNOSI DELLE COMPETENZE LINGUISTICHE IN UN CONTESTO MULTILINGUE: UN PROCESSO CONTINUO CHE FAVORISCE L’INSEGNAMENTO E L’APPRENDIMENTO INDIVIDUALIZZATO

    Directory of Open Access Journals (Sweden)

    Drorit Lengyel

    2011-07-01

    Full Text Available Il presente studio affronta il problema della valutazione diagnostica delle competenze linguistiche in contesti educativi multilingui, con particolare attenzione ai bisogni dei bambini e degli adolescenti immigrati. Vengono brevemente esposti gli obiettivi, le funzioni e i principi della valutazione diagnostica e della valutazione formativa considerate parte integrante di una educazione linguistica continua che prevede un insegnamento-apprendimento individualizzato. Sul piano teorico le procedure della valutazione diagnostica delle competenze linguistiche in contesti multilingui fanno riferimento all’apprendimento delle lingue inteso come attività socio-culturale.     Language diagnostics in multilingual settings with respect to continuous procedures as accompaniment of individualized learning and teaching   This study provides an introduction to language diagnostics in multilingual educational settings, with particular reference to the needs of children and adolescents from migrant backgrounds. It summarises the objectives and functions of language diagnostics and the principles that govern diagnostics including formative assessment, considered to be an integral part of continuous language education that emphasises individualised teaching and learning. From a theoretical perspective, diagnostic procedures in multilingual settings treat language learning as a socio-cultural activity.  

  1. Il Salento che abbiamo attraversato: Rina Durante e Bruno Brancher, il racconto di due vite diverse sulle strade di terra d'Otranto

    Directory of Open Access Journals (Sweden)

    Massimo Melillo

    2015-07-01

    Full Text Available Rina Durante ha rappresentato il meglio della cultura meridionale, ne ha raccolto l’eredità e ne è stata tra le interpreti più acute. Abbiamo avuto l’onore della sua amicizia fraterna e solidale, conosciuto l’azzardo e la radicalità delle sue scelte di vita, la sua dolce timidezza e l’ardita padronanza e consapevolezza del suo ruolo: anni di discussioni, di confronto, di legame cementato da infuocati innamoramenti intellettuali per uno scrittore, un poeta, un regista, di accese ironie sui nostri caratteri, di scontri politici e furibondi litigi finiti in un abbraccio. Anche per Bruno Brancher, milanese di tutti e di nessuno, il ricordo si fa memoria per le sue mille improvvise e imprevedibili incursioni in terra salentina. Non era un uomo facile, anche se aveva dalla sua parte il puntiglio dell’innocenza tipica del ladro gentiluomo. Portava leggero il fardello di due vite in una: la prima segnata da una marginalità, fattasi a volte precariamente lussuosa con i proventi di furti e disarmanti rapine; l’altra con la faccia del redento, che con la scoperta della scrittura diventa cosciente di sé.

  2. Evaluation of the Addition liquor with high ammonia and Carbon Dioxide contentin the still 208 of the “Comandante Che Guevara” industry (ECG

    Directory of Open Access Journals (Sweden)

    María Elena Magaña-Haynes

    2015-12-01

    Full Text Available Adding fresh liquor through the 5th ring in still 208 of distilling liquor product (liquor obtained as a result of ammonium carbonate leaching of lateritic ore in the “Comandante Che Guevara” industry, were evaluated with the objective of reducing the dissolved nickel content of the effluent there from, as well as to improve the characteristics of the nickel carbonate which is delivered to the calcinations process. For the development of the survey, the same methodology used in 2001 for the test was applied. The results showed that by adding fresh liquor, it is possible to reduce the dissolved nickel content at the exit of the distillation column, so that the need for precipitation is minimized, thereby reducing the consumption of reagents and the and the cost for their acquisition. It was possible to corroborate the relationship between the content of NH3 at the discharge and the nickel dissolved therein appreciating that to achieve these results it is necessary to maintain the ammonia in the discharge between 1,0-1,8 g/L. The carbonate obtained in the column where liquor is added with high CO2 and NH3 reached high values of this last element in its composition and to the extent that increased sulphur content decreased. It was also seen an increase in the size of the coarse carbonates particles, which will influence in a decrease of energy consumption.

  3. Mineralogy, provenance, and diagenesis of a potassic basaltic sandstone on Mars: CheMin X-ray diffraction of the Windjana sample (Kimberley area, Gale Crater)

    International Nuclear Information System (INIS)

    Treiman, Allan H.; Bish, David L.; Chipera, Steve J.; Blake, David F.

    2015-01-01

    The Windjana drill sample, a sandstone of the Dillinger member (Kimberley formation, Gale Crater, Mars), was analyzed by CheMin X-ray diffraction (XRD) in the MSL Curiosity rover. From Rietveld refinements of its XRD pattern, Windjana contains the following: sanidine (21% weight, ~Or 95 ); augite (20%); magnetite (12%); pigeonite; olivine; plagioclase; amorphous and smectitic material (~25%); and percent levels of others including ilmenite, fluorapatite, and bassanite. From mass balance on the Alpha Proton X-ray Spectrometer (APXS) chemical analysis, the amorphous material is Fe rich with nearly no other cations—like ferrihydrite. The Windjana sample shows little alteration and was likely cemented by its magnetite and ferrihydrite. From ChemCam Laser-Induced Breakdown Spectrometer (LIBS) chemical analyses, Windjana is representative of the Dillinger and Mount Remarkable members of the Kimberley formation. LIBS data suggest that the Kimberley sediments include at least three chemical components. The most K-rich targets have 5.6% K 2 O, ~1.8 times that of Windjana, implying a sediment component with >40% sanidine, e.g., a trachyte. A second component is rich in mafic minerals, with little feldspar (like a shergottite). A third component is richer in plagioclase and in Na 2 O, and is likely to be basaltic. The K-rich sediment component is consistent with APXS and ChemCam observations of K-rich rocks elsewhere in Gale Crater. The source of this sediment component was likely volcanic. Finally, the presence of sediment from many igneous sources, in concert with Curiosity's identifications of other igneous materials (e.g., mugearite), implies that the northern rim of Gale Crater exposes a diverse igneous complex, at least as diverse as that found in similar-age terranes on Earth.

  4. Quality of the Fosso della Casaccia: analysis of the macroinvertebrates colonizing artificial substrates; Stato di qualita` del fosso della Casaccia: analisi dei macroinvertebrati che colonizzano substrati artificiali

    Energy Technology Data Exchange (ETDEWEB)

    Prato, S.; Morgana, J.G.; Antonelli, D.; Folletto, A. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente

    1999-01-01

    Aim of this work is to analyse the environmental quality of a small stream, the Fosso della Casaccia, flowing near Research Centre of ENEA (Rome, Central Italy). The study was carried out comparing zoo benthic communities of two sampling sites, chosen upstream and downstream the sewage of the Research Centre. Macro invertebrates were sampled using artificial substrates and standard hand net. Taxa number and distribution along along the watercourse were compared. Moreover, biotic index values (I.B.E.=Indice Biotico Esteso) were calculated using data on macro invertebrates collected with both sampling methodologies. Artificial substrates were also useful in establishing colonization patterns at each sampling site, and bio masses of individuals belonging to different trophic groups. The results show the greater sampling effectiveness of artificial substrates, confirming their usefulness for establishing the environmental quality. [Italiano] Il presente lavoro prende in considerazione la qualita` ambientale del Fosso della Casaccia, un piccolo corso d`acqua che scorre in prossimita` del Centro di Ricerche ENEA Casaccia (Italia Centrale). Lo studio e` stato realizzato in base al confronto fra le comunita` zoobentoniche di due stazioni sperimentali situate a monte e a valle dello scarico di acque reflue del centro. Il campionamento dei macroinvertebrati e` stato effettuato utilizzando due diversi metodi di raccolta: i substrati artificiali e il retino immanicato standard. Gli organismi sono stati classificati in unita` sistematiche, e si e` analizzata la loro distribuzione lungo il corso d`acqua. Inoltre sono stati calcolati i valori degli indici biotici I.B.E. (Indice Biotico Esteso) utilizzando i dati ottenuti con le due metodologie di campionamento. L`uso di substrati artificiali in ogni stazione di campionamento e` stato utile anche per stabilire il tipo di colonizzazione, l`abbondanza e le biomasse degli individui appartenenti ai vari gruppi trofici. I nostri

  5. Issues relating to classification of colluvial soils in young morainic areas (Chełmno and Brodnica Lake District, northern Poland

    Directory of Open Access Journals (Sweden)

    Świtoniak Marcin

    2015-06-01

    Full Text Available Colluvial soils (in Polish: gleby deluwialne are an important part of the soil cover in young morainic landscapes of northern Poland. They evolved as a result of the accumulation of eroded material at the foot of the slopes and bottoms of closed depressions. The aim of this study was to determine the systematic position of colluvial soils commonly found in the Chełmno and Brodnica Lake District, northern Poland. Ten soil pits located in different types of landscapes were selected for testing soil properties. The colluvial material is characterized by diversified properties: thickness, particle-size distribution, organic carbon content, color, pH, and base saturation. As a result, the investigated soils represent broad spectrum of typological units according to Polish Soil Classification (2011. Some of them contain epipedons mollic and meet the criteria of colluvial chernozemic soils. They were found mainly on buried black earths in areas with small slope inclinations. Many pedons contain pale colored acidic colluvial material with low base saturation and low organic carbon content and must be classified as other types: arenosols (in Polish: arenosole or rusty soils (in Polish: gleby rdzawe. These soils occur mostly in areas with intensive relief and overlay the different soil types, including rusty soil and organic soils. They are formed as a result of soils lessivés and rusty soils truncation. An introduction of the additional units of “proper colluvial soils” which have epipedon ochric, and “rusty-colluvial soils” with endopedon sideric to the next edition of Polish Soil Classification would enable a more precise expression of the genesis of these soils in the type rank. Moreover, the definition of chernozemic colluvial soils could be extended to colluvial soils with umbric horizon. Classifying soils derived from colluvial material as soils of other types leads to the disappearance of this units on maps and underestimation of the

  6. Architecture of buried reverse fault zone in the sedimentary basin: A case study from the Hong-Che Fault Zone of the Junggar Basin

    Science.gov (United States)

    Liu, Yin; Wu, Kongyou; Wang, Xi; Liu, Bo; Guo, Jianxun; Du, Yannan

    2017-12-01

    It is widely accepted that the faults can act as the conduits or the barrier for oil and gas migration. Years of studies suggested that the internal architecture of a fault zone is complicated and composed of distinct components with different physical features, which can highly influence the migration of oil and gas along the fault. The field observation is the most useful methods of observing the fault zone architecture, however, in the petroleum exploration, what should be concerned is the buried faults in the sedimentary basin. Meanwhile, most of the studies put more attention on the strike-slip or normal faults, but the architecture of the reverse faults attracts less attention. In order to solve these questions, the Hong-Che Fault Zone in the northwest margin of the Junggar Basin, Xinjiang Province, is chosen for an example. Combining with the seismic data, well logs and drill core data, we put forward a comprehensive method to recognize the internal architectures of buried faults. High-precision seismic data reflect that the fault zone shows up as a disturbed seismic reflection belt. Four types of well logs, which are sensitive to the fractures, and a comprehensive discriminated parameter, named fault zone index are used in identifying the fault zone architecture. Drill core provides a direct way to identify different components of the fault zone, the fault core is composed of breccia, gouge, and serpentinized or foliated fault rocks and the damage zone develops multiphase of fractures, which are usually cemented. Based on the recognition results, we found that there is an obvious positive relationship between the width of the fault zone and the displacement, and the power-law relationship also exists between the width of the fault core and damage zone. The width of the damage zone in the hanging wall is not apparently larger than that in the footwall in the reverse fault, showing different characteristics with the normal fault. This study provides a

  7. Dose evaluation for workers employed in an industry involving enamel paints containing zirconium silicate; Valutazione di dose per i lavoratori occupati in una industria che utilizza vernici a smalto contenenti silicato di zirconio

    Energy Technology Data Exchange (ETDEWEB)

    Castellani, C.M.; Berico, M.; De Zaiacomo, T.; Formignani, M.; Ianni, A.; Nobili, C.; Sandri, S.; Vasselli, R. [ENEA, Centro Ricerche Ezio Clementel, Bologna (Italy). Dipt. Ambiente

    1999-07-01

    In the frame of the European Recommendations for radiological protection, an evaluation of the annual dose has been made for workers employed in an industry for the production of sanitary equipment involving the use of enamel paints containing zirconium silicate. [Italian] Nella prospettiva dell'applicazione della direttiva europea relativa alla protezione radiologica dei lavoratori, vengono presentati i risultati relativi alla valutazione di dose annuale complessiva per i lavoratori occupati in una industria per la produzione di articoli igienico-sanitari che utilizza vernici a smalto contenenti silicato di zirconio. Il fine e' la valutazione del problema radioprotezionistico per gli addetti a causa delle impurezza radioattive presenti nei materiali utlizzati.

  8. Illustrations to “Gespräche in dem Reiche derer Todten zwischen dem vortreflichen Moscowitischen Czaar Petro Magno und dem grossen Tyrannen Ivan Basilowiz II” (Peter the Great and Ivan the Terrible) by David Fassmann (1725)

    OpenAIRE

    Ekaterina A. Skvortcova

    2017-01-01

    The journal created by David Fassmann (1683–1744), Gespräche in dem Reiche derer Todten, edited in Leipzig, was a huge success. Each of the 240 issues presents a dialogue between two historical figures from the afterworld. In the 83rd–86th Entrevuë, the interlocutors are Peter the Great and Ivan the Terrible. The texts of the four conversations were thoroughly examined by Eckhard Matthes (1987). The present paper explores how the illustrations to the 83rd–86th Entrevuë visualize the texts, w...

  9. apprendere una lingua straniera: tempo e spazio nella cultura italiana

    African Journals Online (AJOL)

    User

    partecipazione al programma Erasmus/Socrates, 1 che prevede programmi integrati di insegnamento tra le Università partecipanti e un sistema di riconoscimento reciproco delle attività svolte attraverso l'assegnazione di crediti. Dall'altra, hanno il compito di coordinare maggiormente la formazione universitaria in relazione ...

  10. Programma intensivnoi diagnostiki semeinõhh otnosheni / Irina Krot

    Index Scriptorium Estoniae

    Krot, Irina

    2002-01-01

    Intensiivse diagnostika programmist, mis annab võimaluse välja tuua ka nn õnnelike perede psühholoogilised probleemid, ning autor arvab, et nimetatud programm võiks saada psühhoteraapia läbiviimise juhendiks praktikas

  11. “Initial Services”, la nuova fase del programma Galileo

    Directory of Open Access Journals (Sweden)

    Marco Lisi

    2017-03-01

    infrastructures and secure services for public authorities. The Declaration of Galileo Initial Services means that the Galileo satellites and ground infrastructure are now operationally ready. These signals will be highly accurate but not available all the time. In the coming years, new satellites will be launched to enlarge the Galileo constellation, which will gradually improve Galileo availability worldwide. The constellation is expected to be completed by 2020 when Galileo will reach full operational capacity.

  12. Programma EQUAL : ravnõe vozmozhnosti na rabote / Ksenia Repson

    Index Scriptorium Estoniae

    Repson, Ksenia

    2006-01-01

    Tallinnas toimunud 23 Euroopa Liidu liikmesriigi EQUAL programmile pühendatud foorumist, mille eesmärgiks on vähendada diskrimineerimist töökohtadel. Eestis EQUAL programmi raames töötavatest projektidest. Foorumist võttis osa ka sotsiaalminister Jaak Aab. Lisa

  13. ‘Unkind and cruel, to deceive your Son | In borrow’d Shapes, and his Embrace to shun’: Mother-son love in T. S. Eliot’s ‘La Figlia Che Piange’

    Directory of Open Access Journals (Sweden)

    Matthew Geary

    2015-01-01

    Full Text Available T. S. Eliot's "La Figlia Che Piange" (1916 is a curious anomaly in his early works. It stands out as a love poem of outstanding grace portraying a more positive relationship to the feminine compared to other poems contemporaneous with its writing such as "The Love Song of St. Sebastian" (1914 and "Hysteria" (1915. This essay shows the import of Eliot's chosen epigraph for "La Figlia" taken from Virgil's Aeneid to have been largely neglected or misread by critics. As a consequence, it argues that critical readings have crucially missed the presence of a shrouded maternal aspect within the poem. Through the lens of Lacanian psychoanalysis and the work of adherents to Lacanian theory — such as Bruce Fink, Shoshana Felman and Slavoj Zizek — this paper newly argues that the poem's meditation on the issues of union and separation between two lovers is in fact a screen for deeper unconscious ambivalent feelings between mother and son. That is to say, Eliot's "La Figlia Che Piange" shows a failed attempt to reconstruct, traverse and separate from the "fundamental fantasy" unconsciously orientating the male speaker of the poem and his desire.

  14. SOTRAS deelrapport nr. 2. Het grafisch programma XY. Een programma voor visualisatie van de resultaten van rekenprogramma's

    NARCIS (Netherlands)

    van Heerden C; Tiktak A

    1994-01-01

    This report gives a description of the graphical tool XY. This program is developed to be coupled with simulation models and database programs. The program contains options for creating line-graphs, scatter-graphs, area-graphs, ordination-graphs, countour-graphs, maps and vector diagrams. The

  15. Genesis and classification of the soils developed from the sediments of the former Oleszek mill pond basin (the Chełmińskie Lakeland, N Poland / Geneza i pozycja systematyczna gleb wykształconych z osadów niecki dawnego stawu młyńskiego Oleszek (Pojezierze Chełmińskie

    Directory of Open Access Journals (Sweden)

    Mendyk Łukasz

    2015-03-01

    Full Text Available Budowa i funkcjonowanie młynów wodnych znacznie wpłynęły na przekształcenie środowiska przyrodniczego w ich otoczeniu, przede wszystkim na zmiany rzeźby terenu i warunków wodnych. Obszar badañ obejmuje nieckę dawnego stawu młyńskiego Oleszek w okolicach wsi Borówno, w zachodniej części Pojezierza Chełmińskiego, około 20 km na północny wschód od Torunia. Celem badañ było określenie genezy gleb wykształconych z osadów zakumulowanych w niecce dawnego stawu młyńskiego Oleszek. Pięć profili glebowych w transekcie o długości około 550 m zlokalizowanym wzdłuż Strugi Rychnowskiej stanowiącej oś podłużną niecki. Wszystkie przeanalizowane gleby zbudowane są z osadów wypełniających nieckę dawnego stawu młyńskiego. Gleby w opisywanej niecce powstały w wyniku wielu nakładających się procesów, takich jak: proces mułotwórczy, aluwialny, koluwialny oraz glejowy. Dwa z analizowanych profili glebowych (profile 3 i 4 spełniaj¹ kryteria wydzielania gleb organicznych limnowych typowych (Systematyka gleb Polski 2011. Jako pozycję systematyczną kolejnych dwóch gleb (profile 2 i 5 zaproponowano gleby mułowate. W związku z problemami klasyfikacyjnymi dotyczącymi tego typu gleb, przy opracowaniu aktualizacji Systematyki gleb Polski należałoby wprowadzić w typie gleb glejowych podtyp gleb mułowatych lub mułowato-glejowych, obejmuj¹cy gleby wytworzone z mineralno-organicznych utworów aluwialno-mułowych. Cztery wymienione powyżej profile zostały zaklasyfikowane jako Histosols (3 i 4 i Gleysols (2 i 5 według klasyfikacji WRB (2014. Jednostki glebowe wykształcone z osadów aluwialnych (mady wg SgP 2011 lub Fluvic Phaeozems wg WRB 2014 występują w proksymalnej części stawu (cofce.

  16. EURATOM's Programme of Participation in Power Reactor Construction; Le programme de participation d'Euratom aux reacteurs de puissance; Programma uchastiya v razrabotke ehnergeticheskikh reaktorov Evratoma; El programa de participacion de la Euratom en la construccion y explotacion de reactores de potencia

    Energy Technology Data Exchange (ETDEWEB)

    Ramadier, R. C.; Parker, E. [Communaute Europoenne de l' Energie Atomique, Bruxelles (Belgium)

    1963-10-15

    simple y circulacion natural. La participacion mancomunada puede revestir diversas formas. Una de las principales consiste en contribuir a enjugar el deficit que puede producirse en las centrales nucleoelectricas durante los primeros anos de su explotacion. Esta participacion de la EURATOM ha alentado la construccion de algunas centrales nucleoelectricas; ha permitido ademas, y permitira aun, reunir informaciones que seran de suma utilidad en los proximos afios, durante los cuales los problemas que plantea el funcionamiento de los reactores seran decisivos para el desarrollo de la energia atomica. (author) [Russian] Odnim iz sredstv, primenyaemykh Komissiej Evratoma v tselyakh obespecheniya razvitiya evropejskoj yadernoj promyshlennosti, yavlyaetsya programma, imenuemaya ''uchastie v soobshchestve''. Ehta programma pozvolyaet Komissii prinyat' uchastie v predelakh obshchikh raskhodov v summe 32 mln. raschetnykh edenits po evropejskoj sisteme v toj oblasti, kotoraya otnositsya k ehnergeticheskim reaktoram. V obmen predostavlyaetsya informatsiya o konstruktsii i poryadke ehkspluatatsii ehtikh reaktorov. Postupivshie do poslednego vremeni ot trekh obshchestv predlozheniya pozvolili podpisat' kontrakt. Obshchestva sleduyushchie: a) Natsional'noe obshchestvo po atomnoj ehnergii (SENN), kotoroe vedet v Italii stroitel'stvo ehlektrostantsii na 150 mgvt (ehl) netto s kipyashchim reaktorom s dvojnym tsiklom; b) Yuzhnoe ital'yanskoe obshchestvo po atomnoj ehnergii (SIMEA), kotoroe zanyato v Italii stroitel'stvom ehlektrostantsii na 200 mgvt (ehl) netto s uranovo-grafitovym reaktorom s uglekislym gazom v kachestve teplonositelya; c) Franko-bel'gijskoe obshchestvo po yadernoj ehnergii Ardenn (SENA), kotoroe predprinyalo na franko-bel'gijskoj granitse stroitel'stvo ehlektrostantsii s vodyanym reaktorom pod davleniem. Ozhidaetsya, chto stantsiya smozhet dostich' i, veroyatno, prevzojti moshchnost' v 242 mgvt (ehl) netto. Krome togo, Komissiya raspolagaet zaprosami ob uchastii v

  17. The United States Atomic Energy Commission Programme of Nuclear Materials Management; Le Programme de Gestion des Matieres Nucleaires Applique par L'USAEC; Programma komissii po atomnoj ehnergii ssha v oblasti obrashcheniya s yadernymi materialami; El Programa de Administracion de Materiales Nucleares de la Comision de Energia Atomica de los Estados Unidos

    Energy Technology Data Exchange (ETDEWEB)

    George, D. E. [United States Atomic Energy Commission, Washington, DC (United States)

    1966-02-15

    seguidos por la AEC para asegurarse de la eficacia de los programas establecidos por sus contratistas para la administracion de los materiales nucleares. Ademas de las que se encuentran en poder de los contratistas que explotan plantas y laboratorios de la AEC, existen considerables cantidades de materiales nucleares especiales que son objeto de una gran variedad de arreglos de caracter financiero y administrativo: en arriendo, con el titulo de propiedad transferido, sujetos a contratos en virtud de los cuales el usuario es responsable economicamente de las perdidas o a acuerdos en los que se estipula que las perdidas recaen en la AEC. La memoria trata de la forma en que la AEC enfoca esas situaciones tan distintas y concluye con un breve resumen de los problemas que aun quedan por resolver. (author) [Russian] Opredeljaetsja oblast' obrashhenija s jadernymi materialami pod rukovodstvom Komissii po atomnoj jenergii SShA i izlagaetsja istorija razvitija jetoj otrasli proizvodstva s 1943 goda do nastojashhego vremeni.. Namechaetsja i obsuzhdaetsja v obshhih chertah osnovnaja programma. Upor delaetsja na osushhestvlenie teh chastej programmy KAJe SShA, kotorye imejut otnoshenie k razrabotke i hraneniju kolichestvennyh dannyh, ustanovleniju vnutrennego kontrolja i ocenke kachestva ispolnenija. Dovol'no podrobno obsuzhdajutsja primenjaemye v nastojashhee vremja metody registracii i obrabotki dannyh o peredache v ramkah KAJe, kak, naprimer, metody predstavlenija otchetov o balanse materialov, v kotoryh periodicheski obobshhajutsja perevody i rezul'taty operacij. Takzhe obsuzhdajutsja metody, primenjaemye KAJe dlja proverki jeffektivnosti programm podrjadchikov v oblasti obrashhenija s jadernymi materialami. Krome materiala, kotorym raspolagajut podrjadchiki, jekspluatirujushhie ustanovki i laboratorii, prinadlezhashhie KAJe, bol'shoe kolichestvo special'nogo rasshhepljajushhego materiala postupaet v ramkah ochen' raznoobraznyh finansovyh i administrativnyh meroprijatij, naprimer

  18. Il piu grande centro europeo di ricerca oggi festeggia l'anniversario del Nobel di Rubbia e Van der Meer. Cern, vent'anni guardando al futuro Ora la sfida si gioca sull'acceleratore di particelle pronto per il 2007, che provera a svelare i segreti della materia

    CERN Multimedia

    Durante, E

    2003-01-01

    "CERN, vent'anni guardando al futuro Ora la sfida si gioca sull'acceleratore di particelle pronto per il 2007, che provera a svelare i segreti della materia" [CERN, twenty years of looking towards the future. The present challenge is the particle accelerator that will be ready in 2007, which will try to reveal the secrets of matter] (2 pages)

  19. The Israel Food Irradiation Programme and Progress During 1964-1966; Le Programme Israelien d'Irradiation de Denrees Alimentaires et son Evolution entre 1964 et 1966; Izrail'skaya programma po oblucheniyu pishchevykh produktov i uspekhi, dostignutye v ehtoj oblasti v 1964-1966 gg; El Programa de Irradiacion de Alimentos de Israel y sus Progresos Durante el Periodo 1964-1966

    Energy Technology Data Exchange (ETDEWEB)

    Kahan, R. S.; Eisenberg, E.; Lapidot, M. [Soreq Nuclear Research Centre, Yavne (Israel)

    1966-11-15

    con zumos enlatados de naranjas irradiadas. (author) [Russian] Programma po oblucheniju sel'skohozjajstvennyh produktov v Izraile koordiniruetsja komitetom, sozdannym Izrail'skim nacional'nym nauchno-issledovatel'skim sovetom i sostojashhim iz predstavitelej Komissii po atomnoj jenergii Izrailja, Ministerstva sel'skogo hozjajstva i predstavitelej razlichnyh torgovyh i sel'skohozjajstvennyh associacij. Zadachi programmy zakljuchajutsja v sledujushhem: poluchit' razreshenie pravitel'stvennyh organov na obluchenie kul'tur, uzhe poluchivshih- podobnoe razreshenie za granicej (kartofel', luk); prodolzhat' rabotu nad kul'turami. Mestnogo znachenija (abrikosy, grushi) i nad jeksportnymi kul'turami (citrusovye, banany, avokado). Istochnik aktivnost'ju 30 000 kjuri ustanavlivalsja v universal'nyj obluchatel' novejshej konstrukcii. Ob{sup e}kty vesom ot neskol'kih gramm do 50 kg obluchalis' dozami ot 20 do 5 x 10{sup 6} rad i moshhnost'ju dozy ot 1,5 do 800 krad/chas. Dlja citrusovyh issledovalos' vlijanie uslovij proizrastanija, sozrevanija, obluchenija i temperatury hranenija. V ramkah programmy za odnu nedelju bylo polucheno i vypushheno 7 millionov sredizemnomorskih plodovyh muh. Byli opredeleny letal'nye dozy dlja rannih stadij razvitija jetih muh. Kartofel' letnego i zimnego urozhaja sorta ''Ap-tu-dejt'' hranilsja partijami po 40 kg v techenie 12 mesjacev pri raznyh temperaturah posle obluchenija dozami raznoj moshhnosti. Provodjatsja opyty po opredeleniju vlijanija obluchenija na zamedlenie prorastanija luka, a takzhe na zamedlenie sozrevanija bananov iz treh klimaticheskih rajonov i avokado treh sortov. Provedeny predvaritel'nye jeksperimenty na saharnoj svekle s cel'ju predotvrashhenija poter' saharozy v period mezhdu sborom urozhaja i jekstrakciej; na obezvozhennyh ovoshhah s cel'ju sokrashhenija vremeni ih prigotovlenija, na shokoladnyh izdelijah s nachinkoj s cel'ju dezinfestacii i na konservirovannom soke iz obluchennyh apel'sinov. (author)

  20. Spaziotempo la relatività ristretta

    CERN Document Server

    Sexl, Roman

    1980-01-01

    Invitato a parlare della propria vita per un volume celebrativo del suo settantesimo compleanno, Albert Einstein, sempre restio a ogni forma di pubblicità personale, invece di scrivere della sua esistenza privata scelse di rievocare gli sviluppi del suo pensiero: dalle prime curiosità all'affermarsi della vocazione giovanile, sino al riconoscimento sempre più chiaro delle mete che si prefiggeva. Un'"autobiografia scientifica", insomma, dove più dei fatti contano le rivoluzionarie formulazioni teoriche che hanno impresso una svolta fondamentale alla fisica moderna. A seguire, scienziati eminenti come Wolfgang Pauli, Max Born, Niels Bohr e Kurt Godei discutono l'"autobiografia" di Einstein facendo rivivere la grande disputa tra deterministi e indeterministi, tra la ricerca einsteiniana di una teoria del campo sempre più generale e la concezione opposta, allora sostenuta dalla maggioranza dei fisici. Infine, nella sua incisiva replica finale, Einstein risponde punto su punto ai commentatori e ai critici, di...

  1. Louis Blajan, Dottore in Medicina Veterinaria: Il dinamico veterinario che seppe traghettare l’Organizzazione Mondiale per la Sanità Animale (Office International des Épizooties: OIE nel mondo moderno

    Directory of Open Access Journals (Sweden)

    Anon.

    2010-03-01

    Full Text Available Nato il 10 aprile 1924 a Lahage (nell’Alta Garonna, in Francia, Louis Blajan si è spento lo scorso 10 febbraio 2010 a Mont-de-Marsan.Dopo aver frequentato il Lycée Pierre de Fermat di Tolosa, nel 1948 Louis completa gli studi presso la Scuola di Veterinaria di Tolosa. Nel 1949, si diploma all’Institut d’élevage et de médecine vétérinaire des pays tropicaux (IEMVT e dal 1949 al 1952 è nel territorio d’oltremare francese del Mali. Tornato in Francia, dal 1953 al 1968 Louis esercita come veterinario di Stato presso il Ministero dell’Agricoltura, responsabile per l’afta epizootica, la peste suina e la malattia di Newcastle, nonché come Presidente del Comitato consultivo per le malattie infettive. In seguito, viene nominato Ispettore capo veterinario e Responsabile per la politica di controllo delle frontiere.Nel 1952, Louis sposa Janine, moglie affezionata che lo appoggia con ardore in ogni fase della sua carriera e perde la vita in un incidente un mese prima che il marito vada in pensione nel 1990.Dal 1968 al 1977, Louis è Direttore tecnico di Cofranimex (Compagnie Française pour l’importation et l’exportation des animaux reproducteurs et leur semence e dal 1977 al 1978 riveste il ruolo di Direttore dell’Association pour le développement des techniques de l’élevage français (ADETEF.Louis entra a lavorare nell’Office International des Épizooties (oggi noto come Organizzazione Mondiale per la Sanità Animale o ‘OIE’ dove, dal 1978 al 1980, occupa la posizione di Direttore del Dipartimento tecnico. Due anni più tardi, nel 1980, viene eletto Direttore Generale, coronando il sogno di ogni professionista della medicina veterinaria e raggiungendo l’apice della propria carriera. Rieletto nel 1985, si ritira dalla vita lavorativa nel 1990.Durante gli anni in cui fu a capo dell’OIE, Louis seppe trasformare quella che all’epoca era una struttura antiquata in un’organizzazione internazionale moderna ed

  2. Analyse de l’effet du type de tâche sur l’évolution des connaissances à la suite d’un processus d’apprentissage collaboratif

    Directory of Open Access Journals (Sweden)

    Sabine Pohl

    2009-04-01

    Full Text Available L’article analyse l’effet du type de tâche sur le partage des connaissances à la suite d’un processus d’interaction dans un contexte d’apprentissage collaboratif. Cet apprentissage collaboratif est réalisé dans le cadre d’une formation universitaire. Deux types de tâches sont réalisés par les apprenants. Ils se distinguent selon que la solution nécessite ou non la confrontation de points de vue portant sur le champ conceptuel lié à l’apprentissage à réaliser. La méthode de collecte des données consiste en un entretien semi-directif. Les résultats montrent un effet du type de tâches sur l’évolution des connaissances partagées des apprenants.This longitudinal research analyses the effect of the type of task on the development of knowledge following an interaction process in a collaborative learning context. The framework for this collaborative learning is a university education. Two types of tasks are provided to the learners. They differ depending on whether or not the solution requires the comparison of points of view on the conceptual scope of what is to be learned. The data are collected through a semi-directive interview. The results show that the type of task has an effect on the development of shared knowledge.

  3. William Franke, Sulla verità poetica che è superiore alla Storia: Porfirio e la critica filosofica della letteratura William Franke, On the Poetic Truth that is Higher than History: Porphyry and the Philosophical Interpretation of Literature

    Directory of Open Access Journals (Sweden)

    Laura Lucia Rossi

    2010-06-01

    Full Text Available

    In this article we propose the translation of William Franke’s paper On the Poetic Truth that is Higher than History: Porphyry and the Philosophical Criticism of Literature, in which the American scholar presents the hermeneutic method of the ancient commentators of Homer, with particular reference to the critic practice applied by the Neoplatonic Porphyry in his De Antro Nympharum. With this treatment Franke proposes and hopes for the return to an interpretive method, called philosophical or speculative, also for contemporary criticism.

    In questo articolo è presentata la traduzione del saggio di William Franke Sulla verità poetica che è superiore alla Storia: Porfirio e la critica filosofica della letteratura, in cui lo studioso americano presenta il metodo ermeneutico degli antichi commentatori di Omero, con particolare riferimento alla critica praticata dal neoplatonico Porfirio, proponendo e auspicando il ritorno ad una modalità interpretativa, detta filosofica o speculativa, anche per la critica contemporanea.

  4. Impact of environmental pollution on the incidence of malignant neoplasms of upper respiratory tract in the population of Mysłowice, Imielin and Chełm Śląski

    Directory of Open Access Journals (Sweden)

    Jerzy Stockfisch

    2014-03-01

    Full Text Available Background. The paper presents a retrospective analysis of cases of the upper respiratory tract malignant tumors in the settlement: Mysłowice, Imielin, Chełm Śląski based on the patients’ medical history treated in a hospital laryngological ward in Mysłowice between 1995 and 2004. The inspiration to write the paper was the significant frequency of the upper respiratory tract malignant tumor cases in the main areas of Mysłowice; Piasek and Rymera estate. The aim of the study was the assessment of relationship between environmental pollution and territorial diversity in the morbidity of head and neck cancer. Material and methods. The study involved a group of 130 patients with cancer of the upper respiratory tract and a control group of 145 healthy subjects of similar age and sex, living in the different regions of the surveyed towns in the comparable proportions and in the group of patients. The paper aimed to assess the relationship between territorial diversity of the upper respiratory tract cancers, and environmental risk factors. Results. The analysis was based on environmental pollution data. It was confirmed that the geographic picture of the incidence of the upper airways malignant tumors showed that Mysłowice central districts: Piasek and estate Rymera, indicated this region to be particularly critical one. Conclusions. The increased number of morbidity cases in these districts may be associated with: environmental risk factors, increased consumption of high percentage alcohol, excessive amount of smoked cigarette and low socio-economic status of the patients.

  5. Zur chemie der marsoberfläche

    Science.gov (United States)

    Keil, Klaus; Clark, Benton C.; Baird, A.K.; Toulmin, Priestley; Rose, Harry J.

    1978-01-01

    Analyses of 13 samples of Martian surface materials with the Viking X-ray fluorescence spectrometers show SiO2 similar to that of terrestrial mafic rocks, whereas Fe2O3, Cl, and S are higher and Al2O3, K2O, Rb, Sr, Y, and Zr are lower. Low totals suggest presence of CO2, H2O, and Na2O. Duricrust fragments are higher in S than fines, but samples from both landing sites are surprisingly similar. We suggest that Martian surface materials are aeolian deposits of complex mixtures of weathering products of maficultramafic rocks, possibly consisting of iron-rich clays, sulfates, iron oxides, carbonates, and chlorides.

  6. La nuova fisica che ci aspetta

    CERN Multimedia

    Shiga, David

    2007-01-01

    The big accelerator that will enter in function at CERN at the end of the year will have the hard task to verify the relevance of the string theory, today the better candiddate to be the famous "theory of everything" that physicists are looking for since decades. (1 page)

  7. Using Screencasts in ChE Courses

    Science.gov (United States)

    Falconer, John L.; deGrazia, Janet; Medlin, J. Will; Holmberg, Michael P.

    2009-01-01

    Screencasts are digital recordings of the output from a computer monitor, including narration. Their use was piloted in five chemical engineering courses and the feedback from students was overwhelmingly positive. The screencasts were produced on Tablet PCs using Camtasia Studio software and were posted to the Blackboard classroom management…

  8. Illustrations to “Gespräche in dem Reiche derer Todten zwischen dem vortreflichen Moscowitischen Czaar Petro Magno und dem grossen Tyrannen Ivan Basilowiz II” (Peter the Great and Ivan the Terrible by David Fassmann (1725

    Directory of Open Access Journals (Sweden)

    Ekaterina A. Skvortcova

    2017-12-01

    Full Text Available The journal created by David Fassmann (1683–1744, Gespräche in dem Reiche derer Todten, edited in Leipzig, was a huge success. Each of the 240 issues presents a dialogue between two historical figures from the afterworld. In the 83rd–86th Entrevuë, the interlocutors are Peter the Great and Ivan the Terrible. The texts of the four conversations were thoroughly examined by Eckhard Matthes (1987. The present paper explores how the illustrations to the 83rd–86th Entrevuë visualize the texts, which is significant as they were an important instrument for disseminating certain notions about Russia. While the illustration to the first dialogue of the suite juxtaposes Peter and Ivan, the illustration to the second one emphasizes the similarities between them. So the image of the “tyrant” and “barbarian” Ivan becomes a reference point with which a reader is urged to compare Peter’s deeds, seeing not only the differences but also the similarities. This greatly contributes to the creation of the multifaceted image of Russia of the early 18th century. The characters of the second illustration—a tiger and an executioner—can be identified as Ivan and Peter only if the reader takes into consideration an epigram to the illustration, the illustration to the previous dialogue, the text of the next Entrevuë, and facts about the execution of the strel’tsy known from other texts and images, about which Fassmann remains silent in the spirit of ars dissimulandi, which was typical for baroque culture. The paper offers an attempt to trace the iconography of the tyrant as a tiger. In the frontispiece to the 85th Entrevuë, a secretary bringing news from the world of the living and a portrait of Catherine I emphasize the connection of the past and the present, i.e., history and policy. Finally, the illustration to the last dialogue of the series returns to the glorification of Peter the Great declared in the first dialogue.

  9. A Comprehensive Model of the Dry Desulphurisation Process Une modélisation non empirique du procédé de désulfuration par voie sèche

    Directory of Open Access Journals (Sweden)

    Flament P.

    2006-11-01

    humide des fumées, le procédé de désulfuration par voie sèche reste un moyen attractif pour éliminer le dioxyde de soufre lorsque le taux de réduction souhaité ne dépasse pas 90 %. Dans cette technique, l'élimination du SO2 se fait en injectant directement dans les produits de combustion de très fines particules d'un absorbant calcique tel que le calcaire (CaCO3 ou la chaux (Ca(OH². L'absorbant est tout d'abord transformé en oxyde de calcium (CaO avant de réagir avec le SO2 pour former un composé stable : le sulfate de calcium (CaSO4. Bien que les réactions globales soient extrêmement simples, une description complète des mécanismes nécessite de connaître à la fois, les propriétés physiques initiales de l'absorbant et leur évolution durant la réaction. De plus, les conditions d'injection des particules jouent un rôle prépondérant dans le procédé de désulfuration par voie sèche. Tous ces aspects sont traités dans ce papier. Le modèle de désulfuration a d'abord été testé seul par comparaison avec les données cinétiques de la Fondation Internationale de Recherches sur les Flammes (FRIF, puis, couplé avec le code KIVA, il a été utilisé pour simuler la désulfuration dans un nouveau type de chaudière développée par Babcock Entreprise et l'Institut Français du Pétrole (chaudière 'AUDE'. Dans ce dernier cas, l'objectif poursuivi était de déterminer la meilleure configuration à donner au système d'injection des particules pour obtenir un taux de désulfuration maximum. La dispersion des particules étant un paramètre important du procédé de désulfuration, un exemple de validation du modèle de dispersion est également traité. L'injection de particules dans une couche de mélange a été choisie comme cas test. L'accord entre les valeurs expérimentales de Ando et al. (1990 et les calculs effectués avec KIVA est satisfaisant.

  10. La spirale dell’azzardo: una subcultura del gioco che “evapora” le relazioni / La spirale du jeu de hasard : une sous-culture qui empêche toute relation / The gambling: a subculture of game that “burns” the relationships

    Directory of Open Access Journals (Sweden)

    Molin Valentina

    2011-07-01

    Full Text Available In this paper I have analysed the characteristics of what I define the “gambling subculture”, which is detectable in certain gaming environments and in subgroups of particularly “rabid” players. Within these subcultures there have been identified rules and sanctions, values, consolidate behaviours, characterization of relationships and interactions, and the conclusion is that what is built within the gambling environment is a separate universe, an “outer reality”, in which the values of the world “outside” change. It was also possible to conclude that, to join the gambling world for a gambler – learning its rules, sharing its values, developing relations inside it – represents a stimulus for gambling habits, as it allows to consider as “normal” their behaviour thanks to positive feedback from their groups of fellow players, and to the neutralization of possible negative feedback from “non-players”.Nel presente contributo vengono analizzate le caratteristiche di quella che ho definito “subcultura dell'azzardo”, rilevabile in determinati ambienti ludici e in sotto-gruppi di giocatori particolarmente “accaniti”. Di queste forme di subcultura sono state individuate norme e sanzioni, valori, comportamenti consolidati, caratterizzazione delle relazioni e delle interazioni, giungendo alla conclusione che quello che viene costruito negli spazi di gioco rappresenta un universo separato, un “extraluogo”, nel quale vengono scritte nuove regole e nel quale cambiano i valori rispetto al mondo “esterno”. È stato possibile inoltre concludere che l'adesione all'“universo gioco” – l'interiorizzazione delle sue norme, la condivisione dei suoi valori, lo sviluppo di relazioni al suo interno – rappresenta un fattore di mantenimento della condotta ludica, poiché permette di considerare “normale” il proprio comportamento grazie ai rinforzi positivi che giungono dal gruppo dei compagni-giocatori e alla

  11. La normativa italiana sui contratti di lavoro a tempo determinato nel settore della scuola è contraria al diritto dell’Unione: la Corte di Giustizia UE apre al risarcimento per i docenti che abbiano svolto supplenze annuali per la copertura di posti vacanti

    Directory of Open Access Journals (Sweden)

    Arando Plaia

    2015-01-01

    Full Text Available La Corte di Giustizia UE con sentenza 26 novembre 2014, cause riunite C-22/13, C-61/13, C-62/13, C-63/13, C-418/13, Mascolo, ha ritenuto che la normativa europea sul lavoro a tempo determinato, applicabile anche al settore pubblico della scuola (casi Rosado Santana, Marrosu Sardino e Adelener, osta ad un sistema di assunzione per svolgere “supplenze annuali” nelle scuole pubbliche che non prevede almeno una delle seguenti “misure di prevenzione”: l’indicazione delle “ragioni oggettive” che giustificano il rinnovo dei contratti; la determinazione della “durata massima totale dei contratti” o del “numero dei loro rinnovi”, in assenza peraltro di una misura sanzionatoria proporzionata, effettiva e dissuasiva, da applicarsi in caso di utilizzo abusivo di successione di contratti a tempo determinato (clausola 5 dell’accordo quadro 18 marzo 1999 allegato dir. 1999/70/CE. Sebbene dunque il settore dell’insegnamento implichi inevitabilmente una certa “flessibilità”, e la normativa europea non enunci un obbligo generale degli Stati membri di prevedere la sanzione della trasformazione dei contratti di lavoro a tempo determinato in contratti a tempo indeterminato (CGUE 3 luglio 2014, Fiamingo, causa C-362/13, la normativa italiana non prevede misure atte a “prevenire” o “sanzionare” l’utilizzo abusivo di successione di contratti a tempo determinato. Questo (e non altro il principio di diritto affermato dalla Corte di giustizia: la sentenza ribadisce l’assenza di misure di prevenzione imposte dalla disciplina europea nonché di una sanzione risarcitoria rispetto al ricorso abusivo ai contratti a tempo determinato nel settore scolastico.

