WorldWideScience

Sample records for program vtp fact

  1. Vehicle Technologies' Fact of the Week 2011

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Stacy Cagle [ORNL; Diegel, Susan W [ORNL; Boundy, Robert Gary [ORNL

    2012-04-01

    Each week the U.S. Department of Energy s Vehicle Technology Program (VTP) posts a Fact of the Week on their website: http://www1.eere.energy.gov/vehiclesandfuels/. These Facts provide statistical information, usually in the form of charts and tables, on vehicle sales, fuel economy, gasoline prices, and other transportation-related trends. Each Fact is a stand-alone page that includes a graph, text explaining the significance of the data, the supporting information on which the graph was based, and the source of the data. A link to the current Fact is available Monday through Friday on the VTP homepage, but older Facts are archived and still available at: http://www1.eere.energy.gov/vehiclesandfuels/facts/. This report is a compilation of the Facts that were posted during calendar year 2011. The Facts were written and prepared by staff in Oak Ridge National Laboratory's Center for Transportation Analysis.

  2. Weight reductions for the airbus A380; postbuckling of the A380 VTP skin panels

    NARCIS (Netherlands)

    Kroese, R.

    2014-01-01

    The skin panels of the Vertical Tail Plane (VTP) are the largest single piece composite components assembled on the Airbus A380. By allowing postbuckling to these skin panels might result in severe weight reductions for the VTP of the A380. The goal of the study is to give an indication of possible

  3. Vehicle technologies program Government Performance and Results Act (GPA) report for fiscal year 2012

    Energy Technology Data Exchange (ETDEWEB)

    Ward, J.; Stephens, T. S.; Birky, A. K. (Energy Systems); (DOE-EERE); (TA Engineering)

    2012-08-10

    The U.S. Department of Energy's Office of Energy Efficiency and Renewable Energy has defined milestones for its Vehicle Technologies Program (VTP). This report provides estimates of the benefits that would accrue from achieving these milestones relative to a base case that represents a future in which there is no VTP-supported vehicle technology development. Improvements in the fuel economy and reductions in the cost of light- and heavy-duty vehicles were estimated by using Argonne National Laboratory's Autonomie powertrain simulation software and doing some additional analysis. Argonne also estimated the fraction of the fuel economy improvements that were attributable to VTP-supported development in four 'subsystem' technology areas: batteries and electric drives, advanced combustion engines, fuels and lubricants, and materials (i.e., reducing vehicle mass, called 'lightweighting'). Oak Ridge National Laboratory's MA{sup 3}T (Market Acceptance of Advanced Automotive Technologies) tool was used to project the market penetration of light-duty vehicles, and TA Engineering's TRUCK tool was used to project the penetrations of medium- and heavy-duty trucks. Argonne's VISION transportation energy accounting model was used to estimate total fuel savings, reductions in primary energy consumption, and reductions in greenhouse gas emissions that would result from achieving VTP milestones. These projections indicate that by 2030, the on-road fuel economy of both light- and heavy-duty vehicles would improve by more than 20%, and that this positive impact would be accompanied by a reduction in oil consumption of nearly 2 million barrels per day and a reduction in greenhouse gas emissions of more than 300 million metric tons of CO{sub 2} equivalent per year. These benefits would have a significant economic value in the U.S. transportation sector and reduce its dependency on oil and its vulnerability to oil price shocks.

  4. Superfund fact sheet: The remedial program. Fact sheet

    International Nuclear Information System (INIS)

    1992-09-01

    The fact sheet describes what various actions the EPA can take to clean up hazardous wastes sites. Explanations of how the criteria for environmental and public health risk assessment are determined and the role of state and local governments in site remediation are given. The fact sheet is one in a series providing reference information about Superfund issues and is intended for readers with no formal scientific training

  5. Video teaching program on management of colostomy: Evaluation of its impact on caregivers

    Directory of Open Access Journals (Sweden)