  12. Doutorado-sanduíche em enfermagem: relato de experiência Doctorado sándwich en enfermería: relato de experiencia Sandwich doctoral program in nursing: an experience report

    Directory of Open Access Journals (Sweden)

    Rosane Arruda Dantas

    2009-06-01

    Full Text Available Relato de experiência acerca de estágio de doutorando-sanduíche realizado com bolsa da Coordenação de Aperfeiçoamento de Pessoal de Nível Superior, durante o período de outubro de 2005 a janeiro de 2006, na Faculdade de Enfermagem de D. Ana Guedes, no Porto, em Portugal, instituição já visitada na graduação. Tive a oportunidade de replicar a metodologia de parte da dissertação com crianças portuguesas. Isso permitiu estudo comparativo entre duas culturas que guardam afinidades, mas têm características distintas. Além disso, ministrei aulas, participei de cursos e seminários e aprofundei os conhecimentos acerca da Teoria da Universalidade e Diversidade do Cuidado Cultural. Considero que esta experiência é um estímulo para a garantia da autonomia do enfermeiro na assistência de enfermagem, como pesquisador e docente, ampliando conhecimentos e os inserindo no processo de cuidado. Ademais, influencia positivamente no amadurecimento psicológico, cultural e social do doutorando.Relato de experiencia acerca de pasantía de doctorado sándwich realizado con suporte financiero de la Coordinación de Mejora del Personal del Nivel Superior, durante el período de octubre de 2005 a enero de 2006, en la Facultad de Enfermería de D. Ana Guedes, en Porto, Portugal, institución ya visitada durante la graduación. Tuve la oportunidad de replicar la metodología de parte de la disertación junto a niños portugueses. Esto permitió un estudio comparativo entre dos culturas que guardan afinidades, pero tienen características distintas. Además, ministré clases, participé de cursos y seminarios y me profundicé en los conocimientos acerca de la Teoría de la Universalidad y Diversidad del Cuidado Cultural. Considero que esta experiencia es un estímulo para la garantía de la autonomía del enfermero en la atención de enfermería, como investigadora y docente, ampliando conocimientos e insertándolos en el proceso de cuidado. Adem

  13. Variations autour de la tâche dans l'enseignement / apprentissage des langues aujourd'hui What kind of tasks are used for L2 teaching and learning today?

    Directory of Open Access Journals (Sweden)

    Elke Nissen

    2011-10-01

    Full Text Available Cet article se donne pour objectif d'identifier les types de tâches, et leurs dénominateurs communs, qui sont présentés aujourd'hui – où "l'approche par les tâches" est soutenue par le Conseil de l'Europe – aux apprenants. Il analyse pour cela les articles issus de deux numéros de revues et un ouvrage collectif récents. Il apparaît que la grande majorité des scénarios pédagogiques s'y inscrit dans la perspective actionnelle... du moins d'après la déclaration des auteurs, car leur définition de ce qu'est une tâche ne correspond pas toujours à celle du CECR. Pour le public visé, étudiants ou professionnels, on propose le plus souvent des mono-tâches, mais également des projets, ou encore des simulations avec un enchaînement de plusieurs tâches. Elles s'inscrivent généralement dans la (future réalité sociale des apprenants, mais certaines laissent également la place à des thèmes artistiques ou (interculturels. Contrairement à ce que l'on aurait pu attendre dans une démarche qui responsabilise l'apprenant, le recours à Internet n'est pas toujours systématique.At a time when action- and task-based learning is sustained by the European Council, this paper explores which types of tasks are given to second language learners today and what aspects these tasks have in common. The paper analyses two recent issues of scientific journals and one collective book. The analysis shows that the majority of pedagogical scenarios described in these texts claim to adopt an action- and task-based approach. However, in reality the way they define a task does not always correspond to the definition given by the European Framework of Reference for Languages. The described tasks are exclusively dedicated to higher and professional education; they are mostly single tasks, but they can also be projects and simulations including several successive tasks. They generally correspond to the learners' (future reality, with themes that are

  14. Approche multidimensionnelle de la difficulté objective dans une tâche d’anticipation coï ncidence Multidimensional approach of objective difficulty in an aiming task

    Directory of Open Access Journals (Sweden)

    P. Deneuve

    2010-09-01

    Full Text Available

     

    Cet article a pour objet de proposer une nouvelle procédure pour classer les tâches motrices à caractère informationnel à partir d’une approche multidimensionnelle de la difficulté. L’expérimentation a consisté à faire passer des tests de pointage à 345 sujets sur cibles mobiles créées et gérées par ordinateur. Les paramètres des cibles ont été choisis pour leur indépendance et la possibilité de les positionner sur des échelles numériques. Trois descripteurs ont été retenus : la vitesse de déplacement, la surface de la cible et l’incertitude spatiale. La performance ne semblant pas être la seule variable dépendante résumant la difficulté, il lui a été adjoint trois autres variables : les tentatives, le temps de réaction et le temps moteur. En utilisant des outils statistiques permettant des analyses de données multidimensionnelles (CAH, AFC, il a été possible soit d’agréger des tâches aux profils identiques soit de les différencier en fonction du poids de chaque descripteur sur les variables dépendantes. Surtout, il est envisageable de préciser l’apport de chaque variable dans la définition de la difficulté que se donne a posteriori le chercheur.
    PALABRAS CLAVE: Difficulté, traitement de l’information, tâche motrice, classification, analyse de données.

    This article deals with a new method to classify informational motor tasks, through a multidimensional approach of difficulty. The following experiment is used: 345 subjects are asked to point at computer-managed mobile targets. The 3 selected target parameters are: velocity, area and spatial uncertainty. Independence and numerical scalability are the reasons for this choice. As performance does not sump up difficulty, other dependent variables have been added: number of attempts, reaction time and motor time. The use of

  15. Aree Protette del Po e della Collina Torinese: studi propedeutici alla Candidatura MAB - Man and the Biosphere

    Directory of Open Access Journals (Sweden)

    Cimnaghi Elisabetta

    2014-03-01

    Full Text Available Il programma MAB fu lanciato dall’UNESCO negli anni ’70 al fine di migliorare il rapporto tra uomo e ambiente. Negli anni il programma ha portato al riconoscimento di Riserve della Biosfera che gli Stati Membri si impegnano a gestire nella prospettiva della conservazione delle risorse. L’Organismo Gestore dell’Area Protetta, partendo, da un lato, dalla consapevolezza della ricchezza ambientale che caratterizza il suo territorio e, dall’altro, del contesto di sviluppo antropico elevato in cui essa è situata, ha riconosciuto nel programma MAB un’opportunità per incrementare le sue attività di protezione e potenziamento delle risorse. Questo articolo descrive i primi risultati ottenuti negli studi preliminari per la Designazione al MAB, con particolare attenzione sia alle opportunità di implementazione di progetti legati al marchio “Collina Po”, creato dall’Organo di Gestione del Parco, si ain termini di scambio di ‘best practices’ con altre Riserve di Biosfera.

  16. Le basi neurali delle funzioni cognitive di alto livello: un programma possibile?

    Directory of Open Access Journals (Sweden)

    Stefano F. Cappa

    2014-07-01

    Full Text Available The technological developments of the methods of neuroimaging and, in particular, of the new methods of analysis of the dates based on the analysis of functional integration, allow to examine the most complex aspects of brain’s working, by avoiding the risk of a “neofrenology”. The most recent studies deal with aspect of brain’s working that are traditionally considered out of the neurosciences, such as the economic decision, the moral choices and the esthetic experience.   

  17. Evaluation of the industrial programs of NOVEM. Evaluatie industriele programma's NOVEM

    Energy Technology Data Exchange (ETDEWEB)

    Koster, S J; Rademaker, B; Braun, A R; Gerritse, G

    1989-01-01

    The title subject has been evaluated by INDIS (Dutch Bureau for Industrial and Professional Investigations) in order to analyse the demand of the target group and to collect data for the product/market strategical part of the long-range planning for 1989-1993 and 1994-1998. INDIS collected data from 20 interviews with policy-making managers from industrial companies, and 9 interviews with consultancy bureaus, engineering bureaus, contractors, business organizations and the government. These data were supplemented by a literature search. The effectiveness of the NOVEM (Netherlands Agency for Energy and the Environment) has been investigated with regard to the possibilities of developed technologies. This investigation was done by Braun Technoconsult. Conclusions and recommendations are given with regard to energy and environmental projects, the roles of the government, the umbrella organizations and the NOVEM and finally the effectivity of the applicated tools (information, counseling, demonstrations, financing, etc.).

  18. Programma Conoscenza: Psycho-Educational, Integrated and Evolved Treatment for Cocaine Addiction

    Science.gov (United States)

    Leonardi, Andrea; Fioravanti, Paolo; Scavelli, Sonia; Velicogna, Francesco

    2009-01-01

    The 2005 EMCDDA (European Monitoring Centre for Drugs and Drug Addiction, Annual report 2005: the state of the drugs problem in Europe, from http://ar2005.emcdda.europa.eu/en/home-en.html?CFID=5556438&CFTOKEN=9393b63b806e64c7-FB015A79-E157-F9DE-99626FADD9F4C983&jsessionid=2e30185a01447c413a1e) annual report remarks the dearth of options…

  19. Effect 5e Nitraat Actie Programma op de bodembelasting. Berekening bodembelasting voor berekening van de waterkwaliteit

    NARCIS (Netherlands)

    Koeijer, de T.J.; Luesink, H.H.

    2015-01-01

    Uit de MAMBO-berekeningen blijkt dat door invoering van het 5e NAP het gebruik van dierlijke mest op zandgrond daalt. De grootste daling treedt in het zuidelijk zandgebied op. Daarnaast treedt er een verschuiving op van de aanwending van varkensmest naar graasdiermest. Dit komt door de aanscherping

  20. Programma's voor levensvaardigheden op school : achtergronden, ontwikkeling en evaluatie van onderwijs in sociale en emotionele vaardigheden

    NARCIS (Netherlands)

    Gravesteijn, J.C.

    2010-01-01

    The thesis ‘ Skills for Life programs in school’ treats the theoretical foundations, design and evaluation of school-based Skills for Life programs, aimed at promoting social and emotional skills in children and adolescents. More specifically, the formation and development iterations of a Dutch

  1. Rabotshaja sila, gossudarstvennõi sektor i programma promõshlennogo razvitija / Eteri Kekelidze

    Index Scriptorium Estoniae

    Kekelidze, Eteri, 1944-

    2007-01-01

    Tööandjate Keskliidu juhatuse esimehe Enn Veskimägi arvamusi tööjõust, riiklikust sektorist ja tööstuse arenguprogrammist. Tööandjate keskliidu pöördumisest vabariigi valitsuse poole, milles juhitakse tähelepanu riigi majanduse ees seisvatele probleemidele. Vt. samas: Eesti eksport 2005-2007 esimene pool

  2. ALTERNER programme for 1995 and planning for 1996; Programma ALTENER consuntivo 1995 e pianificazione 1996

    Energy Technology Data Exchange (ETDEWEB)

    Crea, C [Ministero dell` Industria, Commercio e Artigianato, Rome (Italy); Ricci, A; Tarquini, P; Gerardi, V; La Motta, S [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dip. Energia

    1995-12-01

    This report concerns the main results, some considerations and analysis on the outcome of Altener Programme for 1995 and information on the necessary formalities for participating to the Programme 1996. Particularly it will be reported the distribution of accepted proposals and relative awarded contributions for each Member States, a critical analysis on the contents of the accepted and financed proposals in relation to indications given by guidelines 1995 and to different energy sources. Further a synthetic description of Italian accepted proposals is reported and at last new Guidelines for the Altener 96 participation are reported.

  3. Il programma di radicale naturalizzazione della mente. Note su alcuni assunti concettuali

    Directory of Open Access Journals (Sweden)

    Aldo Stella

    2014-12-01

    Full Text Available The Project of a Radical Naturalization of Mind. Remarks on Some Conceptual Assumptions - In this paper we address the program of the radical naturalization of the mind and, in particular, the materialist monism perspective which is the product of that program. Our aim is to identify the fundamental assumptions on which the program is based. The first assumption we recognize and critically discuss concerns the correspondentist conception of truth. A second assumption is related to the view that the study of the mind consists solely in the identification of causal relations and laws that govern mechanical processes, while the only investigations that can be considered scientific are those which are based on the principle of the closure of the physical world. In conclusion, we show that the most significant assumption of this program is the negation of subjectivity and consciousness, which are reduced to unconscious, non-intelligent processes. The problem we identify with respect to this reduction is that the fundamental distinction between empirical conditions and the conditions of intelligibility is disregarded.

  4. Vraaggestuurd Programma 2012-2014. Voortgangsrapportage 2013, VP Security, Thema VII High Tech Systemen en Materialen

    NARCIS (Netherlands)

    Don, J.A.

    2014-01-01

    De roadmap Security voor topsector High Tech Systems & Materials wordt gedragen door een breed consortium van bedrijven, overheden, TNO, NLR en STW/NWO (zie www.htsm.nl). Onder regie van het roadmapteam Security is het plan 2013 voor TNO-Vraaggestuurd Onderzoeksprogramma Security 2012-2014 opgesteld

  5. Studie ten behoeve van het programma "Hergebruik van Bouwmaterialen" voor de Stimuleringsregeling Milieutechnologie

    NARCIS (Netherlands)

    Lijzen JPA; Soczo ER; Kamphuis C; LAE

    1994-01-01

    The study is aimed at short and middle-term solutions for separation, handling and processing of waste from the building sector for the purpose of reuse. Qualitative and quantitative preventive measures also receive attention. In view of the large scope of this subject, the development of

  6. Programma podgotovki spetsialistov v oblasti obucheniya bol'nykh sakharnym diabetom

    Directory of Open Access Journals (Sweden)

    Ivan Ivanovich Dedov

    2003-03-01

    Full Text Available Группа исследований в области обучения больных диабетом ? Diabetes Education Study Group (DESG ? функционирует в рамках Европейской ассоциации по изучению диабета ? European Association for the Study of Diabetes (EASD. Она была создана в 1979 г. с целью разработки системы обучения больных диабетом и подготовки медицинских кадров в этой области. Президентом DESG долгие годы был профессор Женевского университета Ж.-Ф. Ассаль, предложивший основные идеи терапевтического обучения больных хроническими заболеваниями. В настоящее время DESG возглавляет профессор А. Мальдонато (Италия. В состав Координационного комитета DESG входят по 2 представителя от каждой страны, в том числе от России. Координатором международной программы подготовки специалистов в области обучения больных диабетом от России является академик РАМН И.И. Дедов. С момента создания фонд исследований DESG поддерживает фар? мацевтическая компания Сервье.

  7. PUMS E ITS: LE STRATEGIE DEL PROGRAMMA UE HORIZON2020 PER UNA MOBILITA' "SMART"

    Directory of Open Access Journals (Sweden)

    Claudio Zavaglia

    2016-06-01

    Full Text Available Nowadays, the need to develop and boost new forms of sustainable urban mobility to replace urban transport is a key iusse, addressed by European Commission with a big effort in terms of research, strategies and initiatives. In this context, two relevant instruments identified to reach this goal are integrated planning at all the mobility levels and its management. The former may be realized through the processing of PUMS (Urban Plan of Sustainable Mobility, while the latter through Intelligent Transport Systems (ITS. Among the other sustainable transport services, car sharing is expected to become efficient and is expected to limit the use of private cars, thus facilitating multi-modal for public transports. The present text deals with a presentation of the state-of.art practices in terms of car sharing, particularly referring to the case of Turin.

  8. Doutorado sanduíche: considerações para uma experiência de sucesso no exterior Doctorado sándwich: consideraciones para una experiencia exitosa en el extranjero 'Sandwich PhD': considerations for a successful experience abroad

    Directory of Open Access Journals (Sweden)

    Marina de Goes Salvetti

    2013-03-01

    Full Text Available O estágio de doutorado no exterior, conhecido, no Brasil, como "Doutorado Sanduíche", é uma oportunidade de aprimorar as habilidades em pesquisa, destacar-se no meio acadêmico e estabelecer e/ou ampliar oportunidades de trabalho em contexto internacional. Neste artigo, descrevemos elementos-chave do processo de planejamento e desenvolvimento do Doutorado Sanduíche aprendidos por professores e alunos envolvidos na colaboração entre a Escola de Enfermagem da Universidade de São Paulo e a Lawrence S. Bloomberg Faculty of Nursing, Universidade de Toronto, Canadá, e apresentamos a participação em uma rede de doutorados, como alternativa ao Doutorado Sanduíche. A experiência internacional, quando bem planejada e desenvolvida, promove o desenvolvimento pessoal e profissional do aluno, favorece a internacionalização dos programas de pós-graduação e dos grupos de pesquisa brasileiros.Una estancia de doctorado internacional, "Doctorado Sándwich" como es conocido en Brasil, es una oportunidad de mejorar las habilidades de investigación, hacerse conocido académicamente y establecer y/o agrandar las oportunidades de trabajo en el contexto internacional. En este artículo, nosotros describimos factores importantes del proceso de la planificación y desarrollo del "Doctorado Sándwich" aprendidos por estudiantes y profesores involucrados en la colaboración entre la Escuela de Enfermería de la Universidad de São Paulo y la Facultad de Enfermería Lawrence S. Bloomberg, Universidad de Toronto, Canadá y presentamos la participación en una red de doctorados como una alternativa a la estancia doctoral internacional. La experiencia internacional, cuando bien planeada y desarrollada, promueve el desarrollo personal y profesional del estudiante y favorece la internacionalización de los programas de postgrado y de los grupos de investigación brasileños.International PhD internship, named "Sandwich PhD'" in Brazil, is an opportunity to

  9. Crescere errando: minori immigrati non accompagnati" (Clara Silva - Giovanna Campani

    Directory of Open Access Journals (Sweden)

    Olivia Salimbeni

    2005-12-01

    Full Text Available La presenza in Italia di minori immigrati non accompagnati è un fenomeno recente e tuttavia in forte crescita. Questo testo raccoglie i risultati di quella che potremmo definire la seconda di tre tappe di una ricerca europea incentrata sullo studio del fenomeno dei minori immigrati non accompagnati, avviata nel 2000 e da poco terminata. L’indagine è stata svolta nel quadro di finanziamento del 'Programma Daphne' della Commissione Europea e ha riguardato nelle prime due fasi tre realtà europee, Italia, Germania e Finlandia e nella terza altre realtà quali il Portogallo, la Spagna, la Francia e la Grecia.

  10. Diciotto uova per una crème caramel. La telepolitica come socievolezza

    OpenAIRE

    Nedelmann, Birgitta

    2017-01-01

    1. Introduzione All’inizio di settembre 1996 il radio-giornale informava la nazione tedesca che «il cancelliere Kohl usa diciotto uova per una crème caramel». Era una informazione tratta da un talkshow con il cancelliere, diretto da Alfred Biolek, conosciuto al pubblico tedesco anche per la sua capacità di cuoco televisivo, e trasmesso nel primo programma della televisione tedesca pochi giorni dopo, l’11 settembre 1996. L’intervista faceva scandalo in Germania. Ma non era il cancelliere a com...

  11. Dicty_cDB: CHE694 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KLLTEKHIALNVKEDGLDWLADQGYDPIYGARPLKRVIQKXRIKSNGKTNT *r*n*rsxxcynxlrinqkxn*klqvnkik Translated Amino Acid seq...ANXPDNTPSATAREEVMGVVRSRFPPEFLNRIDDMILFNRLXRKDMDKI VEIQLXDLRKLLTEKHIALNVKEDGLDWLADQGYDPIYGARPLKRVIQKXRIKSNGKTNT *r*n*rsxxc

  12. Che cos'è la conoscenza? un universo in espansione

    CERN Document Server

    Franceschini, Guiliano

    2017-01-01

    Il testo propone un viaggio nell'universo della conoscenza, tra le galassie di conoscenza (religione, scienza, arte), nel cervello (percezione, apprendimento, memoria) e nell'etica (dalla conoscenza all'educazione). Le argomentazioni si espandono attraverso un registro comunicativo intuitivo, tra divulgazione e speculazione, attraverso esempi e riferimenti concreti, rivolgendosi in alcuni casi direttamente al lettore.

  13. Dicty_cDB: CHE829 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dsl**sx*frlw*rf*m*n*t*wfpmlcpfrkttpttt*xm**xmpxrp*m* s*stckrmmrccp*tttxmxfkmsxkt*m*sxplx*rmlcxxxpr*mfixmsxrp...xm*s* stwkrmxrccp*ttxkmxixmsxkt*m*nqsxw*rmlc*kxx*lf Frame B: lfnfifnhsn*kknnn*ls*

  14. Dicty_cDB: CHE174 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available stallinum mRNA for putative vacuolar ATPase subunit 100 kDa subunit (vpha-a gene). 46 1e-10 4 CV164410 |CV164410.1 rsmsx...54 8e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Library of Salvia mil

  15. Pragmatic Idealism: Ernesto Che Guevaras Strategic Choice for Bolivia

    Science.gov (United States)

    2017-06-01

    security could be achieved through a more mature guerrilla movement. B. LITERATURE REVIEW A review of previous analysis and criticism regarding...was, he split his time prior to Bolivia between Tanzania and Czechoslovakia.24 Whether Guevara spent the majority of his time nursing the emotional ...believed it rational to pursue revolution prior to the maturation of a revolutionary movement as long as the objective

  16. Che fatica far festa all’Odin Teatret!

    DEFF Research Database (Denmark)

    Chemi, Tatiana

    2004-01-01

    A report of the many activities, planned to celebrate a unique birthday: the one of a theatre group existing for 40 years. A piece of history of contemporary theatre is going to show its past, its present and its future. With a synoptic table for the activities in Denmark.......A report of the many activities, planned to celebrate a unique birthday: the one of a theatre group existing for 40 years. A piece of history of contemporary theatre is going to show its past, its present and its future. With a synoptic table for the activities in Denmark....

  17. Dicty_cDB: CHE366 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce update 2002. 9.10 Translated Amino Acid sequence ---xxxxxxxxnfxxxxxxxxxxxlxsxrxxxxxkxvkxxxxxkxgxxxxxxxx...xxxxg* TIXKXVXXFXXYNIXXXSXXXLVLRLXGGMQXFVKTXXGKTITLEVEGXDNIENVKXKIQ DKEGIPPDQQRXIFX...MQIFVKTLTGKTITLEVEGSDNIENVX Translated Amino Acid sequence (All Frames) Frame A: ---xxxxxxgxxfxxxxxxgxxxx...fxkxkxxxxxxxcxxxxxxxxrxxxxxxxxxxfxwv nnxkxgxxxxgx*hxkxixxpxsfkixrwyanxc*nxxw*nnhfrs*...tirrwsysf*lqyskrihspfsfkikr wyanlc*nshw*nnhfrs*rf**h*kcx Frame B: ---xxxxxxxxnfxxxxxxxxxxxlxsxrxxxxx

  18. Le sfide che i figli degli immigrati devono affrontare

    Directory of Open Access Journals (Sweden)

    Sandra Sicurella

    2015-05-01

    Full Text Available Economic changes, poverty, wars, violence and socio-political conditions generated waves of migrants that irreversibly affect the daily lives in our country too. Children of migrants are requested to face many difficulties which are transformed into challenges on a daily basis in order to assert a position in the host society. The number of admissions of foreign children is constantly growing and often the culture clash may lead to exclusion. This is an extremely difficult situation, especially for children who sometimes do not have the adequate tools to deal with this.

  19. Einstein: I cento anni che sconvolsero il mondo

    CERN Multimedia

    Di Giorgio, Claudia

    2005-01-01

    In 1905, the german physicist published five articles about relativity, a theory which changed for ever our knowledge and our life. This beginning year will be "the mondial Year of Physcis" and the physics Community celebrate the Nobel Prize (⅓ page)

  20. Le parole che noi usiamo: l’errore in storia

    Directory of Open Access Journals (Sweden)

    Aurelio Musi

    2017-04-01

    Full Text Available Unlike the hard sciences, historiography lacks a specific nomenclature. The lexicon employed by historians is drawn from the plain language of everyday life. Therefore, the words of history are to be defined within the spatio-temporal framework, and to be construed through processes of contextualization and comparison. My work here stems from these considerations, and attempts to chart the occurrence of errors in historiography. In particular, I take into account the way in which historiographic mistakes arise from the intermingling of words, space, and historical time. Another significant aspect concerns the relationship between history, fiction, and arbitrariness. The latter concept is linked to historical interpretation, which constitutes the last stage of historiographical work, after the analysis and the reconstruction of events. The last part of this paper offers a typology of frequent errors in historiography.

  1. Dicty_cDB: CHE216 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TNTTTAGTTCAATTGCAAACTTTATAANACCTATATTAATCTA TTTGAAATCGATTCAATTTAGAAGAGGTCATANAAAAATGACCCCAGAACANCNACNAAT CCT...ATAANACCTATATTAATCTA TTTGAAATCGATTCAATTTAGAAGAGGTCATANAAAAATGACCCCAGAACANCNACNAAT CCTTAAAACTTTAGNTGCCGAAACTA

  2. Il derubato che sorride. La tragedia umoristica di Pasolini

    Directory of Open Access Journals (Sweden)

    Stefano Casi

    2017-02-01

    Full Text Available In the studies about Pasolini’s work the analysis of the use of comedy and humor is often ignored. This article analyzes the relationship of Pasolini with the forms of comedy, from the indication of Charlot as emblematic point of reference for his own intellectual commitment to the development of an original meaning of the concept of humor. By analyzing statements and plays, a new aspect of Pasolini comes to light. In a conscious and tormented way, Pasolini adheres to humor as the main means of the bourgeoisie, entrusting to it much of its work in the last decade of his life. For Pasolini humor is the communication code of the bourgeoisie, that bourgeoisie uses to distance itself from reality. Thus, by using humor as alienating weapon inside the form-tragedy, Pasolini plans to fight bourgeoisie, challenging it on the ground of the theatrical representation of reality, through its own communication means.

  3. Integrating the ChE Curriculum via a Recurring Laboratory

    Science.gov (United States)

    Kubilius, Matthew B.; Tu, Raymond S.; Anderson, Ryan

    2014-01-01

    A recurring framework has been integrated throughout the curriculum via a Continuously Stirred Tank Reactor (CSTR) platform. This laboratory is introduced during the material and energy balance course, and subsequent courses can use these results when explaining more advanced concepts. Further, this laboratory gives students practical experience…

  4. Dicty_cDB: CHE818 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 8.1 Habrotrocha constricta 82 kDa heat shock protein 2 (hsp82-2) gene, partial cds. 88 3e-48 4 AF143854 |AF143854.1 Sinantherina soci...alis 82 kD heat shock protein (hsp82) gene, partial cds.

  5. CHE COSA RESTA DI CHERUBINI OGGI? DUE CASI DI STUDIO

    Directory of Open Access Journals (Sweden)

    Emanuele Miola

    2016-09-01

    Full Text Available A partire dagli anni Duemila, il fenomeno delle cosiddette risorgenze dialettali si è manifestato, nel panorama linguistico italiano, anche attraverso l’emergenza dei dialetti negli ambiti propri della Comunicazione Mediata dal Computer e, specialmente, sui siti internet creati ‘dal basso’, come l’enciclopedia libera e multilingue online Wikipedia. In questo articolo, si esaminerà il lascito di Cherubini e del suo Vocabolario milanese-italiano sull’edizione regionale lombarda della Wikipedia: gli articoli di quest’ultima saranno passati in rassegna, sia dal punto di vista ortografico, comparando le scelte del lessicografo milanese con quelle più in voga online, sia dal punto di vista morfo-sintattico, discutendo in questo secondo caso la presenza e la produttività di alcuni verbi sintagmatici. What remains of Cherubini today? Two case studies Since the beginning of the twenty-first century, the phenomenon of dialect resurgence has manifested in Italy through the emergence of dialects in Computer Mediated Communication, especially, on bottom-up created Web sites, like the free, multilingual, online encyclopedia Wikipedia. In this article, we will examine the legacy of Cherubini and his Milanese-Italian dictionary on the regional Lombard version of Wikipedia. We will review the articles both in terms of spelling, comparing the choices of Milanese lexicographer with those most utilized currently online, and from a morpho-syntactic point of view, discussing the presence and the productivity of some phrasal verbs.

  6. P. RICOEUR: UN’ANTROPOLOGIA CHE NON ESCLUDE IL FONDAMENTO

    Directory of Open Access Journals (Sweden)

    Attilio Danese

    2013-08-01

    Full Text Available A filosofia de Paul Ricoeur estáligada a uma exigência filosofica de não exclusão das inquietações que dizem respeito ao sentido do agir e do viver, demonstrando o laço indissolúvel entre antropologia, filosofia e busca das verdades últimas que dão sentido ao viver.

  7. Dicty_cDB: CHE850 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DILFNGI EYQCKGWISGFTKCDWKGDSIER--- ---ESLEGNMIENQYITLKTQTHST**r*csl*nlgrlccq*sr*ti*nqylcsrysft* ere*k*tfhslgkr*e*itlmaw**vn*frid...---ESLEGNMIENQYITLKTQTHST**r*csl*nlgrlccq*sr*ti*nqylcsrysft* ere*k*tfhslgkr*e*itlmaw**vn*fridclagikncsticskn

  8. LES VIBRIONS DANS LES PRODUITS DE LA PÊCHE

    African Journals Online (AJOL)

    PC_WINDOWS

    Santé Publique (ENSP) à Rennes et le Centre National de Référence des vibrions et du Choléra (CNRVC) à l'Institut Pasteur ... l'Alimentation, en France, dans le but de normaliser les protocoles d'étude et de recherche de V. cholerae et ..... Vibrio présente dans l'environnement avec les méthodes de détection habituelles.

  9. Dicty_cDB: CHE555 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available la EST MtBC10B03R1 : T7 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrhiza of cultivar J...03F1 : T3 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrhiza ...a EST MtBC39A08F1 : T3 end of clone MtBC39A08 of cDNA library MtBC from arbuscular mycorrhiza of cultivar Je

  10. ChE Undergraduate Research Projects in Biomedical Engineering.

    Science.gov (United States)

    Stroeve, Pieter

    1981-01-01

    Describes an undergraduate research program in biomedical engineering at the State University of New York at Buffalo. Includes goals and faculty comments on the program. Indicates that 58 percent of projects conducted between 1976 and 1980 have been presented at meetings or published. (SK)

  11. Una presenza che si fa ombra in Oriente

    OpenAIRE

    Giovanni Azzaroni

    2017-01-01

    In the contest of Asian culture the “shadow structure” is discussed connected to its native world and then it has to be interpreted starting to the culture of its original world. This essay investigates three different geographic situation, that is Japan (nōtheatre), China (shadow theatre) and Indonesia (shadow theatre), to connect as well as possible the vision and “shadow philosophy” to accurate and cultural perspectives, which can relate it to real cultural images.

  12. Una presenza che si fa ombra in Oriente

    Directory of Open Access Journals (Sweden)

    Giovanni Azzaroni

    2017-03-01

    Full Text Available In the contest of Asian culture the “shadow structure” is discussed connected to its native world and then it has to be interpreted starting to the culture of its original world. This essay investigates three different geographic situation, that is Japan (nōtheatre, China (shadow theatre and Indonesia (shadow theatre, to connect as well as possible the vision and “shadow philosophy” to accurate and cultural perspectives, which can relate it to real cultural images.

  13. 97 Luigi Malerba, Che vergogna scrivere, Milano: Mondadori, 1996 ...

    African Journals Online (AJOL)

    User

    This collection of four loosely-connected essays deals, inter alia, with the status of literature and the writer in society. The first, "Lo scrittore come fantasma", moves from the servile position of the author during the Renaissance, to the author becoming a producer of commodities with the advent of copyright in 1793, pointing.

  14. The bumpy face of che guevara: An interesting case

    Directory of Open Access Journals (Sweden)

    Kingshuk Chatterjee

    2017-01-01

    Full Text Available Placement of decorative tattoo on the skin may lead to various immunological, infective, and coincidental complications. Inoculation of human papillomavirus leading to development of verruca is an uncommon complication of tattoos. The present report highlights the development of verruca vulgaris, developing after 2 years of tattooing in a young male.

  15. à l'encoche sèche

    African Journals Online (AJOL)

    naturel est une matière première importante en industrie. Il intervient à 70% dans la ... caoutchouc naturel de cette région est en constante progression, due au .... L'analyse a été effectuée avec le test statistique de Duncan au risque alpha = 5 % avec les valeurs de LEM transformées en Arc Sinus. Racine carrée de LEM ...

  16. El Che y la natación

    Directory of Open Access Journals (Sweden)

    Ana Maria Peña Rojas

    2009-09-01

    Full Text Available Sobre la vida de Ernesto Guevara de la Serna se puede hablar de una trayectoria tan rica en todos los campos; que se pudiera decir del héroe de nuestra América, el guerrillero, el economista, el escritor, el fotógrafo y un gran apasionado por el deporte. Se aborda algunos aspectos relacionados con el Ché como practicante sistemático de la Natación en el sector residencial y escolar durante su vida, pues siempre le interesó la actividad deportiva a pesar de su escasa salud, por el padecimiento de asma bronquial desde su nacimiento. Tuvo junto a sus padres estancia en varios lugares, buscando condiciones para el progreso de su salud, pues además era el hijo primogénito y su madre padeció de la misma enfermedad durante su niñez, aunque heredó otras cosas muy buenas de ella. Supo sobreponerse con tesón y voluntad, tuvo gran incidencia en actividades relacionadas con la natación y otros deportes. Demostró gran destreza en el estilo Mariposa; aunque también practicaba el estilo pecho y el clavado. Su interactuar apasionado como deportista durante su juventud y adultez, lo hicieron más fuertes para enfrentar la vida, lo que posibilitó una formación integra en su persona; aquí se expresa la versatilidad e integridad y fortaleza de un hombre apasionado por la naturaleza, la formación de un hombre nuevo, con diferentes matices de ejemplaridad y paradigma de los pueblos de América Latina.

  17. LES VIBRIONS DANS LES PRODUITS DE LA PÊCHE

    African Journals Online (AJOL)

    PC_WINDOWS

    polyunsaturated fatty acids omega 3 (EPA and DHA) of frozen sardine. The results ... Keywords : conservability, sardine, freezing, chemical weathering, omega-3 fatty acids, EPA, DHA, TVB-N ...... deterioration of salmon during frozen storage.

  18. L'impronta idrica di quello che mangiamo

    NARCIS (Netherlands)

    Bacenetti, J.; Lovarelli, D.; Fiala, M.; Hoekstra, Arjen Ysbert

    2015-01-01

    È stata recentemente approvata la norma ISO (ISO 14046 Water footprint – requirements and guidelines) per la definizione dell’impronta idrica (Water Footprint) (vedi box). Questo nuovo indicatore di sostenibilità ambientale permette di quantificare il consumo di acqua dolce associato, direttamente o

  19. Dicty_cDB: CHE547 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 25 Translated Amino Acid sequence glleninni*q*tk*INKKKNNNHFFFLXFXIKN--- ---MNWAIRDGTYESFKGSPASKGILQFDMWNVTPS...r*cnsihc*snrisnskts*k*yklnytt*nsn*n skll Frame C: glleninni*q*tk*INKKKNNNHFFFLXFX

  20. Dicty_cDB: CHE515 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hvpkkxv*lilqsilmitmhvplipvhhqlvfptlqltvmi vnpctidscnnstglxxhsnqw****slvp*ih--- --...FGLXGGFXGGGTXGKXDCXTCKN*xtxfi*lxfkk ixkkfxkkfxkkkklfvflsniynf*k*kf Frame C: nkctvdscsnstgcvntpincddsnpctvdscnns

  1. MUSICA E MUSICOTERAPIA

    Directory of Open Access Journals (Sweden)

    Fulvio Šuran

    2014-01-01

    Full Text Available Perché la musica piace? Molte sono le possibili risposte a tale quesito, nessuna però del tutto soddisfacente. Comunque, di certo nessuno avrà da ridire se si risponde con un “perché fa bene”, poiché tale risposta sintetizza un po’ tutte le implicazioni della questione, siano esse di ordine biologico, psicologico, sociologico, estetico o etico. In questo senso le relazioni fra educazione generale, educazione musicale e musicoterapia sono assai strette. Ed è nostra intenzione richiamare l’attenzione su di esse, mostrando che la funzione terapeutica non è una questione semplicemente marginale o accessoria dell’educazione, ma qualcosa di ben più rilevante. Per cui è inconcepibile che ancor oggi si possa pensare ad una compiuta educazione, nella quale la musica non sia in onore. Di più, è impensabile un’educazione priva di spirito musicale, inteso come disposizione ad accogliere e ad esprimere, in ben temperata armonia, pensieri ed azioni.

  2. The role of Multidetector CT in the evaluation of the left atrium and pulmonary veins anatomy before and after radio-frequency catheter ablation for atrial fibrillation. Preliminary results and work in progress.Technical note; Il ruolo della TC Multidetettore nella valutazione anatomica dell'atrio sinistro e delle vene polmonari prima e dopo ablazione percutanea con radiofrequenza della fibrillazione atriale. Risultati preliminari e work in progress

    Energy Technology Data Exchange (ETDEWEB)

    Centoze, Maurizio; Della Sala, Sabino Walter; Dalla Palma, Francesco [Azienda Provinciale per i servizi sanitari, Trento (Italy). Dipartimento di radiodiagnostica; Del Greco, Maurizio; Marini, Massimiliano [Ospedale S. Chiara, Trento (Italy). U.O. di cardiologia; Nollo, Giandomenico; Ravelli, Flavia [Trento Univ., Trento (Italy). Dipartimento di fisica

    2005-07-15

    Radio-frequency catheter ablation (RFCA) of the distal pulmonary veins is increasingly being used to treat recurrent or refractory atrial fibrillation that doesn't respond to pharmacologic therapy or cardioversion. Successful RFCA of atrial al fibrillation depends on the pre-procedural understanding of the complex anatomy of the distal pulmonary veins and the left atrium. Aim of this parer is to describe the technical main features that characterise the multidetector helical computed tomography in the evaluation of this anatomic region before and after RFCA procedure. The 3D post-processing techniques useful for pre-RFCA planning are straightforward. [Italian] La ablazione percutanea con radiofrequenza (RFCA) del tratto distale delle vene polmonari nella fibrillazione atriale, che non risponde al trattamento farmacologico e alla cardioversione elettrica, e una procedura in grande sviluppo. Il successo del trattamento dipende dalla comprensione della complessa anatomia delle vene polmonari e dell'atrio sinistro. Lo scopo di questo articolo e illustrare gli aspetti tecnici fondamentali che caratterizzano lo studio di questa regione anatomica con TC spirale multidetettore prima e dopo RFCA. Particolare risalto e stato rivolto alle tecniche di post-processing 3D estremamente utili nella pianificazione della procedura di ablazione.

  3. Matematica numerica esercizi, laboratori e progetti

    CERN Document Server

    Quarteroni, Alfio

    2013-01-01

    La Matematica Numerica una disciplina che si sviluppa in simbiosi con il calcolatore; essa fa uso di linguaggi di programmazione che consentono di tradurre gli algoritmi in programmi eseguibili. Questo testo si propone di aiutare lo studente nella transizione fra i concetti teorici e metodologici della Matematica Numerica e la loro implementazione al computer. A questo scopo vengono proposti Esercizi teorici da risolvere con carta e penna atti a far comprendere meglio al lettore la teoria, e Laboratori, in cui per un dato problema si debbono scegliere gli algoritmi pi adatti, realizzare un programma in linguaggio MATLAB per la loro implementazione, rappresentare graficamente in maniera idonea i risultati ottenuti dal calcolatore, infine interpretarli ed analizzarli alla luce della teoria. Per ogni Esercizio ed ogni Laboratorio si presenta una risoluzione dettagliata,completata da una ampia discussione critica. Per una migliore fruizione degli argomenti sviluppati, il testo si apre con una introduzione allambi...

  4. Tutorial GPS I programmi TGO e TTC di Trimble

    Directory of Open Access Journals (Sweden)

    Vittorio Grassi

    2005-10-01

    Full Text Available Sia questo articolo che quelli che seguiranno sui più diffusi programmi di elaborazione dei dati GPS circolanti in Italia, non pretendono d’essere ne’ saranno mai un manuale d’uso. Il loro scopo è quello di mettere in risalto le funzionalità del programma recensito sulla base di quanto esposto nell’articolo dello stesso autore, intitolato “L’elaborazione dei dati GPS” e pubblicato sul n° 2 di Geomedia 2005 ed è quindi visto solo sotto l’aspetto della elaborazione dei dati GPS e della loro compensazione.

  5. Intercâmbio educacional internacional na modalidade doutorado sanduíche em enfermagem: relato de experiência Intercambio educacional internacional en la modalidad doctorado sándwich: relato de experiencia International educational exchange in nursing s andwich doctorate modality: experience report

    Directory of Open Access Journals (Sweden)

    Kleyde Ventura de Souza

    2008-06-01

    Full Text Available Relato de experiência de estágio de Doutorado Sanduíche oferecido pela Coordenação de Aperfeiçoamento de Pessoal de Nível Superior, realizado na Faculté des Sciences Infirmières/Université de Montreal, no período de agosto a dezembro de 2004. O estágio teve como enfoque o aprofundamento dos aspectos conceituais e práticos relacionados à saúde da mulher e seus direitos sexuais e reprodutivos. Este artigo tem como propósito apresentar as atividades realizadas e despertar o interesse dos estudantes de doutorado dos programas brasileiros de pós-graduação nessa modalidade de intercâmbio. Destacam-se a participação em cursos, reuniões de grupos de pesquisas e em eventos científicos; visitas técnicas e troca de experiências com pesquisadores e integrantes de organizações sociais e conferências. Com esta experiência, verificou-se a importância da cooperação entre pesquisadores e instituições do Brasil e do exterior e fortaleceu-se o compromisso com um projeto de emancipação profissional e social, por meio da pesquisa e deste tipo de cooperação.El artículo relaciona a la experiencia del entrenamiento del Doctorado Sándwich, ofrecido por Cordenación de Perfeccionamiento de Personal de Nivel Superior y realizado en la Faculté de Sciences Infirmières/Université de Montreal, de agosto al diciembre de 2004. El entrenamiento enfocó en profundizar los aspectos conceptuales y prácticos relacionados con la salud de la mujer y con sus derechos sexuales y reproductivos. Este artículo se trata de presentar las actividades realizadas e inspirar el interés de estudiantes de los programas brasileños de la post-grado en esta modalidad del intercambio. Este intercambio era distinguido por la participación en cursos, en reuniones de grupos de investigación y en conferencias científicos, y en las visitas técnicas y el intercambio de experiencias entre investigadores y miembros de organizaciones social. La experiencia

  6. La nascita del programma nucleare iraniano. Washington e Teheran tra alleanza e reciproci sospetti 1956-1979

    OpenAIRE

    Passino, Carlo

    2013-01-01

    The purpose of this dissertation is to investigate and understand the role of the Shah of Iran, and his close relationships with the United States, in the development of the Iranian nuclear program before the Revolution of 1979. The period covered goes from the assignment of Mohammed Reza Pahlavi as Shah of Iran in 1946 to the 1979 when finally Iran and United States found an agreement about mutual nuclear cooperation. The first part of this study examines the situation when Mohammed Reza...

  7. Snelheid en snelheidsbeheersing : samenvatting van de belangrijkste bevindingen uit de snelheidsprojecten in het SWOV-programma 2003-2006.