    Heena Dabas

    2016-01-01

    Full Text Available Context: Care of a child having colostomy has not been institutionalized for a long time for economic and administrative reasons. After stoma formation, stoma care has to be provided to the child by caregivers at home. Hence, caregivers need to be provided with ongoing education and support, commencing from preoperative teaching to discharge from the hospital and home care. Aims: The aims of this study were to develop video-based learning resource material and to evaluate its effectiveness in terms of knowledge and skill attainment by caregivers. Settings and Design: The study design was time series, one group pretest and post test. This was conducted among 30 caregivers attending pediatric surgery outpatients and indoor departments of a tertiary level care center. Materials and Methods: A video teaching program (VTP related to pediatric colostomy was developed and used to teach the caregivers about colostomy care. Pretested and validated knowledge questionnaire, observational checklist, and stoma assessment scale (SAS were used to assess the knowledge and skills of caregivers before and after the administration of VTP immediately (post test 1 after and 2 weeks (post test 2 after the intervention. Statistical Analysis Used: Repeated measures analysis of variance (ANOVA, Bonferroni correction, Mann-Whitney U test, and Kruskal-Wallis test were used. Results: There were significant increases in knowledge (from 10.9 ± 2.5 to 16.4 ± 1.67 and 15.9 ± 4.02, P = 0.001, maximum score 20 and skill scores as assessed by the observation checklist (from 5.6 ± 2.0 to 9.8 ± 1.6 and 8.6 ± 2.1, P = 0.001, maximum score 12 immediately after and 2 weeks after the VTP. However, a decline in skills was observed at 2 weeks when compared with immediate scores, as measured by the observation checklist. There was no significant increase in the skill scores of caregivers as measured by SAS at 2 weeks compared to the immediate scores. Conclusion: The VTP was

  6. CMS Fast Facts

    Data.gov (United States)

    U.S. Department of Health & Human Services — CMS has developed a new quick reference statistical summary on annual CMS program and financial data. CMS Fast Facts includes summary information on total program...

  7. Childhood Obesity Facts

    Science.gov (United States)

    ... and Local Programs Related Topics Diabetes Nutrition Childhood Obesity Facts Recommend on Facebook Tweet Share Compartir On ... Children (WIC) Program, 2000-2014 Prevalence of Childhood Obesity in the United States Childhood obesity is a ...

  8. Facts on Employee Assistance Programs. Clearinghouse Fact Sheet.

    Science.gov (United States)

    Desmond, Thomas C.

    Employee Assistance Programs (EAPs) offer employees confidential, professional assistance for the kinds of personal problems that adversely affect their lives and their jobs. These programs started when acute worker shortages during World War II, coupled with the successes of Alcoholic Anonymous, prompted some companies in the 1940s to develop…

  9. Clean Cities Fact Sheet

    Energy Technology Data Exchange (ETDEWEB)

    2004-01-01

    This fact sheet explains the Clean Cities Program and provides contact information for all coalitions and regional offices. It answers key questions such as: What is the Clean Cities Program? What are alternative fuels? How does the Clean Cities Program work? What sort of assistance does Clean Cities offer? What has Clean Cities accomplished? What is Clean Cities International? and Where can I find more information?

  10. Combat Wound Initiative Program

    Science.gov (United States)

    2010-07-01

    Government as part of that person’s official duties. Deliver~~ by Publishing Technology to: Waiter Reed Army Institute of R~l!il>~~vTP:11~1~:S6;!4!B1...develop a predictive model, which could serve as a clinical decision support tool in the management of complex war wounds. Bayesian belief networks...decisions regarding the surgical management of wounds and estimate overall out- come of patients on the basis of casualty-specific factors in wounded

  11. Spina Bifida: General Information. Fact Sheet Number 12 = La Espina Bifida: Informacion General. Fact Sheet Number 12.

    Science.gov (United States)

    National Information Center for Children and Youth with Disabilities, Washington, DC.

    This fact sheet offers definitions of the three types of spina bifida, outlines their incidence, describes characteristics of individuals with spina bifida, and reviews educational implications. The fact sheet emphasizes that school programs should be flexible to accommodate these students' special needs and frequent absences, that children with…

  12. Photovoltaics (PV) as an Eligible Measure in Residential PACE Programs: Benefits and Challenges (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    Coughlin, J.

    2010-06-01

    Property Assessed Clean Energy (PACE) financing is one of several new financial models broadening access to clean energy by addressing the barrier of initial capital cost. The majority of the PACE programs in the market today include PV as an eligible measure. PV appeals to homeowners as a way to reduce utility bills, self-generate sustainable power, increase energy independence and demonstrate a commitment to the environment. If substantial state incentives for PV exist, PV projects can be economic under PACE, especially when partnered with good net metering policies. At the same time, PV is expensive relative to other eligible measures with a return on investment horizon that might exceed program targets. This fact sheet reviews the benefits and potential challenges of including PV in PACE programs.

  13. Facts about Physical Activity

    Science.gov (United States)

    ... Micronutrient Malnutrition State and Local Programs Facts about Physical Activity Recommend on Facebook Tweet Share Compartir Some Americans ... Activity Guideline for aerobic activity than older adults. Physical activity and socioeconomic status Adults with more education are ...

  14. MAPLIB, Thermodynamics Materials Property Generator for FORTRAN Program

    International Nuclear Information System (INIS)

    Schumann, U.; Zimmerer, W. and others

    1978-01-01

    1 - Nature of physical problem solved: MAPLIB is a program system which is able to incorporate the values of the properties of any material in a form suitable for use in other computer programs. The data are implemented in FORTRAN functions. A utility program is provided to assist in library management. 2 - Method of solution: MAPLIB consists of the following parts: 1) Conventions for the data format. 2) Some integrated data. 3) A data access system (FORTRAN subroutine). 4) An utility program for updating and documentation of the actual library content. The central part is a set of FORTRAN functions, e.g. WL H2O v(t,p) (heat conduction of water vapor as a function of temperature and pressure), which compute the required data and which can be called by the user program. The data content of MAPLIB has been delivered by many persons. There was no systematic evaluation of the material. It is the responsibility of every user to check the data for physical accuracy. MAPLIB only serves as a library system for manipulation and storing of such data. 3 - Restrictions on the complexity of the problem: a) See responsibility as explained above. b) Up to 1000 data functions could be implemented. c) If too many data functions are included in MAPLIB, the storage requirements become excessive for application in users programs

  15. Weatherization Assistance Program Fact Sheet

    Energy Technology Data Exchange (ETDEWEB)

    None

    2018-02-01

    The U.S. Department of Energy’s (DOE) Weatherization Assistance Program reduces energy costs for low-income households by increasing the energy e ciency of their homes, while ensuring their health and safety. The Program supports 8,500 jobs and provides weatherization services to approximately 35,000 homes every year using DOE funds.

  16. Vitality training-A mindfulness- and acceptance-based intervention for chronic pain.

    Science.gov (United States)

    Zangi, Heidi A; Haugli, Liv

    2017-11-01

    Chronic non-malign pain has a substantial impact on all parts of an individual's life. Mindfulness- and acceptance- based interventions are increasingly offered to help people manage their pain and strengthening their health promoting resources. In this paper, we present a mindfulness- and acceptance-based intervention, the Vitality Training Programme (VTP), to mitigating pain and accompanying symptoms and increasing pain coping abilities. Based on a clinical case presentation, we discuss how the VTP can help individuals to live a better life with pain. The VTP has been evaluated in two randomised controlled trials and two qualitative studies. Existing evidence is presented. Finally, based on a recently published theoretical model, we present some possible common explanatory mechanisms across various mindfulness- and acceptance-based interventions that might also apply to the VTP. Copyright © 2017 Elsevier B.V. All rights reserved.

  17. Evaluation of Quality Aspects in Vocational Training Programmes. Synthesis Report. CEDEFOP Document.

    Science.gov (United States)

    Seyfried, Erwin

    National evaluations of quality aspects of vocational training programs (VTPs) in five European countries--Belgium, Germany, France, Greece, and Portugal--were reviewed to determine how VTP quality is currently being evaluated and identify a more coherent approach to evaluating VTPs. Special attention was paid to how existing evaluation studies…

  18. Ethanol Basics (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    2015-01-01

    Ethanol is a widely-used, domestically-produced renewable fuel made from corn and other plant materials. More than 96% of gasoline sold in the United States contains ethanol. Learn more about this alternative fuel in the Ethanol Basics Fact Sheet, produced by the U.S. Department of Energy's Clean Cities program.

  19. International Nuclear Waste Management Fact Book

    International Nuclear Information System (INIS)

    Leigh, I.W.