    NARCIS (Netherlands)

    Schagen, I.N.L.G. van (red.)

    2007-01-01

    Speed and speed management; Summary of the most important findings from the speeding projects in SWOV's 2003-2006 research programme. Driving too fast, i.e. faster than the speed limit or insufficiently adapted to the circumstances, is one of road safety's central problems. In SWOV's 2003-2006

  8. Italian ENEA 1993-1995 tri-annual program. Programma triennale dell'ENEA 1993-1995

    Energy Technology Data Exchange (ETDEWEB)

    1993-01-01

    ENEA (Italian Agency for New Technology, Energy and the Environment) has a dual role - research and development and public administration for that which regards energy and the environment. The Agency has the responsibility of furnishing high level scientific and technological consulting services to the national public administration and to industry. Its joint ventures with industry in commercialization efforts are limited to a 30% share of involvement. This paper describes the planned activities of the Agency in the fields of renewable, nuclear and fusion energy, energy conservation, environmental monitoring and protection, lasers and robotics, technology transfer, training and information dissemination. Breakdowns are provided of the relevant outlays set aside by the national government for these planned activities.

  9. Perceived quality of reproductive care for girls in a competitive voucher programma: a quasi-experimental intervention study, Managua, Nicaragua.

    NARCIS (Netherlands)

    Meuwissen, S.G.M.; Gorter, A.C.; Knottnerus, J.A.

    2006-01-01

    Objective: To determine whether female adolescents from low-income areas in Managua were satisfied with the sexual and reproductive health (SRH) care provided through a competitive voucher programme and to analyse the determinants of their satisfaction. Design: A community-based quasi-experimental

  10. Evaluatie prenatale huisbezoeken JGZ ZonMw-project in het kader van programma ’Vernieuwing uitvoeringspraktijk jeugdgezondheidszorg’

    NARCIS (Netherlands)

    Vink, R.; Sleuwen, B. van; Boere-Boonekamp, M.

    2013-01-01

    Deze rapportage geeft de resultaten weer van de evaluatie van het aanbod van prenatale huisbezoeken door de jeugdverpleegkundige (PHB-JGZ). In een aantal regio’s bestaat de mogelijkheid om al tijdens de zwangerschap,meestal op indicatie van de verloskundige zorgverlener, prenatale huisbezoeken bij

  11. Gauvain e il corpo smembrato: allegorie nell'«Atre périlleux»

    Directory of Open Access Journals (Sweden)

    Maurizio Virdis

    2013-07-01

    Full Text Available L’Atre Périlleux è un romanzo anonimo francese del XIII secolo e fa parte della corrente letteraria che rimettere in questione il romanzo cortese di tradizione chrestieniana. Piú che all’ideologia o alle istanze della classe cavalleresca e della nobiltà minore, il nostro romanzo risponde alle prospettive e alle necessità intellettuali della clergie, che si fa gioco dei valori cavallereschi tradizionali. L’Atre Périlleux è condotto, con toni di humour e una trama complessa, su binari metaletterari e allegorici (di cui il corpo smembrato di Gauvain è il simbolo piú eminente, e si pone come critica della decadenza della società cortese, animato però dal proposito del rinnovamento morale di essa.L’Atre Périlleux is an anonymous French romance of the thirteenth century and it is part of the literary movement that calls into question the tradition of courtly romance dating back to Chrétien de Troyes. More than to the ideology and instances of the class of minor nobility and chivalry, our romance responds to the clergie’s needs and intellectual perspectives, and it mocks the traditional values of chivalry. L’Atre Périlleux is conducted, with a hint of humour and a complicated plot, on metaliterary and allegorical tracks (and Gauvain’s dismembered body is the most prominent symbol of this allegorical tone, so that our romance stands as a critique of courtly society decadence, nevertheless animated by the purpose of its moral renewal.

  12. Book review. Procedure cliniche e terapeutiche negli animali esotici. Marta Avanzi

    Directory of Open Access Journals (Sweden)

    Manuel Graziani

    2014-12-01

    Full Text Available Negli ultimi anni è in costante aumento il numero degli animali da compagnia, con la diretta conseguenza che negli ambulatori veterinari arrivano sempre più pet diversi dal cane e dal gatto. Per dare loro cure di qualità non è sufficiente conoscere soltanto la fisiologia e la patologia ma c'è bisogno di saper maneggiare correttamente questi animali non convenzionali, oltre che conoscere le procedure per arrivare a una diagnosi e quindi ad una terapia appropriata. Procedure cliniche e terapeutiche negli animali esotici di Marta Avanzi risponde al bisogno di conoscenza in un settore in cui la formazione accademica è ancora scarsa, a fronte di un aumento della richiesta di cure da parte dei proprietari. Come scrive l'autrice nella prefazione: "Non sempre il professionista ha la possibilità di seguire un periodo di tirocinio pratico presso colleghi più esperti e spesso è la mancanza di esperienza che scoraggia il neofita ad ampliare il range di specie a cui dedicarsi. Il libro nasce proprio dall'esigenza di colmare questa lacuna, rispondendo al bisogno crescente di formazione nel campo della cura e del trattamento degli animali esotici da compagnia". Il manuale della dott.ssa Avanzi illustra con chiarezza le procedure diagnostiche, anestesiologiche, terapeutiche indispensabili per la pratica clinica. Per questo è rivolto principalmente ai medici veterinari che si occupano degli animali esotici da compagnia quali furetti, conigli, roditori, uccelli e rettili, di cui vengono illustrate le tecniche fondamentali per maneggiarli e contenerli con competenza e sicurezza. Il volume, pubblicato nel grande formato 19,5x26,5 cm, contiene più di mille fotografie a colori, comprese quelle delle attrezzature specifiche per i vari casi. Un'iconografia ricchissima che ha la funzione di descrivere passo dopo passo le manovre e le procedure per trattare questi particolari pazienti. I capitoli sono 14 e descrivono circa 150 procedure, dalla dermatologia all

  13. Lettere di Vilfredo Pareto all’amico Roberto Michels: confini e confine nel Trattato di Sociologia Generale del 1916

    Directory of Open Access Journals (Sweden)

    Raffaele Federici

    2017-08-01

    in occasione della pubblicazione del volume “Problemi di sociologia applicata” che Pareto risponderà a Michels a proposito di metodo scientifico.

  14. Teacher learning and student outcomes in the context of classroom discourse. Findings from a video-based teacher professional development programme

    Directory of Open Access Journals (Sweden)

    Katharina Kiemer

    2014-06-01

    Full Text Available We present an innovative teacher professional development programme (TPD focusing on the re-definition of teachers’ discourse behaviour. We report findings on teacher learning and student outcomes, and reflect on practical implications and directions for future research on the programme. In the “Dialogic Video Cycle” (DVC six teachers participated in a year-long intervention built on effective components of TPD and using videos of teachers’ own practices as tools for reflection and basis for group discussions. We compared the DVC with a traditional TPD programme (n= 4 teachers. Additionally, students (N= 226 were assessed regarding their motivational orientations and individual beliefs. Results show that effective TPD components could successfully be implemented in the DVC and that this new and innovative programme enhances teachers’ performance in classroom discourse and affects students’ interest in the subject, self-efficacy and domain-specific self-concept of ability positively. Thus, the DVC seems a promising tool to foster teacher learning with an impact on perceived student motivation and learning. Presentiamo un programma innovativo per lo sviluppo professionale degli insegnanti (TPD, centrato sulla ridefinizione della conduzione di interazioni verbali in classe. Sono riportati i risultati dell’apprendimento di insegnanti e studenti, e la riflessione sulle implicazioni pratiche per la ricerca futura sul programma. Nel “Dialogic Video Cycle” (DVC sei insegnanti hanno partecipato per un anno a un intervento di TPD mediante videoregistrazioni usate come strumenti di riflessione sulle proprie pratiche e per le discussioni di gruppo. Abbiamo confrontato il DVC con un programma TPD tradizionale (n= 4 insegnanti. Inoltre sono stati valutati gli orientamenti degli studenti (N= 226 in termini di motivazione e fiducia nelle proprie capacità. I risultati mostrano che le componenti efficaci del TPD potrebbero essere attuate con

  15. Abbiamo bisogno della "populäre Musik"? Una prospettiva tedesca

    Directory of Open Access Journals (Sweden)

    Dietrich Helms

    2017-05-01

    Nessuno di questi termini risponde ai requisiti di base della terminologia accademica: sono ambigui, e in alcuni casi anche contraddittori; inoltre, non sono assolutamente neutrali né imparziali. Finora, ogni tentativo di definire la populäre Musik come un insieme di oggetti musicali dotati di caratteristiche simili ha avuto un successo piuttosto limitato nel mondo accademico tedesco. Di conseguenza, per molti studiosi l’espressione populäre Musik acquista una valenza esclusivamente discorsiva. Adottando questa prospettiva, tuttavia, l’ambito di applicazione dei popular music studies si ridurrebbe a un’analisi o a una storia dei discorsi sulla musica, escludendo l’applicazione di strumenti metodologici tipici della musicologia, come ad esempio l’analisi musicale. Ne consegue la proposta di usare l’espressione populäre Musik solamente nei contesti in cui si definisce la politica delle discipline musicologiche, mentre nell’ambito della ricerca vera e propria si dovrebbero trovare e definire termini più adeguati, in grado di descrivere con precisione gli oggetti che si intendono studiare.

  16. Nuclear magnetic resonance spectroscopy in biomedicine. Course organized by the Istituto Superiore di Sanita`. Marciana Marina (Isola d`Elba), September 18-23, 1995; Spettroscopia di risonanza magnetica nucleare in biomedicina. Corso organizzato dall`Istituto Superiore di Sanita`. Marciana Marina (Isola d`Elba), 18-23 settembre 1995

    Energy Technology Data Exchange (ETDEWEB)

    Luciani, A M; Rosi, A [ed.; Istituto Superiore di Sanita` , Rome (Italy). Lab. di Fisica

    1997-12-01

    Nuclear magnetic resonance is a powerful technique that can be used in a wide range of applications, such as the structural characterization of high molecular weight molecules, conformational studies on enzymes in solution, enzyme-substrate or DNA-protein interactions, monitoring of cell metabolism in vivo, and for diagnostic purposes, employing spectroscopic and imaging techniques. This course was organized in order to introduce the participants to the fundamentals of NMR spectroscopy, and offer practical advice on performing NMR experiments on cell systems, cell and tissue extracts and animal models. The main implications regarding human experiments were also discussed. Finally the quantification of information and the interpretation of data were considered with regard to the main nuclei observed. [Italiano] La risonanza magnetica nucleare e` una delle tecniche spettroscopiche che meglio risponde all`ampio spettro di condizioni imposto dalla ricerca in biofisica e biomedicina. Il campo applicativo di questa tecnica copre un intervallo molto ampio che va dalla caratterizzazione di strutture di macromolecole con elevato peso moleculare, a studi di tipo conformazionale su enzimi in soluzione e sull`interazione enzima-substrato o DNA-proteine, fino al monitoraggio in vivo del metabolosmi cellulare e alla diagnostica medica con spettroscopia ed imaging. Il corso e` stato articolato in modo da presentare ai partecipanti nozioni di base della spettroscopia RMN, aspetti pratici della realizzazione di esperimenti di spettroscopia in sistemi cellulari, in estratti cellulari e tissutali e in animali da esperimento, nonche` le principali considerazioni relative agli esperimenti nell`uomo. Sono state affrontate tematiche relative alla quantificazione dell`informazione e all`interpretazione dei dati in relazione ai principali nuclei osservati.

  17. Campagna di social marketing per sensibilizzare all'uso delle cinture di sicurezza e dispositivi per bambini

    Directory of Open Access Journals (Sweden)

    S. Cinquetti

    2003-05-01

    Full Text Available

    Obiettivi: aumento del 10% dell’uso delle cinture di sicurezza anteriori e posteriori e del 20% dei seggiolini per bambini nella Regione del Veneto.

    Metodi: il Programma Regionale di Prevenzione dei Traumi da Traffico è stato varato nel 1998 e rifinanziato nel 2002 per un secondo triennio. Fa capo alla Direzione per la Prevenzione dell’Assessorato alle Politiche Sanitarie del Veneto, coinvolge i Dipartimenti di Prevenzione di tutte le Aziende ULSS del Veneto e ha come capofila l’azienda ULSS 7 di Pieve di Soligo (TV. Nell’ambito del programma, il 16 maggio 2003 è stata avviata una campagna di marketing sociale finanziata dalla fondazione CARIVERONA e commissionata ad un’ agenzia pubblicitaria leader del settore. La campagna è stata preceduta da ricerca formativa con 19 focus group e 12 interviste, volta ad analizzare il punto di vista dei diversi target, nonché degli attori principali coinvolti (Forze dell’Ordine, autoscuole, etc. Dopo un test di gradimento, la campagna è partita con spot televisivi e radiofonici, inserzioni nei giornali e manifesti informativi destinati alle scuole medie superiori, alle scuole guida nonché agli ambulatori dei medici di famiglia. Attraverso i media si sostiene una serie di azioni nel territorio che coinvolgeranno le amministrazioni comunali, le forze di polizia e le associazioni di volontariato.

    Risultati: l’efficacia della campagna viene valutata attraverso due distinte rilevazioni dell’uso delle cinture di sicurezza/seggiolini, confrontando i dati raccolti prima della campagna e dopo.

    Conclusioni: i traumi da traffico rappresentano nel Veneto un’importante causa di mortalità e morbosità. Il programma regionale ha utilizzato la tecnica innovativa del marketing sociale come strumento essenziale per sostenere i cambiamenti comportamentali necessari a prevenire l’incidentalità da traffico nel

  18. CO{sub 2} emission costs and Gas/Coal competition for power production; Prezzi delle emissioni di CO{sub 2} e competivita' gas/carbone per la produzione termoelettrica

    Energy Technology Data Exchange (ETDEWEB)

    Santi, Federico [La Sapienza Univ., Roma (Italy). Dipartimento di Ingegneria Nucleare e Conversioni dell' Energia

    2005-05-01

    This paper demonstrates how a CO{sub 2} emission reduction programme can change the competition between the two power production technologies which will probably dominate the future of the Italian power industry: the coal fired USC steam power plant and the natural gas fired CCGT power plant. An economic value of the CO{sub 2} emission is calculated, in order to make the short-run-marginal-cost (or the long-run-marginal-cost). equal for both technologies, under a CO{sub 2} emission trading scheme and following a single-plant specific CO{sub 2} emission homogenizing approach. [Italian] Si dimostra come un programma teso alla riduzione delle emissioni di CO{sub 2} possa mutare la competivita' tra le due tecnologie per la produzione termoelettrica che saranno dominanti nel prossimo futuro in Italia: le centrali a carbone USC e le centrali CCGT a gas naturale. Si calcola il prezzo delle emissioni di CO{sub 2} per valutare il costo marginale di breve periodo (o il costo marginale di lungo periodo) per entrambe le tecnologie, avvalendosi di un programma di emission trading e utilizzando un approccio di omogeneizzazione delle emissioni di CO{sub 2} specifiche di ogni impianto.

  19. L’immagine ricreata. L’esperienza del sacro nell’arte contemporanea seguito da Intervista con James Elkins

    Directory of Open Access Journals (Sweden)

    Marta Gabriele

    2012-01-01

    Full Text Available Il saggio tenta di analizzare il rapporto tra il sacro e l’arte contemporanea alla luce dei recenti studi del professore americano James Elkins. Secondo l’autore del testo On the strange place of religion in contemporary art, l’arte e la religione, in passato, nella reciproca dipendenza inveravano la dimensione costitutiva e originaria dell’uomo; rivelavano la condizione rituale, cultuale, individuale e collettiva che risponde alla primordiale sacralità della vita. L’osmosi ha lasciato il posto alle singole entità non più sovrapponibili nell’era secolarizzata. In un’epoca dominata dalla razionalità della tecnica, per la maggior parte della produzione artistica contemporanea il tema religioso sembra debba essere intrecciato e connaturato al lavoro creativo. Per evitare il rischio di far risultare l’arte come “propaganda” per la religione, deve  apparire, secondo Elkins, la figura dell’artista meditativo e incerto, sia sull’arte che sulla religione: ambiguità, autocritica e ironia devono insinuarsi nell’opera per decretarne l’appartenenza allo statuto delle belle arti. La religione, come il pensiero mitico, il pensiero simbolico e la ragione, fanno parte dell’uomo, sono insite nell’uomo religioso e a-religioso, ugualmente la psicologia, come la religione in passato, si è occupata di “guarire” l’anima, di scoprire la sfera più segreta dell’individualità. La distruzione o meglio la separazione di questi linguaggi ha comportato un indebolimento dell’Io, un allontanamento dal centro, un disorientamento espresso visivamente dall’artista. La perdita di orientamento si traduce in una leggerezza dell’esistenza, fatta di molteplici direzioni, di infinite Weltanschauungen, in cui si incrociano linguaggi, culture, religioni, ideali, valori che generano vie emancipative diversificate, plurime. L’esclusività e l’intimità del rapporto fra chi guarda e l’opera, che genera stupore, meraviglia

  20. EGNOS: è ora di usarlo

    Directory of Open Access Journals (Sweden)

    Fabrizio Bernardini

    2006-04-01

    Full Text Available Dall’inizio di quest’anno EGNOS, European Geostationary Navigation Overlay Service, iniziativa dell’Unione Europea e dell’Agenzia Spaziale Europea, è operativo e nel corso dell’anno raggiungerà i livelli di servizio richiesti dapprima per le applicazioni commerciali e, all’inizio del 2007, quelli per le applicazioni Safety Of Life. Sarà dunque il conseguimento finale di EGNOS V2.1 al quale farà seguito un programma di evoluzione articolato in tre altre fasi che si estenderanno almeno fino alla fine del 2011 con ampliamenti della copertura, della fornitura di servizi anche nella nuovabanda L5, fino all’integrazione con Galileo. In questo articolo,che gode della collaborazione della Next SpA, realizzatriceanche dell’applicazione descritta nella rubrica Reports di questo stesso numero, vogliamo evidenziare alcuni aspetti del sistema che non ci sembra ancora ben apprezzato a livello utente e due prospettive note come SISNET ed ESA ALIVE.

  1. Rilievo terrestre dell’ambiente urbano con tecnologie a scansione: un test sulla città-industria di Dalmine

    Directory of Open Access Journals (Sweden)

    Luigi Colombo

    2014-12-01

    Full Text Available Il patrimonio edilizio urbano è un bene che caratterizza l’identità dell’uomo che con esso ha vissuto; la conoscenza della realtà originaria, la conservazione e valorizzazione nel tempo comportano interventi di tipo documentale che possono interessare sia gli aspetti costruttivi degli edifici, connessi a dimensioni e geo-localizzazione, sia quelli legati alla forma urbana, sia ancora altri più specifici di tipo storico-artistico e materico. Le nuove tecnologie laser di misura terrestre, integrate da sensori di posizionamento e fotografici, consentono di rilevare in tempi ridotti e di rappresentare anche spazialmente sia singole unità edilizie sia interi insediamenti urbani. Le grandi quantità di dati acquisiti costituiscono un arricchimento della conoscenza geometrica di base, fornita in genere da rappresentazioni cartografiche “vettoriali o raster”. Il lavoro descrive un test di scansione laser, statica e cinematica, avviato sul territorio di Dalmine (Bergamo nell’ambito di un programma di interventi comunali di tutela paesaggistica, conservazione dei caratteri costruttivi e valorizzazione degli insediamenti storici della città, realizzati negli anni venti del secolo scorso e identificativi del suo passato di città-industria. L’approccio al rilievo tende altresì a validare una procedura operativa, basata su componenti tecnologiche innovative, semplice, sufficientemente economica e convenientemente applicabile all’indagine su aree urbane.

  2. The environmental project of the enhancement of the fluvial area: L’Aquila and the Aterno River

    Directory of Open Access Journals (Sweden)

    Luciana Mastrolonardo

    2016-06-01

    Full Text Available Il contributo si colloca in un programma interdisciplinare volto alla valorizzazione e la tutela del fiume, attraverso il controllo dei flussi e l’attivazione di simbiosi. Si integrano, con un approccio che parte dalla progettazione ambientale, le tematiche urbane, paesaggistiche, tecnologiche ed ecologiche, per orientare lo sviluppo del territorio in termini di tutela e valorizzazione delle risorse, e per recuperare le discontinuità rappresentata oggi dal fiume, in alcuni contesti urbani, conferendole maggiore riconoscibilità e potenzialità. Nello specifico si indaga il rapporto tra L’Aquila e il fiume Aterno per individuare, a livello locale, le strategie perseguibili per il recupero delle connessioni tra l’ambito fluviale e urbano, per la valorizzazione del territorio e il ripristino della funzionalità dell’acqua nel suo ciclo vitale. 

  3. Pronuncia e altre abilità linguistiche

    DEFF Research Database (Denmark)

    Pierucci, Giulia

    In questa sede si intende illustrare e discutere alcuni interventi didattici nell’ambito del progetto di ricerca “ Dai suoni alla lingua in uso: sviluppare consapevolezza fonologica per favorire l’acquisizione e l’interazione nell’apprendimento dell’italiano LS a livelli iniziali”, presentato...... in occasione del X Congresso degli Italianisti Scandinavi a Reykjavik nel giugno 2013. In particolare verranno proposti percorsi didattici finalizzati all’acquisizione della competenza e consapevolezza fonologica in relazione allo sviluppo delle altre abilità linguistiche che saranno state sperimentate...... in classe, nei corsi di laurea in italiano dell’Università di Århus, con gruppi principianti e non. Si illustreranno anche interventi seminariali rivolti a insegnanti di lingua straniera nelle scuole superiori danesi, in programma per gennaio presso l’Universitá di Århus. Saranno presi in visione video e...

  4. Le novità in Quantum GIS: versione 1.8 “Lisboa” ed oltre

    Directory of Open Access Journals (Sweden)

    Giovanni Manghi

    2013-02-01

    Full Text Available Quantum GIS, il noto programma GIS libero ed Open Source distribuito con licenza GPL, hacompiuto nel 2012 i primi 10 anni di vita. La sua popolarità tra gli utenti finali è in continuoaumento* (statistiche dei download, gistackexchange, google trends, etc. cosí come é inaumento** il numero di sviluppatori coinvolti e il numero di enti (anche importanti, tra cui laRegione Toscana, World Bank, vari cantoni svizzeri, ecc. che ne finanziano lo sviluppo.   What's New in Quantum GIS version 1.8"Lisboa" and over Quantum GIS, the well known GIS programfree and open source GPL-licensed,reached in 2012 the first 10 years of life. Itspopularity among end users is increasingas well as is increasing the number of developersinvolved and the number of entities(also important, including the TuscanyRegion, World Bank, various Swiss cantons,etc.. that are financing the development.

  5. Le novità in Quantum GIS: versione 1.8 “Lisboa” ed oltre

    Directory of Open Access Journals (Sweden)

    Giovanni Manghi

    2013-02-01

    Full Text Available Quantum GIS, il noto programma GIS libero ed Open Source distribuito con licenza GPL, hacompiuto nel 2012 i primi 10 anni di vita. La sua popolarità tra gli utenti finali è in continuoaumento* (statistiche dei download, gistackexchange, google trends, etc. cosí come é inaumento** il numero di sviluppatori coinvolti e il numero di enti (anche importanti, tra cui laRegione Toscana, World Bank, vari cantoni svizzeri, ecc. che ne finanziano lo sviluppo. What's New in Quantum GIS version 1.8"Lisboa" and overQuantum GIS, the well known GIS programfree and open source GPL-licensed,reached in 2012 the first 10 years of life. Itspopularity among end users is increasingas well as is increasing the number of developersinvolved and the number of entities(also important, including the TuscanyRegion, World Bank, various Swiss cantons,etc.. that are financing the development.

  6. Computer codes application to evaluate comparative analysis of environmental compatibility between waste treatment plants and site characterization of Matera (southern Italy); Applicazioni del codice di calcolo SITEVAL per l'analisi della compatibilita' ambientale degli impianti di smaltimento e recupero dei rifiuti alle discariche non controllate presenti nella provincia di Matera

    Energy Technology Data Exchange (ETDEWEB)

    Cautilli, F.; Musmeci, F.; Tassoni, E. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente

    1998-07-01

    The report presents the software SITEVAL aimed at tackling the comparative analysis of environmental compatibility between waste treatment plants and hosting areas. The SITEVAL application for non-monitored urban waste landfills in the province of Matera (southern Italy) is showed with the objective to identify the more relevant environmental components in such landfills. [Italian] L'articolo illustra il codice di calcolo SITEVAL utilizzato per analisi comparative di compatibilita' ambientale di impianti di smaltimento di rifiuti con i siti che li ospitano e poi riporta l'applicazione del codice nella situazione della provincia di Matera riguardo allo smaltimento non controllato di rifiuti solidi urbani e alla individuazione delle componenti ambientali piu' sensibili alla presenza di tali discariche nel territorio. Il codice ha permesso di stilare graduatorie di compatibilita' delle discariche non controllate e di definire l'interdipendenza dei risultati dalla scelta dei parametri di input del programma.

  7. Small-scale hydro-power plant in Quinto - Preliminary project; Progetto minicentrale idroelettrica, Ri Secco - Quinto. Programma piccole centrali idrauliche. Progetto di massima

    Energy Technology Data Exchange (ETDEWEB)

    Dotti, R. [Reali e Guscetti SA, Ambri (Switzerland); Rosselli, P. [Celio Engineering SA, Ambri (Switzerland)

    2009-06-15

    This report for the Swiss Federal Office of Energy (SFOE) takes a look at a project for the realisation of a small hydro-power plant on the alpine stream 'Ri Secco' in the municipality of Quinto, southern Switzerland. The Ri Secco partly flows in a steep canyon. The elevation difference of 810 or 620 m (depending on the location of the water deviation from the stream) is favorable to the installation of a small-scale high-head power plant. The report presents details on the hydrological data and the dimensioning of the installation. Several variants are considered, which also include two possible penstock diameters for each weir location. The electricity production expected is discussed, as is the economic viability of the project.

  8. Small-scale hydro-power plant in Anzonico - Preliminary project; Progetto microcentrale idroelettrica, Anzonico. Programma Centrali idrauliche. Progetto di massima

    Energy Technology Data Exchange (ETDEWEB)

    Dotti, R. [Reali e Guscetti SA, Ambri (Switzerland); Rosselli, P. [Celio Engineering SA, Ambri (Switzerland)

    2009-01-15

    This report for the Swiss Federal Office of Energy (SFOE) takes a look at a project for the realisation of a small hydro-power plant in the municipality of Anzonico, southern Switzerland. The water of a small alpine stream is to be used for power generation and vineyard irrigation as well as for the creation of an additional water resource for fire fighting in this sensitive region. The report is foreseen to support the request for a water usage concession to the authorities of the Canton of Ticino. It presents details on the hydrological data for the river and the dimensioning of the installation. The hydrological installations and the turbine foreseen are described and discussed, as is the removal of river sediment. The electricity production expected is discussed, as is the economic viability of the project. Synergies exist with the local electricity utility that will renew and improve its power distribution and telecommunication system when the penstock will be mounted in the underground.

  9. On Continuous Distributions and Parameter Estimation in Probabilistic Logic Programs (Over continue verdelingen en het schatten van parameters in probabilistische logische programma's)

    OpenAIRE

    Gutmann, Bernd

    2011-01-01

    In the last decade remarkable progress has been made on combining statistical machine learning techniques, reasoning under uncertainty, and relational representations. The branch of Artificial Intelligence working on the synthesis of these three areas is known as statistical relational learning or probabilistic logic learning.ProbLog, one of the probabilistic frameworks developed, is an extension of the logic programming language Prolog with independent random variables that are defined by an...

  10. Gezondheidsvoorlichting en bewegingsstimulering voor ouderen: Ontwikkeling en evaluatie van het programma "Gezond & Vitaal" [Health education and exercise stimulation for older people: Development and evaluation of "Healthy & Vital"

    NARCIS (Netherlands)

    Hopman-Rock, M.; Westhoff, M.H.

    2002-01-01

    In order to promote health in people of 65 years and older, TNO Prevention and Health developed, evaluated, and implemented "Healthy & Vital" (also known as "Ageing Well and Healthily"). Healthy & Vital consists of six sessions of health education and low-intensity exercises. This paper reports on

  11. Interpolis SlimOpWeg-programma : de AutoModus-app : vragenlijstonderzoek naar het effect van een app om smartphonegebruik in de auto te verminderen.

    NARCIS (Netherlands)

    Groot-Mesken, J. de Wijnen, W. Stelling-Konczak, A. & Commandeur, J.J.F.

    2017-01-01

    Interpolis SlimOpWeg programme: the AutoModus app; Survey into the effect of an app on reducing smartphone use while driving a car. Within the programme SlimOpWeg the Dutch insurance company Interpolis had a smartphone app developed. The purpose of this ‘AutoModus app’ is to help young drivers to

  12. Een energiebalans programma voor pasgepensioneerden : impact op lichaamssamenstelling, lichamelijke activiteit en voeding = An energy balance intervention at retirement : impact on body composition, physical activity and diet

    NARCIS (Netherlands)

    Werkman, A.M.

    2007-01-01

    background Occupational retirement is a life event that is likely to induce lifestyle changes leading to a positive energy balance, and hence weight gain and accumulation of abdominal fat mass. aims The aims of this thesis are 1) to systematically develop an energy balance intervention

  13. Che cosa comporta introdurre nuove tecnologie didattiche a scuola : un modello

    Directory of Open Access Journals (Sweden)

    Alessandro Antonietti

    2009-01-01

    Full Text Available This article discusses a model on the set of factors that come into play in seguitodell'introduzione to school for a new educational technology. The model regards the relations between gliobiettivi or needs that motivate the adoption of a new educational tool, the choice of this instrument, the way it is impiegatoe the effects it produces. The model also takes into account the relationship between the individual and social representations sisviluppano about the needs and objectives of the technological tool, its use and changes induce.Vengono discussed the implications of the model for the management of these complex relationships in the school context.

  14. QUEL CHE RESTA DELLA PSICANALISI. UNA LETTURA MERLEAU‐PONTIANA DI FREUD

    Directory of Open Access Journals (Sweden)

    Scotti, Alessandra

    2015-12-01

    Full Text Available This paper investigates Maurice Merleau‐Ponty’s interest about Freud’s philosophical works. It invokes the Freud’s recognition as “Master of the School of suspicion”, a famous definition made by Paul Ricœur. According to Ricœur, Freud’s theories take place within the philosophical stream that looks at “constituted cogito” with deep mistrust. Through the analysis of “Phenomenology of Perception” we can observe the accusation of “pansexuality” moved by Merleau‐Ponty. However, as Merleau‐ Ponty’s philosophy develops and his view changes from “existential” to “ontological”, the relation between Freud and Merleau‐Ponty changes accordingly, until the acknowledgment of the unconscious as a prediction of the “chair”.

  15. Effort de pêche et production poscicole au lac d'ayame i

    African Journals Online (AJOL)

    -made Lake Ayamé I, from August 2004 to July 2005, allowed to evaluate at 236.9 t the landed catches of these stations. The global production of the lake, estimated to 381.8 t was below the 1060 t reported in 1996 before the closing of this ...

  16. Assai più che eutanasia. Prelegomeni a ogni futura interpretazione filosofica del tradimento

    Directory of Open Access Journals (Sweden)

    Vincenzo Cicero

    2015-12-01

    Full Text Available At the very central point of the first episode in the Matrix Trilogy (1999-2003 is the cornerstone of the film’s narrative: the scene of Cypher’s betrayal, also known as the restaurant scene, which immediately received special attention from scholars. As regards the tone of interpretations, so far it has been almost a competition to issue the more sophisticated and persuasive verdict of guilty, and all of them agree, even the not incriminating ones, in believing Cypher as an incurable selfish hedonist. Their hermeneutical common limits are basically three: a they treat the Cypher case only by analyzing the verbal level, that is the script, and then by abstracting from the fact that it’s a story in a filmic text; b they isolate and crystallize the character in Chapter 19 of Matrix (the dialogue between Neo and Cypher and the restaurant scene, as though he appeared only in this specific context and not already at the beginning of the film; c they apply from above and extrinsically the theoretical formulas of some philosophers (no matter if Kant, Mill, Nietzsche, Nozick etc. dealt with as if taken from a handbook. The suggested interpretation sounds like a completely different register. We do not refer to any philosopher, instead we refer to the verse from a book of VT, Judges 16.30, in which a very similar impulse to the one moving Cypher is found. And of this character, who has an extraordinary tragic depth, the simulational and cryptogramatic structural shape is shown.

  17. Wie aus dem Nichts etwas entsteht Gespräche über Antimaterie

    CERN Document Server

    AUTHOR|(CDS)2051122

    2018-01-01

    Antimaterie beschäftigt nicht nur Physiker, sondern auch die Phantasie von Science fiction-Autoren, Star Trek-Fans und Laien. Aber was ist eigentlich Antimaterie, und wie stellt man sie her? Kann man sie speichern? Wird sie bald eine Rolle im Alltag spielen? Und warum verdanken wir unsere Existenz – und die unseres Universums – einem winzigen Unterschied zwischen Materie und Antimaterie? Rolf Landua, einer der weltweit führenden Experten auf diesem Gebiet, beantwortet in seinem neuen Buch anschaulich diese und andere Fragen.

  18. Future of Chemical Engineering: Integrating Biology into the Undergraduate ChE Curriculum

    Science.gov (United States)

    Mosto, Patricia; Savelski, Mariano; Farrell, Stephanie H.; Hecht, Gregory B.

    2007-01-01

    Integrating biology in the chemical engineering curriculum seems to be the future for chemical engineering programs nation and worldwide. Rowan University's efforts to address this need include a unique chemical engineering curriculum with an intensive biology component integrated throughout from freshman to senior years. Freshman and Sophomore…

  19. “Le parole che vengono da fuori”: i forestierismi nella lingua cinese contemporanea

    Directory of Open Access Journals (Sweden)

    Alessandro Tosco

    2015-10-01

    Full Text Available This article explores how the words of foreign origin (loanwords, in Chinese wailaici are integrated in the modern and contemporary Chinese language. The phenomenon of the introduction of the loanwords in Chinese has become more and more productive, specially in the last thirty years. Over the time the Chinese language has devised many strategies to integrate foreign words; most of the words of Japanese origin are introduced as graphic loans, while the words introduced by Western languages (specially English are integrated as phonemic loans, loan-translations, semantic loans, or hybrid words. In recent years, many loanwords and neologisms have been created by using the language of the network, as the acronyms written in Latin letters.

  20. El Che - más que médico

    OpenAIRE

    Natalia I. Osorio Curbelo

    2015-01-01

    Revolucionario, dirigente político, comandante guerrillero, intelectual y médico.  Uno de los íconos del siglo XX.  Nació en Rosario, Argentina, el 14 de junio de 1928. En 1938, con apenas 10 años, el padre le enseñó a jugar Ajedrez en el transcurso del año, deporte que no dejaría de practicar nunca más y lo estudiaría por siempre. En 1939 supo de la existencia de Cuba, pues teniendo 11 años, cuando vivía en Alta Gracia, en Buenos Aires se desarrollaba la VII Olimpiada de Ajedrez y el más con...

  1. In Teufels Küche – Bohrungen ins Innere von Vulkanen

    OpenAIRE

    T. Wiersberg; Samuel Niedermann; Martin Zimmer

    2014-01-01

    Volcanoes fascinate both scientists and the general public alike. Their hazard risk, their capability to provide unique samples from depth, and their geothermal potential renders them important targets for scientific drilling. To date, a total of seven ICDP volcano drilling projects have been in operation or completed, while several others are in planning. Here we report on the Hawaii Scientific Drilling Project HSDP (USA), the Unzen Scientific Drilling Project USDP (Japan) and the C...

  2. La tortura in Italia. Il reato che non c’è

    Directory of Open Access Journals (Sweden)

    Rossana Gabrieli

    2016-07-01

    Full Text Available After having introduced a definition of the word “torture” and briefly analysed from a historic point of view, this behaviour thanks to well-known events (Dozier kidnapping and G8 summit in Genoa, in this article the author will first discuss the lack of an appropriate legislation on this topic in Italy. Then, she will analyse some aspects of the criminological profile of a torturer.

  3. Che cos'è la matematica? introduzione elementare ai suoi concetti e metodi

    CERN Document Server

    Courant, Richard

    1971-01-01

    I numeri naturali ; la teoria dei numeri ; il sistema dei numeri nella matematica ; l'algebra delle classi ; costruzioni geometriche, l'algebra nei campi di numeri ; geometria proiettiva, assiomatica, geometrie non euclidee ; topologia ; funzioni e limiti ; ulteriori esempi sui limiti e sulla continuità ; massimi minimi ; il calcolo.

  4. Resti che ritornano testi: il ruolo della memoria in una possibile risemantizzazione di luoghi.

    Directory of Open Access Journals (Sweden)

    Amedeo Trezza

    2012-08-01

    involved towards planning and managing of the territory. In this way the memory of what is left as a mark on the territory of a pre-existent order (already disappeared or disappearing could offer suggestions to political debates about planning. In this manner a radical change of the study perspective could be achieved; for instance, manufactures should be assumed not merely as precipitates of ideologies and political strategies but in fact as expressive, material and concrete rests (concretions... able to activate semiotic processes of recognizing identities and possibilities along with the opening of new meanings.

  5. Definitive Mineralogical Analysis of Mars Analog Rocks Using the CheMin XRD/XRF Instrument

    Science.gov (United States)

    Blake, D. F.; Sarrazin, P.; Bish, D. L.; Feldman, S.; Chipera, S. J.; Vaniman, D. T.; Collins, S.

    2004-01-01

    Mineral identification is a critical component of Mars Astrobiological missions. Chemical or elemental data alone are not definitive because a single elemental or chemical composition or even a single bonding type can represent a range of substances or mineral assemblages. Minerals are defined as unique structural and compositional phases that occur naturally. There are about 15,000 minerals that have been described on Earth, all uniquely identifiable via diffraction methods. There are likely many minerals yet undiscovered on Earth, and likewise on Mars. If an unknown phase is identified on Mars, it can be fully characterized by structural (X-ray Diffraction, XRD) and elemental analysis (X-ray Fluorescence, XRF) without recourse to other data because XRD relies on the principles of atomic arrangement for its determinations. XRD is the principal means of identification and characterization of minerals on Earth.

  6. Neanderthal teeth from Moula-Guercy, Ardèche, France.

    Science.gov (United States)

    Hlusko, Leslea J; Carlson, Joshua P; Guatelli-Steinberg, Debbie; Krueger, Kristin L; Mersey, Ben; Ungar, Peter S; Defleur, Alban

    2013-07-01

    Here we describe dental remains from a Neanderthal fossil assemblage from Moula-Guercy, France. Our report demonstrates that the Moula-Guercy hominid remains contribute important morphological, developmental, and behavioral data to understanding Neanderthal evolutionary history. We include gross comparative morphological descriptions and enamel surface microstructure and microwear data. These teeth reveal numerous characteristics that are diagnostic of Neanderthals and provide no evidence for the presence of any other hominid taxa. Enamel growth increment data from the Moula-Guercy specimens yield evidence of a Neanderthal pattern of development, although at the lower end of the range of variation. The presence of a significant number of linear enamel hypoplasias indicates that these individuals were stressed during childhood. Molar microwear data suggest that these Neanderthals did not differ significantly from modern humans in terms of the fracture properties of the food they were consuming. The incisor microwear and macro striations provide evidence that these individuals may have been using their anterior teeth as tools, similar to the practices of several modern human populations such as the Inuit, Ipiutak, and Australian Aboriginals, and reminiscent of evidence from other Neanderthals from Krapina, Croatia, as well as the 600,000 year old hominids from Sima de los Huesos, Spain. Am J Phys Anthropol 151:477-491, 2013.© 2013 Wiley Periodicals, Inc. Copyright ©2013 Wiley Periodicals, Inc.

  7. Sprüche, Sentenzen, Zitate als Kurzformen oder "einfache Formen" der Textsorten in interkultureller Sicht

    Directory of Open Access Journals (Sweden)

    Mirko Križman

    1998-12-01

    Full Text Available Eine systematische sprachliche Behandlung der Sprichwörter in bezug auf die verschiedenen Sprachen und auf die sprachliche Varianz nur einer Sprache wäre eine umfangreiche Arbeit. Man kann aber doch in einem Beitrag, wo zwei oder drei Sprachen in Betracht gezogen werden, zuerst einige allgemeine Feststellungen erwähnen, womit die Varianz, die in den Bereich der Sprachwissenschaft gehört, einigermaßen prinzipiell zu lösen wäre und etliche Details der Stilistik (auch im ästhetischen Sinn gezeigt werden können.

  8. What is philosophy of medicine? : (Che cos’è la filosofia della medicina?)

    NARCIS (Netherlands)

    Kingma, E.M.

    2011-01-01

    Philosophy of Medicine is considered a new and emerging discipline. This paper presents an overview of philosophy of medicine, discusses its relation to bioethics and to other areas of philosophy, and introduces three potential topics for research in the philosophy of medicine: concepts of health

  9. Sui diritti dell’infanzia e la libertà che comincia

    Directory of Open Access Journals (Sweden)

    Mariangela Caporale

    2014-06-01

    Full Text Available The present article deals with children’s rights. It focuses on the problematic aspect regarding all the documents – included the Convention on the Rights of the Child - that only support adults’ point of view about life and world without considering the peculiarity of the reason and freedom of childhood, that is its autonomy.

  10. A Theory of Revolutionary Warfare and its Application to the Bolivian Adventure of Che Guevara

    Science.gov (United States)

    1973-01-01

    training in Cuba Molses Nato Molses Guevara Rodriguez Julio Mendez Cano .Member of Center; later Joined the Rearguard; recrui ter Member of...Fort Bragg, North Carolina, 1965. Carol ! na. Counterinsurgency Planning Guide. ST-31-176, Fort Bragg, North Von Lsz&r, Arpad and Robert R. Kaufman

  11. Il PIL: oltre il PIL. E oltre il PIL che c’è?

    Directory of Open Access Journals (Sweden)

    Giuseppe Alvaro

    2011-01-01

    Full Text Available The article criticises the recent Stiglitz-Sen-Fitoussi Report arguing that the suggestion of developing a series of indicators that would complement the traditional GDP will in fact end up in confirming the centrality of the GDP, which would remain the central theoretical reference point as well as the main policy target. What is needed is a new conceptual framework of which the GDP is only a part, that has the potential to lead to a new synthetical index, replacing the GDP altogether. The article sketches the main characteristics of such a new index.

  12. Segui le orme che portano alle ceneri del focolare. Il Festival Culturale Gattjirrk di Milingimbi

    Directory of Open Access Journals (Sweden)

    Franca Tamisari

    2016-12-01

    Full Text Available This article considers the socio-cultural meaning of the Gattjirk Cultural Festival of Milingimbi, an event that is annually held in the indigenous Yolngu community in the Northern Territory, Australia. Despite its small-scale dimensions and ludic nature, the Festival provides an arena where the postcolonial realities the Yolngu people live in are negotiated. Focusing not only on the organisers' point of view - who see the Festival as an opportunity to "share culture" - but also on that of the youth - who reveal their experiences and visions through hip-hop and comic dances - I argue that the Festival creates a space in which both generational tensions, within the community, and those between Indigenous and non indigenous people, can be displayed and mediated. If, on the one hand, the Festival is a moment of encounter where culture can be shared, on the other it also generates new modalities of confrontation and defiance. By weaving together elements of Yolngu cultural heritage and pop culture, I argue that hip-hop and comic dances, which are mainly performed by the youth, are tactics of cultural remix that demand attention through laughter and irony: a mutual recognition which equally engages performers and spectators, the elders and the youth, indigenous and non indigenous people to participate and respond. These performances thus generate connections and relationships that remix the old and the new, the elders and the youth, indigenous and non indigenous people in an encounter which is at once efficacious yet ephemeral.

  13. BIOACTIVITIES AND CHEMICAL CONSTITUENTS OF A VIETNAMESE MEDICINAL PLANT JASMINUM SUBTRIPLINERVE BLUME (CHE VANG )

    OpenAIRE

    Dai, Hue Ngan

    2006-01-01

    #This thesis encompasses two parts. The first part deals with general introduction to isolation, characterization, and bioactivities of natural products, with emphasis on Jasminum Subtriplinerve Blume spp., and its genus. The second is experimental study of J.subtriplinerve Bl. about its bioactivities and chemical constituents. In first part (from chapter 1 to 6), the botanical of two varieties of J.subtriplinerve Bl., a medicinal plant widely distributed in Middle area of Vietnam that has ju...