    1994-05-01

    International Nuclear Waste Management Fact Book has been compiled in an effort to provide current data concerning fuel cycle and waste management facilities, R ampersand D programs, and key personnel in 24 countries, including the US, four multinational agencies and 21 nuclear societies. This publication succeeds the previously issued International Nuclear Fuel Cycle Fact Book (PNL-3594), which appeared annually for 13 years. While the title is different, there are no substantial changes in the content

  20. The sustained effect (12 months) of a single-dose vectored thermal pulsation procedure for meibomian gland dysfunction and evaporative dry eye.

    Science.gov (United States)

    Blackie, Caroline A; Coleman, Christy A; Holland, Edward J

    2016-01-01

    To evaluate the sustained effect (up to 1 year) of a single, 12-minute vectored thermal pulsation (VTP) treatment in improving meibomian gland function and dry eye symptoms in patients with meibomian gland dysfunction and evaporative dry eye. The prospective, multicenter, open-label clinical trial included 200 subjects (400 eyes) who were randomized to a single VTP treatment (treatment group) or twice-daily, 3-month, conventional warm compress and eyelid hygiene therapy (control group). Control group subjects received crossover VTP treatment at 3 months (crossover group). Effectiveness measures of meibomian gland secretion (MGS) and dry eye symptoms were evaluated at baseline and 1, 3, 6, 9, and 12 months. Subjects with inadequate symptom relief could receive additional meibomian gland dysfunction therapy after 3 (treatment group) and 6 months (crossover group). At 3 months, the treatment group had greater mean improvement in MGS (Pdry eye symptoms (P=0.0068), compared to controls. At 12 months, 86% of the treatment group had received only one VTP treatment, and sustained a mean improvement in MGS from 6.4±3.7 (baseline) to 17.3±9.1 (Pdry eye symptoms from 44.1±20.4 to 21.6±21.3 (Pdry eye symptoms from 49.1±21.0 to 24.0±23.2 (Pdry eye symptoms, over 12 months. A single VTP treatment provides significantly greater mean improvement in meibomian gland function and dry eye symptoms as compared to a conventional, twice-daily, 3-month regimen. Early VTP intervention for meibomian gland dysfunction is associated with improved treatment outcomes.

  1. International waste management fact book

    Energy Technology Data Exchange (ETDEWEB)

    Amaya, J P; LaMarche, M N; Upton, J F

    1997-10-01

    Many countries around the world are faced with nuclear and environmental management problems similar to those being addressed by the US Department of Energy. The purpose of this Fact Book is to provide the latest information on US and international organizations, programs, activities and key personnel to promote mutual cooperation to solve these problems. Areas addressed include all aspects of closing the commercial and nuclear fuel cycle and managing the wastes and sites from defense-related, nuclear materials production programs.

  2. International waste management fact book

    International Nuclear Information System (INIS)

    Amaya, J.P.; LaMarche, M.N.; Upton, J.F.

    1997-10-01

    Many countries around the world are faced with nuclear and environmental management problems similar to those being addressed by the US Department of Energy. The purpose of this Fact Book is to provide the latest information on US and international organizations, programs, activities and key personnel to promote mutual cooperation to solve these problems. Areas addressed include all aspects of closing the commercial and nuclear fuel cycle and managing the wastes and sites from defense-related, nuclear materials production programs

  3. SunShot Catalyst Prize Competition Fact Sheet

    Energy Technology Data Exchange (ETDEWEB)

    Solar Energy Technologies Office

    2015-04-01

    This fact sheet is an overview of the Catalyst Energy Innovation Prize, an open innovation program launched in 2014 by the U.S. Department of Energy SunShot Initiative. This program aims to catalyze the rapid creation and development of products and solutions that address near-term challenges in the U.S. solar energy marketplace.

  4. Drug Facts

    Medline Plus

    Full Text Available ... Facts Bath Salts Facts Cocaine (Coke, Crack) Facts Heroin (Smack, Junk) Facts Marijuana (Weed, Pot) Facts MDMA ( ... Videos Information About Drugs Alcohol Bath Salts Cocaine Heroin Marijuana MDMA Meth Pain Medicines Spice (K2) Tobacco/ ...

  5. Technologies for Distributed Energy Resources. Federal Energy Management Program (FEMP) Technical Assistance Fact Sheet

    International Nuclear Information System (INIS)

    Pitchford, P.; Brown, T.