  14. Bioactivities and chemical constituents of a Vietnamese medicinal plant Che Vang, Jasminum subtriplinerve Blume (Oleaceae).

    Science.gov (United States)

    Ngan, Dai Hue; Hoai, Ho Thi Cam; Huong, Le Mai; Hansen, Poul Erik; Vang, Ole

    2008-01-01

    Five crude extracts were made from leaves and stems of Jasminum subtriplinerve Blume (Oleaceae) and investigated for antimicrobial, antioxidant and cytotoxic activities. The extractions were done with petroleum ether, ethyl acetate, ethanol, methanol or water. All extracts exhibited anti-bacterial activity except the water fraction. On the other hand, all extracts exhibit antioxidant activity except the petroleum ether fraction using the DPPH radical scavenging assay. Only the petroleum ether fraction showed a cytotoxicity activity against tested cell-lines, Hep-G2 and RD with IC(50) values of 19.2 and 20 microg mL(-1), respectively. From the petroleum ether and ethyl acetate extracts, two triterpenes namely 3beta-acetyl-oleanolic acid and lup-20-en-3beta-ol and a sterol, stigmast-5-en-3beta-ol were isolated. The structure of those compounds were elucidated by spectrometric methods IR, MS, 1D-NMR, 2D-NMR and simulated ACD/NMR spectra. The data presented here indicate that J. subtriplinerve do contain compounds with interesting biological activity.

  15. Usage based language acquisition in the Danish crèche

    DEFF Research Database (Denmark)

    Hansen, Ole Henrik

    2010-01-01

    Forskning i det lille barns sprogtilegnelse i den danske vuggestue må tage højde for diverse sprogsyn og videnskabelige grundsyn, for at kunne udtrykke noget validt om barnets første sprog....

  16. Bioactivities and chemical constituents of a vietnamese medicinal plant Che Vang, Jasminum subtriplinerve Blume (Oleaceae)

    DEFF Research Database (Denmark)

    Dai Hue, Ngan; Thi Cam, Hoai; Le Mai, Huong

    2008-01-01

    Five crude extracts were made from leaves and stems of Jasminum subtriplinerve Blume (Oleaceae) and investigated for antimicrobial, antioxidant and cytotoxic activities. The extractions were done with petroleum ether, ethyl acetate, ethanol, methanol or water. All extracts exhibited anti-bacteria...

  17. Maria Rizzarelli, Una terra che è solo visione. La poesia di Pasolini tra cinema e pittura

    Directory of Open Access Journals (Sweden)

    Paolo Lago

    2016-11-01

    Full Text Available La contaminazione tra scrittura e visione, la «natura anfibologica» tra parola e immagine, secondo una definizione dello stesso autore, risulta fondamentale nell’intera opera letteraria di Pier Paolo Pasolini.

  18. Apertura dei lavori

    Directory of Open Access Journals (Sweden)

    Giovanni Renga

    2003-05-01

    Full Text Available

    Questa sessione apre i lavori dell’VIII Conferenza di Sanità Pubblica della nostra Società. Il programma che vi è stato presentato, la sede in cui si svolge, la qualità e la dimensione della vostra partecipazione riconfermano la validità di una formula che si è andata consolidando nel tempo e rappresenta ormai, insieme al Congresso Nazionale biennale, il fiore all’occhiello della ricchissima attività convegnistica della SItI.

    Si conferma anche la straordinaria continuità e coerenza della nostra società scientifica nell’interpretare, a livelli qualitativi sempre più elevati, la propria missione di individuazione, approfondimento e disseminazione della conoscenza necessaria per migliorare l’azione di Sanità Pubblica nel nostro Paese.

    La sessione testimonia questa attenzione! Con il tema della SARS, la Relazione di Pietro Crovari dà conto delle linee di comportamento dell’apparato di sanità pubblica nell’affrontare un problema che ha scosso l’opinione pubblica mondiale risvegliando anche nei paesi più progrediti antiche paure e arcaici pregiudizi; che ha provocato contraccolpi enormi in ambito commerciale ed economico; che ha richiamato l’attenzione su regole e precauzioni tanto scontate da risultare poi in pratica quasi inapplicate. La risposta italiana è stata corretta, impostata sulle conoscenze scientifiche adottate con pragmatico buon senso. Una autorevole presenza della cultura igienistica nelle sedi decisionali ci consente anche di guardare con serenità ai possibili rischi ancora ipotizzabili.

    La partecipazione alla Comunità Europea e l’adesione ai suoi principi e le sue regole stanno producendo una serie di cambiamenti che arriveranno a incidere anche sui nostri modelli di prevenzione. La Relazione di Vittorio Carreri fornirà il punto di vista di uno sperimentato ed attento conoscitore della materia riguardo agli innumerevoli problemi già aperti e su quelli ancora incombenti sul

  19. Progetto EURAMET: HLT03 DUTy - Dosimetria per terapie ultrasonore. Confronto tra metodi di misura - EURAMET: HLT03 DUTy - Dosimetry for ultrasound therapy. Intercomparison of methods

    Directory of Open Access Journals (Sweden)

    Giovanni Durando

    2016-03-01

    Full Text Available La mancanza di una definizione della dose ultrasonora rende di fatto impossibile la valutazione della più appropriata “quantità” energia ceduta ai tessuti dal fascio ultrasonoro emesso da un trasduttore durante una terapia. Il progetto di ricerca “Dosimetry for Ultrasound Therapy - DUTy”, finanziato dal programma di ricerca EURAMET EMRP, aveva tra i suoi principali obiettivi, oltre al confronto interlaboratorio che validasse le capacità metrologiche dei laboratori partecipanti, la ricerca della definizione di dose ultrasonora che consentisse la definizione di un piano terapeutico specifico per ogni paziente. ------ Standardized and traceable dose has not yet been developed for medical ultrasound applications. This means that the ‘amount’ of ultrasound required for a particular therapy cannot be calculated and that the ‘amount’ actually delivered quantified. The aim of EURAMET EMRP project “Dosimetry for Ultrasound Therapy - DUTy” project was developing the metrological infrastructure (definitions, validated measurement and modelling methods which underpins the specification of dose for therapeutic ultrasound applications allowing appropriate treatment planning and risk assessment.

  20. Antarctic environmental specimen bank. A tool for chemical monitoring

    Energy Technology Data Exchange (ETDEWEB)

    Soggia, F.; Dalla Riva, S.; Abelmoschi, M.L.; Frache, R. [Genoa Univ., Genoa (Italy). Dipt. di Chimica e Chimica Industriale

    2000-02-01

    The work illustrates the project on Antarctic Environmental Specimen Bank (BCAA), which is an integral part of the Italian project on the micropollutants chemistry (sector on chemical contamination of the Italian Antarctic Research program, PNRA), begun in 1994 when the BCAA was installed in the department of chemistry and industrial chemistry (Genoa University, Italy). Its objective underlines an emphasis on environmental chemistry and the establishment of baselines similar to the approaches followed by the other environmental specimen banks, begun at the end of Sixties with the aim of long-term storage of representative environmental specimens in order to study the presence and the evolution of dangerous substances, but focus on the chemical characterization of samples. [Italian] Il lavoro illustra le finalita' del Progetto su una Banca Campioni Ambientali Antartici (BCAA), che e' parte integrante del progetto Chmica dei microinquinannti del Settore Contaminazione chimica del Programma Nazionale di ricerche in Antartide (ONRA), nata nel 1994 presso il dipartimento di chimicia e chimica industriale dell'universita' di Genova. A differenza di altri progetti internazionali che enfatizzano gli aspetti biologici, ecologici e medici, il progetto BCAA enfatizza la chimica ambientale.

  1. BPM Magazine : biobased performance materials

    NARCIS (Netherlands)

    Bolck, C.H.; Bos, H.L.; Gennip, van E.; Zee, van der M.

    2011-01-01

    BPM magazine is een uitgave van het Biobased Performance Materials programma. In dit programma werken kennisinstellingen en bedrijven samen aan nieuwe biobased plastics en aan toepassingsgericht onderzoek om de eigenschappen van bestaande biokunststoffen te verbeteren.

  2. Formation et initiation à la tâche : éléments de ritualisation favorisant le développement d’une culture de santé et sécurité au travail auprès des travailleurs immigrants Training and initiation to the task: ritual elements promoting the development of a culture of health and safety at work for immigrant workers Formación e iniciación a la tarea : elementos de ritualización que favorecen el desarrollo de una cultura de salud y seguridad en los trabajadores inmigrantes

    Directory of Open Access Journals (Sweden)

    Sylvie Gravel

    2011-11-01

    Full Text Available Le présent article traite une partie des résultats d’une étude portant sur les stratégies favorables à la prise en charge des mesures de santé et sécurité au travail (SST dans les petites entreprises montréalaises (PE embauchant une main-d’œuvre immigrante. Dans cet article est abordée entre autres l’influence de l’immigration sur la capacité et la motivation des superviseurs et des travailleurs à participer à la gestion des mesures de SST dont celles de la formation et de l’initiation à la tâche.. L’échantillon comprend 28 PE de Montréal ayant entre 10 et 50 travailleurs répartis en deux groupes : a PE d’observation ayant 25 % et plus de travailleurs immigrants (n=19; b PE de comparaison ayant 75 % et plus de travailleurs nés au Canada (n=9. Les résultats indiquent que les compétences des dirigeants et la formation acquise dans leur pays d’origine orientent l’adoption de rituels de prévention dès l’embauche des nouveaux travailleurs. Enfin, malgré l’importance de la présence de travailleurs immigrants dans les PE, seulement deux entreprises de notre échantillon ont adapté leur formation aux nouveaux employés immigrants.This study examines the influence of immigration on motivation and ability of supervisors and workers in small business (SB to participate in health and safety measures (OSH management. The sample consists of 28 Montreal’s SB between 10 and 50 workers divided into two groups: a SB observation with 25 % or more immigrant workers (n=19; b SB compared with 75 % and more Canadian-born workers (n=9. The results indicate that managers’ competencies and training developed in their country of origin condition their approach concerning hiring and training rituals. Despite the importance of immigrant workers’ presence, only two companies in our sample have adapted their training for new immigrant employees.El presente artículo trata una parte de los resultados de un estudio sobre

  3. Habitat networking: a new chance for the otter in Europe?

    Directory of Open Access Journals (Sweden)

    Claus Reuther

    1995-12-01

    Full Text Available Abstract One of the main problems for otter protection in Germany as well as in Europe is the fragmentation and isolation of populations. In Germany a thriving population exists in the eastern parts of the country while in the central parts only isolated populations remain, and in the western parts the species is extirpated. On the basis of this situation a habitat network program is in progress with the aim to protect and restore not only those habitats where the otter still remains but also those habitats which can function as a network to connect the thriving with the isolated populations. This network focuses on existing protected wetlands or rivers and restoration activities in wetlands or rivers. The situation of the otter in Europe (excluding Scandinavia and the British Isles is comparable to that in Germany. There are stable or thriving populations in the eastern and western parts while in Central Europe only isolated populations remain. Following the German otter habitat network program possibilities are shown and discussed to establish a habitat network program for the otter on a European level. Riassunto Ripristino di una rete di ambienti favorevoli alla lontra: una nuova possibilità per la specie in Europa? - Uno dei principali problemi riguardanti la conservazione della lontra (Lutra lutra in Germania, come del resto in Europa, è la frammentazione e l'isolamento delle popolazioni. In Germania, una cospicua popolazione esiste nella parte orientale, mentre in quella centrale sono presenti nuclei isolati; nella porzione occidentale del paese la specie è invece praticamente estinta. Tenendo presente questa situazione, è stato avviato un programma di ricostruzione di una rete di ambienti favorevoli alla lontra con l'obiettivo di proteggere e ripristinare non solo gli ambienti in cui la specie è attualmente presente, ma anche quelli che possono funzionare come rete di

  4. L'educazione di un "Architetto-Urbanista". Manuel Solà-Morales e la Pedagogia Urbana all'ETSAB / The Education of an "Architect-Urbanist". Manuel Solà-Morales and Urban Pedagogy at the ETSAB

    Directory of Open Access Journals (Sweden)

    Marta Caldeira

    2016-10-01

    Full Text Available In qualità di docente, fondatore e direttore del Laboratori d’Urbanisme de Barcelona presso la ETSAB dal 1969 al 2012, l’architetto e urbanista spagnolo Manuel Solà-Morales ha curato la riforma chiave della pedagogia urbana della scuola di Barcellona. Deciso a superare la tendenza tecnocratica che aveva contraddistinto l’architettura e la pianificazione spagnola durante l’ultimo decennio del regime di Franco, l’obiettivo di Solà-Morales fu la formazione di quello che definì l’‘architetto-urbanista’ attraverso un programma propedeutico che accorpava architettura e urbanistica in un’unica disciplina. Sotto l’egida della morfologia urbana, il nuovo corso di Urbanistica impartito dal corpo docente del LUB diede il via allo studio della città e della sua storia come base principale di ogni progetto architettonico e urbano. / As professor and founding director of the Laboratori d’Urbanisme at the ETSAB from 1969 to 2012, Manuel Solà-Morales oversaw the pivotal reform of urban pedagogy in the Barcelona school. Determined to overcome the technocratic tendency that marked Spanish architecture and planning in the final decade of Franco’s regime, Solà-Morales’ mission was to educate what he defined as the ‘architect-urbanist’ through a foundational program that unified architecture and studies of urban form as a single discipline. Under the aegis of urban morphology, the new course of Urbanística taught by LUB’s team instituted the study of the city and its history as the primary ground for every architectural and urban project.

  5. Sviluppi di Ricevitori E di Componentistica Per Banda 3 mm Ad INAF-OA Cagliari

    Science.gov (United States)

    Navarrini, Alessandro

    2017-11-01

    L'INAF-OA Cagliari (OACa) sta sviluppando un ricevitore criogenico a basso rumore basato su un mixer SSB (Single Side Band) a superconduttore SIS (Superconductor-Insulator-Superconductor) per la banda 3 mm. Il ricevitore, acquistato da IRAM, è stato fortemente modificato per essere adattato al fuoco Gregoriano di SRT (Sardinia Radio Telescope). Lo strumento è caratterizzato da una nuova criogenia a ciclo chiuso 4 K (per evitare l'uso di elio liquido in antenna), da un nuovo oscillatore locale (di tipo ALMA Banda 3) e da un nuovo sistema di controllo e di monitoraggio basato su schede Raspberry ed Arduino sviluppato ad OACa. Verranno presentati i recenti sviluppi sul ricevitore, inclusi i risultati preliminari della misura della temperatura di rumore, che raggiunge un valore pari a Trec=66 K alla frequenza di 86 GHz, nonostante la criogenia non sia ancora ottimizzata. L'INAF-OACa è coinvolto nel progetto AETHRA (Advanced European Technologies for Heterodyne Receivers for Astronomy) nel quadro del programma Radionet/Horizon2020 per il quale sta contribuendo al WP1 (Work Package 1). Lo scopo del WP1 è di sviluppare e costruire un dimostratore di un array di ricevitori a doppia polarizzazione per la banda 3 mm basato su amplificatori criogenici a basso rumore (LNA) in tecnologia a semiconduttore MMIC. Nell'ambito del WP1 l'OACa ha in carico il progetto di un OrthomodeTransducer (OMT) in guida d'onda o in tecnologia planare per la banda 72-116 GHz che sia integrabile con amplificatori MMICs ed adatto all'integrazione in un array da installare nel piano focale di un radiotelescopio. Verranno presentati i design preliminari degli OMT per AETHRA, che sono basati su prototipi sviluppati in passato da OACa.

  6. Lo screening auxologico: un'indagine necessaria per la prevenzione dell'obesitá in etá scolare

    Directory of Open Access Journals (Sweden)

    R. La Licata

    2003-05-01

    Full Text Available

    Obiettivi: l’interesse suscitato dall’obesità in età scolare è in continuo aumento, sia a causa della prevalenza sempre più estesa di tale patologia in questa età, sia perché il bambino vive con ansia e ostilità questo suo stato divenendo spesso oggetto di derisione da parte del gruppo. In un progetto di educazione alimentare che potesse avere un’azione di prevenzione primaria nei riguardi dell’obesità in età evolutiva; il nostro obiettivo è stato quello di effettuare uno screening prima di iniziare l’intervento su una porzione di popolazione scolastica per valutare lo stato auxologico dei soggetti e saggiare le loro conoscenze sulla nutrizione e sulle abitudini alimentari. Abbiamo ritenuto che ormai sia assolutamente necessario ricavare queste informazioni per poi programmare interventi efficaci ed efficienti per migliorare la qualità di ogni programma di educazione alimentare.

    Materiali e metodi: l’indagine condotta in tre scuole elementari di Palermo ha coinvolto per ogni scuola due terze, due quarte, due quinte per un totale di 360 bambini con un’età compresa tra i 7 e gli 11 anni. Per la valutazione auxologica sono stati presi in considerazione statura, peso ed età cronologica secondo il metodo di J.M. Tanner. Il rilevamento delle abitudini alimentari e stili di vita è stato effettuato per mezzo di un questionario a risposta multipla.

    Risultati: dai risultati di questa indagine preliminare è emerso che la prevalenza dell’obesità in età evolutiva nella nostra popolazione si avvicina notevolmente a quella italiana che è del 19%. Lo stile di vita sedentario aggrava la già precaria situazione dovuta alla cattiva alimentazione.

    Conclusioni: dalle considerazioni fatte appare evidente quanto sia necessario e urgente un intervento efficiente di educazione alimentare che non resti sporadico e privo di una metodologia ben

  7. Tecnocrazia e politica in Italia dalla crisi del 1907 al Primo Dopoguerra = Technocracy and political crisis in Italy from 1907 till the early after World War

    Directory of Open Access Journals (Sweden)

    Marcello Benegiamo

    2014-12-01

    Full Text Available Uscito a pezzi dalla pesante crisi finanziaria e industriale del 1907, che aveva messo a nudo i limiti della struttura economica del Paese, il capitalismo industriale italiano elaborò un programma, portato avanti fino al primo dopoguerra, che prevedeva l’instaurazione di un governo di tecnocrati. Questo avrebbe dovuto trainare il Paese fuori dalla crisi, pianificarne l’economia e trasformarlo in una grande potenza industriale, con forti connotazioni imperialistiche. Segnali in tale direzione si erano registrati anche nei decenni precedenti, tra fine Ottocento e inizi Novecento, quando ebbe inizio un processo di concentrazione nel settore siderurgico e meccanico. Un percorso peraltro stimolato dalle commesse statali sempre più consistenti (Galli Della Loggia, 1970; Battilossi, 1999; Amatori e Colli, 1999; Bolchini, 2002. La crisi industriale e finanziaria del 1907 e la recessione a livello mondiale che ne seguì, accelerarono la soluzione tecnocratica, che prevedeva un’alleanza, più o meno stretta, con una parte della classe politica e l’entrata in guerra. Negli anni immediatamente seguenti il conflitto, il potere dei tecnocrati sulla scena politica italiana sembrò accrescersi notevolmente, soprattutto quando il governo progettò un programma di espansione economica nelle regioni del Caucaso, nei Balcani e nel Levante ex ottomano, territori in grado di fornire materie prime e di assorbire la produzione italiana in eccesso rispetto alle richieste di un mercato interno asfittico. La collaborazione tra mondo imprenditoriale, bancario e politico non produsse il risultato sperato. La caduta del governo Nitti e il ruolo destabilizzante e filotedesco della Banca Commerciale Italiana nell’Est europeo e nel Caucaso furono tra le cause principali che impedirono il decollo del progetto tecnocratico, provocando una dura reazione da parte dei fratelli Perrone alla guida del gruppo Ansaldo. Heavily Weakened by the financial and industrial crisis

  8. Il Corporativismo: un paradosso della politica economica dello stato fascista = Corporativism: a paradox of the economic policy of the fascist state

    Directory of Open Access Journals (Sweden)

    Natascia Ridolfi

    2014-12-01

    Full Text Available Uscito a pezzi dalla pesante crisi finanziaria e industriale del 1907, che aveva messo a nudo i limiti della struttura economica del Paese, il capitalismo industriale italiano elaborò un programma, portato avanti fino al primo dopoguerra, che prevedeva l’instaurazione di un governo di tecnocrati. Questo avrebbe dovuto trainare il Paese fuori dalla crisi, pianificarne l’economia e trasformarlo in una grande potenza industriale, con forti connotazioni imperialistiche. Segnali in tale direzione si erano registrati anche nei decenni precedenti, tra fine Ottocento e inizi Novecento, quando ebbe inizio un processo di concentrazione nel settore siderurgico e meccanico. Un percorso peraltro stimolato dalle commesse statali sempre più consistenti (Galli Della Loggia, 1970; Battilossi, 1999; Amatori e Colli, 1999; Bolchini, 2002. La crisi industriale e finanziaria del 1907 e la recessione a livello mondiale che ne seguì, accelerarono la soluzione tecnocratica, che prevedeva un’alleanza, più o meno stretta, con una parte della classe politica e l’entrata in guerra. Negli anni immediatamente seguenti il conflitto, il potere dei tecnocrati sulla scena politica italiana sembrò accrescersi notevolmente, soprattutto quando il governo progettò un programma di espansione economica nelle regioni del Caucaso, nei Balcani e nel Levante ex ottomano, territori in grado di fornire materie prime e di assorbire la produzione italiana in eccesso rispetto alle richieste di un mercato interno asfittico. La collaborazione tra mondo imprenditoriale, bancario e politico non produsse il risultato sperato. La caduta del governo Nitti e il ruolo destabilizzante e filotedesco della Banca Commerciale Italiana nell’Est europeo e nel Caucaso furono tra le cause principali che impedirono il decollo del progetto tecnocratico, provocando una dura reazione da parte dei fratelli Perrone alla guida del gruppo Ansaldo. Heavily Weakened by the financial and industrial crisis

  9. La langue qui fâche : quand la norme qui lâche suscite l’insulte When norms loosen, abuse pops up and language offends

    Directory of Open Access Journals (Sweden)

    Laurence Rosier

    2012-04-01

    Full Text Available Dans cet article nous proposons d’étudier les titres de groupes facebook dont les dénominations visent à dévaloriser les locuteurs qui ne maîtrisent pas la norme linguistique. On verra que lorsqu’il s’agit de la maîtrise de la langue, les internautes stigmatisent les accrocs à la norme et peuvent adopter des attitudes d’une extrême violence : les fautes sont considérées comme insultantes pour ceux qui maîtrisent la langue. La violence verbale observée trouverait sa légitimité dans le fait qu’il y a « outrage à la langue » : les locuteurs « censeurs » seraient dès lors autorisés à produire un discours violent « outrageant » vis-à-vis des faiseurs de fautes. Nos analyses montreront que l’appel au regroupement contre les « locuteurs-fauteurs » repose sur une doxa commune (l’importance de la maîtrise de la langue plutôt que sur une argumentation explicite. Nous verrons comment se manifeste linguistiquement la violence verbale dans notre corpus (phénomènes énonciatifs, processus interactionnel,… et où se situent les dénominations facebookiennes sur une échelle graduée de violence.In this article, we study the names of facebook groups which aim at reducing the value of the speakers who do not control linguistic norms. The internet users stigmatize tears in norm and can adopt attitudes of an extreme violence: errors are considered as insulting for those who master the language. The “offense to the language” is supposed to legitimize verbal violence: the speakers “censors” would since then be authorized to produce a violent speech "offending" in relation to the miracle-workers of errors. Our analyses will show that the call to grouping against the “speakers-troublemakers” rests on a common doxa (the importance of the workmanship of the language rather than on a definite argumentation. We will examine the various manifestations of verbal violence (on the level on enunciation, interaction, etc., and check where the names of the Facebook groups stand on a gradual scale of violence.

  10. Stringhe alla prova dei fatti In arrivo il primo esperimento che vaglierà la teoria delle stringhe

    CERN Multimedia

    Pisani, Stefano

    2007-01-01

    The first experiment that will test the string theory validity will be done with the Large Hadron Collider, the particle accelerator of CERN, that will come into force at the end of this year. (1/2 page)

  11. A Modular Approach to Integrating Biofuels Education into ChE Curriculum Part I--Learning Materials

    Science.gov (United States)

    He, Q. Peter; Wang, Jin; Zhang, Rong; Johnson, Donald; Knight, Andrew; Polala, Ravali

    2016-01-01

    In view of potential demand for skilled engineers and competent researchers in the biofuels field, we have identified a significant gap between advanced biofuels research and undergraduate biofuels education in chemical engineering. To help bridge this gap, we created educational materials that systematically integrate biofuels technologies into…

  12. Da invisibile a visibile ecco la materia oscura Prima mappa in 3D della sostanza che regge l'universo

    CERN Multimedia

    Bianucci, Piero

    2007-01-01

    It's the first view of the black matter, mysterious matter that constitute a third of the mass of the universe. It has the structure of a big sponge and with its garvitational force, it is at the origin of the birth of galaxies and stars (3/4 page)

  13. Un rilievo sotto sopra Modelli digitali 3D ad alta definizione sia dei fondali che delle coste

    Directory of Open Access Journals (Sweden)

    Codevintec Italiana Srl Codevintec Italiana Srl

    2009-03-01

    Full Text Available An upside down survey: shores and sea bed hi-res 3D digital models Laser scanning and interferometric bathymetry represent the cutting edge of coastal survey technology and can be very beneficial for mapping complicated waterside areas. The similarity of the data provided by the two systems (point cloud and intensity value make it easy to integrate the two surveys using PolyWorks commercial software. The final product is a single 3D model made up of bathymetry and topography. Since 2004 Codevintec tested the integration of these two methodologies, carrying out a number of high resolution surveys, generating a complete and accurate digital model of areas both above and below water level, a result inimitable by any other topographical survey method. The 3D-laser scanner was an Optech ILRIS-ER that allows scanning in dynamic from the boat while a SEA SWATHplus-H wide swathsonar system was used to collect underwater topography. A combined GPS and inertial platform (Applanix POS/MV 320 is used to measure position and 3D attitude of the two sensors during the survey.

  14. Kartei unveroffentlichter linguistischer Arbeiten zur Deutschen Spra che der Gegenwart (KULA) (Bibliography of Unpublished Linguistic W orks on Contemporary German)

    Science.gov (United States)

    Toman, Jindrich

    1974-01-01

    This bibliography includes titles of unpublished works in various fields of linguistics such as grammar (morphology, phonology and syntax), socioli nguistics, psycholinguistics, foreign language instruction, language acquisit ion, discourse analysis, poetics, etc. (Text is in German.) (DS)

  15. Caractérisation de la Biomasse sèche des mosaïques forêt-savane ...

    African Journals Online (AJOL)

    SARAH

    2 sept. 2013 ... statistique réalisée sur ces données a montré que la productivité moyenne de biomasse ... impact économique notamment dans le cadre du programme REDD. .... notamment Hyparrhenia diplandra, Loudetia demeusii les.

  16. Faire crédit : de la noble tâche à la corvée

    OpenAIRE

    Lazarus, Jeanne

    2012-01-01

    Malgré le « tournant commercial » des banques de détail françaises, de multiples registres de relations subsistent dans les interactions entre employés de banque et clients. Nous en distinguons quatre : le commerçant, le conseiller, le juge et le sauveur. L’analyse du crédit permet de voir à l’œuvre ces différents registres et montrer que la banque ne peut se définir comme un lieu de commerce pur. En effet, les crédits ne sont pas des produits à vendre comme les autres, et leur commercialisat...

  17. La carriera di un economista. che cosa? Perchè? Come? (An economist’s career: what? why? how?

    Directory of Open Access Journals (Sweden)

    R. TRIFFIN

    2013-12-01

    Full Text Available Il documento è un contributo ad una serie di ricordi e riflessioni sulle esperienze professionali di illustrieconomisti con Banca Nazionale del Lavoro Quarterly Review iniziate nel 1979. In esso Robert Triffin fornisce riflessioni personali sulla sua carriera, il suo marchio personale di economia pratici, e la sua filosofia di vita.The paper is a contribution to a series of recollections and reflections on the professional experiences of distinguished economists which the Banca Nazionale del Lavoro Quarterly Review started in 1979. In it Robert Triffin provides personal reflections on his career, his personal brand of practical economics, and his life philosophy.JEL: B31

  18. Interruzione del trattamento nei pazienti con schizofrenia che ricevono olanzapina o aripiprazolo: metanalisi degli studi clinici controllati

    Directory of Open Access Journals (Sweden)

    Benedetta Santarlasci

    2005-03-01

    Full Text Available BACKGROUND: In schizophrenia the drop-out rate can be used as proxy of effectiveness. The drop-out evaluation is also important considering the relevant economic impact for NHS of an antipsychotic therapy discontinuation in terms of patient hospitalization and other related healthcare resources consumption. OBJECTIVE: To analyze the differences in the rates of drop-out from clinical trials between olanzapine and aripiprazole. METHODS: Literature search was based on MEDLINE, on Iowa-IDIS and Drugdex databases (1966-Dec 2004. Analysis included 12 randomized controlled trials (3.778 patients, 8 for olanzapine (2.559 patients and 4 for aripiprazole (1.219 patients. RCT inclusion criteria were: a Patients affected by schizophrenia; b Randomized assignment to olanzapine or aripiprazole treatment group; c Number of patients included in the treatment group higher than 100; d Drop-out frequency evaluation between 4th and 26th weeks of follow-up. RESULTS: The rate of treatment discontinuation was greater for aripiprazole than for olanzapine (42,2% vs. 31,6% respectively. The comparison between drop-out percentages is statistically significant (p<0,001. CONCLUSIONS: The incidence of drop-outs was better controlled in the olanzapine group of studies than in the aripiprazole group of studies.

  19. Il protonio nasce dall'antimateria Assomiglia sia ad un atomo di idrogeno che a uno di anti-idrogeno

    CERN Multimedia

    2006-01-01

    For the fist time in the history, a chemical reaction has been realized between matter and antimatter; from this reaction is born the "new born" protonio, made of one ion of hydrogen and one of anti-hydrogen

  20. Dal parco-spiaggia al paesaggio che in-segna: significati sovrapposti della natura intorno alla metropoli

    Directory of Open Access Journals (Sweden)

    Tomaso Colombo

    2013-03-01

    Full Text Available The author, cultural manager of Parco Nord (Milano, points out the key elements of this periurbanpark that since the Seventies has been managing to turn out an outskirts in a new attractive point ofthe town.A park has not only an environmental meaning but also a cultural one: its identity may influencepeople’s behaviours, uses and expectations as well. Thus territorial and hystorical features becomeopportunities for cultural planning, and they are taken in account when devicing opportunities forfruition and animation, always aiming at reinforcing the parks’s own identity.Colombo articulates the three guiding principles that steer the park’s cultural planning, then he recallsseveral site-specific events, from Biodiversity festival, that takes place every year, to the theaterperformances in nature such as The third Step, a visionary walk through the park at night and at dawn,taken as a symbol of a certain way of doing culture strictly connected to a way of living in nature.

  1. Recombinant butyryl-cholinesterase (RBuChe) therapy following VX poisoning by the percutaneous route: preliminary studies

    International Nuclear Information System (INIS)

    Speakman, P.; Armstrong, S.

    2009-01-01

    Medical countermeasures to prevent or mitigate the effects of nerve agent poisoning are part of the UK MoD's integrated approach to CBRN defence. Protexia is currently in advanced development as a pretreatment for nerve agent poisoning by PharmAthene in collaboration with US DoD. The principle of its use in this context has been demonstrated in a model of inhalation exposure. Nerve agent poisoning by the percutaneous route poses additional challenges for medical countermeasures. The present study investigates the effects of non-pegylated rBuChE administered following poisoning by VX in an animal model of percutaneous exposure. This investigation is part of an ongoing programme of work assessing the potential of candidate medical interventions. Male guinea pigs implanted with dermal and blood microdialysis probes were maintained under anaesthesia. VX (296 micro g/kg or 740 micro g/kg) was applied to the dorsal skin and non-pegylated rBuChE or placebo was administered (i.v.) 30 minutes later. Dialysate fractions were collected for 8 hours and VX was analysed by LC-MS-MS. Cholinesterase levels were measured in selected tissues post mortem. Following VX (296 micro g/kg), non-pegylated rBuChE significantly reduced the concentration of VX in the blood but had no effect on dermal concentrations; additionally following VX (740 micro g/kg), non-pegylated rBuChE prevented lethality. Tissue cholinesterase activity was inhibited following VX exposure but in those animals treated with rhBuChE, activities were similar to control values. To our knowledge these results provide the first evidence of the mechanism of therapeutic intervention with rBuChE. Further work is necessary to increase confidence in these preliminary observations by conducting confirmatory studies. Crown Copyright 2008. This work was carried out as part of the UK MoD NBC Research Programme. Non-pegylated rBuChE was supplied by PharmAthene under a materials transfer and non-disclosure agreement. (author)

  2. Studio dei fattori che influenzano la digeribilità della fibra nella bovina da latte: approcci dinamici

    OpenAIRE

    Bonfante, Elena

    2017-01-01

    I ruminanti sono altamente specializzati nella digestione della fibra. In condizioni di ottima funzionalità digestiva, sono le particelle di foraggio ad essere trattenute per lungo tempo nel rumine dove possono essere degradate dai batteri cellulosolitici. Nonostante queste conoscenze, la stima della degradabilità ruminale delle porzioni potenzialmente degradabili delle fibre è stata notevolmente sottostimata da taluni modelli dinamici di razionamento. Studi più recenti realizzati da Kriz...

  3. The European Regulation no. 761/2001 EMAS; Il Regolamento Europeo no.761/2001 EMAS: principi, obiettivi e principali esperenze in atto

    Energy Technology Data Exchange (ETDEWEB)

    Andriola, L.; Battellini, S. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Unita tecnico scientifica Protezione e Sviluppo dell' Ambiente e del Territorio, Tecnologie Ambientali

    2005-08-15

    The Regulation 761/2001 EMAS (Environmental Management and Audit Scheme), introduced by the 1836/93 Community regulation, is one of the tools activated by the European Union in order to apply the 5. and 6. Community Environmental Programme, in the field of firm-environment interactions at first (overcoming the old Command and Control logic), then by extending its applicability to ali Organisations. EMAS is a voluntary tool that enables Organisations to evaluate their own interaction with the Environment, to plan and check the yearly improvement of their environmental performance, providing the public documented relevant information. The report illustrates the procedure far applying this regulation, its implementation and new application trends in Italy and the advantages far firms. [Italian] II Regolamento n.761/2001 EMAS (Environmental Management and Audit Scheme), introdotto con il Regolamento Comunitario 1836/93, e uno degli strumenti che l'Unione europea ha attivato per l'applicazione del quinto e sesto Programma di Politica e Azione per l'Ambiente, inizialmente con particolare riferimento alle interazioni impresa-ambiente (superando la vecchia logica del Command and Control), e successivamente estendendone la possibilita di impiego a tutte le Organizzazioni. Lo strumento EMAS e uno strumento volontario che consente alle organizzazioni di analizzare la propria posizione rispetto all' Ambiente, pianificando e monitorando di anno in anno il miglioramento della propria prestazione ambientale, comunicandone alcune pertinenti informazioni di sintesi al pubblico in forma documentata. II rapporto illustra il percorso per l'applicazione del Regolamento, il suo stato di attuazione e le ultime tendenze applicative in Italia, i vantaggi di EMAS per le Organizzazioni.

  4. Una ricerca sulla violenza di genere nell’Ateneo bolognese / Une recherche sur la violence de genre à l’Université de Bologne (Italie / A research on gender violence at the University of Bologna

    Directory of Open Access Journals (Sweden)

    Bisi Roberta

    2013-07-01

    Full Text Available Nell’articolo vengono proposte alcune riflessioni sui dati emersi da una ricerca condotta tra le studentesse universitarie dell’Ateneo bolognese. La ricerca in tema di “Gender –Based Violence, Stalking and Fear of Crime – Prevention and Intervention”, inserita entro il programma dell’Unione Europea “Prevention of and Fight Against Crime”, ha posto in evidenza la necessità che l’Università si impegni a preparare dal punto di vista professionale tutti gli operatori che, a vario titolo, lavorano su queste problematiche (volontari, forze dell’ordine, medici, operatori sociali, avvocati, giudici, ecc.. RésuméCet article a pour but de présenter quelques pistes de réflexion sur les données venant de la recherche “Gender –Based Violence, Stalking and Fear of Crime – Prevention and Intervention”. Les réponses des étudiantes de l’Université de Bologne ont mis l’accent sur le fait qu’il est nécessaire que l’Université s’engage plus activement dans le développement des programmes de formation pour tous les professionnels travaillant sur ce sujet (avocats, juges, policiers, médecins, volontaires, travailleurs sociaux.AbstractThe article suggests some reflections on data gathered from a research among female students of the University of Bologna. The research dealing with “Gender –Based Violence, Stalking and Fear of Crime – Prevention and Intervention”, highlighted the important role of the University in training all professionals involved in this matter (doctors, lawyers, police forces, judges, volunteers, social workers.

  5. The European Regulation no. 761/2001 EMAS; Il Regolamento Europeo no.761/2001 EMAS: principi, obiettivi e principali esperenze in atto

    Energy Technology Data Exchange (ETDEWEB)

    Andriola, L; Battellini, S [ENEA, Centro Ricerche Casaccia, Rome (Italy). Unita tecnico scientifica Protezione e Sviluppo dell' Ambiente e del Territorio, Tecnologie Ambientali

    2005-08-15

    The Regulation 761/2001 EMAS (Environmental Management and Audit Scheme), introduced by the 1836/93 Community regulation, is one of the tools activated by the European Union in order to apply the 5. and 6. Community Environmental Programme, in the field of firm-environment interactions at first (overcoming the old Command and Control logic), then by extending its applicability to ali Organisations. EMAS is a voluntary tool that enables Organisations to evaluate their own interaction with the Environment, to plan and check the yearly improvement of their environmental performance, providing the public documented relevant information. The report illustrates the procedure far applying this regulation, its implementation and new application trends in Italy and the advantages far firms. [Italian] II Regolamento n.761/2001 EMAS (Environmental Management and Audit Scheme), introdotto con il Regolamento Comunitario 1836/93, e uno degli strumenti che l'Unione europea ha attivato per l'applicazione del quinto e sesto Programma di Politica e Azione per l'Ambiente, inizialmente con particolare riferimento alle interazioni impresa-ambiente (superando la vecchia logica del Command and Control), e successivamente estendendone la possibilita di impiego a tutte le Organizzazioni. Lo strumento EMAS e uno strumento volontario che consente alle organizzazioni di analizzare la propria posizione rispetto all' Ambiente, pianificando e monitorando di anno in anno il miglioramento della propria prestazione ambientale, comunicandone alcune pertinenti informazioni di sintesi al pubblico in forma documentata. II rapporto illustra il percorso per l'applicazione del Regolamento, il suo stato di attuazione e le ultime tendenze applicative in Italia, i vantaggi di EMAS per le Organizzazioni.

  6. Il sistema EGNOS a supporto della navigazione sicura nei porti: il progetto SafePort

    Directory of Open Access Journals (Sweden)

    Antonio Casoria

    2012-09-01

    Full Text Available Il progetto SafePort, sviluppato all’interno del 7° Programma Quadro promosso dalla Unione Europea con la supervisione di European GNSS Agency (GSA che segue tutti i programmi applicativi inerenti ai sistemi GNSS europei, Galileo ed EGNOS, ha l’obbiettivo di migliorare la capacità recettiva dei porti europei, aumentando al contempo la sicurezza delle operazioni di navigazione, di attracco e di ormeggio. The EGNOS system to support safe navigation in ports: the project SafePORT SafePORT The project, developed within the 7 th Framework Programme  sponsored  by  European  Union  under  the  super-vision of European GNSS Agency (GSA, which follows all ap-plications relating to the European GNSS systems, Galileo and EGNOS, has the aim to improve receptive capacity of Europe-an ports, while increasing the safety of operations, navigation, docking and mooring.

  7. Il sistema EGNOS a supporto della navigazione sicura nei porti: il progetto SafePort

    Directory of Open Access Journals (Sweden)

    Antonio Casoria

    2012-09-01

    Full Text Available Il progetto SafePort, sviluppato all’interno del 7° Programma Quadro promosso dalla Unione Europea con la supervisione di European GNSS Agency (GSA che segue tutti i programmi applicativi inerenti ai sistemi GNSS europei, Galileo ed EGNOS, ha l’obbiettivo di migliorare la capacità recettiva dei porti europei, aumentando al contempo la sicurezza delle operazioni di navigazione, di attracco e di ormeggio.The EGNOS system to support safe navigation in ports: the project SafePORTSafePORT The project, developed within the 7 th Framework Programme  sponsored  by  European  Union  under  the  super-vision of European GNSS Agency (GSA, which follows all ap-plications relating to the European GNSS systems, Galileo and EGNOS, has the aim to improve receptive capacity of Europe-an ports, while increasing the safety of operations, navigation, docking and mooring.

  8. La ricerca di un senso di sé: la narrazione nei social network come possibilità di ricostruzione del tessuto sociale

    Directory of Open Access Journals (Sweden)

    Antonio Notarbartolo

    2011-04-01

    Full Text Available Diventa difficile, in questa situazione sfuggire alla logica della precarietà, così come riuscire a stabilire un discorso continuativo con una o più persone, se non ricorrendo a qualche trucco “tecnico” migliorativo. Rimane il grosso vantaggio rappresentato dalla comunicazione diretta, quasi in tempo reale, se le persone sono in quel momento collegate al programma, quindi sono in grado di replicare. Diventa quindi il possibile veicolo e motore di movimenti di opinione, di gruppi spontanei di persone, di emozioni che possono diventare “oceaniche”, come quando, in uno stadio gremito, tutti si muovono all’unisono sotto il segno della ola. Vengono così soddisfatte la partecipazione e la reciprocità nel bisogno di relazione, e viene soddisfatto il bisogno delle persone di narrazione, ovvero il bisogno di raccontare con leggerezza ad un possibile interlocutore, o ad una platea, la propria storia in frammenti, attraverso commenti puntuali, espressioni di intento, canzoni e immagini. La narrazione, oggi, è fenomeno sempre più raro, grazie al crollo del valore aggiunto rappresentato dall’esperienza, e si è trasformata in storytelling.

  9. CityLog, verso nuove soluzioni per la distribuzione urbana delle merci

    Directory of Open Access Journals (Sweden)

    Saverio Zuccotti

    2010-07-01

    Full Text Available La logistica urbana rappresenta oggi una delle principali sfide per una mobilità sostenibile. La distribuzione delle merci in città paga infatti in competitività quei problemi di cui è in parte responsabile: traffico, inquinamento, incidenti etc. Negli ultimi anni la sensibilità su questi aspetti di sostenibilità ambientale è cresciuta in maniera netta, e a livello europeo molta strada è stata fatta per predisporre le risposte più adeguate. Il progetto europeo CityLog, finanziato nell’ambito del Settimo Programma Quadro, vede oggi collaborare diciotto partner europei coordinati dal Centro Ricerche Fiat per migliorare la logistica urbana agendo lungo tre direttrici: •\tservizi telematici orientati alla logistica, per dare un contributo decisivo al miglioramento della pianificazione delle missioni utilizzando strumenti per il routing ottimizzato dei veicoli e il supporto informativo costante agli autisti dei veicoli; •\tsoluzioni a bordo veicolo, che rappresentano un fattore chiave per aumentare la flessibilità operativa di camion e furgoni; •\tunità di carico innovative, accuratamente progettate per essere utilizzate su veicoli diversi in missioni diverse. Ne deriva pertanto una famiglia di container compatti con un layout interno riconfigurabile così da poter essere utilizzati per scopi diversi.

  10. Chemistry Programme for Water Cooled Nuclear Power Plants. Specific Safety Guide (Russian Edition); Programma po vodno-khimicheskomu rezhimu dlya atomnykh ehlektrostantsij s vodookhlazhdaemymi reaktorami. Spetsial'noe rukovodstvo po bezopasnosti

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2014-02-15

    This publication provides guidance on establishing a high standard chemistry programme in accordance with plant safety policy and regulatory requirements. It will be useful to managers of operating organizations and other staff responsible for supporting or monitoring plant activities and for oversight of the plant chemistry programme, as well as to regulatory bodies. Contents: 1. Introduction; 2. Functions, responsibilities and interfaces; 3. Chemistry programme; 4. Chemistry control; 5. Chemistry aspects of radiation exposure optimization; 6. Chemistry surveillance; 7. Management of chemistry data; 8. Training and qualification; 9. Quality control of chemicals and other substances.

  11. Universal energy-dispersive EXAFS spectrometer based on SR beam of `Kurchatovskij Institute` and scientific program of investigations; Universal`nyj ehnergodispersionnyj EXAFS-spektrometr v Natsional`nom tsentre sinkhrotronnogo izlucheniya (`Kurchatovskij institut`) i nauchnaya programma issledovanij

    Energy Technology Data Exchange (ETDEWEB)

    Aksenov, V L; Ivanov, I N [Laboratory of Particle Physics, Joint Institute for Nuclear Research, Dubna (Russian Federation); Koval` chuk, M V [Institut Kristallografii, RAN, Moscow (Russian Federation); and others

    1997-12-31

    The scheme of the energy-dispersive EXAFS spectrometer is discussed. The spectrometer will be used for the solid state investigations on the Kurchatov Synchrotron Radiation Source KSRS. The main elements of the universal station are described, including the results of the positive-sensitive X-ray detector testing. The experimental investigations are presented which are supposed to be carried out with this EXAFS spectrometer. (author). 4 refs., 14 figs., 1 tab. Submitted to Poverkhnost`. Rentgenovskie, Sinkhrotronnye i Nejtronnye Issledovaniya.

  12. GAPHAT-II, program for outlined analysis of wind turbines. Part 1: model description and verification. GAPHAT-II, programma voor globale analyses van windturbines. Deel 1: Modelbeschrijving en verificatie

    Energy Technology Data Exchange (ETDEWEB)

    Schepers, J.G.

    1988-05-01

    The second version of the program GAPHAT (Outlined Analysis Program Horizontal Axis Wind Turbines) is discussed. The program can be used for investigated analysis and gives the following results: 1. aerodynamical coefficients as functions of high-speed, blade angle and rotor azimuth angle; 2. loads in the heart of the blade and on the rotor axis as function of the time; 3. dynamic behavior at different adjustments. The aerodynamic loads follow a combination of linear momentum theory and blade element theory. The resulting equations are calculated with a quadratic equation with the inflow angle as an unknown. Summation of aerodynamic, innate weight and centrifugal loads gives the total loads. For the blade angle control a few general models were developed: an active on/off control for power and a PID control for linear speed (PID is proportional, integral and differential control). Calculations of aerodynamic coefficients and of loads in the heart of the blade were compared to calculations with the program PHATAS-I. The differences are less than 10% in most cases. 16 figs., 7 refs., 1 tab

  13. Archeologia e città: la ricostruzione della linea di costa

    Directory of Open Access Journals (Sweden)

    Daniela Giampaola

    2009-11-01

    Full Text Available Argomento del contributo è la storia del paesaggio costiero antistante il nucleo più antico della città di Napoli ricostruita attraverso la procedura dello scavo archeologico, nel corso dei lavori per la realizzazione della linea 1 e 6 della Metropolitana. L’intervento archeologico si è rivelato un’occasione irripetibile di conoscenza, per la sua ampia dimensione e per la circostanza che si è sviluppato in un comparto topografico unitario quale il water front cittadino. Esso appare straordinario per l’intreccio di fattori diversificati: per la sua complessità tecnica e metodologica, per la rilevanza delle acquisizioni scientifiche, per lo stretto rapporto con un’opera pubblica di carattere ingegneristico che è parte di una delle più importanti trasformazioni della città contemporanea, avviata attraverso il Piano comunale dei trasporti. Occorre innanzitutto sottolineare che le indagini, dal punto di vista metodologico-procedurale, documentano una precoce attività di archeologia preventiva, avviata sin dalla metà degli anni ‘90 del secolo scorso, in un momento lontano dalle leggi vigenti che regolamentano l’impatto archeologico rispetto alle opere pubbliche. Nello stesso momento dell’inserimento di norme specifiche di tutela archeologica nella variante del PRG della città di Napoli, in base ad una concertazione fra il Ministero per i Beni e le Attività Culturali, il Comune di Napoli e la Società Metropolitana, Concessionaria delle opere, si sono inserite le attività di natura archeologica , dalle prospezioni preliminari sino alle indagini estensive delle stazioni, all’interno del programma dell’opera pubblica di cui sono diventate una fase operativa preliminare e ineludibile. Il progetto della linea 1, il cui obiettivo è di collegare alla fascia collinare della città, di recente servita da un efficiente trasporto su ferro, il nucleo più antico dell’insediamento napoletano, risparmia l’area urbana di Neapolis

  14. Evaluation and standardisation of fast analytical techniques for destructive radwaste control

    Energy Technology Data Exchange (ETDEWEB)

    De Simone, A.; Troiani, F. [ENEA, Unita' Rifiuti Radioattivi e Disattivazione Impianti, Centro Ricerche Saluggia, Vercelli (Italy)

    2001-07-01

    elevata risoluzione (HPIC) e del Conteggio a Scintillazione Liquida (LSC) su soluzioni ad elevato contenuto salino, e' stata eseguita utilizzando una soluzione sintetica di cemento contenente alcuni {beta}-emettitori che sono difficilmente rivelabili mediante tecniche di misura non-distruttive, insieme con altri radionuclidi importanti per la definizione dell'inventario radiologico nei rifiuti radioattivi. Dato che il lavoro richiedeva la manipolazione di soluzioni radioattive, e' stato progettato e realizzato un ambiente remoto in cui collocare l'apparato HPIC-LSC, in modo da operare in condizioni di sicurezza. Secondo quanto stabilito dal programma di ricerca, sono stati sviluppati e qualificati metodi analitici veloci per la separazione chimica e contemporanea rivelazione radiochimica degli elementi radioattivi di interesse. Dai risultati ottenuti, sono stati definiti alcuni protocolli di analisi che decrivono le condizioni operative dell'apparato HPIC-LSC, il loro campo di applicabilita', i limiti di rilevabilita' chimici e radiochimici.

  15. Caratterizzazione genetica di alcune popolazioni di cinghiale (Sus scrofa dell'Italia meridionale

    Directory of Open Access Journals (Sweden)

    M.F. Caliendo

    2003-10-01

    liberi, che probabilmente rappresentano popolazioni più omogenee. Tra le popolazioni in cui l?ibridazione col maiale sembra maggiore figurano quelle di Padula e Cerreta Cognole (allevamenti, insieme alle popolazioni di Sacco, Monteverde e Baronissi (individui liberi. La sola popolazione di Cuccaro Vetere presenta individui marcatamente assegnabili al genotipo cinghiale (Castelporziano. Data la grande diversificazione delle popolazioni di cinghiale (libere e allevate si ritiene necessaria una caratterizzazione più estesa e basata su tecniche molecolari prima di effettuare un programma di gestione rivolto a questa specie.

  16. Green economy: un'occasione per le aree montane

    Directory of Open Access Journals (Sweden)

    Maria Sapone

    2013-06-01

    Full Text Available È ormai opinione largamente condivisa che l’attuale “crisi” dell’organismo territoriale non sia soltanto economica ma anche ambientale. Quest’ultima tematica unita a quella della green economy potrebbero rappresentare l'occasione di intervenire sui sistemi territoriali non urbani, un tempo vitali per l’economia locale, ed oggi abbandonati a se stessi a favore delle aree urbanizzate, luoghi economicamente più vantaggiosi. Partendo dalle indicazioni del Programma per l’Ambiente delle Nazioni Unite (UNEP si potrebbero definire politiche di sviluppo al fine di migliorare la competitività e l'attrattività dei sistemi territoriali rurali attraverso la valorizzazione delle risorse endogene presenti su tali territori, con l’obiettivo di favorire lo sviluppo ecosostenibile delle diverse attività al fine di creare una rete integrata. La ricerca svolta presenta le diverse dinamiche legate alla creazione di una rete di Eco-Villaggi, con lo scopo di rifunzionalizzare il patrimonio edilizio e urbanistico esistente, migliorando, così, la qualità della vita dei centri montani. Questo modello può rappresentare concretamente una delle possibili soluzioni allo spopolamento, nel conservare e tutelare lo spazio naturale attraverso la promozione della green economy, basata sull’utilizzo di sistemi di produzione sostenibili, nel rispetto dei requisiti ambientali, nell’attivazione di sistemi energetici rinnovabili e nel richiamo turistico del patrimonio storico-culturale della montagna. Infatti queste risorse se gestite nel modo corretto, attraverso una attenta pianificazione territoriale, potrebbero rappresentare il volano per un modello di sviluppo sostenibile e allo stesso tempo potrebbero avviare una riqualificazione e valorizzazione dei borghi rurali, che spesso ospitano un patrimonio architettonico di notevole pregio. Risulta necessario, per i contesti rurali, porre in atto strumenti, modalità e forme innovative d’intervento capaci

  17. The Pragmatics of Virtual Environments. Compliment responses in Second Life

    Directory of Open Access Journals (Sweden)

    V. Cirillo

    2012-08-01

    l’apprendimento linguistico, rimangono ancora un terreno linguisticamente inesplorato. Ma se internet ha cambiato il modo in cui la gente interagisce, è anche plausibile che le norme sottostanti questa nuova forma di comunicazione siano cambiate; pertanto comprenderne il funzionamento aiuterebbe a comprenderne anche l’efficacia. Questo studio si propone di colmare un vuoto nella letteratura osservando come si risponde ai complimenti su Second Life. I risultati sono poi confrontati con le risposte ai complimenti nella conversazione reale per capire se la lingua usata negli ambienti virtuali riproduce fedelmente la lingua utilizzata nella conversazione faccia a faccia, e fino a che punto è conveniente e significativo per gli insegnanti integrare tali ambienti nelle pratiche d’insegnamento. I risultati mostrano una tendenza maggiore ad accettare i complimenti rispetto alla conversazione reale. Possibili implicazioni pedagogiche e indicazioni per ricerche future sono prese in considerazione.Parole chiave: pragmatica; risposte ai complimenti; ambienti virtuali; apprendimento linguistico

  18. Basiscursus SPSS (versie 18-19) [4e druk

    NARCIS (Netherlands)

    Grotenhuis, H.F. te; Matthijssen, A.C.B.

    2012-01-01

    Het statistische programma SPSS is al geruime tijd op de Nederlandse markt. In die periode zijn er ook veel leerboeken verschenen waarin het programma uitvoerig werd beschreven, vaak in combinatie met de bijbehorende statistische theorie. Dit boek wijkt af van deze aanpak doordat de auteurs zich

  19. KB WOT Fisheries 2013 - Maintaining Excellence and Innvovation in Fisheries Research

    NARCIS (Netherlands)

    Damme, van C.J.G.; Beek, van F.A.

    2013-01-01

    Het KB programma voor Visserijonderzoek onderhoudt en ontwikkelt de expertise, die nodig is om de WOT voor de visserij uit te voeren. De inhoud van het KB WOT-programma voor 2013 weerspiegelt de recente discussies tussen IMARES, CVO en EZ over de toekomstige richting van het onderzoek. De KB

  20. Lādētu daļiņu kustības magnētiskā laukā 3D modelēšana OpenFOAM vidē

    OpenAIRE

    Venčels, Juris

    2013-01-01

    Darbā tiek aplūkota aprēķinu programmas izveide un tās funkcionalitāte elektriskā un magnētiskā lauka modelēšanai trijās dimensijās, izmantojot magnētiskā vektorpotenciāla “A, V-A” formulējumu. Programma veidota uz atvērtā koda bibliotēkas OpenFOAM bāzes. Rezultāti salīdzināti ar programmas FEMM aksiāl-simetriskajiem aprēķiniem. Programma nodrošina multi-reģionu aprēķinus, iespēju vienlaicīgi modelēt dažādus procesus, uzdot fizikālu lielumu atkarību no citiem lielumiem. Programma modelē el...

  1. Le collezioni di Mammiferi del Museo Civico di Zoologia di Roma: una sintesi storica

    Directory of Open Access Journals (Sweden)

    Gloria Svampa

    2003-10-01

    Full Text Available Il Museo Civico di Zoologia di Roma è sorto nel 1932 all?interno del Giardino Zoologico dell?allora Governatorato di Roma, di cui ha condiviso la direzione tecnica ed amministrativa sino al 1998. Il nucleo centrale delle collezioni è costituito dal materiale di proprietà universitaria, di quello che fu il Museo di Zoologia della Regia Università, a sua volta diretto discendente delle collezioni del Museo di Zoologia ed Anatomia Comparata del Pontificio Archiginnasio Romano. La quasi totalità degli esemplari tassidermizzati risale al periodo in cui l?Istituto di Zoologia fu diretto da Antonio Carruccio (1883-1914. Dal 1932, la collezione teriologica si è andata arricchendo, in particolare di materiale osteologico, soprattutto con acquisizioni provenienti dal Giardino Zoologico e da rare spedizioni scientifiche, come quella organizzata dal CNR nell?Alto Rio Negro del 1962-3, guidata da Ettore Biocca. Anche a causa del fatto che per molti anni il Museo è stato privo di curatori, mancano importanti collezioni teriologiche da studio, fatta eccezione per quella cetologica. In molti casi, singoli esemplari potenzialmente di grande valore scientifico, mancano di dati esatti sulla località di cattura. Nell?ambito di un programma di ricatalogazione della collezione recentemente intrapreso, particolare attenzione è stata posta all?acquisizione di tutti i dati legati alla storia dei singoli esemplari, rintracciabili attraverso i resoconti di viaggio dei singoli esploratori. Nel periodo universitario, infatti, il Museo della nuova capitale d?Italia fu oggetto di grande attenzione da parte di privati ed enti, a partire dai Savoia, che donarono le loro collezioni o il materiale raccolto durante le spedizioni effettuate. Il lavoro di revisione in corso sta mettendo in luce una serie di esemplari meritevoli di ulteriori, dettagliate ricerche. È probabile che molto del materiale del Museo, pervenuto a Roma attraverso donazioni della famiglia reale

  2. The article 583 bis of the Criminal Code: an illicit committed in the name of religion? - L’article n° 583 bis du Code Pénal : un acte illicite commis au nom de la réligion? - L’articolo 583 bis c.p. un illecito compiuto in nome della religione?

    Directory of Open Access Journals (Sweden)

    Colombo C.

    2009-08-01

    Full Text Available Mutilations of female genital organs are a particularly difficult issue. That is the reason why it occupies historical, anthropological and medico-legal research. So the present article considers the situation in all these aspects together with the provisions introduced by Law n. 7, 9/1/2006 and article 583 bis of the Criminal Code for the Protection of the rights of women being mutilated.Indeed we believe that the mutilations are real and cause personal psychic injury. The custom of mutilation has nothing to do with religious beliefs, but is the product of old social prejudices against women, as an individual.La MGF (mutilation génitale féminine est un sujet de société tristement actuel dont on dit qu'elle est pratiquée au nom des croyances religieuses les plus ancestrales.C’est la raison pour laquelle j’ai voulu avant tout consulter, bien que brièvement, l'analyse anthropologique, historique, médico-légale et juridique effectuée sur cet argument pour me pencher ensuite sur la loi italienne n° 7 du 9/1/2006 et sur l’article n° 583bis du Code Pénal Italien, ayant trait à la sauvegarde des droits inaliénables de la femme qui subit une mutilation.En effet les mutilations sont de véritables lésions physiques et souffrances psychiques qui plus que motivées par des croyances religieuses sont dictées par d'anciens us et coutumes combles de préjugés sociaux envers la femme en tant qu’individu.Le mutilazioni degli organi genitali femminili rappresentano un tema tristemente attuale legato per “comodità” alle credenze religiose più arcaiche.Per questo motivo, l’articolo ha voluto, da subito, volgere uno sguardo, seppur breve, all’analisi antropologica, storica e medico-giuridica dell’argomento per poi considerare la legge n. 7 del 9/1/2006 (che ha attuato i principi della Dichiarazione e del Programma della IV Conferenza mondiale dell’ONU sulle donne - Pechino 1995, nonché le disposizioni degli artt. 2,3,32 della

  3. Associazionismo industriale e corporativismo: l’American Chamber of Commerce in Italy nell’epoca fascista = Industrial association and corporatism: The American chamber of commerce in Italy during the fascism age

    Directory of Open Access Journals (Sweden)

    Vittoria Ferrandino

    2014-12-01

    Full Text Available Il contributo in oggetto si propone di approfondire i rapporti tra le corporazioni e i gruppi industriali italiani da un’ottica particolare, quella dell’associazionismo che si concretizza con l’American Chamber of Commerce in Italy, instituita nel 1915 per agevolare le relazioni commerciali tra Italia e Stati Uniti. La grave crisi economica del 1930 e del 1931 e, poco dopo, le gravissime restrizioni portate agli scambi con l’estero dal programma autarchico del Governo fascista, influirono notevolmente sullo sviluppo della Camera. L’autorità dell’istituzione venne a diminuire, i rapporti con gli Stati Uniti si fecero più rari e il numero dei soci diminuì notevolmente. Alle corporazioni furono affidate le autorizzazioni sui nuovi impianti, la costituzione delle compagnie per la valorizzazione dell’Africa orientale italiana, il controllo sulle iniziative economiche nelle colonie, la collaborazione col fisco nella determinazione e nell’applicazione dei tributi ed infine il controllo sul commercio estero e sulle valute. Di conseguenza, la funzione che lo Stato avrebbe dovuto esercitare servendosi delle corporazioni finì col ricadere nelle mani dei grandi industriali, che le dominavano attraverso i loro rappresentanti. Da un lato, quindi, vi erano le corporazioni, che garantivano piena libertà ai gruppi industriali, avallandone le scelte; dall’altro lato, invece, vi erano le autorità governative che riconoscevano i limiti di competenza e d’intervento di quelle istituzioni e la necessità di una migliore definizione degli obiettivi. This contribution aims to examine the relationship between corporations and the Italian industrial groups from a particular perspective, which is that of associations through the American Chamber of Commerce in Italy, established in 1915 to facilitate the commercial relations between Italy and the United States. The economic crisis of 1930 and 1931 and, shortly after, the very serious restrictions

  4. Sedimentation Effects of Adding Flocculants to Leached Slurries at Lab Scale in the “Comandante Ernesto Che Guevara” plant in Cuba

    Directory of Open Access Journals (Sweden)

    Eluberto Espinosa-Espinosa

    2016-10-01

    Full Text Available The objective of this investigation was to evaluate the effects of adding PICIZ 7010, AN 910SH and Quimifloc N-30 flocculants to leached and magnetized slurries at lab scale. The evaluation was completed through the comparative method in accordance to the NRBI-579 Standard: Sedimentation Tests which use Talmage and Fitch method. The addition of Quimifloc N-30 flocculants to 6 g/t of reduced ore increased slurry density by 5,9 %, improved liquor clarification as result of a reduction of up to 75 % in suspended solids and slightly reduced the required unit area.

  5. L’ITALIANO CHE INCLUDE: LA LINGUA PER NON ESSERE STRANIERI. ATTENZIONI E PROPOSTE PER UN PROGETTO DI FORMAZIONE LINGUISTICA NEL TEMPO DELLA PLURALITÀ

    Directory of Open Access Journals (Sweden)

    Graziella Favaro

    2016-09-01

    Thoughts and proposals for language training in a plural world We present a document created by Group 1 of the National Observatory for the integration of foreign students and inter-culture “Teaching Italian as a second language and an enhancement of multilingualism”. The paper explores the aspects of Italian L2 in multicultural contexts and situations, the type of learners and their individual needs. Based on this analysis, thoughts and proposals on language training for adults and children, on the enhancement of multilingualism and on teacher training are formulated.

  6. Aux origines de la guillotine sèche. La déportation dans les Assemblées révolutionnaires

    Directory of Open Access Journals (Sweden)

    Louis-José Barbançon

    2007-01-01

    Full Text Available À la veille de la Révolution, une révision des lois pénales est déjà en cours. Par lettres patentes datées du 6 janvier 1789 , Louis XVI avait désigné une commission chargée de purger de l’ancienne législation, les « odieuses prescriptions qui y avaient trouvé une trop large place. »  . Dans le même ordre d’idées, il faut aussi signaler la déclaration du 1er mai 1788, sur la révision des lois criminelles.En Europe, la décennie précédente a vu l’Anglais John Howard entreprendre plusieurs voyag...

  7. Che Challenges of Real and Subjective Poverty and the Growth of Inequality in the Economies of South Eastern Europe in Transition

    Directory of Open Access Journals (Sweden)

    Ivo Bićanić

    2005-03-01

    Full Text Available From the beginning it was clear that during the transformation, all aspects of economic inequality were likely to be exacerbated and that poverty was likely to emerge. This paper discusses the size and consequences of transformation-generated changes in economic inequality and poverty, both “real” and “subjective”, for future economic growth and the legitimacy of continued transformation in the Mediterranean economies in transformation (Bosnia and Herzegovina, Croatia, Macedonia, Serbia and Montenegro and Slovenia, which have been expanded to include Romania and Bulgaria. This area is referred to as the “region”.

  8. l tornado che colpì la laguna di Venezia I ' l l Settembre 1970 Qualche considerazione intorno alla teoria elettrica dei tornado

    Directory of Open Access Journals (Sweden)

    R. JANESELLI

    1972-06-01

    Full Text Available After a short description of the disastrous effects of the
    tornado which struck the Venice lagoon on September 11, 1970, the principal
    theories which in the centuries tried to account for the origin of such
    terrible vortexes, are reviewed. In particular, some remarks are given about
    the electrical theory of the tornadoes. It seems to the author that some features
    would be explained in a simple way by considering the tornado as a
    convectivo cell with electric currents of high intensity. Finally, after recalling
    the meteorological conditions preceding the tornado of September 11,
    its chief features are described.

  9. Il computer per il compositore: slave o master? Su alcune risorse, e le conseguenti problematiche, che pongono le nuove tecnologie applicate alla composizione musicale

    Directory of Open Access Journals (Sweden)

    Mauro Cardi

    2010-12-01

    Full Text Available Mauro Cardi addresses the implications of the development of technologies and networking on the ‘work’ of the composer and the influence they exert on the modalities of ‘generation’, reception and fruition of musical texts, both in terms of social impact, and of mechanisms and practices they produce. Where the greater availability of resources proves to offer opportunities hard to imagine before, the problems that are created extend their range. It therefore remains the inescapable need for the composer to design his own instruments, in order to maintain a fully active role in the choices required by his work.

  10. Effets de la saison sur les qualités microbiologiques de Kilishi, une viande sèche traditionnelle du Cameroun

    Directory of Open Access Journals (Sweden)

    Fonkem, DN.

    2010-01-01

    Full Text Available Effects of Season on the Microbiological Quality of Kilishi, a Traditional Cameroonian Dried Beef Product. The microbiological quality of Kilishi, a traditional Cameroonian dried meat, produced in the Northern part of the country, was studied over one-year period. 79 Kilishi samples collected at various selling points were used for microbiological evaluation. The results on the microbiological analyses were then subjected to a statistical analysis using the General Linear Model (GLM approach to assess environmental factors that affect quality. Final results indicated that the quality of Kilishi was greatly affected (P< 0.001 by the season and location of production though the total bacterial, mould and yeast counts (cfu/g were lower than the recommended acceptability limit for the total viable bacterial counts of micro-organisms in meat at the point of consumption.

  11. Sei così bella quando piangi. Lana Del Rey, voce e fenomeno della fragilità che è in noi

    Directory of Open Access Journals (Sweden)

    Federico Zannoni

    2015-07-01

    Full Text Available Frailty is an ontological part of human experience and characterizes our times. Instability, insecurity, addictions, loneliness, difficulty in finding meaning and perspectives, desire to escape and nostalgia for an unknown and unreal past are predominant in the life of many young people and teenagers. In this context it is possible to consider the global success of the singer Lana Del Rey and of her melancholy and languid lyrics, but also of her videos and photographs, that are expression and celebration of an alleged existential frailty that allows her supporters, especially if adolescents or young women, to identify with her. The study of the phenomenon Lana Del Rey allow to move closer to those feelings of weakness and discomfort that are often hidden, unspoken, confined in the shadows for lack of courage or for shame, but that are, at the same time,  full of grace and of vital energy.  This is one of the tasks of pedagogy.

  12. Merci esotiche che viaggiano verso occidente: la cornice e la figura del narratore popolare a partire da una lettura del Cunto de li cunti di Basile

    Directory of Open Access Journals (Sweden)

    Elena Massi

    2011-11-01

    Full Text Available One of the most precious goods we have gained from the East is the literary frame. Certain of its functions are observable from its early history, in the Middle Ages. In Eastern countries, ”the frame” was a communicative tool to express judgement and opinions in public according to different social conditions. In Western countries, it is still used as an   to express judgement, but only in the literary world. Eric Auerbach in Zur Technik der Fruhrenaissancenovelle in Italien und Frankreich says that from Dante to Boccaccio, the literary frame becomes the story's atmosphere and its barycentre because it offers writers the possibility to organize the relationship between text and context. In my hypothesis, Auerbach's words can work to introduce a narratological function to the literary frame. We notice other two functions: an anthropological one explained by Tzvetan Todorov in La conquête de l'Amérique and a psychological one showed by Andrè Jolles in De Decameron van Boccaccio. According to Tzvetan Todorov, in the seventeenth century, missionaries used literary frames to communicate with native Americans: in Historia general de las cosas de la Nueva España by Bernardino de Sahagún, a literary frame is used to organize different cultural knowledges. Andrè Jolles metaphorically says that thanks to literary frames, we are still able to listen to the voices of popular narrators because the literary frame reproduces cognitive structures typical of children. I propose to show these functions in the Cunto de li cunti by Basile. In this way, we can observe the modernity of Basile. The Neapolitan author not only founded the fairytale genre in Europe. He also contributed to spread a universal communicative form we can observe from three points of view: narratological, anthropological, and psychological.

  13. Un singolare caso di rifrazione letteraria. A proposito di una generazione di autori di origine russa che scrive nella lingua del paese di adozione

    Directory of Open Access Journals (Sweden)

    Giulia Gigante

    2016-01-01

    From the investigation of some examples of narrative contexts and stylistic processes typical of various contemporary Russian authors who have chosen to write in the language of the country where they emigrated, a common tendency emerges concerning the representation of Russia. Despite the differences of the works considered, these authors represents the culture of their roots in a ‘kaleidoscopic’ way, reconsidering the historical, literary and artistic references through memories, dreams and reflections, filtering them through the language and culture of their chosen country.

  14. A high-precision chronological model for the decorated Upper Paleolithic cave of Chauvet-Pont d'Arc, Ardèche, France

    NARCIS (Netherlands)

    Quiles, Anita; Valladas, Hélène; Bocherens, Hervé; Delqué-Količ, Emmanuelle; Kaltnecker, Evelyne; van der Plicht, Johannes; Delannoy, Jean-Jacques; Feruglio, Valérie; Fritz, Carole; Monney, Julien; Philippe, Michel; Tosello, Gilles; Clottes, Jean; Geneste, Jean-Michel

    2016-01-01

    Radiocarbon dates for the ancient drawings in the Chauvet-Pont d'Arc Cave revealed ages much older than expected. These early ages and nature of this Paleolithic art make this United Nations Educational, Scientific and Cultural Organization (UNESCO) site indisputably unique. A large,

  15. Burner flow regulators with mechanisms performing two variable function. Meccanismi che generano una funzione di due variabili applicati alla regolazione dei bruciatori

    Energy Technology Data Exchange (ETDEWEB)

    Borelli, L.; Tagliaferro, B. (R.B.L. Riello Bruciatori, Legnago Spa, Legnago (Italy)); Cossalter, V.; Da Lio, M. (Padua Univ. (Italy). Dip. di Ingegneria Meccanica)

    1993-08-01

    A new class of fuel oil burners has recently been developed by an Italian firm with the aim of obtaining high performances in terms of both energy efficiency and air pollution abatement. The innovative feature of these burners is that they are equipped with a device which permits the automatic and optimum regulation of the air fuel mixture independent of ambient and operating conditions. To reduce costs, the regulation system is a mechanical one instead of electronic which would require an expensive lambda probe. The mechanical regulating system controls air intake by simply taking into account two main combustion factors - ambient temperature and the nominal fuel flow rate. The special cam mechanism is thus classified as one which performs a single function with two degrees of freedom, i.e., the independent variables of ambient temperature and nominal fuel flow. One of the air intake valve's movements is governed by a temperature transducer, the other (primary), by a screw which allows the registering of the air flow during burner installation or upon completion of periodic maintenance checks. In addition to optimizing combustion control, this control technique affords the possibility to adapt the air flow to the different fuel flows obtained by changing the type of nozzle or supply pressure.

  16. Sich (nicht geschlagen geben. Unabdingbare Ansprüche, Kompromisse und das Interesse an einer agonistischen Lebensform: Zu Chantal Mouffes Begriff des Politischen

    Directory of Open Access Journals (Sweden)

    Burkhard Liebsch

    2010-08-01

    Full Text Available This article discusses Chantal Mouffe’s concept of the political that allegedly departs fun-damentally from the so called “cosmopolitical illusion”, i. e. the illusion that liberal-democratic forms of life could overcome antagonistic conflicts once and for all. Mouffe’s diametrically opposed idea of a “conflictual consensus” is critically examined particularly for the claim that it promises to sublate contradictory claims in agonistic forms of conflict. A critical evaluation of this thesis refers to the question whether such a consensus unconditionally requires the renunciation of any unalienable claim.

  17. Crisi identitaria e speculazione panarabista nella Tunisia post-rivoluzionaria: che ne facciamo della tunisianità e della lingua tunisina?

    Directory of Open Access Journals (Sweden)

    Alfonso Campisi

    2015-08-01

    Full Text Available This text speaks about two very important problems existing in Tunisia, after revolution: identity and language. The problem about Tunisian identity is very present in Tunisia, because the article 38 of constitution speaks about Arabic-Muslim identity, but that, it is not correspond to the reality, because we have to talk about  a specific identity character of the country. “Tunisianity”, it’s the wright answer to the article 38.Second important question is the language. Always the article 38 of the constitution voted by the Islamic party at that time at the power, says that the national language is Arabic. Even that not correspond to the linguistic reality of the country, because classical Arabic is not spoken in Tunisia. People speaks Tunisian Arabic. So the text analyses the dangers of the article 38 about the real Tunisian identity and Tunisian language.

  18. European analytical column no. 37 (January 2009) Division of Analytical Chemistry (DAC) of the European Association for Chemical and Molecular Sciences (EuCheMS)

    DEFF Research Database (Denmark)

    Karlberg, Bo; Grasserbauer, Manfred; Andersen, Jens Enevold Thaulov

    2009-01-01

    This issue of the European Analytical Column has again a somewhat different format: once more DAC invited a guest columnist to give his views on various matters related to Analytical Chemistry in Europe. This year, Professor Manfred Grasserbauer of the Vienna University of Technology focuses...... representing a major branch of chemistry, namely analytical chemistry. The global financial crisis is affecting all branches of chemistry, especially analytical chemistry since our discipline by tradition has many close links to industry. Already now a decrease of industrial commitment with respect to new...... research projects and sponsoring of conferences can be observed. It is therefore important to strengthen all efforts and to keep the presence of analytical chemists at meetings and conferences unchanged. Recent activities of DAC and details regarding the major analytical-chemistry event this year in Europe...

  19. European analytical column No. 37 from the Division of Analytical Chemistry (DAC) of the European Association for Chemical and Molecular Sciences (EuCheMS)

    DEFF Research Database (Denmark)

    Karlberg, Bo; Grasserbauer, Manfred; Andersen, Jens Enevold Thaulov

    2009-01-01

    The European Analytical Column again has a somewhat different format. We have once more invited a guest columnist to give his views on various matters related to analytical chemistry in Europe. This year we have invited Prof. Manfred Grasserbauer of Vienna University of Technology to present some...... representing a major branch of chemistry, namely, analytical chemistry. The global financial crisis is affecting all branches of chemistry, but analytical chemistry in particular since our discipline by tradition has many close links to industry. We are already noticing a decreased industrial commitment...... with respect to new research projects and sponsoring of conferences. It is therefore important that we strengthen our efforts and that we keep our presence at analytical chemistry meetings and conferences unchanged. Recent activities of the Division of Analytical Chemistry (DAC) and details regarding the major...

  20. New Fractures, Old Wounds: Africa and the Renewal of South Agency Neue Brüche, alte Wunden: Afrika und die Erneuerung der South agency

    Directory of Open Access Journals (Sweden)

    Carlos Lopes

    2010-01-01

    Full Text Available Africa has recently come to the forefront of world politics as part of the emerging South. Its increased prominence in the global discourse as a “new frontier of development” signals the recognition of its economic potential. Indeed, the continent has registered an average 5 per cent annual GDP growth rate over the past decade. However, there is more to the story than that: The rising profile of the African continent also reveals the growing role of a number of its countries in the emergence of a new South agency. It is argued that South–South cooperation is an opportunity. The discussion of the current situation in Africa understood as a continent in all its diversity including sub-Saharan Africa, but also the Maghreb and Egypt, will therefore be placed into this wider context. The renewal of a South agency witnessed over the past decade is somewhat different from the trilateral alliance of Asia–Africa–Latin America formed in the wake of decolonization. Current mega-trends demonstrate that the global South, driven by a number of regional powers, will play a vital role in shaping the twenty-first century. Understanding the complexities of this renewed agency is vital for addressing old wounds that marked the emergence of a South voice in the not-so-distant past. In jüngster Zeit ist Afrika als Teil des emerging South in den Vordergrund der Weltpolitik gerückt. Seine zunehmende Prominenz im globalen Diskurs als new frontier of development signalisiert die Anerkennung des ökonomischen Potenzials des Kontinents. Tatsächlich konnte Afrika im vergangenen Jahrzehnt eine durchschnittliche jährliche BIP-Wachstumsrate in Höhe von 5 Prozent verzeichnen. Aber es geht um mehr: Die wachsende Wahrnehmung des afrikanischen Kontinents ist Ausdruck der immer wichtigeren Rolle einiger afrikanischer Länder bei der Entstehung einer neuen South agency. Die Süd-Süd-Kooperation wird wieder als Möglichkeit erkannt. Die Diskussion der aktuellen Lage Afrikas – in all seiner Vielfalt zwischen subsaharischem Afrika, Maghreb und Ägypten – muss in diesem umfassenderen Kontext geführt werden. Die Erneuerung der South agency, die im vergangenen Jahrzehnt zu beobachten war, ist nicht gleichzusetzen mit der trilateralen Allianz Asien-Afrika-Lateinamerika in der Phase der Dekolonisation. Jüngste Megatrends signalisieren, dass der “globale Süden”, vorangetrieben von einigen Regionalmächten, bei der Gestaltung des 21. Jahrhunderts eine ganz wesentliche Rolle spielen wird. Ein Verständnis für die Komplexität dieser neuen Akteursrolle zu entwickeln, ist die Voraussetzung, wenn man alte Wunden ansprechen will, die in nicht allzu ferner Vergangenheit die Herausbildung einer Stimme des Südens begleiteten.

  1. "Accessible à tous": la rivista «Mouseion» per la promozione del ruolo sociale dei musei negli anni ’30 del Novecento / “Accessible à tous”: the magazine «Mouseion» for the promotion of social role of museums during the 1930s

    Directory of Open Access Journals (Sweden)

    Patrizia Dragoni

    2015-06-01

    Full Text Available Nel 1927 la commissione di esperti riunita per mettere a punto il programma dell’Office International des Musées (OIM, istituito l’anno precedente, aveva adottato alcune risoluzioni relative anche al ruolo sociale che il museo moderno era sempre più chiamato a svolgere. L’articolo, a partire da queste prime indicazioni, affronta, attraverso l’analisi della rivista ufficiale dell’OIM «Mouseion»,  il tema dello sviluppo delle attività sociali e educative promosse dall’Office e declinate nei principali paesi membri della Società delle Nazioni fino al 1939, anno in cui si sarebbe dovuto svolgere un convegno internazionale sul tema, i cui risultati avrebbero dovuto costituire il terzo volume degli atti di Muséographie. Il convegno, di cui vengono qui riferiti proposte e programmi, non venne mai realizzato a causa dello scoppio della seconda guerra mondiale.   In 1927, the committee of experts convened to study the program of the Office International des Musées (OIM, established the previous year, had adopted a number of resolutions relating to the organization of the institution, cataloging and social role of the modern museum was increasingly called upon to perform. The paper, based on these early indications, addresses through the analysis of the official magazine «Mouseion» the issue of the development of educational and social activities promoted by the OIM and declined in the major member countries of the League of Nations until 1939, the year in which would have to play an international conference on whose acts would have to be the third volume of Muséographie. The conference, which we outline here the proposals and programs, was never realized due to the outbreak of the World War II.

  2. Detection system qualification for direct measurement of thyroid internal contamination by radioiodine; Qualificazione di un sistema di rilevazione trasportabile per misure dirette di contaminazione interna di radioiodio

    Energy Technology Data Exchange (ETDEWEB)

    Tiberi, V.; Battisti, P.; Gualdrini, G. [ENEA, Centro Ricerche Ezio Clementel, Bologna (Italy). Dipt. Ambiente

    1999-07-01

    The work deals with a detection system qualification for direct measurements of thyroid internal contamination by radioiodine. The isotopes {sup 131}I and {sup 125}I are the most frequently used in nuclear medicine. Because of their volatility they are very dangerous for thyroid contamination by inhalation. The system has been projected to be easily and fast used and above all transportable where the control is necessary. These characteristic make it able to realise supervision programs of internal contamination by radioiodine. In fact due the very high control frequencies (each 15 days for {sup 131}I), these programs are usually very expensive and demanding when they are executed in external measurement laboratories. The following steps are described: devices presentation, calculation of energy and efficiency parameters, minimum detectable activity, time system reliability, best operative conditions in the measurements. At the end an application example of the system is reported. [Italian] Il presente lavoro consiste nella qualificazione di un sistema di rivelazione per misure dirette di contaminazione interna da radioiodio in tiroide, progettato per essere maneggevole, di semplice e rapido impiego e trasportabile sul luogo dove e' richiesta la misura. Il sistema e' stato studiato per la realizzazione di programmi di sorveglianza della contaminazione interna da radioiodio che, richiedendo frequenze di controllo elevate (quindicinali per lo {sup 131}I), sono estremamente impegnativi ed onerosi, soprattutto se i controlli vengono effettuati in centri di misura esterni. Dopo la determinazione dei parametri della calibrazione in energia ed efficienza, la minima attivita' rivelabile, l'affidabilita' del sistema nel tempo e le condizioni operative ottimali da adottare in sede di misura, viene verificata la piena affidabilita' del sistema in un programma di sorveglianza della contaminazione interna da radioiodio.

  3. International Meeting on Needs and Challenges in Translational Medicine: filling the gap between basic research and clinical applications. Book of abstract

    Energy Technology Data Exchange (ETDEWEB)

    Moretti, F; Belardelli, F [Department of Cell Biology and Neurosciences, Istituto Superiore di Sanita, Rome (Italy); Romero, M [Alleanza Contro il Cancro, Rome, (Italy)

    2008-07-01

    This multidisciplinary international meeting is organized by the Istituto Superiore di Sanita, in collaboration with Alleanza Contro il Cancro (Alliance Against Cancer, the Network of the Italian Comprehensive Cancer Centres) and EATRIS (European Advanced Translational Research Infrastructure in Medicine). The primary goal of the meeting is to provide a scientific forum to discuss the recent progress in translational research. Moreover, a particular focus will be devoted to the identification of needs, obstacles and new opportunities to promote translational research in biomedicine. The scientific programme will cover a broad range of fields including: cancer; neurosciences; rare diseases; cardiovascular diseases and infectious and autoimmune diseases. Furthermore, special attention will be given to the discussion of how comprehensive initiatives for addressing critical regulatory issues for First-In-Man - Phase I clinical studies can potentially improve the efficiency and quality of biomedical and translational research at an international level. [Italian] Questo convegno internazionale multidisciplinare e organizzato dall'Istituto Superiore di Sanita, in collaborazione con Alleanza Contro il Cancro (la rete italiana degli IRCCS oncologici) ed EATRIS (European Advanced Translational Research Infrastructure in Medicine). L'obiettivo principale del convegno e di rappresentare un forum scientifico per lo scambio di informazioni e di opinioni sui nuovi progressi nel campo della ricerca traslazionale. Un interesse particolare sara rivolto inoltre all'identificazione dei bisogni, degli ostacoli e delle nuove opportunita per promuovere la ricerca traslazionale in biomedicina. Il programma scientifico coprira una vasta area di campi di ricerca, tra cui cancro, neuroscienze, malattie rare, malattie cardiovascolari, malattie infettive ed autoimmuni. Particolare attenzione sara rivolta poi al dibattito sul modo in cui iniziative di vasta portata, che riguardano gli aspetti

  4. Phytoextraction. A new pilot-plant project for the soil decontamination; Fitodecontaminazione. Un sistema pilota per la fito-decontaminazione di suoli inquinati da piombo

    Energy Technology Data Exchange (ETDEWEB)

    Bregante, M.; Paganetto, A.; Magistrelli, P.; Martella, L.; Gambale, F. [Consiglio Nazionale delle Ricerche, Istituto di Cibernetica e Biofisica, Genoa (Italy); Sacchi, G.A.; Rivetta, A.; Cocucci, R. [Milan Univ., Milan (Italy). Dipt. di Produzione Vegetale

    2001-12-01

    The environmental pollution is continuously increasing owing to anthropic activity. High concentrations of heavy metals may have drastic consequences on human health, particularly on children development. Conventional approaches have high economical and environmental costs that do not allow soil decontamination unless sites are particularly valuable. Phytoextraction uses plants producing biomass to transfer metals from the soil to the aerial parts of the plants at the expenses of solar energy. This work illustrates the activity performed within a Life-Environment european project in order to verify whether phytoremediation can be transferred from the laboratory scale to the field scale. [Italian] L'inquinamento del suolo dovuto all'accumulo di metalli come conseguenza delle attivita' umane sta continuamente e drammaticamente aumentando. Principali cause di contaminazione sono l'accumulo di rifiuti urbani, l'utilizzo di fertilizzanti, il traffico motorizzato, gli inceneritori, le centrali termoelettriche, le emissiioni industriali nocive, lo sfruttamento e dismissione di miniere. La decontaminazione di suoli inquinati da metalli e' un problema estremamente difficile da trattare. La bonifica di suoli inquinati da metalli mediante l'utilizzo di piante metallofite e/o agronomiche (fitoestrazione) emerge quindi come una tecnica estremamente interessante. Viene percio' illustrato il progetto PhyLeS (Phytoextraction of Lead from Soil), un progetto pilota finanziato dal programma Europeo Life/Ambiente (DG XI), che si propone di verficare i potenziali vantaggi e la trasferibilita' della metodica di fitoestrazione assistita dalla scala di laboratorio a quella di campo.

  5. Personal monitoring services available at Institute for Radiation Protection of ENEA; Il servizo di dosimetria personale dell'Istituto per la Radioprotezione dell'ENEA

    Energy Technology Data Exchange (ETDEWEB)

    Fantuzzi, E.; Bonarelli, T. [ENEA Centro Ricerche Ezio Clementel, Bologna (Italy). Dipt. Ambiente

    1999-07-01

    Personnel monitoring provides the means to measure and record the radiation doses received by individual workers. The ionising radiation decree (230/95) set out the circumstances when the assessment and recording of person's exposure is legally required. Many employers issue dosemeters to staff even though there is no legal requirement to do so. This may be part of a quality assurance programme or as a reassurance measure. Dosemeter readings will serve to ensure compliance with legal dose limits and assure the employer that radiation exposure is as low as reasonably achievable. The ENEA (National Agency for New Technology, Energy and the Environment) IRP (Institute for Radiation Protection) individual monitoring service has been running for over 30 years. It offers personnel dosemeters which are based on its expertise and backed up by continual research and development. The report provides details of the dosemeters in use at IRP enable to decide which ones most suit the needs and shows IMS's organisation, customer and communications, dose reports form and administrative items. A short mention of future development will also be given. [Italian] La dosimetria individuale fornisce gli strumenti per misurare e registrare le dosi da radiazioni ionizzanti ricevute dai lavoratori esposti. Il decreto legislativo 230/95 stabilisce le circostanze in cui il monitoraggio individuale e' legalmente richiesto. Molti datori di lavoro forniscono dosimetri individuali anche quando non vi e' una richiesta legale spesso per seguire le regole di un programma di assicurazione di qualita' relativo alla radioprotezione o per ottenere una conferma che il principio ALARA sia soddisfatto. Il servzio di dosimetria personale dell'Istituto per la Radioprotezione dell'ENEA e' attivo da oltre 30 anni e offre dosimetri sviluppati sulla propria esperienza nelle tecniche dosimetriche che vengono continuamente aggiornati e adeguati rispecchiando lo stato dell

  6. ESTRATEGIA ANESTÉSICA PARA LA CIRUGÍA CON EL CORAZÓN LATIENDO. CINCO AÑOS DE EXPERIENCIA EN EL CARDIOCENTRO ERNESTO CHE GUEVARA / Anesthesia strategy for surgery with beating heart. Five years of experience at the “Ernesto Che Guevara” Cardiology Hospital

    Directory of Open Access Journals (Sweden)

    Ignacio R. Fajardo Egozcue

    2009-06-01

    Full Text Available Introduction and Objectives: The anesthesia in coronary surgery, using high sustained doses of fentanyl, leads to protracted postoperative extubation and stay. The assessment of an anesthesiastrategy for coronary surgery without extracorporeal circulation, in order to reduce the use of opioids and make possible an early extubation and a shorter post-surgical stay, was the objective of thiswork. Methods: 732 patients who underwent surgical myocardial revascularization without heartlung machine, from February 2003 to December 2007, using general anesthesia with intermittent boluses of fentanyl, with or without associated epidural anesthesia, were studied. Results: 625 surgical operations with general anesthesia in boluses and 107 adding peridural anesthesia were carried out. The average amount of fentanyl was 34.7 ml per patient in the first group and 24.9 ml when adding peridural anesthesia. Twenty seven patients were extubated in the operating room. The total average time was 8.6 hours (8.8 hours in the group where the anesthesia in boluses wasused and 6.7 hours for those with peridural anesthesia associated. The total average stay at the Intensive Care Unit was 40.1 hours. Conclusions: The intermittent anesthesia reduced the amount of fentanyl used in 86.6 percent when compared to the high sustained doses reported in a previous study. This made possible the early extubation of the patients, which increased due to the use of peridural anesthesia, and a decrease in average stay of the patient at the Intensive Care Unit.

  7. Design and Infrastructure: the Transformations of Senigallia’s Interface among Town, Port and Canal Progetto e infrastruttura: le trasformazioni dell’interfaccia città-porto-canale a Senigallia

    Directory of Open Access Journals (Sweden)

    Antonella Falzetti

    2009-11-01

    enterprises, the topic of infrastructures plays a dominant role. The need to re-balance and re-establish a relationship with the town definitely requires a new planning of existing tracks, accesses, and relational spaces.Come altre realtà urbane di costa, anche Senigallia, nell’ultimo decennio, si colloca tra quelle città d’acqua, di medie dimensioni, attente a ridisegnare e riorganizzare gli spazi di interfaccia tra contesti urbani e gli ambiti delle attività fronte mare. Un tentativo di ricomporre una continuità tra le trame della città, le aree funzionali della costa e delle sponde e il sistema delle sue infrastrutture. Lo scenario morfologico che appare oggi, per Senigallia, racconta una città i cui confini si affermano sul fronte mare, variamente segnati dalla richiesta di protezione e difesa sulla linea della costa o viceversa incalzati, in tempi più recenti, dalle ragioni dello scambio e dei commerci. Una città divisa dalla cesura del fiume Misa, primaria infrastruttura lineare, che impone le leggi insondabili delle piene e dei reflussi mentre reclama gli strumenti per il controllo delle acque, una città spezzata dalla lacerazione imposta dalla linea ferrata, sistema dirompente ed escludente (per Senigallia e per lunga parte della costa adriatica. In questi termini il progetto, come campo di sperimentazione, si prefigura, insieme ad adeguate gestioni e controllo delle politiche urbane, come valido strumento tecnico-operativo per esplorare risposte progettuali in grado di ricucire l’apparente insanabile frattura che l’estraneità funzionale delle rive del fiumi o il degrado di coste malamente urbanizzate o infrastrutture non perfettamente integrate nella dinamica urbana hanno determinato. La registrazione da più parti di esperimenti progettuali che vanno in questa direzione ci avverte di un significativo cambiamento dei paradigmi progettuali applicabili alla realtà senigalliese inseriti in un vasto programma di riqualificazione da parte dell

  8. Business Model Canvas & Elevator pitch : 29-10-2013

    NARCIS (Netherlands)

    Eelco Bakker

    2013-01-01

    Presentatie bij de Workshop Business Model Canvas: de bouwstenen en het gebouw van de onderneming - workshopprogramma ViB050. In het kader van het programma Teach the Teacher. Gehouden op 29-10-2013..

  9. Realisation of a small-scale hydro-power plant between two drinking water reservoirs in the municipality of Vira Gambarogno - Feasibility study; Realizzazione di una microcentrale idroelettrica sulla condotta di adduzione tra il serbatoio Monti di Fosano e il serbatoio Fosano. Programma piccole centrali idrauliche. Studio di fattibilita

    Energy Technology Data Exchange (ETDEWEB)

    Mutti, M.

    2009-02-15

    This report for the Swiss Federal Office of Energy (SFOE) takes a look at a project for the realisation of a small hydro-power plant on the drinking water supply in the municipality of Vira Gambarogno, southern Switzerland. The old conduit connecting two drinking water reservoirs has to be replaced. The elevation difference of 260 m is favorable to the installation of a turbine near the lower reservoir. The report presents details on the hydrological data and the dimensioning of the installation. Several variants are considered, which also include the possible reconstruction of the lower reservoir and/or an increased water flow rate from the springs. The electricity production expected is discussed, as is the economic viability of the project.

  10. United Kingdom Food Irradiation Programme - Wholesomeness Aspects; Programme du Royaume-Uni Relatif a l'Irradiation des Aliments: Comestibilite; Programma oblucheniya pishchevykh produktov v soedinennom korolevstve - problemy sokhraneniya vkusovykh i pitatel'nykh kachestv; Programa del Reino Unido Relativo a la Irradiacion de Alimentos: El Problema de la Comestibitidad

    Energy Technology Data Exchange (ETDEWEB)

    Hickman, J. R. [Wantage Research Laboratory (A.E.R.E.), Wantage, Berks. (United Kingdom)

    1966-11-15

    Tests for wholesomeness carried out in the United Kingdom as a part of the food irradiation programme are described. Both short-term animal feeding studies in rats, chickens and pigs, and long-term studies in rats and mice, have failed to demonstrate any adverse effects attributable to the consumption of irradiated food by the animals. The animal feeding tests have been designed with specific irradiation processes in mind, and all of these processes have involved the use of low, or moderate radiation doses. Thus, grain treated with 20 000 and 200.000 rad gamma radiation, and frozen egg (irradiated-to kill Salmonellae) treated with 0.5 and 1.0 Mrad have been tested by feeding to animals. Ham, irradiated with 250 000 rad to prolong its shelf life, has been tested, and also ham irradiated with 2 Mrad. Currently long-term studies are in progress to investigate the wholesomeness of fish treated with 0.6 Mrad (the maximum dose likely to be used to provide extended refrigerated (0 Degree-Sign - 4 Degree-Sign C) storage life). Short-term tests- have also been undertaken with potatoes (10000 rad) and horse flesh (0.65 Mrad). The nutritional quality of irradiated grain, egg, fish and some animal' feedings-stuffs has been investigated, using microbiological assay techniques. Losses in the B vitamins have been, found comparable with those reported by workers in the United States and are of the same order,of magnitude as losses occurring on heating, although differences were observed in the sensitivity of individual vitamins towards heat and irradiation. The losses in B vitamins occurring on irradiation and cpoking were found to be additive. No effects on the nutritional value of protein have been found. In 1962 the United Kingdom Ministry of Health set up a Working Party to review the effects of irradiation on food, and to report on the necessity-for official control. The report-pf the working party published in 1964, is discussed in relation to the wholesomeness tests carried out in the United-Kingdom. (author) [French] L'auteur decrit des examens de la comestibilite effectues au Royaume-Uni au titre du programme d'irradiation de produits alimentaires. Des etudes a court terme sur des rats, des poulets et des porcs, et des etudes a long terme sur des'rats et des souris n'ont permisse deceler aucun effet nuisible attribuable a la consommation par ces animaux.de nourritures irradiees. Les essais d'alimentation des animaux ont ete concus compte tenu de certains procedes,precis d'irradiation qui tous comportaient l'utilisation de doses d'irradiation faibles ou moderees. C'est ainsi que des. cereales traitees aux rayons gamma a 20 000.et 200 000 rad et des oeufs congeles (irradies pour detruire Salmonellae) traites a 0, 5 et 1 Mrad ont ete essayes. L'auteur a fait des essais avec du jambon irradie a 250 000 rad pour prolonger la duree de conservation et avec du jambon irradie a 2 Mrad. On procede, actuellement a des etudes a long terme, sur la comestibilite du poisson traite a 0,6.Mrad (dose maximale qui sera probablement utilisee pour augmenter la duree de conservation en refrigerateur (0 Degree-Sign / 4 Degree-Sign C)). L'auteur a egalement entrepris des essais a court terme sur les pommes de terre (10 000 rad) et la viande de cheval (0,65 Mrad). L'auteur a fait des recherches sur la qualite nutritive des cereales, des oeufs et.du poisson irradies et sur.quelques aliments pour animaux egalement irradies en reecurant a des procedes d'analyse microbiolo- gique. Il a constate que les pertes en vitamines B sont comparables a celles qu'ont indiquees des chercheurs des Etats-Unis et sont du meme ordre de grandeur que les pertes dues au traitement thermique bien que des differences aient ete observees dans la sensibilite de certaines vitamines a la chaleur et.aux rayonnements. Il a en outre constate que les pertes en vitamines B dues a l'irradiation et celles qui sont dues a la cuisson s'ajoutent. Il n'a constate aucun effet sur la valeur nutritive des proteines. En 1962, le Ministere de la sante publique du Royaume-Uni a cree un groupe de travail charge d'examiner les effets des rayonnements sur les produits alimentaires et de faire un rapport sur la necessite d'un controle officiel. L'auteur examine le rapport du groupe de travail, publie en 1964, en tenant compte ' des essais de comestibilite effectues au Royaume-Uni. (author) [Spanish] En la memoria se describen las pruebas de comestibilidad realizadas en el Reino. Unido como parte del programa de irradiacion de alimentos. Se han efectuado estudios a corto plazo con ratas, pollos y cerdos, y a largo plazo con ratas y ratones, y no se han observado efectos perniciosos que puedan atribuirse al consumo de alimentos irradiados por dichos animales. Estas pruebas se efectuaron pensando en procesos especificos de irradiacion con dosis bajas o moderadas. Se utilizaron, en efecto, cereales sometidos a 20 000 y 200 000 rad de rayos gamma y huevos congelados, irradiados con 0,5 y 1,0 Mrad para eliminar las Salmonellae. Ademas se han realizado pruebas con jamon tratado con dosis de 250 000 rad, para prolongar su periodo de almacenamiento, y con dosis de 2 Mrad. Se estan ejecutando estudios a largo plazo con el fin de investigar la comestibilidad del pescado tratado con 0,6 Mrad (la dosis maxima que probablemente se administrara para prolongar el periodo de almacenamiento en frigorifico (0 Degree-Sign -4 Degree-Sign C)). Tambien se han emprendido pruebas de corta duracion con patatas (10 000 rad) y carne de caballo (0,65 Mrad). Se han investigado, por analisis microbiologico, las.propiedades nutritivas de los cereales, los huevos, el pescado y algunos alimentos de consumo animal irradiados. Las perdidas de vitaminas B son analogas a las indicadas por investigadores de los Estados Unidos, y son del mismo orden de magnitud que las que ocasiona el tratamiento termico, aunque se ha observado que la sensibilidad d Inverted-Question-Mark determinadas vitaminas al calor y a la irradiacion es diferente. Las perdidas de vitaminas B producidas por irradiacion y cochura son acumulativas. No se ha observado efecto alguno en el valor nutritivo de las proteinas. En 1962, el Ministerio de Sanidad Publica del Reino Unido constituyo un Grupo de trabajo encargado de estudiar los efectos de las radiaciones en los alimentos y de presentar un informe sobre la necesidad de controles oficiales. En la memoria se examina el informe del Grupo de trabajo, publicado en 1964, en relacion con las pruebas de comestibilidad efectuadas en el Reino Unido. (author) [Russian] Daetsja opisanie ispytanij, provedennyh v Soedinennom Korolevstve, na sohranenie pishhevymi produktami vkusovyh i pitatel'nyh kachestv. Ispytanija velis' po programme obluchenija produktov pitanija. Kratkosrochnye issledovanija kormlenija krys, kur i svinej i dlitel'nye issledovanija kormlenija krys i myshej obluchennym kormom ne pokazali kakogo-libo vrednogo vlijanija jetogo korma na organizm. Opyty s kormleniem zhivotnyh byli prednaznacheny dlja vyjavlenija specificheskih processov obluchenija, i vse jeti processy ohvatyvajut ispol'zovanie nizkih ili umerennyh doz radiacii. Tak, zerno, obrabotannoe gamma-luchami dozoj v 20 000 i 200 000 rad, i zamorozhennye jajca (obluchennye dlja togo, chtoby ubit' salmonellae), obluchennye dozami 0,5 i 1,0 megarad, skarmlivali zhivotnym. Ispytyvalas' vetchina, obluchennaja dozoj 250 000 rad dlja prodl nija srokov ee hranenija, a takzhe vetchina, obluchennaja dozoj 2 megarada. V nastojashhee vremja provodjatsja dlitel'nye issledovanija po izucheniju voprosa sohranenija vkusovyh i pitatel'nyh kachestv ryby, obrabotannoj dozoj 0,6 megarada (maksimal'naja doza, kotoraja, verojatno, budet ispol'zovat'sja dlja obespechenija dlitel'nogo hranenija v zamorozhennom so- stojajii (0 Degree-Sign - 4 Degree-Sign C)). Kratkosrochnye opyty provedeny takzhe s kartofelem (10 00O rad) i koninoj (0,65 megarada). Pitatel'nye kachestva obluchennogo zerna, jaic, ryby i nekotoryh kormov dlja zhivotnyh issledovalis' s ispol'zovaniem mikrobiologicheskih metodov analiza. Kak ustanovleno, poteri vitamina V sravnimy s poterjami, o kotoryh soobshhaetsja issledovateljami v Soedinennyh Shtatah, oni ravny poterjam pri nagrevanii, hotja nabljudalis' razlichija v chuvstvitel'nosti otdel'nyh vitaminov k nagrevaniju i oblucheniju. Ustanovleno, chto poteri vitamina V pri obluchenii i varke dopolnjajut drug druga. Ne ustanovleno vlijanie obluchenija na pitatel'nye kachestva proteina. V 1962 godu Ministerstvo zdravoohranenija Soedinennogo Korolevstva sozdalo rabochuju gruppu dlja sostavlenija obzora vlijanija obluchenija na produkty pitanija i podgotovki doklada o neobhodimosti oficial'nogo kontrolja. Doklad jetoj gruppy, opublikovannyj v 1964 godu, rassmatrivaetsja v svjazi s provodimymi v Soedinennom Korolevstve ispytanijami otnositel'no sohranenija vkusovyh i pitatel'nyh kachestv pishhevyh produktov. (author)

  11. Feasibility of an individual surveillance program on contamination with direct measurement methods based on the criteria established in the ICRP publication 54; Fattibilita di un programma di sorveglianza individuale della contaminazione interna con metodi diretti sulla base dei criteri proposti nella pubblicacione 54 dell'ICRP

    Energy Technology Data Exchange (ETDEWEB)

    Melandri, C; Battisti, P [ENEA - Area Energia, Ambiente e Salute - Centro Ricerche Energia ' Ezio Clementel' - Bologna (Italy)

    1990-05-15

    If different methods of adequate sensitivity are available ICRP Publication 54, 'Individual Monitoring for Intakes-of Radionuclides by Workers: Design and Interpretations', recommends the use of direct measurements in individual monitoring for intakes of radionuclides. This report analyses the possibility to perform the different controls on the basis of the proposed Derived Reference Levels, respecting the accuracy requirement in evaluation of individual intake and dose. Therefore, general operative criteria are defined by analysing the potentialities and limitations of the different Whole Body Counters utilizable for the measurement with regard to the chemical, physical and metabolic characteristics of some radionuclides of particular interest in Radiation Protection. These criteria are useful for monitoring planning wherever a radiocontamination risk is possible. (author)

  12. MR study of the intrinsic acromial angle in 74 symptomatic patients; Studio RM dell'angolo intrinseco dell'acromion in 74 pazienti sintomatici

    Energy Technology Data Exchange (ETDEWEB)

    Di Mario, Mario; Fraracci, Lucio [Ospedale Fondazione Santa Lucia IRCCS, Roma (Italy). Servizio di radiologia

    2005-09-15

    e totali della cuffia i valori dell'angolo sono sempre risultati compresi tra 8{sup o} e 17{sup o}. Non si sono osservate rotture per valori angolari inferiori a 8{sup o}; nelle rotture totali l'angolo era sempre inferiore o uguale a 12{sup o}. La distanza acromion-omerale espressa in millimetri e stata calcolata oscillare tra 2 e 10 mm; nelle rotture della cuffia la distanza non e stata mai valutabile perche quasi sempre vicino allo zero, mentre nell'impingement senza rottura la distanza oscillava tra 5 e 10 mm. Il quadro di impingement senza rottura si e evidenziato in 31 casi con valore angolare compreso tra 10{sup o} e 17{sup o}. Conclusioni. Il nostro studio ha dimostrato la efficienza di due parametri quantitativi (il valore dell'angolo intrinseco dell'acromiom e la distanza acromion-omerale) che risultano essere dei fattori eziopatogenetici importanti nella sindrome da impingement. Tali parametri sono risultati compatibili e confrontabili con la classificazione di Bigliani, la quale, a nostro avviso, e suggestiva per la rilevazione morfologia qualitativa ma non risponde pienamente alla esigenza quantitativa. Il nostro studio suggerisce una correlazione inversamente proporzionale tra la misura della distanza acromion-omerale e la sindrome, mentre esiste un rapporto direttamente proporzionale tra il valore dell'angolo intrinseco dell'acromion e la sindrome da impingement. Tali parametri facilmente rilevabili con la RM possono rappresentare un ausilio oggettivo per il Radiologo e di conseguenza per il Clinico, nella determinazione dei soggetti affetti da sindrome da inpingement aspecifico.

  13. Environmental radioactivity networks in Italy, 1994-1997; Reti nazionali di sorveglianza della radioattivita' ambientale in Italia: 1994-1997

    Energy Technology Data Exchange (ETDEWEB)

    Belli, M; Notaro, M; Rosamilia, S; Sansone, U [Agenzia Nazionale per la Protezione dell' Ambiente, Rome (Italy). Dipt. StatoAmbiente, Controlli e Sistemi Informativi, Unita' Interdipartimentale di Metrologia Ambientale

    1999-07-01

    fine della valutazione della dose ricevuta dalla popolazione itlaiana a seguito dell'esposizione alle radiazioni derivanti dai radionuclidi presenti nell'ambiente. Le Reti Nazionali consistono in un insieme di punti di osservazione localizzati sul territorio nazionale definiti per analizzare l'andamento spazio-temporale delle concentrazioni dei radioelementi in matrici ambientali ed alimentari dei diversi comparti ambientali interessati dalla diffusione della radioattivita' e dal trasferimento di questa all'uomo. Le Reti sono progettate in modo da permettere anche la rilevazione di fenomeni di accumulo dei radionuclidi a lunga vita media nell'ambiente. Le frequenze di campionamento delle matrici ambientali previste nelle diverse reti, tengono conto dei tempi di accumulo della radioattivita' nei vari comparti ambientali. Il Decreto Legislativo N. 230 del 1995 affida all'ANPA il coordinamento tecnico delle Reti Nazionali. In questo ambito l'ANPA e' tenuta alla raccolta e all'analisi dei dati di radioattivita' ambientale provenienti dalle Istituzioni partecipanti alle Reti Nazionali, assicurandone la diffusione periodica tramite appositi rapporti annuali. In ottemperanza di accordi internazionali, gli stessi dati sono trasmessi anche alla Commissione Europea. All'ANPA sono inoltre affidate attivita per la normalizzazione dei metodi di prelievo e di misura delle matrici ambientali e alimentari. Per garantire l'affidabilita' generale dei dati pubblicati e delle valutazioni conseguenti e permettere agli Istituti, Enti ed Organismi che partecipano alle Reti Nazionali il raggiungimento di livelli di accuratezza e di affidabilita adeguati agli scopi del controllo ambientale, i laboratori responsabili dei prelievi e delle misure e facenti parte delle Reti Nazionali, partecipano sistematicamente ad un programma di affidabilita' organizzato dall'ANPA in collaborazione con l'Istituto Nazionale di Metrologia delle Radiazioni Ionizzanti (ENEA). Il programma comprende campagne

  14. Environmental radioactivity networks in Italy, 1994-1997; Reti nazionali di sorveglianza della radioattivita' ambientale in Italia: 1994-1997

    Energy Technology Data Exchange (ETDEWEB)

    Belli, M.; Notaro, M.; Rosamilia, S.; Sansone, U. [Agenzia Nazionale per la Protezione dell' Ambiente, Rome (Italy). Dipt. StatoAmbiente, Controlli e Sistemi Informativi, Unita' Interdipartimentale di Metrologia Ambientale

    1999-07-01

    ' ambientale sul territorio nazionale, al fine della valutazione della dose ricevuta dalla popolazione itlaiana a seguito dell'esposizione alle radiazioni derivanti dai radionuclidi presenti nell'ambiente. Le Reti Nazionali consistono in un insieme di punti di osservazione localizzati sul territorio nazionale definiti per analizzare l'andamento spazio-temporale delle concentrazioni dei radioelementi in matrici ambientali ed alimentari dei diversi comparti ambientali interessati dalla diffusione della radioattivita' e dal trasferimento di questa all'uomo. Le Reti sono progettate in modo da permettere anche la rilevazione di fenomeni di accumulo dei radionuclidi a lunga vita media nell'ambiente. Le frequenze di campionamento delle matrici ambientali previste nelle diverse reti, tengono conto dei tempi di accumulo della radioattivita' nei vari comparti ambientali. Il Decreto Legislativo N. 230 del 1995 affida all'ANPA il coordinamento tecnico delle Reti Nazionali. In questo ambito l'ANPA e' tenuta alla raccolta e all'analisi dei dati di radioattivita' ambientale provenienti dalle Istituzioni partecipanti alle Reti Nazionali, assicurandone la diffusione periodica tramite appositi rapporti annuali. In ottemperanza di accordi internazionali, gli stessi dati sono trasmessi anche alla Commissione Europea. All'ANPA sono inoltre affidate attivita per la normalizzazione dei metodi di prelievo e di misura delle matrici ambientali e alimentari. Per garantire l'affidabilita' generale dei dati pubblicati e delle valutazioni conseguenti e permettere agli Istituti, Enti ed Organismi che partecipano alle Reti Nazionali il raggiungimento di livelli di accuratezza e di affidabilita adeguati agli scopi del controllo ambientale, i laboratori responsabili dei prelievi e delle misure e facenti parte delle Reti Nazionali, partecipano sistematicamente ad un programma di affidabilita' organizzato dall'ANPA in

  15. Planning of mobility and parking. The acting of the Urban Mobility Plan Pianificazione delle mobilità e sosta. L’attuazione del Piano Urbano di Mobilità

    Directory of Open Access Journals (Sweden)

    Giuseppe Mazzeo

    2009-05-01

    Mobilità è l’ultimo nato tra questi ed è uno strumento prevalentemente strategico in quanto agisce sul sistema nel suo complesso ipotizzando una generale razionalizzazione ed evoluzione di reti e mezzi. L’articolo approfondisce i caratteri di questo strumento, a partire dalle previsioni legislative ed in relazione a specifici casi applicativi. In particolare, la prima parte analizza i concetti che sono alla base delle relazioni tra città, mobilità urbana e regolazione della sosta. Nella seconda parte si analizzano gli aspetti normativi, ossia il Piano Urbano della Mobilità, anche in relazione ad uno strumento che lo ha preceduto e che era specificamente indirizzato alla programmazione delle infrastrutture per la sosta, il Programma Urbano dei Parcheggi. La terza parte analizza due casi di applicazione dello strumento, relativi alle città di Ferrara e Perugia con lo scopo di evidenziare le diverse opzioni che si aprono davanti al pianificatore nel momento in cui è necessario applicare lo strumento teorico ad una specifica realtà urbana. Infine, nella quarta parte, sono messe in evidenza alcune delle tecniche e degli strumenti utilizzabili per la risoluzione del problema della sosta in relazione ai tipi di sosta, alle diverse modalità per la sua organizzazione e alle tecniche di gestione indirizzate a favorire comportamenti più corretti in relazione ai diversi ambiti urbani.

  16. La stima dei fabbisogni irrigui a scala aziendale e consortile mediante tecniche di Osservazione della Terra

    Directory of Open Access Journals (Sweden)

    Filiberto Altobelli

    2012-04-01

    Full Text Available Le applicazioni agrometeorologiche per la gestione delle colture in pieno campo e l’utilizzo di nuove tecnologie di monitoraggio sono sempre più diffuse e si concretizzano anche attraverso lo sviluppo di progetti di ricerca internazionali orientati all’implementazione di servizi operativi. Particolare rilevanza assume il programma Global Monitoring for Enviroment and Security (GMES, che supporta lo sviluppo di capacità e servizi di monitoraggio globale attraverso tecniche di Osservazione della Terra. Irrigation  needs  estimation  at  farm  and  district  level  by Earth Observation techniquesSIRIUS  (Sustainable  Irrigation  water  management  and  River-basin  governance:  Implementing  User-driven  Services  is  a research project funded by EU FP7 in the GMES framework supporting the development of monitoring services through remote sensing and ICT technologies to deliver the service to the  final  users.  SIRIUS  is  developing  efficient  water  resource management  services  in  support  of  food  production  in  water-scarce  environments.  It  addresses  water  governance  and management  in  accordance  with  the  vision  of  bridging  and integrating sustainable development and economic competi-tiveness. The project is developing new services for water man-agers and food producers, and a range of additional information products in support of sustainable irrigation water use and management under conditions of water scarcity and drought.

  17. Verifica della qualitá delle indagini epidemiologiche per eventi epidemici di tossinfezione alimentare: l'esperienza del Servizio Igiene Pubblica della ASL RMG

    Directory of Open Access Journals (Sweden)

    A. Lancia

    2003-05-01

    Full Text Available

    Obiettivi: obiettivo dello studio è verificare il miglioramento della qualità delle indagini epidemiologiche per eventi epidemici di tossinfezione alimentare dopo l’implementazione di un protocollo aziendale condiviso tra i servizi del Dipartimento di Prevenzione della ASL RMG (SIP-SIAN-SV e l’attivazione della pronta disponibilità di una equipe dedicata.

    Metodi: sono state presi in considerazione tutti gli eventi epidemici di tossinfezione alimentare individuati dal SIP nel periodo 1998-2002: il periodo A (1998-1sem2000 è quello precedente all’attivazione del protocollo e il periodo B (2sem 2000-2002 è quello successivo. È stato realizzato un questionario per la raccolta retrospettiva dei dati archiviati; l’informatizzazione è stata effettuata con il programma EPIinfo vers. 6.0 e l’analisi con il software microsoft excel vers 7.0. Risultati: nel periodo A sono stati individuati n.14 eventi epidemici per un totale di 76 malati. Il servizio SIAN e/o SV è stato attivato nel 28% dei casi, il sopralluogo nel luogo di consumo del pasto è stato effettuato nel 42%(6/14 e nel 33% dei casi il campionamento dell’alimento ha individuato l’agente microbiologico. Nel periodo B invece sono stati individuati n.21 eventi epidemici per un totale di 202 malati. Il servizio SIAN e/o SV è stato attivato nel 71% dei casi, il sopralluogo nel luogo di consumo del pasto è stato effettuato nel 57%(12/21 e nel 57% dei casi il campionamento dell’alimento ha individuato l’agente microbiologico.

    Conclusioni: in seguito all’attivazione del protocollo è migliorata la qualità dei dati raccolti. L’istituzione di una equipe dedicata ha determinato una più accurata sorveglianza degli episodi di tossinfezione attraverso una maggiore efficienza nell’attivazione dei servizi SIAN-SV. Questa esperienza dimostra che l’integrazione tra i Servizi del Dipartimento di Prevenzione

  18. L’INSEGNAMENTO DELLE SCIENZE IN EUROPA: ASPETTI LINGUISTICI A CONFRONTO (ITALIA, DANIMARCA, GALLES

    Directory of Open Access Journals (Sweden)

    Silvia Marianna Bollone

    2015-02-01

    Full Text Available La componente linguistica riveste un ruolo prioritario nell’insegnamento-apprendimento delle scienze, specificamente prescritto dai programmi scolastici attualmente vigenti in Europa e pienamente accolto dalle Indicazioni nazionali per il curricolo della scuola dell'infanzia e del primo ciclo d’istruzione, di cui D.M. 254/2012. Il presente lavoro intende indagare l’incidenza dell’aspetto linguistico-comunicativo nel processo di insegnamento-apprendimento delle scienze nell’ambito di tre differenti contesti europei: l’Italia, la Danimarca e il Galles, nella fascia di età compresa all’incirca tra gli 11 e 14 anni, corrispondente per l’Italia alla Scuola secondaria di primo grado, per la Danimarca ad un segmento della Folkeskole, e per il Galles alla fase iniziale della Secondary School. La ricerca, incentrata su uno specifico argomento del programma di scienze comune ai tre sistemi scolastici, prevede un’analisi dei programmi ministeriali, delle programmazioni degli insegnanti, dei manuali in uso nelle scuole, nell’intento di definire il ruolo assegnato agli aspetti linguistici nell’insegnamento delle scienze sia livello legislativo-istituzionale che nella quotidiana pratica didattica.  Teaching science in Europe: language issues compared (Italy, Denmark, Wales The linguistic component plays a major role in the teaching and learning of science, specifically prescribed by the curriculum currently in force in Europe and fully supported by the National Guidelines for the curriculum in kindergarten and the first cycle of education, regulated by DM 254/2012. This paper aims to investigate the linguistic-communicative impact in the process of teaching and learning science in three different European contexts: Italy, Denmark and Wales in children aged 11 to 14, corresponding in Italy to Middle school, in Denmark to a segment of the Folkeskole, and in Wales to the initial phase of the Secondary school. The research focused on a

  19. La stima dei fabbisogni irrigui a scala aziendale e consortile mediante tecniche di Osservazione della Terra

    Directory of Open Access Journals (Sweden)

    Filiberto Altobelli

    2012-04-01

    Full Text Available Le applicazioni agrometeorologiche per la gestione delle colture in pieno campo e l’utilizzo di nuove tecnologie di monitoraggio sono sempre più diffuse e si concretizzano anche attraverso lo sviluppo di progetti di ricerca internazionali orientati all’implementazione di servizi operativi. Particolare rilevanza assume il programma Global Monitoring for Enviroment and Security (GMES, che supporta lo sviluppo di capacità e servizi di monitoraggio globale attraverso tecniche di Osservazione della Terra.   Irrigation  needs  estimation  at  farm  and  district  level  by Earth Observation techniques SIRIUS  (Sustainable  Irrigation  water  management  and  River-basin  governance:  Implementing  User-driven  Services  is  a research project funded by EU FP7 in the GMES framework supporting the development of monitoring services through remote sensing and ICT technologies to deliver the service to the  final  users.  SIRIUS  is  developing  efficient  water  resource management  services  in  support  of  food  production  in  water-scarce  environments.  It  addresses  water  governance  and management  in  accordance  with  the  vision  of  bridging  and integrating sustainable development and economic competi-tiveness. The project is developing new services for water man-agers and food producers, and a range of additional information products in support of sustainable irrigation water use and management under conditions of water scarcity and drought.

  20. A high space-time resolution dataset linking meteorological forcing and hydro-sedimentary response in a mesoscale Mediterranean catchment (Auzon) of the Ardèche region, France

    NARCIS (Netherlands)

    Nord, Guillaume; Boudevillain, Brice; Berne, Alexis; Branger, Flora; Braud, Isabelle; Dramais, Guillaume; Gérard, Simon; Coz, Le Jérôme; Legoût, Cédric; Molinié, Gilles; Teuling, Ryan

    2017-01-01

    A comprehensive hydrometeorological dataset is presented spanning the period 1 January 2011-31 December 2014 to improve the understanding of the hydrological processes leading to flash floods and the relation between rainfall, runoff, erosion and sediment transport in a mesoscale catchment

  1. A high space-time resolution dataset linking meteorological forcing and hydro-sedimentary response in a mesoscale Mediterranean catchment (Auzon) of the Ardèche region, France

    OpenAIRE

    Nord, Guillaume; Boudevillain, Brice; Berne, Alexis; Branger, Flora; Braud, Isabelle; Dramais, Guillaume; Gérard, Simon; Coz, Le, Jérôme; Legoût, Cédric; Molinié, Gilles; Teuling, Ryan

    2017-01-01

    A comprehensive hydrometeorological dataset is presented spanning the period 1 January 2011-31 December 2014 to improve the understanding of the hydrological processes leading to flash floods and the relation between rainfall, runoff, erosion and sediment transport in a mesoscale catchment (Auzon, 116km2) of the Mediterranean region. Badlands are present in the Auzon catchment and well connected to high-gradient channels of bedrock rivers which promotes the transfer of suspended solids downst...

  2. Radioactive investigation in an industrial plant of Ascoli Piceno which makes use of graphite scraps; Indagine radiometrica in un insediamento produttivo di Ascoli Piceno che utilizza rottami di grafite

    Energy Technology Data Exchange (ETDEWEB)

    Di Ciaccio, P.; Grisanti, F.; Sabatini, F. [Istituto Superiore di Sanita' , Working Group on Radioactive Contamination of Graphite Samples, Rome (Italy)

    2001-07-01

    In 1997 a radiological alarm originated in an Italian industrial plant in Ascoli Piceno. This fact required to investigate a peculiar case of a possible radioactive contamination in a working environment up to its solution. A working group made of experts of various Institutes and Organisations, after an analysis of the situation, carried out an experimental study and drew some scientific and radiation protection conclusions. This report contains a review of the work performed by the working group and a summary of the radiation protection intervention at the plant. [Italian] L'allarme radiologico creatosi nel 1997 in un insediamento produttivo di Ascoli Piceno ha portato all'esame ed alla soluzione di un singolare evento di possibile contaminazione di un ambiente di lavoro industriale. Il rapporto riporta il resoconto degli interventi di radioprotezione operativa eseguiti presso l'insediamento, l'analisi del problema e lo studio sperimentale eseguiti da un gruppo di lavoro creato fra varie istituzioni e alcune conclusioni scientifiche e radioprotezionistiche del gruppo stesso.

  3. «…la fatica di ricostruire la naturale unità fra parola e immagine». Warburg, Benjamin e ciò che la storia non può dire

    Directory of Open Access Journals (Sweden)

    Silvia Ferretti

    2012-05-01

    Full Text Available The paper intends to draw some topics about relationship between word and image in works and thinking of Aby Warburg and Walter Benjamin. In recent history of ideas, word and image are frequently interpreted as alternative ways to express reality. In both, Warburg and Benjamin, and in spite of  their very different methods of approaching history of art and history of culture, we can find a similar idea of the connection between word and image. The two authors deem that this relationship is necessary to understand historical facts and legacy.

  4. Origini Concettuali di Errori che si Riscontrano Nel Confrontare Numeri Decimali e Frazioni=Conceptual Sources of Difficulties Concerning the Ordering of Decimal Numbers and the Comparison of Fractions.

    Science.gov (United States)

    Bonotto, C.

    1993-01-01

    Examined fifth-grade students' survey responses to investigate incorrect rules that derive from children's efforts to interpret decimals as integers or as fractions. Regarding fractions, difficulties arise because only the whole-part approach to fractions is presented in elementary school. (Author/MDH)

  5. [Exploring life-experience of the staff and volunteers assisting pediatric patients in end-of-life situations] [Article in Italian] • I vissuti dello staff e dei volontari che assistono pazienti pediatrici terminali

    Directory of Open Access Journals (Sweden)

    Rosapia Lauro Grotto

    2014-06-01

    Full Text Available The development of guidelines for palliative care in the paediatric settings is judged to be still incomplete and characterized by many controversial issues; in order to explore the life-experience of individual health care professionals, we proposed a semi-structured questionnaire with open questions on end-of-life procedures to the staff members of the Paediatric Onco-hematology Ward of the University of Padua, of the Oncology Ward and in the Home Assistance Module of the Giannetta Gaslini Hospital, Genoa, both in Italy. This paper will focus on the responses provided to the third question: “In your opinion, can inducing the suspension of the state of consciousness be counted among end-of-life procedures? If so, how and when?”. Staff members were found to face challenging interactions at at least three levels: within the professional team, with respect to the parents and with respect to the adolescent patients. Among the most complex issues raised by the participants we found the moral distress sometimes experienced by nurses with respect to the decisions assumed by doctors, as stated by a nurse: “Everything is subjective in those 24 hours  (… and you are to do or not do certain things and it makes you feel distressed”. Second, it emerged that the relationship with the parents becomes very challenging when the two are not in agreement: “The father wants to give the morphine, but the mother secretly closes the drip”. Finally, the relationship of trust with the adolescent patients is under threat when they ‘want to know’ while parents seem to be unable to tolerate this degree of painful but essential self-consciousness in their ‘child’: “He locked me in the room and asked, ‘Am I dying?’, and I wanted to die at that point…”. Our study shows that health care professionals require not just guidelines but a tailor-made training and support which integrate much deeply the therapeutic as well as the moral and philosophical approaches to the issues raised by palliative care in paediatric settings.Articoli Selezionati del Congresso “Medicina Narrativa e Comunicazione nella Pratica Clinica” ·  Cagliari · 14 Aprile 2014 Guest Editors: Massimiliano Zonza, Vassilios Fanos, Gian Paolo Donzelli

  6. LA SITUATION DES ÉCREVISSES EN FRANCE RÉSULTATS DES ENQUÊTES NATIONALES RÉALISÉES ENTRE 1977 ET 2006 PAR LE CONSEIL SUPÉRIEUR DE LA PÊCHE

    Directory of Open Access Journals (Sweden)

    COLLAS M.

    2007-07-01

    Full Text Available Depuis la fin du XIX° siècle, la distribution des écrevisses en France a connu de profonds bouleversements, et l’introduction d’écrevisses allochtones en provenance essentiellement du continent nord-américain, a irrémédiablement modifié le paysage astacologique français et européen. Les quatre enquêtes réalisées en France par le Conseil Supérieur de la Pêche depuis 1977, ont permis de suivre l’évolution des différentes espèces d’écrevisses recensées sur le territoire national, mettant à chaque fois en évidence la forte expansion des espèces exotiques et le recul des espèces natives. L’enquête de 2006 n’échappe pas à cette tendance et la situation de nos trois espèces d’écrevisses doit désormais être considérée comme alarmante. Deux de ces espèces se caractérisent par un statut de conservation proche de l’extinction (Austropotamobius torrentium et Astacus astacus alors que la troisième, Austropotamobius pallipes est « réfugiée » sur les secteurs apicaux des bassins versants, confinée sur des zones soumises aux premières manifestations du changement climatique et isolées par les espèces exotiques qui progressent de plus en plus vers l’amont. En effet, l’écrevisse du Pacifique (Pacifastacus leniusculus, mais aussi l’écrevisse rouge de Louisiane (Procamabrus clarkii, sont les espèces qui montrent la plus forte expansion géographique durant la période 2001-2006. Partout elles apparaissent comme des concurrents redoutables, plus agressifs, résistants aux pathologies, capables de coloniser des habitats variés…. Ces deux espèces en particulier étendent leur aire de répartition et colonisent chaque année de nouveaux départements, de nouveaux cours d’eau, éliminant par là même, les espèces autochtones. L’expansion des écrevisses introduites, l’arrivée récente en France d’une nouvelle espèce (Orconectes juvenilis et les modifications de la Loi autorisant dorénavant le transport à l’état vivant des « espèces susceptibles de provoquer des déséquilibres biologiques » pourraient sceller définitivement le sort des écrevisses endémiques, si aucune mesure n’est prise rapidement par les autorités, dans le cadre d’un plan d’action national « écrevisse ».

  7. Le site d'Orgnac 3 (Ardèche, France). Étude sédimentologique et géochimique. Cadre chronologique et évolution paléoclimatique

    OpenAIRE

    Khatib , Samir

    1989-01-01

    Les études développées dans cette thèse ont permis de proposer de nouvelles données stratigraphiques, chronologiques et géochimiques. L'étude sédimentologique a mis en évidence quatre ensembles sédimentaires bien distincts, comprenant 12 niveaux stratigraphiques. Les ensembles inférieur I et supérieur IV, se sont déposés sous un climat froid et sec accompagné d'actions éoliennes intenses. L'origine des sédiments de l'ensemble inférieur se situe dans le Massif Central (abondance des minéraux m...

  8. A high space-time resolution dataset linking meteorological forcing and hydro-sedimentary response in a mesoscale Mediterranean catchment (Auzon) of the Ardèche region, France

    Science.gov (United States)

    Nord, Guillaume; Boudevillain, Brice; Berne, Alexis; Branger, Flora; Braud, Isabelle; Dramais, Guillaume; Gérard, Simon; Le Coz, Jérôme; Legoût, Cédric; Molinié, Gilles; Van Baelen, Joel; Vandervaere, Jean-Pierre; Andrieu, Julien; Aubert, Coralie; Calianno, Martin; Delrieu, Guy; Grazioli, Jacopo; Hachani, Sahar; Horner, Ivan; Huza, Jessica; Le Boursicaud, Raphaël; Raupach, Timothy H.; Teuling, Adriaan J.; Uber, Magdalena; Vincendon, Béatrice; Wijbrans, Annette

    2017-03-01

    A comprehensive hydrometeorological dataset is presented spanning the period 1 January 2011-31 December 2014 to improve the understanding of the hydrological processes leading to flash floods and the relation between rainfall, runoff, erosion and sediment transport in a mesoscale catchment (Auzon, 116 km2) of the Mediterranean region. Badlands are present in the Auzon catchment and well connected to high-gradient channels of bedrock rivers which promotes the transfer of suspended solids downstream. The number of observed variables, the various sensors involved (both in situ and remote) and the space-time resolution ( ˜ km2, ˜ min) of this comprehensive dataset make it a unique contribution to research communities focused on hydrometeorology, surface hydrology and erosion. Given that rainfall is highly variable in space and time in this region, the observation system enables assessment of the hydrological response to rainfall fields. Indeed, (i) rainfall data are provided by rain gauges (both a research network of 21 rain gauges with a 5 min time step and an operational network of 10 rain gauges with a 5 min or 1 h time step), S-band Doppler dual-polarization radars (1 km2, 5 min resolution), disdrometers (16 sensors working at 30 s or 1 min time step) and Micro Rain Radars (5 sensors, 100 m height resolution). Additionally, during the special observation period (SOP-1) of the HyMeX (Hydrological Cycle in the Mediterranean Experiment) project, two X-band radars provided precipitation measurements at very fine spatial and temporal scales (1 ha, 5 min). (ii) Other meteorological data are taken from the operational surface weather observation stations of Météo-France (including 2 m air temperature, atmospheric pressure, 2 m relative humidity, 10 m wind speed and direction, global radiation) at the hourly time resolution (six stations in the region of interest). (iii) The monitoring of surface hydrology and suspended sediment is multi-scale and based on nested catchments. Three hydrometric stations estimate water discharge at a 2-10 min time resolution. Two of these stations also measure additional physico-chemical variables (turbidity, temperature, conductivity) and water samples are collected automatically during floods, allowing further geochemical characterization of water and suspended solids. Two experimental plots monitor overland flow and erosion at 1 min time resolution on a hillslope with vineyard. A network of 11 sensors installed in the intermittent hydrographic network continuously measures water level and water temperature in headwater subcatchments (from 0.17 to 116 km2) at a time resolution of 2-5 min. A network of soil moisture sensors enables the continuous measurement of soil volumetric water content at 20 min time resolution at 9 sites. Additionally, concomitant observations (soil moisture measurements and stream gauging) were performed during floods between 2012 and 2014. Finally, this dataset is considered appropriate for understanding the rainfall variability in time and space at fine scales, improving areal rainfall estimations and progressing in distributed hydrological and erosion modelling. DOI of the referenced dataset: doi:10.6096/MISTRALS-HyMeX.1438.

  9. Frontières, traduction et politiques de la différence : la tâche herméneutique de l'éducation comparée

    Science.gov (United States)

    Malet, Régis

    2011-08-01

    Borders, translation and politics of difference: the hermeneutic task of comparative education - Governments are making increasing use of international comparisons as a tool to run and reform education systems, through the establishment of competency norms and assessment standards. In light of this trend, this paper wishes not only to reiterate the crucial distinction, made by Max Weber as early as 1922, between scientific research and political action, but also to recall the principles of separation and mediation from which the comparative approach in education derives. The concepts that comprise a language, that are disseminated and become established in a social world, are borne of history, of dynamic uses, and are culturally rooted. By neglecting this social and cultural provenance of words there is a danger that one can end up with a comparability based on functional equivalencies alone; although there are strong pressures in this direction, it is probably the surest way, in the words of Marcel Détienne, of "comparing the incomparable". The purely instrumental rationality that favours the spread of such frameworks or interpretative models appears indifferent to questions of meaning and culture, apart from being irrational on an axiological level, if we follow Weber. Strangeness or even `otherness' tends to be erased. One wonders therefore what issues are raised for the comparativist when the illusion of spontaneity in translation is reduced to a functional equivalence. In keeping with the researcher's responsibility to mediate, he/she must promote clarification and mutual understanding (inspired by C. Taylor), replacing the standardisation of words with a critical illumination of the semiotic variations generated by their use.

  10. High resolution analysis of uranium and thorium concentration as well as U-series isotope distributions in a Neanderthal tooth from Payre (Ardèche, France) using laser ablation ICP-MS

    Science.gov (United States)

    Grün, Rainer; Aubert, Maxime; Joannes-Boyau, Renaud; Moncel, Marie-Hélène

    2008-11-01

    We have mapped U ( 238U) and Th ( 232Th) elemental concentrations as well as U-series isotope distributions in a Neanderthal tooth from the Middle Palaeolithic site of Payre using laser ablation ICP-MS. The U-concentrations in an enamel section varied between 1 and 1500 ppb. The U-concentration maps show that U-migration through the external enamel surface is minute, the bulk of the uranium having migrated internally via the dentine into the enamel. The uranium migration and uptake is critically dependent on the mineralogical structure of the enamel. Increased U-concentrations are observed along lineaments, some of which are associated with cracks, and others may be related to intra-prismatic zones or structural weaknesses reaching from the dentine into the enamel. The uranium concentrations in the dentine vary between about 25,000 and 45,000 ppb. Our systematic mapping of U-concentration and U-series isotopes provides insight into the time domain of U-accumulation. Most of the uranium was accumulated in an early stage of burial, with some much later overprints. None of the uranium concentration and U-series profiles across the root of the tooth complied with a single stage diffusion-adsorption (D-A) model that is used for quality control in U-series dating of bones and teeth. Nevertheless, in the domains that yielded the oldest apparent U-series age estimates, U-leaching could be excluded. This means that the oldest apparent U-series ages of around 200 ka represent a minimum age for this Neanderthal specimen. This is in good agreement with independent age assessments (200-230 ka) for the archaeological layer, in which it was found. The Th elemental concentrations in the dental tissues were generally low (between about 1 and 20 ppb), and show little relationship with the nature of the tissue.

  11. Palaeolithic Timekeepers Looking At The Golden Gate Of The Ecliptic; The Lunar Cycle And The Pleiades In The Cave Of La-TETe-Du-Lion (Ardéche, France) - 21,000 BP

    Science.gov (United States)

    Rappenglück, Michael A.

    Decades of research work done by several scientists all over the world since the beginning of the 20th century confirmed the idea, that Palaeolithic man looked up to the starry sky and recognized prominent patterns of stars as well as the course of the celestial bodies. Though sometimes highly speculative, the investigations made clear, that time-factored notations played an important role in the archaic cultures of Palaeolithic epochs (from 33,000 to 10,000 BP). There are some distinct and detailed examples of lunar-, solar- and lunisolar-calendars sometimes combined with pictures of seasonality, mostly discovered on transportable bones and stones, but also on the fixed walls of certain caves. The investigations showed that in Palaeolithic epochs time-reckoning, in particular the lunar cycle, had been related to the pregnancy of women too (Figure 2a-d). Recently I showed, that in the Magdalenian time (16,000-12,000 BP) man also recognized single and very complex star patterns, including the Milky Way: the Northern Crown in the cave of El Castillo (Spain), the Pleiades in the cave of Lascaux (France) and the main constellations of the sky at the same location. They were used by the Palaeolithic hunter-gatherers for orientation in space and for time-reckoning. These star patterns also played an important role in the cosmovisions of archaic cultures. Together with the depictions of the course of the moon and the sun, they helped to organize the spatiotemporal structure of daily and spiritual life of Palaeolithic man. Now I present a rock panel in the cave of La-T^ete-du-Lion (France) that shows the combination of a star pattern - Aldebaran in the Bull and the Pleiades - with a drawing of the moons cycle above. This picture comes from the Solutrean epoch ca 21,000-22,000 BP. It shows not only a remarkable similarity with the representation in the Lascaux cave, but clearly connects the star pattern with a part of the lunar cycle.

  12. Organisation de l'activité neuronale cérébelleuse lors de d'une tâche de préhension et reste dans des rats déplaçant librement

    OpenAIRE

    Gao , Hongying

    2012-01-01

    The cerebellum is a brain structure involved in coordination complex motor actions such as voluntary movements. To achieve this function, the precise temporal control of a large population of neurons is required. While a large number of patterned population activity has been characterized in many major brain structures (thalamo-cortical system, basal ganglia, hippocampal formation, etc...), very little is currently known in the cerebellum. Therefore, I investigated the presence and characteri...

  13. Victims of Occupational Injuries: A Comparison between Migrants and Italians. Results of a survey conducted in Trentino in 2009 / Vittime di infortunio sul lavoro : una comparazione tra italiani e stranieri. Risultati di una ricerca condotta in Trentino nel 2009 / Victimes d’accidents du travail: une comparaison entre travailleurs immigrés et italiens. Résultats d’une enquête conduite en 2009 en Trentin

    Directory of Open Access Journals (Sweden)

    Martinello Daniela

    2011-07-01

    analisi statistica, quali fattori possono aiutare a spiegare la maggiore vittimizzazione degli stranieri. Il presente saggio risponderà alle seguenti domande: Chi è la vittima? Con che frequenza è stata vittimizzata? Qual è la gravità degli infortuni subiti? Quale la tendenza alla non denuncia? Quali le caratteristiche personali (età, genere, ecc. della vittima? E la sua storia professionale? Quali le caratteristiche dell’azienda in cui lavora e il livello di conformità alle norme sulla Salute e Sicurezza nell’azienda stessa? Infine, sono presentati i fattori che possono aiutare a spiegare la maggiore vittimizzazione degli stranieri nel fenomeno e sono indicate alcune possibili direzioni di azione per contrastare la problematica degli infortuni sul lavoro. Cet article attire l’attention sur les victimes d’accidents du travail et, de manière plus spécifique, sur les différences entre travailleurs italiens et immigrés. Une enquête de terrain a été conduite dans la région du Trentin : un questionnaire a été soumis à deux groupes de victimes d’accidents du travail, l'un composé de travailleurs italiens (300 répondants et l'autre d’immigrés (200 répondants. Cette étude a permis d'atteindre les objectifs suivants : vérifier si les travailleurs étrangers sont plus vulnérables aux accidents du travail que les italiens ; décrire le profil des victimes d’accidents du travail (aussi bien italiennes qu’immigrantes ; à travers l'analyse statistique, identifier les facteurs qui peuvent contribuer à expliquer la plus haute proportion de victimes parmi les immigrés.Ensuite, cet article s’attache à répondre aux questions suivantes : Qui est la victime ? Combien de fois est-elle victime ? Quelle est la gravité des accidents subis ? Qu'en est-il de la propension des victimes à ne pas porter plainte ? Quelles sont les caractéristiques personnelles (âge, genre, etc. et l’histoire professionnelle de la victime ? Quelles sont les caractéristiques de

  14. Status sulle conoscenze dei mammiferi molisani

    Directory of Open Access Journals (Sweden)

    Nicola Norante

    2003-10-01

    Full Text Available Il Molise risulta poco studiato dal punto di vista teriologico e, per colmare almeno in parte tale lacuna, il GMSO si è proposto di raccogliere dati bibliografici e inediti e promuovere qualche progetto. Si riportano sinteticamente dati relativi ad alcune specie. Sciurus vulgaris risulta comune in Prov. di Isernia, più localizzato in quella di Campobasso, presente nelle riserve MAB, nel Parco Naz. d?Abruzzo, Matese e Venafrano, nei pressi della zona ospedaliera di Campobasso ed anche al centro del capoluogo. Hystrix cristata, segnalata fino agli anni anni ?60 a Campomarino è stata trovata di recente (aculei in Alto Molise, sporadiche le segnalazioni nell?agro di S. Croce di Magliano-Colletorto (CB. Canis lupus ha recentemente allargato il suo areale raggiungendo anche siti in collina (per l?immissione dei Daini. Presente oltre che nel PNA, in tutta la Prov. di Isernia, Matese, montagna di Frosolone fino a Castropignano-Casalciprano. Preoccupante invece il randagismo canino verso il quale è auspicabile prendere dei provvedimenti. Ursus arctos è in aumento con massimi in Val di Mezzo, Val Fiorita, Val Pagana, M .te Marrone ed in tutto il gruppo delle Mainarde; fuori dal PNA è sempre più frequente: Matese, Carpinone e recentemente (27.04.03 una coppia in Valle del Sangro a S. Angelo in Pesco (IS. Nel 1995 una femmina è stata investita dal treno nei pressi di Carpinone (IS. Lutra lutra invece è diminuita rispetto al passato. La si incontrava fino agli anni ?70/80 fino alla foce dei fiumi Trigno, Biferno e T. Saccione. Attualmente è segnalata in prov. di Isernia (es. Venafrano, Matese, Montagna di Frosolone. Felis silvestris è presente soprattutto in Prov. di Isernia dove è segnalato in 38 Comuni. In quella di Campobasso appare più localizzato a nord e nel Matese. Riguardo Lynx lynx pare che qualche soggetto sia stato osservato nell?area limitrofa al P.N.A. dove è stata

  15. Non mi diverto più! Il gioco d’azzardo patologico / Je ne m’amuse plus ! Le jeu de hasard problématique / I am not amused anymore! The pathological gambling

    Directory of Open Access Journals (Sweden)

    Vico Giulia

    2011-04-01

    .Argomento centrale di questo articolo è il gioco d’azzardo ed in particolare la patologia che esso può indurre. Al fine di introdurre il tema, viene esaminata l’organizzazione del gioco pubblico in Italia ed il contesto normativo in cui la materia è inserita. E’ poi analizzato l’inquadramento clinico della patologia e le caratteristiche di personalità e comportamentali tipiche del giocatore d’azzardo problematico. Dopo una breve disamina dei diversi programmi di trattamento della patologia, viene approfondita la particolare forma di terapia del gruppo di auto-aiuto dei “Giocatori Anonimi”. Essa rappresenta il contesto clinico all’interno del quale si è svolta una ricerca, che ha coinvolto 10 membri di un gruppo dell’associazione Giocatori Anonimi di Firenze, volta ad approfondire due aspetti peculiari dei giocatori d’azzardo patologici, cioè quelli relativi alle loro modalità erronee di pensiero concernenti il gioco ed alla loro decisione di partecipare al programma. In conclusione, data la gravità di questa patologia ai più sconosciuta, sono analizzate alcune importanti misure di prevenzione e di tutela dei giocatori d’azzardo problematici.

  16. UNPUBLISHED TEXTS / INEDITI

    African Journals Online (AJOL)

    User

    È come una fetta di luna. L'nguria che assaggi e che sputi non ti puoi saziare come del mare e dell'aria e dei pini marittimi e di questa quercia alberi dal tronco di sughero che è facile strappare, corteccia che ricresce. Non ti puoi saziare di questo mare verde e profondo luminosa acqua pietre pesci coralli gusci di perle.

  17. Il potere di Prometeo e il dovere di Kant

    Directory of Open Access Journals (Sweden)

    Stefano Picchetti

    2006-10-01

    Full Text Available Kant ci suggerisce qualcosa che Prometeo e il mito greco avevano già accennato. L'imperativo che pone freno al fare, è già in sé nel soggetto ed è per questo che egli che egli è responsabile delle proprie azioni, indipendentemente dalla legge scritta.

  18. Voyage in Italy : Roberto Rossellini's Non–Dualistic View of the ...

    African Journals Online (AJOL)

    Sostengo inoltre che Viaggio in Italia è il primo passo nella creazione di un cinema inteso come attività che aiuta gli spettatori a liberare se stessi da stereotipi e preconcetti. Concludo affermando che Viaggio in Italia anticipa la caratteristiche estetiche e filosofiche del cinema storico e didattico di Rossellini, che culmina ...

  19. A Multi-Institution Study of Student Demographics and Outcomes in Chemical Engineering

    Science.gov (United States)

    Lord, Susan M.; Layton, Richard A.; Ohland, Matthew W.; Brawner, Catherine E.; Long, Russell A.

    2014-01-01

    Using a large multi-institutional dataset, we describe demographics and outcomes for students starting in and transferring into chemical engineering (ChE). In this dataset, men outnumber women in ChE except among black students. While ChE starters graduate in ChE at rates comparable to or above their racial/ethnic population average for…

  20. BOOK REVIEWS / RECENSIONI

    African Journals Online (AJOL)

    User

    colei che trascorre il tempo accompagnandolo ai giovanotti, dando prova della sua peccaminosità sia sul piano individuale che su quello sociale”. (191). Secondo Bernardino le donne che cercavano di abbellirsi con i cosmetici in realtà finivano per imbruttirsi e compromettere la loro bellezza naturale, oltre che annullare “la ...

  1. La fisica del Novecento per un bilancio critico

    CERN Document Server

    Selleri, Franco

    1999-01-01

    Ma chi ha detto che la fine della fisica è vicina? Che tutto quello che c'era da scoprire è già stato scoperto? E che le generazioni future potranno solo precisare e raffinare, e mai negare o arricchire le attuali teorie? Questo libro si contrappone a pensatori come Heisenberg, Feyman e Hawking che hanno predetto la morte della fisica. L'autore sostiene che grandi progressi sono possibili, ma che il prezzo da pagare per realizzarli è una modifica radicale delle basi della fisica moderna, in particolare abbandonando l'indeterminismo, la non località (paradosso di Einstein, Podolsky e Rosen) e lo stesso principio di relatività.

  2. Programmēšanas spēle "PyDrone"

    OpenAIRE

    Siliņš, Viesturs

    2010-01-01

    Darbā “Programmēšanas spēle “PyDrone”” ir dokumentēta atvērtā koda programmas PyDrone izstrāde. PyDrone ir programmēšanas spēle, kas paredzēta izklaidei un izglītošanai, spēles veidā iepazīstinot cilvēkus ar programmēšanu. Programma izstrādāta, izmantojot Python programmēšanas valodu. Programma izstrādāta, izmantojot spējo metodiku programmizstrādes principus. Atslēgvārdi: Python, spējās metodikas, programmēšanas spēle.

  3. ARTICLES / SAGGI

    African Journals Online (AJOL)

    User

    che intellettuali o analfabeti, fortunati o disgraziati, poveri o ricchi, alla fine il bilancio è sempre lo stesso. [...] È la vita, e basta, e se riesco a dirla in modo che altri la riconosca in fraternità leggendomi, questo è il solo dovere che conti, la sola estetica che sia anche un'etica. Che sollievo! Infine l'ho detto, e in prima persona”.

  4. Deciphering chemotaxis pathways using cross species comparisons

    Directory of Open Access Journals (Sweden)

    Armitage Judith P

    2010-01-01

    Full Text Available Abstract Background Chemotaxis is the process by which motile bacteria sense their chemical environment and move towards more favourable conditions. Escherichia coli utilises a single sensory pathway, but little is known about signalling pathways in species with more complex systems. Results To investigate whether chemotaxis pathways in other bacteria follow the E. coli paradigm, we analysed 206 species encoding at least 1 homologue of each of the 5 core chemotaxis proteins (CheA, CheB, CheR, CheW and CheY. 61 species encode more than one of all of these 5 proteins, suggesting they have multiple chemotaxis pathways. Operon information is not available for most bacteria, so we developed a novel statistical approach to cluster che genes into putative operons. Using operon-based models, we reconstructed putative chemotaxis pathways for all 206 species. We show that cheA-cheW and cheR-cheB have strong preferences to occur in the same operon as two-gene blocks, which may reflect a functional requirement for co-transcription. However, other che genes, most notably cheY, are more dispersed on the genome. Comparison of our operons with shuffled equivalents demonstrates that specific patterns of genomic location may be a determining factor for the observed in vivo chemotaxis pathways. We then examined the chemotaxis pathways of Rhodobacter sphaeroides. Here, the PpfA protein is known to be critical for correct partitioning of proteins in the cytoplasmically-localised pathway. We found ppfA in che operons of many species, suggesting that partitioning of cytoplasmic Che protein clusters is common. We also examined the apparently non-typical chemotaxis components, CheA3, CheA4 and CheY6. We found that though variants of CheA proteins are rare, the CheY6 variant may be a common type of CheY, with a significantly disordered C-terminal region which may be functionally significant. Conclusions We find that many bacterial species potentially have multiple

  5. Monte Carlo analysis of radiative transport in oceanographic lidar measurements

    Energy Technology Data Exchange (ETDEWEB)

    Cupini, E.; Ferro, G. [ENEA, Divisione Fisica Applicata, Centro Ricerche Ezio Clementel, Bologna (Italy); Ferrari, N. [Bologna Univ., Bologna (Italy). Dipt. Ingegneria Energetica, Nucleare e del Controllo Ambientale

    2001-07-01

    foreseen its use for the analysis of data measured both by a ship bottom fluorosensor lidar and by a fluorosensor package payload of a submersible vehicle (ROV). [Italian] L'analisi delle misure di sistemi lidar oceanografici viene spesso effettuata mediante metodi semi empirici poiche' si ha solamente una conoscenza approssimata degli effetti delle numerose variabili ambientali. Si rende quindi necessario lo sviluppo di tecniche che permettano di valutare l'accuratezza delle misure dei sistemi lidar al variare delle condizioni ambientali, delle configurazioni della geometria sorgente/sensore e di determinate condizioni al contorno. Lo sviluppo di un modello di simulazione Montecarlo semi analitico rappresenta una soluzione che ben si presta a rispondere a questi quesiti. Il codice Montecarlo PREMAR-2F e' stato sviluppato prendendo in considerazione i principali componenti, sia molecolari che non, dell'ambiente marino. Sono previsti i processi di interazione della radiazione laser di diffusione, riemissione, rifrazione e assorbimento. In particolare vengono considerati lo scattering elastico di tipo Rayleigh prodotto da atomi e molecole con dimensioni piccole rispetto alla lunghezza d'onda di emissione del laser (per esempio molecole d'acqua), lo scattering elastico di Mie originato da atomi o molecole con dimensioni comparabili alla lunghezza d'onda del laser (idrosol), lo scattering inelastico di tipo Raman, tipico dell'acqua, l'assorbimento dell'acqua, degli idrosol inorganici (sedimenti) e organici (fitoplancton e CDOM), la fluorescenza di riemissione di clorofilla e sostanze gialle. PREMAR-2F e' un'estensione di un codice per la simulazione del trasporto radioattivo in ambienti atmosferici (PREMAR-2). Il codice PREMAR-2, sviluppato precedentemente, associa a tecniche Montecarlo convenzionali stime analitiche della probabilita' del ricevitore di avere un contributo da fotoni che ritornano dopo un

  6. Identification of genes involved in the regulation of programmed cell death in Arabidopsis thaliana : a functional genomics approach

    NARCIS (Netherlands)

    Gechev, Tsanko

    2007-01-01

    Geprogrammeerde celdood, in dieren zowel als in planten, is een genetisch gecontroleerd programma waarin cellen die niet meer nodig zijn, zichzelf vernietigen. Hoewel paradoxaal, is dit type celdood essentieel voor het leven en vindt plaats tijdens de ontwikkeling, maar ook als antwoord op

  7. Wieden zonder handwerk : wat mogen we van de onkruidrobot verwachten?

    NARCIS (Netherlands)

    Lokhorst, C.; Achten, V.T.J.M.; Bakker, T.; Goense, D.; Vermeulen, G.D.

    2003-01-01

    IMAG en WUR werken aan de ontwikkeling van een wiedrobot die geschikt is voor de Nederlandse omstandigheden en die het benodigde aantal uren handwieden in de biologische vollegrondsteelten kan helpen verminderen. Inmiddels is een programma van eisen geformuleerd en is onderzoek gestart naar de

  8. Relatie tussen ITS, weerstand tegen vervorming en de mengsels samenstelling : Gebruik van de MEPDG relaties voor Nederlandse mengsels uit NL-LAB

    NARCIS (Netherlands)

    Erkens, Sandra; Kasbergen, C.; Villani, M.M.; Scarpas, Athanasios; Florio, E.; Berti, C.

    2014-01-01

    Sinds 2008 werken we in Nederland met functionele eigenschappen voor asfalt
    beton. Hierbij wordt niet zo zeer op het “recept” van het asfalt gestuurd, als
    wel op de eigenschappen ervan die van belang zijn voor het gedrag in de weg.
    Binnen het NL-LAB programma wordt de relatie tussen deze

  9. Handleiding MEBOT onderwijs 2.03 : MEBOT onderwijs 2.0 : milieutechnisch, economisch bedrijfsmodel open teelten

    NARCIS (Netherlands)

    Hendriks, V.J.C.; Reeuwijk, van P.

    2010-01-01

    In deze handleiding staat informatie over het installeren van MEBOT en een algemene uitleg van het programma. Daarnaast staat hierin informatie over het invoeren van gegevens in MEBOT en hoe rapportages gemaakt kunnen worden. Het Milieutechnisch, Economie Bedrijfsmodel Open Teelten (MEBOT) is

  10. Inzicht in de netwerken op Facebook : Fanpages Analyse van Facebook Fanpages met behulp van de netwerkanalysetool NodeXL

    NARCIS (Netherlands)

    Sanne Gaastra; Sonja Utz

    2013-01-01

    Hoe analyseer je het netwerk van fans op je Facebookpagina? En wat zegt dat over de kracht van posts en actoren. In dit whitepaper zetten we uiteen hoe je het gratis programma NodeXL een visuele analyse van je pagina kunt maken. Interessant voor organisaties. Met deze kennis kun je immers gericht

  11. Bat 1: Estimate of bat populations at the southern North Sea

    NARCIS (Netherlands)

    Lagerveld, S.; Limpens, H.J.G.A.; Schillemans, M.J.; Scholl, M.

    2017-01-01

    To close the knowledge gap described above, or better said in order to make a start to overcome this crucial lack of insight into (sub)population sizes, RWS commissioned the Bats_1 study as part of the Wind op Zee Ecological Programma (Wozep; in English: Wind at Sea Ecological Programme), a

  12. Tunnelvisie op tunnelvisie? PVO en de spanning tussen voorzorg en daadkracht in de grootschalige opsporing

    NARCIS (Netherlands)

    Helsloot, I.; Groenendaal, J.

    2013-01-01

    In dit artikel onderzoeken we de betekenis van het Nederlandse landelijke Programma Versterking Opsporing (PVO) voor het kunnen onderkennen van tunnelvisie en andere procesaspecten tijdens het opsporingsproces door Teams Grootschalige Opsporing (TGO’s). Hiertoe hebben we het PVO-beleid geanalyseerd,

  13. Enterovirus surveillance in the Netherlands 1996-1998: Indications for the absence of wild poliovirus circulation

    NARCIS (Netherlands)

    van der Avoort HGAM; Ras A; Dorigo-Zetsma JW; LIS

    1999-01-01

    Vaccinatie, surveillance and certificering vormen de hoekstenen van het WHO polio eradicatie programma dat wereldwijde eradicatie van de ziekte poliomyelitis en de verwekkers ervan, de wilde poliovirussen, in het jaar 2000 beoogt. Certificering van regio's als poliovrije zones kan enkel worden

  14. GENSEN: a program for generalized sensitivity analysis

    NARCIS (Netherlands)

    Janssen PHM; CWM

    1995-01-01

    De release-versie 1.0 van het programma GENSEN wordt gepresenteerd, tezamen met instructies en richtlijnen voor installatie en gebruik van de software. GENSEN voert een gegeneraliseerde gevoeligheidsanalyse uit door berekening van de discrepantie tussen acceptabele en niet-acceptabele

  15. RORASC: Software for the rotated-random-scan calibration procedure

    NARCIS (Netherlands)

    Janssen PHM; CWM

    1995-01-01

    De release-versie 1.0 van het programma RORASC wordt gepresenteerd, tezamen met instructies en richtlijnen voor installatie en gebruik van de software. RORASC speelt een essentiele rol bij de 'rotated-random-scan' methode voor modelkalibratie. De software is geschreven in standaard

  16. Onderzoek crowdfunding

    NARCIS (Netherlands)

    de Boer, Alwin; Froma, Terence; Verheul, Maarten

    2013-01-01

    Eindrapport van het Honourstalent-programma van de Hanzehogeschool Groningen. Het onderzoek beschrijft de beweegredenen en risico’s van crowdfunding bij het MKB. Door meerdere oorzaken zoals Bazel III zijn bedrijven op zoek naar alternatieve financieringsvormen. Crowdfunding is hier één van. In

  17. Verslag kennisbijeenkomst ‘crowdfunding voor eventmanagers’

    NARCIS (Netherlands)

    Slender, Hans

    2014-01-01

    Woensdag 22 oktober organiseerden Mieke Zijl (namens KennisCentrum Events Drenthe) en Hans Slender (namens Sportplein Groningen) gezamenlijk een kennisbijeenkomst over crowdfunding voor sportevenementen. Het programma vond plaats bij het TT Circuit in Assen en werd verzorgt door crowdfuncing expert

  18. Euro NCAP : een veiligheidsinstrument.

    NARCIS (Netherlands)

    2007-01-01

    Het programma Euro NCAP test sinds 1996 de (bots)veiligheid van de meest gangbare personen-auto’s. Het feit dat de testresultaten bekend zijn bij de consumenten stimuleert de autofabrikanten om personenauto’s produceren die veelal veiliger zijn dan wettelijk is vereist. Euro NCAP test de

  19. Izmaksu sistēmas integrācija Openstack mākoņu sistēmā

    OpenAIRE

    Andruškeviča, Eleonora

    2015-01-01

    Izmaksu sistēma ir programma priekš OpenStack atvērta pirmkoda mākoņu sistēmai, kas ir uzrakstīta ar Python programmēšanās valodas palīdzību. Programmas izstrādes nolūks ir paplašināt OpenStack platformu ar precīzu izmaksu radītājiem. Sistēma ir domāta tikai OpenStack lietotājiem. Izmaksu programma dod iespēju lietotājam zināt, cik viņām būtu jāmaksā par patērētiem resursiem konkrētajos periodos, ja OpenStack būtu par maksu. Rezultātā tika iegūta programma, kas dabū virtuālu mašīnu st...

  20. Six Sigma: blauwdruk voor de kenniseconomie.

    NARCIS (Netherlands)

    Does, R.J.M.M.; de Mast, J.

    2005-01-01

    Abstract Six Sigma is zo langzamerhand een niet weg te denken programma voor kwaliteits- en efficiencyverbeteringen. Het heeft met name voor enorme successen gezorgd in productiebedrijven. Six Sigma ligt ook onder vuur: het zou een trend zijn die voorbij gaat. De auteurs van dit artikel zijn het van

  1. Six Sigma als blauwdruk voor de kenniseconomie.

    NARCIS (Netherlands)

    de Mast, J.; Does, R.J.M.M.

    2005-01-01

    Abstract Six Sigma is zo langzamerhand een niet weg te denken programma voor kwaliteits- en efficiencyverbeteringen. Het heeft met name voor enorme successen gezorgd in productiebedrijven. Six Sigma ligt ook onder vuur: het zou een trend zijn die voorbij gaat. De auteurs van dit artikel zijn het van

  2. Vrijwillig kinderloze vrouwen : verkenningen rond een keuze

    NARCIS (Netherlands)

    Bandt, den M.L.

    1982-01-01

    This research on voluntarily childless married women was carried out by the direction of the "Netionaal Programma Demografisch Onderzoek (NPDO) (National Program for Demographic Research). To all appearances, the percentage of voluntarily childless married couples is increasing in various western

  3. Preventive rehabilitation in patients treated with chemoradiation for advanced head and neck cancer

    NARCIS (Netherlands)

    van der Molen, L.

    2011-01-01

    Lisette van der Molen onderzocht twee preventieve slik- en kauwrevalidatiemethoden. Ze deed dit bij patiënten met een kwaadaardige tumor in het hoofd-halsgebied die worden behandeld met chemotherapie en bestraling. Een intensief programma van slik- en kauwspieroefeningen is goed uitvoerbaar en de

  4. Grand Challenges Learning Analytics and Open Online Onderwijs

    NARCIS (Netherlands)

    Manderveld, Jocelyn; Berg, Alan; Schuwer, Robert; Drachsler, Hendrik

    2018-01-01

    Als onderdeel van het programma voor open en online onderwijs werkt SURF samen met de hogescholen en universiteiten aan kennisontwikkeling op allerlei thema’s. Deze uitgave is een eerste verkenning van de mogelijkheden om learning analytics in te zetten bij open en online onderwijs en de uitdagingen

  5. Positive educative programme : A whole school approach to supporting children’s well-being and creating a positive school climate: a pilot study

    NARCIS (Netherlands)

    Elfrink, Teuntje R.; Goldberg, Jochem M.; Schreurs, Karlein M.G.; Bohlmeijer, Ernst T.; Clarke, Aleisha M.

    2017-01-01

    Purpose: The purpose of this paper is to report on a process and impact evaluation of the Positief Educatief Programma (Positive Education Programme (PEP)), a whole school approach to supporting children’s well-being and creating a positive school climate in primary schools in the Netherlands. PEP

  6. The national immunisation programme in the Netherlands: current status and potential future developments

    NARCIS (Netherlands)

    Abbink F; Al MJ; Berbers GAM; van Binnendijk RS; Boot HJ; van Duynhoven YTHP; van Gageldonk-Lafeber AB; de Greeff SC; Kimman TG; Meijer LA; Mooi FR; van Oosten M; van der Plas SM; Schouls LM; van Soolingen D; Vermeer-de Bondt PE; van Vliet JA; de Melker HE; Hahne SJM; de Boer IM; CIE

    2005-01-01

    Het Rijksvaccinatieprogramma in Nederland is zeer effectief en veilig. Om het succes en de effectiviteit van het vaccinatieprogramma te vergroten, is vaccinatie van andere (leeftijds)groepen aan te bevelen. Uitbreiding van het programma met nieuwe doelziekten kan voor een aantal ziekten

  7. Huiskatten in natuurgebieden : kan TNR hybridisatie met de Wilde kat voorkomen?

    NARCIS (Netherlands)

    Lammertsma, D.R.; Janssen, R.; Hout, van der J.; Jansman, H.A.H.

    2011-01-01

    De Wilde kat keert weer terug in Nederland. Een bedreiging daarbij is hybridisatie met verwilderde huiskatten. De provincie Limburg heeft Alterra verzocht om te onderzoeken in hoeverre het TNR-programma van de Dierenbescherming (TNR: trap-neuter-return, vangen-steriliseren-terugplaatsen) een

  8. Learning Networks: connecting people, organizations, autonomous agents and learning resources to establish the emergence of effective lifelong learning

    NARCIS (Netherlands)

    Koper, Rob; Sloep, Peter

    2003-01-01

    Koper, E.J.R., Sloep, P.B. (2002) Learning Networks connecting people, organizations, autonomous agents and learning resources to establish the emergence of effective lifelong learning. RTD Programma into Learning Technologies 2003-2008. More is different… Heerlen, Nederland: Open Universiteit

  9. Jong wonen: de gewoonste zaak van de wereld?

    NARCIS (Netherlands)

    Schnabel, P.; Kullberg, J.

    2006-01-01

    Als het om wonen gaat, denken we vaak in stereotype beelden. Ook bij het plannen en ontwikkelen van wijken lijken we weinig rekening to houden met de belevingswereld van de individuele mens. We gaan uit van concrete parameters als programma's, doelgroepen, budgetten en dichtheden. We spreken over

  10. Nazi Soundscapes : Sound, Technology and Urban Space in Germany, 1933-1945

    NARCIS (Netherlands)

    Birdsall, Carolyn

    2012-01-01

    Na de formatie van de NSDAP in de jaren '20 werden verschillende vormen van geluid (stem, ruis, stilte, populaire muziek) en mediatechnologieën (radio- en luidsprekersystemen) ingezet voor hun politieke programma. Vanuit de historisch invalshoek van het stedelijke 'soundscape' van Düsseldorf,

  11. Domotica in Noord Brabant in opmars (1)

    NARCIS (Netherlands)

    Mohammadi, M.

    2011-01-01

    In twee artikelen bespreekt dr. Ir. Masi Mohammadi aan de hand van een van de projecten van het Slimme Zorg Programma van de provincie Noord Brabant (onderzoeks)resultaten met betrekking tot de toegepaste technologie, effecten voor eindgebruikers en ervaringen van samenwerkende projectpartners. In

  12. NORFACE Research Programme on Migration. Migration in Europe: Social, Economic, Cultural, and Policy Dynamics, 2009-2014. Summary Report

    NARCIS (Netherlands)

    Caarls, K.

    2016-01-01

    Naar aanleiding van een verzoek van Nederlandse Organisatie voor Wetenschappelijk Onderzoek (NWO) om de uitkomsten van het NORFACE programma samen te vatten is een rapport geschreven. T.b.v. onder meer een bijeenkomst van de Europese Unie over wat te doen in de toekomst n.a.v. de resultaten.

  13. Hoornloze koeien in aantocht

    NARCIS (Netherlands)

    Windig, J.J.

    2009-01-01

    Hoornloosheid komt bij enkele koeienrassen voor. Om het in de huidige melkkoe in te fokken, zou een fokprogramma hulp kunnen bieden. De veehouderij vindt gebruik van zo'n programma prima, de gemiddelde burger is daar wat terughoudender in en ook meer verdeeld.

  14. Positive educative programme : A whole school approach to supporting children’s well-being and creating a positive school climate: a pilot study

    NARCIS (Netherlands)

    Elfrink, Teuntje R.; Goldberg, Jochem M.; Schreurs, Karlein M.G.; Bohlmeijer, Ernst T.; Clarke, Aleisha M.

    2017-01-01

    Purpose The purpose of this paper is to report on a process and impact evaluation of the Positief Educatief Programma (Positive Education Programme (PEP)), a whole school approach to supporting children’s well-being and creating a positive school climate in primary schools in the Netherlands. PEP

  15. '"Crazy Mina" guerrillas hit Holland." Transfer van Dolle Mina's ludieke acties' van en naar de VS (1968-1970)'

    NARCIS (Netherlands)

    Geerlings, A.J.M.

    2014-01-01

    Zaterdagavond 24 januari 1970, kwart over negen ’s avonds. Het tv-programma Brandpunt zond een item uit over actiegroep Dolle Mina. Jonge meiden die opriepen tot een kookstaking, die mannen nafloten op straat en een korset verbrandden. Vier miljoen mensen zaten die avond aan de buis gekluisterd en

  16. Diadrome vissen in de Waddenzee: Monitoring bij Kornwerderzand 2000 - 2005

    NARCIS (Netherlands)

    Tulp, I.Y.M.; Boois, de I.J.; Willigen, van J.A.; Westerink, H.J.

    2006-01-01

    Sinds 2000 wordt een monitoringprogramma van zeldzame diadrome vis aan de Waddenzeezijde van de Afsluitdijk uitgevoerd. Het doel van het programma is om trends en ontwikkelingen in de zeldzame diadrome vissoorten (fint, houting, grote marene, rivierprik, zeeprik, zalm en zeeforel) aan de zoute kant

  17. Zeldzame vissen in het IJsselmeergebied : Jaarrapport 2006

    NARCIS (Netherlands)

    Leijzer, T.B.; Boois, de I.J.; Willigen, van J.A.; Westerink, H.J.

    2007-01-01

    In opdracht van Rijkswaterstaat, Directie IJsselmeergebied, is in 1994 een monitoringsprogramma gestart waarin zeldzame vissoorten in het IJsselmeergebied bemonsterd worden. In dit programma wordt door opkoop van binnen de commerciële visserij gevangen migrerende vissoorten een indruk verkregen van

  18. Zeldzame vissen in het IJsselmeergebied Jaarrapport 2005

    NARCIS (Netherlands)

    Leeuw, de J.J.; Tulp, I.Y.M.; Boois, de I.J.; Willigen, van J.A.; Westerink, H.J.

    2007-01-01

    In opdracht van RWS, Directie IJsselmeergebied is in 1994 een monitoringprogramma gestart waarin zeldzame vissoorten bemonsterd worden. In dit programma wordt door opkoop van binnen de commerciële visserij gevangen migrerende vissoorten een indruk verkregen van aanwezigheid van zeldzame soorten.

  19. Diadrome vissen in de Waddenzee: monitoring bij Kornwerderzand 2000-2006

    NARCIS (Netherlands)

    Tulp, I.Y.M.; Boois, de I.J.; Willigen, van J.A.; Westerink, H.J.

    2007-01-01

    Sinds 2000 wordt een monitoringprogramma van zeldzame diadrome vis aan de Waddenzeezijde van de Afsluitdijk uitgevoerd. Het doel van het programma is om trends en ontwikkelingen in de zeldzame diadrome vissoorten (fint, houting, grote marene, rivierprik, zeeprik, zalm en zeeforel) aan de zoute kant

  20. Diadrome vissen in de Waddenzee: Monitoring bij Kornwerderzand 2000-2007

    NARCIS (Netherlands)

    Tulp, I.Y.M.; Boois, de I.J.; Willigen, van J.A.; Westerink, H.J.

    2008-01-01

    Sinds 2000 wordt een monitoringprogramma van zeldzame diadrome vis aan de Waddenzeezijde van de Afsluitdijk uitgevoerd. Het doel van het programma is om trends en ontwikkelingen in de zeldzame diadrome vissoorten (fint, houting, grote marene, rivierprik, zeeprik, zalm en zeeforel) aan de zoute kant

  1. Tropospheric Ozone Research: Monitoring and modelling of photo-oxidants over Europe

    NARCIS (Netherlands)

    Beck JP; Roemer MGM; Vosbeek MEJP; Builtjes PJH; RIVM-LLO; TNO-MEP; KEMA

    1996-01-01

    Het EUROTRAC-TOR programma is opgezet om chemische- en transportprocessen, die van belang zijn voor het optreden van foto-oxidantia in Europa te bestuderen. Kernvraag is: "welke rol spelen emissies in Europa en welke resultaten kunnen beleidsmatig maximaal behaald worden?". In het

  2. Long-term risks of inadequate management practices on the sustainability of agricultural soils

    NARCIS (Netherlands)

    Vries, de W.; Groenenberg, J.E.; Murányi, A.; Curlík, J.; Sefcík, P.; Römkens, P.F.A.M.; Reinds, G.J.; Bril, J.; Modin, A.K.; Sverdrup, H.U.; Alloway, B.J.

    2003-01-01

    This report describes the major result of a research project funded by the INCO-Copernicus programma of European Commission under Contract number ERB-IC15-CT98-0133. The study focused on the long-term environmental risk of soil acidification on: (i) mobilisation and leaching and (ii) plant uptake of

  3. Ontwikkeling van enkele mosselbanken in de Nederlandse Waddenzee; situatie 2007

    NARCIS (Netherlands)

    Fey-Hofstede, F.E.; Dankers, N.M.J.A.; Meijboom, A.; Leeuwen, van P.W.; Verdaat, J.P.; Jong, de M.L.; Heusinkveld, J.H.T.

    2008-01-01

    In het kader van naar de lange termijn ontwikkeling van mosselbanken en de factoren die het al dan niet het overleven van mosselbanken bepalen, worden door IMARES enkele individuele mosselbanken in detail bestudeerd. De inventarisaties worden ingebracht in het trilaterale monitoring programma (TMAP)

  4. Reisverslag van de boomkorsurvey (BTS) in 2012

    NARCIS (Netherlands)

    Boois, de I.J.; Bol, R.A.

    2012-01-01

    In 2012 is de beam trawl survey (BTS) uitgevoerd met de Tridens II en de Isis in opdracht van het ministerie van EL&I. De survey is onderdeel van het EU Data Collectie Programma (DCF) en valt daarmee onder de wettelijke taken die binnen IMARES worden uitgevoerd. In dit rapport staan de

  5. De blinde vlek van Le Corbusier

    NARCIS (Netherlands)

    Wallis De Vries, J.G.; Spaan, M.; Verstegen, T.

    2004-01-01

    Het programma van 'Tastenderwijs' formuleert een kritiek op de moderne architectuur. Het stelt vast dat de huidige architectonische cultuur wordt gedomineerd door theorieën en ideologieën die de gebouwde omgeving reduceren tot een technologisch universum. Dit wordt drievoudig omschreven als

  6. The Dutch CAFE baseline: In or out of line?

    NARCIS (Netherlands)

    Jimmink BA; Folkert RJM; Thomas R; Beck JP; van Eerdt MM; Elzenga HE; van der Hoek KW; Hoen A; Peek CJ; LED; KMD; NMD; LVM; RIM; LDL

    2004-01-01

    De Europese Commissie zet een strategie op voor de aanpak van luchtverontreiniging in het Clean Air for Europe (CAFE) programma. De strategie wordt gebaseerd op beoordelingen met het RAINS model van verschillende beleidsambities met het CAFE scenario en bestrijdingsstrategieen. Het Milieu- en

  7. Da Eros a Gaia

    CERN Document Server

    Dyson, Freeman

    1993-01-01

    L'emigrazione verso altri pianeti come mezzo di sopravvivenza umana, l'immagazzinaggio nello spazio delle scorie nucleari, un programma di rimboschimento per ripristinare l'equilibrio climatico, la bomba atomica, il comportamento delle tribù africane: sono alcuni dei temi affrontati dall'autore in questa raccolta di saggi, articoli, lezioni universitarie.

  8. Onderzoek crowdfunding

    NARCIS (Netherlands)

    Maarten Verheul; Terence Froma; Alwin de Boer

    2014-01-01

    Eindrapport van het Honourstalent-programma van de Hanzehogeschool Groningen. Het onderzoek beschrijft de beweegredenen en risico’s van crowdfunding bij het MKB. Door meerdere oorzaken zoals Bazel III zijn bedrijven op zoek naar alternatieve financieringsvormen. Crowdfunding is hier één van. In

  9. Parking Policies in Tourist Cities Politiche della sosta in città turistiche

    Directory of Open Access Journals (Sweden)

    Rosa Anna La Rocca

    2009-05-01

    miglioramento delle condizioni di spostamento e per garantire buoni livelli di sicurezza stradale. La realizzazione di strutture per la sosta in ambito urbano, invece, è regolamentata dal programma urbano dei parcheggi introdotto alla fine degli anni ottanta. All’interno di tali strumenti, le indicazioni relative alla predisposizione di specifiche aree da destinare alla sosta turistica occupa un ruolo marginale. La totalità delle indicazioni relative alla mobilità turistica fanno riferimento a due tipi di interventi: –istituzione di una zona a traffico limitato per la circolazione dei bus turistici; –individuazione delle aree di sosta breve dove è consentito ai visitatori di scendere o salire dal bus. In relazione alla sosta, le indicazioni si riferiscono alla individuazione di aree urbane o di assi stradali dove viene consentito lo stazionamento temporaneo. Molto raramente, per quel che riguarda la situazione italiana nelle principali città turistiche, gli interventi prevedono la realizzazione di specifiche strutture integrate al trasporto pubblico o a modalità di spostamento sostenibile che garantirebbero una migliore distribuzione dei flussi turistici consentendo al contempo al visitatore differenti modalità di visita con positivi effetti anche sulla percezione della visita. Nel tentativo di dimostrare come gli interventi finalizzati alla realizzazione di aree per la sosta dei bus turistici possano essere strumenti di riqualificazione fisica e funzionale della città, l’articolo nella prima parte si focalizza sulla definizione delle caratteristiche della domanda di spostamento turistico in ambito urbano. Nella seconda parte, attraverso una panoramica delle politiche della sosta urbana in Italia si evidenzia la carenza di interventi finalizzati alla realizzazione di una rete per la sosta turistica integrata all’offerta di servizi urbani. Nella parte conclusiva si individuano gli elementi che consentirebbero alle aree di sta di porsi come aree di qualit

  10. Disturbi mentali come complex network : Un’ introduzione e una panoramica all’ approccio network in psicopatologia

    NARCIS (Netherlands)

    Nuijten, M.B.; Deserno, Marie K.; Cramer, A.O.J.; Costantini, Giulio; Borsboom, Denny

    2016-01-01

    I disturbi mentali sono stati tradizionalmente concepiti come variabili latenti, che hanno un impatto sulla sintomatologia osservabile. Approcci alternativi proposti più recentemente invece concepiscono i disturbi mentali come sistemi di sintomi che si rinforzano vicendevolmente. Tali approcci

  11. Cronache dell'universo fisica moderna e cosmologia

    CERN Document Server

    Regge, Tullio

    1981-01-01

    Dall'infinitamente piccolo all'infinitamente grande: è il viaggio che ci propone Tullio Regge, che oltre ad essere uno dei massimi fisici contemporanei, ha rivelato un talento eccezionale per la divulgazione.

  12. Filosofia della fisica

    CERN Document Server

    1997-01-01

    Un libro che mancava : attraverso i contributi dei maggiori specialisti italiani, la definizione rigorosa di una disciplina, la filosofia della fisica, che si pone nel punto d'incontro tra la cultura scientifica e quella umanistica.

  13. Environmental study for optimal sites selection for incineration plant of refuse derived fuel in Lucca Province, Tuscany (Italy); Metodologie e tecniche di analisi ambientale per l`ubicazione `sostenibile` di impianti di smaltimento rifiuti: l`esperienza della Provincia di Lucca

    Energy Technology Data Exchange (ETDEWEB)

    Tassoni, E; Cautilli, F; Polizzano, C; Andriola, L [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente

    1998-04-01

    -southern part of the potentially suitable area mentioned above, finally further subdivided in 2 priority levels. [Italiano] Il lavoro presenta i risultati ottenuti dall`ENEA nell`ambito di un incarico conferito dall`Amministrazione Provinciale di Lucca, riguardante la localizzazione delle aree idonee all`installazione di un impianto di termoutilizzazione energetica di CdR (Combustibile derivato dai Rifiuti) e di una discarica ad esso associata, in sintonia con gli indirizzi contenuti nel `Programma politico d`azione della Comunita` Europea a favore dell`ambiente e di uno sviluppo sostenibile`. La ricerca e` stata effettuata dall`ENEA attraverso il supporto di metodologie, basate su criteri di natura ambientale, gia` precedentemente applicate a diverse situazioni territoriali italiane (Provincia di Cremona, Comune di Latina ecc.). Nel territorio in oggetto la localizzazione e` stata ricondotta alle problematiche connesse con quella delle discariche, che presentano generalmente maggiore impatto ambientale. Per calcolare l`impatto dei rilasci del termoutilizzatore nella fascia di potenziale idoneita` e` stato effettuato uno studio meteo-diffusivo per calcolare i livelli medi annui di concentrazione in aria a livello del suolo dei principali inquinanti (CO, SO2, NO2, ecc.) e le deposizioni (secca e umida), assumendo come emissioni al camino i valori limite imposti dalle direttive CEE; i valori medi calcolati sono risultati notevolmente al di sotto dei limiti di legge (DPR 203/1988). Sono stati infine selezionati 14 siti, concentrati prevalentemente nella porzione centro-meridionale della fascia suddetta, successivamente suddivisai in due classi di priorita` sulla base di motivazioni ambientali (elevata soggiacenza della falda, assenza di rischio di alterazione dei processi ecologici, scarso impatto sulle attivita` agricole), logistiche (maggiore estensione media con possibilita` di ospitare tutti gli impianti) e socioeconomici (presenza di grandi complessi industriali, minore

  14. Geologia, misura e posizionamento spaziale

    Directory of Open Access Journals (Sweden)

    Renzo Carlucci

    2007-04-01

    Full Text Available Le Scienze della Terra sono poi date dall’insieme delle discipline che studiano la struttura interna, la morfologia superficiale e tutta l’atmosfera che circonda il pianeta Terra e la sua evoluzione nel tempo. Potremmo anche dire ormai che lo studio della Terra costituisce un caso particolare delle Scienze Planetarie, che si occupano dello studio dei pianeti presenti nel nostro sistema solare.

  15. Il marketing del nuovo millennio

    OpenAIRE

    M. Addis

    2007-01-01

    Con la consueta maestria, Kolter, supportato da Keller, mette a disposizione dei suoi numerosi lettori uno strumento di grande efficacia, dalla struttura estremamente agile, che potrà essere apprezzato da coloro che il marketing lo insegnano e dai professionisti che cercano un'opera di riferimento autorevole e aggiornata ma al contempo di facile consultazione, che possa accompagnarli nello svolgimento delle attività quotidiane. Il testo è una guida essenziale alla disciplina del marketing,...

  16. Gregory Crane e i cittadini della repubblica delle lettere

    Directory of Open Access Journals (Sweden)

    Maria Chiara Pievatolo

    2012-05-01

    Full Text Available Chi studia l’antichità conosce Gregory Crane anche quando non ne rammenta il nome, non per quello che ha scritto ma per quello che ha reso possibile scrivere. Crane è il direttore del Perseus Project, una biblioteca digitale che libera gli studiosi dal microcosmo chiuso e inaccessibile della monografia accademica, permettendo loro di lavorare sui classici [...

  17. LIFE-WRITING / NARRARSI

    African Journals Online (AJOL)

    User

    12 nov 2004 ... pochi minuti, prima che il vecchio scendesse dall'autobus, una sorta di intimità fra di noi che ricordo mi infastidiva. Una vicinanza eccessiva che mi faceva percepire chiaramente quanto incolmabile fosse la nostra distanza. Prima di scendere dall'autobus quel vecchio mi diede altri consigli su argomenti ...

  18. NOTES AND GLEANINGS / NOTE E CURIOSITÀ

    African Journals Online (AJOL)

    Principe D. Sigismondo Chigi ed altri” con il numero di catalogo. 1815/IV. .... ricorre a formula del tipo “un certo Pietro che non so dei quali”. Frequente l'uso di 'con' ...... catene di Sant'Antonio; che sono convinte che ficcando uno spillone in ...

  19. L’estetica dell’ebreo e del cristiano nei racconti de Lo scialle andaluso di Elsa Morante

    NARCIS (Netherlands)

    Cascio, G.

    2007-01-01

    Quest’articolo indaga alcuni elementi fisiognomici ricorrenti nelle figure che popolano le novelle de Lo scialle andaluso di Elsa Morante. Cioè, qui suggeriamo l’ipotesi che nel piano narrativo ci sia una categorizzazione estetica che si riversa nel progetto dei contenuti e si proponga di dedurre i

  20. Prefazione

    NARCIS (Netherlands)

    Gobbo, F.; Caligaris, I.

    2016-01-01

    Chi sono gli esperantisti? Perché scelgono di studiare l’esperanto? Per quali ragioni si accostano al movimento? Che cosa rappresenta per loro questa lingua? Quali valori veicola? Che posizione occupa nel loro repertorio linguistico? Ma soprattutto: l’esperanto è solo una lingua? E in che modo è

  1. Subversion and reconstruction of the detective novel: a reading of ...

    African Journals Online (AJOL)

    Nella lettura che si fa del terzo romanzo poliziesco di Sciascia, lo si scompone per dimostrare come l'autore intenzionalmente sovverte, manipola e rielabora la tecnica e gli elementi che costituiscono il 'giallo' come genere. Nel contempo si cerca di decifrare la pletora di citazioni pittoriche e letterarie che s'intrecciano nella ...

  2. Family Planning - A Priority Social and Health Action Programme for ...

    African Journals Online (AJOL)

    personal identity and value, make connections wich ancestors and descendants" ... which promote che use of safe and effective modern mechods of contraception which ... ety as a whole. FP services, on the other hand, are motivated ... you cannot fail to have noticed che almost total collapse of che economies of many ...

  3. ARTICLES / SAGGI

    African Journals Online (AJOL)

    User

    tardi, nel V libro dei Discorsi del poema eroico. 5, il Tasso, dopo aver affermato che non solo Dante ha innalzato il livello di reputazione dell'allegoria, ma che tutta la Commedia poggia su basi allegoriche (“non è parte che non sia allegorica”)6 ribadisca il concetto della medesima postilla: “Ma egli non dechiara se stesso ...

  4. Il narratore algoritmico

    Directory of Open Access Journals (Sweden)

    Paolo Sordi

    2017-06-01

    Ciò che resta dell’ipertesto è una “rete televisiva”, una piattaforma di broadcasting che privilegia oralità, video e slideshow in modo che con le loro performance dai palchi di TED e YouTube i guru dell’epica digitale e dell’innovazione possano affermarsi come le vere pop star di questa epoca neoliberista.

  5. Corpi abit(uati: relazioni di relazioni e unità sistemica

    Directory of Open Access Journals (Sweden)

    Sergio Straface

    2014-11-01

    Full Text Available Consacrare uno spazio, allora, un’abitazione, un corpo, il corpo persona e personificato potrebbe generare quella connessione sistemica che disabit(ua… Questo è forse uno dei motivi per cui è spesso così difficile imparare le lingue. E allora, l’unità sistemica, quella nuova, che genera significati vivi, potrebbe essere possibile con-sé-crandosi all’unità stessa ricordando quella lingua connettiva e correttiva, sistemica, che riconnette il sé al proprio corpo, lo stesso corpo che non dimentica e che si esprime in gesti e toni di voce. Forse. Per una antropologia degli spazi… persona.

  6. Il passato nell’epoca della sua (ri)producibilità digitale. Torino 1943 - 45. Metodologia della ricerca con tecnologie informatiche. Sistema storico-territoriale di informazione multimediale

    OpenAIRE

    Tosatto, Claudio

    2008-01-01

    Se il lavoro dello storico è capire il passato come è stato compreso dalla gente che lo ha vissuto, allora forse non è azzardato pensare che sia anche necessario comunicare i risultati delle ricerche con strumenti propri che appartengono a un'epoca e che influenzano la mentalità di chi in quell'epoca vive. Emergenti tecnologie, specialmente nell’area della multimedialità come la realtà virtuale, permettono agli storici di comunicare l’esperienza del passato in più sensi. In che...

  7. Individuazione degli errori di scheggiatura nei diversi metodi di débitage del Paleolitico inferiore e medio. Gli esempi di Cà Belvedere di Monte Poggiolo (FC), Guado San Nicola 1 (IS), Riparo Tagliente (VR), Payre e Abri du Maras (Ardéche, Francia).

    OpenAIRE

    Buonsanto, Cecilia

    2012-01-01

    The understanding of the management of natural resources by prehistoric man through an analysis of stone tools is useful to create parameters for the study of the level of manual dexterity and subsistence strategies in the Paleolithic. The study of knapping errors in experimental and archaeological lithic collections can reveal the presence of beginners or of experienced knappers and offers a comprehensive overview on the various errors associated with different methods of knapping débitage. ...

  8. ÉVOLUTION DE LA RÉPARTITION DES ÉCREVISSES EN FRANCE MÉTROPOLITAINE SELON LES ENQUÊTES NATIONALES MENÉES PAR LE CONSEIL SUPÉRIEUR DE LA PÊCHE DE 1977 À 2001

    Directory of Open Access Journals (Sweden)

    CHANGEUX T.

    2003-04-01

    Full Text Available Selon les enquêtes nationales menées par le Conseil supérieur de la pêche depuis 1977 en France métropolitaine, la répartition des espèces d’écrevisses montre que les espèces autochtones (Austropotamobius pallipes, Astacus astacus, Austropotamobius torrentium sont soit rares, soit en forte régression, alors que les espèces introduites (Orconectes limosus, Pacifastacus leniusculus, Procambarus clarkii, Astacus leptodactylus progressent. L’interdiction de transport vivant des espèces introduites, à l’exception d’A. leptodactylus, n’a pas enrayé le phénomène avec une accélération particulière de la progression de P. leniusculus ces cinq dernières années, certainement responsable de la recrudescence des cas de peste (Aphanomyces astaci. Les autres mesures favorisant les espèces autochtones, comme la limitation des prélèvements par pêche et les programmes de réintroduction, n’inversent pas la tendance. Il semble donc nécessaire de développer une politique de conservation centrée sur la préservation de l’habitat et le respect de certaines règles de prophylaxie à déterminer. Cela ne peut s’envisager que sur des bassins versants de petite surface facilement contrôlables s’il existe un fort engagement des autorités locales. Les 55 arrêtés de biotope, et surtout les 154 sites Natura 2000 avec leurs plans de gestion associés, apparaissent comme des voies prometteuses pour mettre en œuvre ce type d’actions en France. Le cas de l’île Corse, récemment colonisée par O. limosus, mériterait des mesures réglementaires particulières pour éviter que P. leniusculus et P. clarkii, ne la suivent dans l’avenir.

  9. Overpotential for CO2 electroreduction lowered on strained penta-twinned Cu nanowires? ?Electronic supplementary information (ESI) available: Details of DFT and MD calculations, CHE model and reaction pathways for C2H4 production. See DOI: 10.1039/c5sc02667a Click here for additional data file.

    OpenAIRE

    Chen, Zhengzheng; Zhang, Xu; Lu, Gang

    2015-01-01

    Based on first-principles calculations, we predict that penta-twinned Cu nanowires (NWs) are superior to conventional Cu catalysts for CO2 electroreduction. The penta-twinned NWs possess a combination of ultrahigh mechanical strength, large surface-to-volume ratios and an abundance of undercoordinated adsorption sites, all desirable for CO2 electroreduction. In particular, we show that the penta-twinned Cu NWs can withstand elastic strains orders of magnitude higher than their conventional co...

  10. Overpotential for CO2 electroreduction lowered on strained penta-twinned Cu nanowires† †Electronic supplementary information (ESI) available: Details of DFT and MD calculations, CHE model and reaction pathways for C2H4 production. See DOI: 10.1039/c5sc02667a Click here for additional data file.

    Science.gov (United States)

    Chen, Zhengzheng; Zhang, Xu

    2015-01-01

    Based on first-principles calculations, we predict that penta-twinned Cu nanowires (NWs) are superior to conventional Cu catalysts for CO2 electroreduction. The penta-twinned NWs possess a combination of ultrahigh mechanical strength, large surface-to-volume ratios and an abundance of undercoordinated adsorption sites, all desirable for CO2 electroreduction. In particular, we show that the penta-twinned Cu NWs can withstand elastic strains orders of magnitude higher than their conventional counterpart, and as a result their CO2 electroreduction activities can be significantly enhanced by elastic tensile strains. With a moderate tensile strain, the bias potential for methane production at a decent current density (2 mA cm–2) can be reduced by 50%. On the other hand, the competing hydrogen evolution reaction can be suppressed by the tensile strains. The presence of H at the NW surface is found to have a minor effect on CO2 electroreduction. Finally, we propose to use graphene as a substrate to stretch deposited Cu NWs. PMID:28757974

  11. Étude de l’impact de la matrice d’un fruit sur la libération et la perception des composés d’arôme en condition in vivo : application à la mangue fraîche ou transformée

    OpenAIRE

    Bonneau , Adeline

    2016-01-01

    Retro-nasal perception of flavor during chewing food in mouth is a complex process. The physico-chemical and aromatic compositions of food, its physical properties, the interactions and reactions involved in oral cavity are the main parameters which can influence flavor perception. In this study, mango is used as model fruit. The study will be focused in better understanding of food disintegration effect, its texture and inter-individual variability on the flavor perception. Liberation of vol...

  12. Reconstruction of the Chemotaxis Receptor-Kinase Assembly

    International Nuclear Information System (INIS)

    Park, S.; Borbat, P.; Gonzalez-Bonet, G.; Bhatnagar, J.; Pollard, A.; Freed, J.; Bilwes, A.; Crane, B.

    2006-01-01

    In bacterial chemotaxis, an assembly of transmembrane receptors, the CheA histidine kinase and the adaptor protein CheW processes environmental stimuli to regulate motility. The structure of a Thermotoga maritima receptor cytoplasmic domain defines CheA interaction regions and metal ion-coordinating charge centers that undergo chemical modification to tune receptor response. Dimeric CheA-CheW, defined by crystallography and pulsed ESR, positions two CheWs to form a cleft that is lined with residues important for receptor interactions and sized to clamp one receptor dimer. CheW residues involved in kinase activation map to interfaces that orient the CheW clamps. CheA regulatory domains associate in crystals through conserved hydrophobic surfaces. Such CheA self-contacts align the CheW receptor clamps for binding receptor tips. Linking layers of ternary complexes with close-packed receptors generates a lattice with reasonable component ratios, cooperative interactions among receptors and accessible sites for modification enzymes

  13. La mente incarnata e le prospettive morali della Fenomenologia della Percezione

    Directory of Open Access Journals (Sweden)

    Francesco Consiglio

    2015-03-01

    Full Text Available In contrasto con quella che era stata la tradizione dell’empirismo classico di matrice hobbesiana e lockiana da un lato, e la tradizione razionalista a erente al nucleo loso co cartesiano, Merleau-Ponty elabora una “terza via” che si propone di riportare la conoscenza nell’ambito dello stretto rapporto tra il corpo e i fenomeni che esso esperisce in quanto corpo vivente e non mero oggetto tra gli oggetti. Il mio corpo non è, come credeva convintamente Cartesio, mera res extensa, separata dalla mia più pura e vera essenza di res cogitans; anzi è proprio col mio essere corpo vivente che conosco pienamente il mondo. Noi non costruiamo il mondo naturale, ma lo viviamo. È in esso che avviene l’incontro con l’Altro, l’incontro di prospettive che ci mette alla prova nell’agire morale; è in questo incontro che nasce il senso che esso assume per noi. È in questo rapporto d’intersoggettività che si genera il nodo di signi cati che costituisce il mondo culturale e più ancora quello morale. In questo contesto l’ottica del corpo vissuto costituisce un presupposto radicale che modi ca n dal principio il rapporto tra soggetto e mondo, tra soggetto singolo e altri individui.

  14. Divergent effects of postmortem ambient temperature on organophosphorus- and carbamate-inhibited brain cholinesterase activity in birds

    Science.gov (United States)

    Hill, E.F.

    1989-01-01

    Time- and temperature-dependent postmortem changes in inhibited brain cholinesterase (ChE) activity may confound diagnosis of field poisoning of wildlife by anticholinesterase pesticide. Carbamate-inhibited ChE activity may return to normal within 1 to 2 days of exposure of intact carcass to moderate ambient temperature (18-32C). Organophosphorus-inhibited ChE activity becomes more depressed over the same time. Uninhibited ChE activity was resilient to above freezing temperature to 32C for 1 day and 25C for 3 days. Carbamate- and organophosphorus-inhibited ChE can be separated by incubation of homogenate for 1 hour at physiological temperatures; carbamylated ChE can be readily reactivated while phosphorylated ChE cannot.

  15. La strana storia della luce e del colore

    CERN Document Server

    Guzzi, Rodolfo

    2011-01-01

    Sino al 1600 la luce era oggetto di studio degli scienziati ed il colore dei filosofi. Questa dicotomia fu superata dall’Esperimentum Crucis di Newton che spiego’ come la luce contenesse il colore. Il libro analizza le teorie che furono sviluppate dai greci, per evolversi successivamente nelle teorie degli scienziati arabi e approdare al medio evo. Con l’Esperimentum Crucis Newton dimostro’ che la luce conteneva i colori primari. Tra gli esperimenti che egli fece ci furono anche quelli sulla percezione che risultarono sbagliati; solo Goethe capi’ quale era la vera portata di quegli esperimenti e li rifece dando una interpretazione che, oggi, sappiamo essere vera, ma che a quel tempo fu alquanto osteggiata. Nel frattempo la comunita’ scientifica progrediva sul concetto di visione e di sensazione, poiche’ gli strumenti di indagine si raffinavano. Bisogna pero’ arrivare ai giorni nostri per avere una spiegazione sul comportamento della luce e del colore e come questa viene percepita da noi. Solo ...

  16. Evaluation of gaseous emissions produced in the tests on the demonstration plant for sludge drying and incineration; Valutazione delle emissioni gassose prodotte nelle prove sull'impianto dimostrativo di essiccamento e di incenerimento di fanghi

    Energy Technology Data Exchange (ETDEWEB)

    Lotito, V.; Spinosa, L.; Antonacci, R. [Consiglio Nazionale delle Ricerche, Istituto di Ricerca sulle Acque, Bari (Italy); Mininni, G. [Consiglio Nazionale delle Ricerche, Istituto di Ricerca sulle Acque, Rome (Italy)

    2001-03-01

    -current operation mode. This was depending on the excessive length of the drum designed also for counter-current mode, so that ashes melted in the first part solidify in the second part because of heat losses. In conclusion, plant operation resulted satisfactory, also under the environmental aspects, despite of the very severe test conditions, with high chlorine content and the presence of aromatic compounds and copper, which acts as catalyst in the novo-synthesis of dioxins. Incineration and co-incineration of sewage sludge and hazardous compounds were therefore demonstrated to be a safe and viable disposal option. [Italian] L' incenerimento dei fanghi di depurazione e' una valida altenativa ai sistemi utilizzati per lo smaltimento (utilizzazione agricola, discarica controllata) nei casi in cui si trovino difficolta' di applicazione per la presenza di inquinanti in concentrazione superiore ai limiti consentiti o per situazioni contingenti spesso non prevedibili. Tuttavia, esso puo' essere causa di emissione in atmosfera di microinquinanti inorganici (metalli pesanti) e organici (IPA, PCDD, PCDF), oltre che di materiale particolato e di ossidi di azoto e di carbonio (NO{sub x} e CO), e composti acidi; cio' ha ingenerato una forte avversione popolare che ha ostacolato la utilizzazione. L'Istituto di Ricerca sulle Acque del CNR ha pertanto realizzato, nell'area dell'impianto di depurazione di Bari Ovest, un impianto dimostrativo di incenerimento costituito essenzialmente da due forni, uno a letto fluido e uno a tamburo rotante, da un essiccatore, da un sistema di recupero termico e da una sezione di abbattimento delle polveri e degli altri macroinquinanti, e ha messo a punto un programma di ricerca per verificare la compatibilita' ambientale e il rispetto della normativa vigente nell'incenerimento dei fanghi con particolare riferimento alle emissioni di microinquinanti organici ed al destino dei metalli. I microinquinanti organici

  17. Market Initiatives for Clean Air Schools; Marktinitiatieven frisse scholen

    Energy Technology Data Exchange (ETDEWEB)

    Teeuwen, D. [Communication Concert, Weesp (Netherlands)

    2012-07-15

    Seven years ago, the Clean Air Schools Program was launched to encourage people to use less energy and improve the indoor environment. In 2012, the program Energy and Built Environment will no longer pay specific attention focused on school buildings. Therefore, the market needs to jump in. 'Market initiatives' refers to projects, products and services that contribute to the realization of Clean Air Schools and which are not initiated by the Dutch government [Dutch] Zeven jaar geleden is het Frisse Scholen Programma gestart om gemeenten en scholen te stimuleren om minder energie te gebruiken en het binnenmilieu te verbeteren. In 2012 biedt het programma Energie en Gebouwde Omgeving geen ruimte meer voor specifieke aandacht gericht op scholen. Daarom zal het stokje overgedragen moeten worden aan marktpartijen. Met 'marktinitiatieven' wordt gedoeld op projecten, producten en diensten die bijdragen aan de realisatie van Frisse Scholen en niet door de Rijksoverheid worden geinitieerd.

  18. How to adjust traffic management to air quality; Hoe kun je verkeersmanagement afstemmen op de kwaliteit van lucht?

    Energy Technology Data Exchange (ETDEWEB)

    Cornelissen, T. [Rijkswaterstaat, Den Haag (Netherlands)

    2011-04-15

    Matrix boards are used to manage traffic speed on roads. The Dutch InnovatieProgramma Luchtkwaliteit IPL (Air Quality Innovation Programme ) has looked at the option of using matrix boards to improve the air quality along the highways. The IPL has also examined other temporary measures that can be deployed at times of peak concentrations of PM10 and/or NO2. [Dutch] Met matrixborden kan op wegen de snelheid worden geregeld. In het InnovatieProgramma Luchtkwaliteit (IPL) is gekeken of men de matrixborden ook kan inzetten om de luchtkwaliteit langs de snelweg te verbeteren. Door het IPL is ook gezocht naar andere tijdelijke maatregelen die je in kunt zetten op die momenten dat er een piek in de concentraties aan PM10 en/of NO2 optreedt.

  19. Worldwide Report, Telecommunications Policy, Research and Development, No. 258

    Science.gov (United States)

    1983-01-28

    3379, December 1979. [20] F. Vatalaro: Caratteristiche di un filtro digitale dpplicato al sistema DME di precisione per MLS, F.U.B., Relazione 43...Spring 1980. [8] F. Chiarini, M. Gori: Possibilitä di miglioramento della precisione di un DME in banda L öfferta da u’n sistema di antenne a...Vecchio, G. Pedrini, F. Vatalaro: Rapporto sul programma per la determinazione delta forma d’onda impulsiva ottima per un sistema DME di precisione in

  20. Atlante project; Progetto atlante. Quadro di riferimento, analisi degli strumenti esistenti, implementazione metodologica e applicazione prototipale

    Energy Technology Data Exchange (ETDEWEB)

    Baratozzi, L.; Cagnoli, P.; Filippi, N.; Gherardi, L.; Montaletti, V.; Poli, G.; Scarelli, M. [Regione Emilia Romagna, Assessorato Territorio, Programmazione e Ambiente, Servizio Paesaggio, Parchi e Patrimonio Naturale, Bologna (Italy); Basili, M.; Battista, A.; Colonna, R.; Del Cellio, R.; Forni, A.; Olivetti, I.; Regina, P.; Zarlenga, F. [ENEA, Divisione Caratterizzazione dell' Ambiente e del Territorio, Centro Ricerche della Casaccia, S. Maria di Galeria, RM (Italy)

    2001-07-01

    This paper presents the Atlante project a joint program of Emilia Romagna region and Italian ENEA based on the concept of substantiality and the most important methods and models used in the territorial planning. [Italian] La redazione del presente volume e' stata articolata in modo da bilanciare, da un lato l'esigenza di rispettare il programma di attivita' previsto nell'ambito della Convenzione fra Regione Emilia Romagna ed ENEA.

  1. Fostering an entrepreneurial mindset in upper secondary school

    Directory of Open Access Journals (Sweden)

    Manuel Gentile

    2014-08-01

    In questo articolo si descrive il modello di formazione all’EE definito nell’ambito del progetto europeo “Posso ... Non Posso ... Vado! Rev. 2”, finanziato dal programma Leonardo da Vinci – Transfer of Innovation (TOI, ed è fornita una prima valutazione qualitativa dell’attività di sperimentazione condotta con gli studenti del 4° anno di un Istituto Tecnico per il Turismo di Palermo.

  2. Teachers’ perceptions of individual performance-related pay in practice : A picture of a counterproductive pay system

    OpenAIRE

    Lundström, Ulf

    2012-01-01

    This article describes and discusses Swedish upper-secondary teachers’ perceptions of the effects of individual performance-related pay (PRP) in the context of educational restructuring and governance. The empirical data were generated through semi-structured interviews of 23 teachers. Power’s distinction between programmatic and technological elements of audit is used as a frame of reference for the problematization of the pay system. The findings demonstrate a wide gap between the programma...

  3. Vrijwillig kinderloze vrouwen : verkenningen rond een keuze

    OpenAIRE

    Bandt, den, M.L.

    1982-01-01

    This research on voluntarily childless married women was carried out by the direction of the "Netionaal Programma Demografisch Onderzoek (NPDO) (National Program for Demographic Research). To all appearances, the percentage of voluntarily childless married couples is increasing in various western countries, including the Netherlands. This makes this relatively new topic of research extra interesting.The problem-definition of the research was as follows:- Which factors influence the choice for...

  4. Inventarisatie van Functionele Gebruikerseisen voor een Geografisch Informatie Systeem (Plan of Action ’Survey of Functional Requirements for a Geographical Information System’)

    Science.gov (United States)

    1991-11-07

    draait op een SUN wcrkstation. Het research GIS systeem zal zijn gebaseerd op POSTGRES , een niet-commercidle nakomeling van INGRES ( POSTGRES is een...produkt van Berkeley University, Professor Stonebraker). POSTGRES kan zowel rechtstreeks als via applicatie-programma’s worden benaderd. De query- taal...is gebaseerd op POSTQUEL. Het geheel draait op een SUN werkstation. POSTGRES is gekozcn omdat dit DBMS vele voordelen biedt als research GIS, met

  5. Emissions inventories and options for control SUMMARY REPORT

    OpenAIRE

    Swart RJ; van Amstel AR; van den Born GJ; Kroeze C; MTV; LAE

    1994-01-01

    Dit is het eindrapport van het project "Maatschappelijke oorzaken broeikaseffect: emissie-inventarisaties en opties voor uitworpbeperking", gefinancierd door het Nationaal Onderzoek Programma Mondiale Luchtverontreiniging en Klimaatverandering en het Directoraat Milieuhygiene van het Ministerie van Volkshuisvesting, Ruimtelijke Ordening en Milieubeheer. In 1990 was er weinig bekend over de nationale uitworp van de niet-CO2 broeikasgassen en de oorzaken ervan. De doelstellingen van h...

  6. Il mondo dentro il mondo

    CERN Document Server

    Barrow, John D

    1991-01-01

    Davvero esistono “lì fuori” leggi di natura, che stanno in attesa di essere scoperte, indipendenti dal nostro modo di pensare, o esse rappresentano soltanto la descrizione più conveniente di ciò che abbiamo visto? Come è nata l’idea stessa di “leggi di natura”? Queste costituiscono la realtà profonda o sono soltanto pezzi di un regolamento che ci siamo dati per organizzare meglio la nostra conoscenza del mondo? o semplici paletti che piantiamo e ci lasciamo alle spalle come segnali via via che procediamo nella giungla dell’esperienza? È possibile che non esistano affatto leggi di natura? Forse esse, e anche l’universo che da esse sembra regolato, sono del tutto creazioni della nostra mente: un’illusione che scompare appena cessiamo di pensarvi. Ma allora, che cosa accadrebbe, se non ci fossero osservatori dell’universo?». Interrogativi di questo genere, che incontriamo sulla soglia del Mondo dentro il mondo, sarebbero suonati eccentrici fino a qualche anno fa. Oggi, al contrario, circ...

  7. Disturbi dello spettro autistico tra filosofia della medicina e delle neuroscienze

    Directory of Open Access Journals (Sweden)

    Carlo Maria Cirino

    2012-05-01

    Full Text Available L’autismo è un disturbo pervasivo dello sviluppo neuropsicologico che interessa all’incirca un bambino su mille. Purtroppo, si tratta di un dato destinato ad aumentare, anche per via dell’interesse mediatico e scientifico che questa patologia è stata capace di richiamare intorno a sé. Da un lato, infatti, sono aumentate le richieste di screening presso i numerosi centri che monitorano questa complessa patologia neurologica e dall’altro sono migliorate le tecniche di diagnosi che sempre più spesso si avvalgono di esami genetici all’avanguardia in aggiunta alle ormai classiche interviste psicologiche. L’autismo pone, dunque, serie questioni all’attenzione della ricerca scientifica sia nel vasto campo delle neuroscienze che in quello della neuropsichiatria e della psicologia clinica. Ebbene: quel settore della filosofia che guarda alla scienza con interesse particolare, non può che seguire con partecipazione i progressi nella spiegazione di questa misteriosa patologia che, attualmente, resta un vero e proprio rompicapo per tutti coloro che hanno a che fare con la complessità dell’organizzazione cerebrale dell’essere umano.

  8. Induction of reactive oxygen species-stimulated distinctive autophagy by chelerythrine in non-small cell lung cancer cells.

    Science.gov (United States)

    Tang, Zheng-Hai; Cao, Wen-Xiang; Wang, Zhao-Yu; Lu, Jia-Hong; Liu, Bo; Chen, Xiuping; Lu, Jin-Jian

    2017-08-01

    Chelerythrine (CHE), a natural benzo[c]phenanthridine alkaloid, shows anti-cancer effect through a number of mechanisms. Herein, the effect and mechanism of the CHE-induced autophagy, a type II programmed cell death, in non-small cell lung cancer (NSCLC) cells were studied for the first time. CHE induced cell viability decrease, colony formation inhibition, and apoptosis in a concentration-dependent manner in NSCLC A549 and NCI-H1299 cells. In addition, CHE triggered the expression of phosphatidylethanolamine-modified microtubule-associated protein light-chain 3 (LC3-II). The CHE-induced expression of LC3-II was further increased in the combination treatment with chloroquine (CQ), an autophagy inhibitor, and large amounts of red-puncta were observed in the CHE-treated A549 cells with stable expression of mRFP-EGFP-LC3, indicating that CHE induces autophagy flux. Silence of beclin 1 reversed the CHE-induced expression of LC3-II. Inhibition of autophagy remarkably reversed the CHE-induced cell viability decrease and apoptosis in NCI-H1299 cells but not in A549 cells. Furthermore, CHE triggered reactive oxygen species (ROS) generation in both cell lines. A decreased level of ROS through pretreatment with N-acetyl-L-cysteine reversed the CHE-induced cell viability decrease, apoptosis, and autophagy. Taken together, CHE induced distinctive autophagy in A549 (accompanied autophagy) and NCI-H1299 (pro-death autophagy) cells and a decreased level of ROS reversed the effect of CHE in NSCLC cells in terms of cell viability, apoptosis, and autophagy. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

  9. Long-term planning 'Energiesprong'. Update 2012; Meerjarenplan Energiesprong. Update 2012

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-04-15

    The SEV program 'Energiesprong' ('Energy Leap') (SEV is the Dutch abbreviation for Steering Group Experimental Housing) aims to contribute substantially to the conditions under which the energy transition can be realized. This basic plan outlines how the market can realize an effective transition, which activities should be supported, set up and executed. The SEV program Energiesprong is commissioned by the Ministry of the Interior and Kingdom Relations (BZK). The program is derived from the Innovation Agenda for Energy in the Built Environment [Dutch] Het SEV-programma Energiesprong (SEV is Stuurgroep Experimenten Volkshuisvesting) beoogt een substantiele bijdrage te leveren aan de condities waaronder de energietransitie effectief tot stand kan komen. In dit basisplan wordt uiteengezet hoe de markt daartoe moet kunnen komen en welke activiteiten daarvoor worden ondersteund, opgezet en/of uitgevoerd vanuit Energiesprong. Het SEV-programma Energiesprong wordt in opdracht van het Ministerie van Binnenlandse Zaken en Koninkrijksrelaties (BZK) uitgevoerd. Het programma is afgeleid van de Innovatie Agenda energie Gebouwde Omgeving.

  10. Long-term planning 'Energiesprong'. Update 2012; Meerjarenplan Energiesprong. Update 2012

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-04-15

    The SEV program 'Energiesprong' ('Energy Leap') (SEV is the Dutch abbreviation for Steering Group Experimental Housing) aims to contribute substantially to the conditions under which the energy transition can be realized. This basic plan outlines how the market can realize an effective transition, which activities should be supported, set up and executed. The SEV program Energiesprong is commissioned by the Ministry of the Interior and Kingdom Relations (BZK). The program is derived from the Innovation Agenda for Energy in the Built Environment [Dutch] Het SEV-programma Energiesprong (SEV is Stuurgroep Experimenten Volkshuisvesting) beoogt een substantiele bijdrage te leveren aan de condities waaronder de energietransitie effectief tot stand kan komen. In dit basisplan wordt uiteengezet hoe de markt daartoe moet kunnen komen en welke activiteiten daarvoor worden ondersteund, opgezet en/of uitgevoerd vanuit Energiesprong. Het SEV-programma Energiesprong wordt in opdracht van het Ministerie van Binnenlandse Zaken en Koninkrijksrelaties (BZK) uitgevoerd. Het programma is afgeleid van de Innovatie Agenda energie Gebouwde Omgeving.

  11. Funzioni identitarie dell'alternanza linguistica in apprendenti di italiano durante lo svolgimento di attività in gruppo

    Directory of Open Access Journals (Sweden)

    Roberta Ferroni

    2013-12-01

    Full Text Available Questo articolo indaga, servendosi degli strumenti teorici messi a disposizione dall’analisi della conversazione, coadiuvata da una serie di nozioni e riferimenti tratti dagli studi che esaminano la struttura dell’interazione nella classe di lingua, i diversi usi che gli apprendenti di italiano LS fanno delle lingue presenti nella classe, specialmente della loro LM, durante lo svolgimento di attività di gruppo per dare voce alle multiple identità che costituiscono ciascun individuo. Dallo studio emerge che l’identità degli apprendenti è in continua trasformazione. Infatti, per potersi affermare, gli apprendenti dovranno “interpretare” un insieme di ruoli che cambiano e che dovranno negoziare in base al contesto d’interazione

  12. Unità di conto di bilancio.

    Directory of Open Access Journals (Sweden)

    R. VALCAMONICI

    2014-09-01

    Full Text Available La principale conclusione che si ricava dall’articolo mostra che l’aggravio che deriverebbe ai paesi a moneta debole dalla introduzione dell’UCE e, alternativamente, il vantaggio in favore dei paesi a moneta forte, sono destinati a livellarsi a partire dal 1978 in conseguenza dell’applicazione integrale del sistema delle risorse proprie e della maggiore partecipazione dei nuovi Stati menbri.

  13. Role of motility and chemotaxis in the pathogenesis of Dickeya dadantii 3937 (ex Erwinia chrysanthemi 3937).

    Science.gov (United States)

    Antúnez-Lamas, María; Cabrera-Ordóñez, Ezequiel; López-Solanilla, Emilia; Raposo, Rosa; Trelles-Salazar, Oswaldo; Rodríguez-Moreno, Andrés; Rodríguez-Palenzuela, Pablo

    2009-02-01

    Dickeya dadantii 3937 (ex Erwinia chrysanthemi), a member of the Enterobacteriaceae, causes soft rot in many economically important crops. A successful pathogen has to reach the interior of the plant in order to cause disease. To study the role of motility and chemotaxis in the pathogenicity of D. dadantii 3937, genes involved in the chemotactic signal transduction system (cheW, cheB, cheY and cheZ) and in the structure of the flagellar motor (motA) were mutagenized. All the mutant strains grew like the wild-type in culture media, and the production and secretion of pectolytic enzymes was not affected. As expected, the swimming ability of the mutant strains was reduced with respect to the wild-type: motA (94%), cheY (80%), cheW (74%), cheB (54%) and cheZ (48%). The virulence of the mutant strains was analysed in chicory, Saintpaulia and potato. The mutant strains were also tested for their capability to enter into Arabidopsis leaves. All the mutants showed a significant decrease of virulence in certain hosts; however, the degree of virulence reduction varied depending on the virulence assay. The ability to penetrate Arabidopsis leaves was impaired in all the mutants, whereas the capacity to colonize potato tubers after artificial inoculation was affected in only two mutant strains. In general, the virulence of the mutants could be ranked as motA<cheYZ, which correlated with the degree to which swimming was affected. These results clearly indicate that motility plays an important role in the pathogenicity of this bacterium.

  14. DALL’«ARTICOLO EPR» AGLI ESPERIMENTI DI ALAIN ASPECT: IL LUNGO CAMMINO DEL PROBLEMA DELLA NONLOCALITÀ IN MECCANICA QUANTISTICA

    OpenAIRE

    Matarese, Vera

    2014-01-01

    Quando, nel 1935, venne pubblicato il famoso articolo chiamato poi “EPR Paper” per le iniziali dei suoi autori - Einstein, Podolsky, Rosen -, la comunità scientifica dovette confrontarsi non solo con le manifeste provocazioni che il suo argomento voleva mostrare, ma anche con latenti problemi che sarebbero sbocciati più avanti in tutti i loro stridenti contrasti. L’incompletezza della meccanica quantistica, che l’“articolo EPR” si proponeva di dimostrare, poggiava infatti su un principio molt...

  15. La certezza della pena tra lavoro nero e problematiche di integrazione / La certitude de la sanction entre travail au noir et problèmes d'intégration / Sanction Certainty between Illegal Work and Immigration Problems

    Directory of Open Access Journals (Sweden)

    Bisi Roberta

    2010-07-01

    Full Text Available L’immissione di nuove popolazioni in una società provoca inevitabilmente sfide a carattere sociale. Affrontare i problemi che la popolazione immigrata pone significa, tra l’altro, considerare che si tratta di un attore sociale che, con i propri comportamenti, le proprie scelte, i propri orientamenti mette in continua discussione i meccanismi logici e le politiche presenti nelle società.

  16. Emozione, discorso e politiche della vita quotidiana

    Directory of Open Access Journals (Sweden)

    Lila Abu-Lughod

    2013-07-01

    Full Text Available Le emozioni sono una di quelle nozioni considerate scontate sia dalla conoscenza specialistica che dal discorso quotidiano, che stanno ora diventando parte del dominio della ricerca antropologica. Nonostante che siano ancora principalmente appannaggio della filosofia e della psicologia all’interno delle discipline accademiche, le emozioni sono anche questioni ordinarie del discorso culturale popolare americano,la cui relazione con questi discorsi professionali è complessa e solo parzialmente indagata.

  17. T. A. Sebeok e i congegni di modellazione del mondo: strumenti teorici al servizio delle pratiche professionali

    Directory of Open Access Journals (Sweden)

    Giorgio Maggi

    2005-06-01

    Full Text Available L'elaborato si compone di una parte che comprende l'illustrazione delle linee generali del pensiero teorico di T. A. Sebeok e nello specif ico della sua teoria dei "sistemi di modellazione", e l'altra che include le riflessioni circa la possibilità di adoperare l'approccio biosemiotico alla realtà sociale e costruire, in tale direzione, un professionalismo ideal-tipico che sia capace di rispondere alle esigenze pratiche della vita quotidiana.

  18. Immigrants and the US Army: A Study in Readiness and the American Dream

    Science.gov (United States)

    2016-05-26

    Immigrants and the US Army: A Study in Readiness and the American Dream A Monograph by LTC Che T. Arosemena...Approval Page Name of Candidate: LTC Che T. Arosemena Monograph Title: Immigrants and the US Army: A Study in Readiness and the American Dream Approved by...Abstract Immigrants and the US Army: A Study in Readiness and the American Dream , by LTC Che T. Arosemena, USA, 71

  19. La figura di Maria Maddalena nella tradizione agostiniana del XII secolo e l'allegoria nuziale in Bernardo di ClairvauxUn'ipotesi di interpretazione alla luce di categorie di ordine psicoanalitico

    Directory of Open Access Journals (Sweden)

    Elena Cartotto

    2008-07-01

    La lettura viene condotta sulla base di categorie concettuali di carattere psicoanalitico, in quanto tali categorie trovano la propria origine, prima ancora che nel pensiero, nella più concreta e profonda esperienza umana. Ed è proprio il collocarsi all'interno di questa viva esperienza umana che consente di cogliere in modo più diretto la dimensione antropologica che pare emergere dagli scrittori monastici di questo periodo.

  20. Mondi possibili

    CERN Document Server

    Dyson, Freeman

    1998-01-01

    Scienza, fantascienza, storia. Freeman Dyson percorre con sicurezza, acume e spirito critico i sentieri che conducono al futuro del nostro mondo ; ci fa scorgere i pericoli e le insidie del progresso scientifico e tecnologico, ci narra le vicende che hanno caratterizzato la scienza e la cultura del nostro secolo e si misura con le grandi questioni che gli scienziati e l'umanita dovranno affrontare agli inizi di un nuovo millenio.