    2001-01-01

    This four-page fact sheet describes distributed energy resources for Federal facilities, which are being supported by the U.S. Department of Energy's (DOE's) Federal Energy Management Program (FEMP). Distributed energy resources include both existing and emerging energy technologies: advanced industrial turbines and microturbines; combined heat and power (CHP) systems; fuel cells; geothermal systems; natural gas reciprocating engines; photovoltaics and other solar systems; wind turbines; small, modular biopower; energy storage systems; and hybrid systems. DOE FEMP is investigating ways to use these alternative energy systems in government facilities to meet greater demand, to increase the reliability of the power-generation system, and to reduce the greenhouse gases associated with burning fossil fuels

  6. State Energy Program Fact Sheet

    Energy Technology Data Exchange (ETDEWEB)

    None

    2018-02-01

    The U.S. Department of Energy’s State Energy Program (SEP) provides funding and technical assistance to states, territories, and the District of Columbia to enhance energy security, advance state-led energy initiatives, and maximize the benefits of decreasing energy waste.

  7. Design and Implementation of an Interactive Website for Pediatric Voice Therapy-The Concept of In-Between Care: A Telehealth Model.

    Science.gov (United States)

    Doarn, Charles R; Zacharias, Stephanie; Keck, Casey Stewart; Tabangin, Meredith; DeAlarcon, Alessandro; Kelchner, Lisa

    2018-06-05

    This article describes the design and implementation of a web-based portal developed to provide supported home practice between weekly voice therapy sessions delivered through telehealth to children with voice disorders. This in-between care consisted of supported home practice that was remotely monitored by speech-language pathologists (SLPs). A web-based voice therapy portal (VTP) was developed as a platform so participants could complete voice therapy home practice by an interdisciplinary team of SLPs (specialized in pediatric voice therapy), telehealth specialists, biomedical informaticians, and interface designers. The VTP was subsequently field tested in a group of children with voice disorders, participating in a larger telehealth study. Building the VTP for supported home practice for pediatric voice therapy was challenging, but successful. Key interactive features of the final site included 11 vocal hygiene questions, traditional voice therapy exercises grouped into levels, audio/visual voice therapy demonstrations, a store-and-retrieval system for voice samples, message/chat function, written guidelines for weekly therapy exercises, and questionnaires for parents to complete after each therapy session. Ten participants (9-14 years of age) diagnosed with a voice disorder were enrolled for eight weekly telehealth voice therapy sessions with follow-up in-between care provided using the VTP. The development and implementation of the VTP as a novel platform for the delivery of voice therapy home practice sessions were effective. We found that a versatile individual, who can work with all project staff (speak the language of both SLPs and information technologists), is essential to the development process. Once the website was established, participants and SLPs effectively utilized the web-based VTP. They found it feasible and useful for needed in-between care and reinforcement of therapeutic exercises.

  8. Sandia National Laboratories: News: Publications: Fact Sheets

    Science.gov (United States)

    Environmental Management System Pollution Prevention History 60 impacts Diversity Locations Facts & Figures Does Sandia Buy? Opportunities Small Business Procurement Technical Assistance Program (PTAP) Current Technology Partnerships Business, Industry, & Non-Profits Government Universities Center for

  9. International Nuclear Fuel Cycle Fact Book

    Energy Technology Data Exchange (ETDEWEB)

    Leigh, I.W.; Patridge, M.D.

    1991-05-01

    As the US Department of Energy (DOE) and DOE contractors have become increasingly involved with other nations in nuclear fuel cycle and waste management cooperative activities, a need has developed for a ready source of information concerning foreign fuel cycle programs, facilities, and personnel. This Fact Book was compiled to meet that need. The information contained in the International Nuclear Fuel Cycle Fact Book has been obtained from many unclassified sources: nuclear trade journals and newsletters; reports of foreign visits and visitors; CEC, IAEA, and OECN/NEA activities reports; not reflect any one single source but frequently represent a consolidation/combination of information.

  10. Drug Facts

    Medline Plus

    Full Text Available ... Cocaine (Coke, Crack) Facts Heroin (Smack, Junk) Facts Marijuana (Weed, Pot) Facts MDMA (Ecstasy, Molly) Facts Meth ( ... Information About Drugs Alcohol Bath Salts Cocaine Heroin Marijuana MDMA Meth Pain Medicines Spice (K2) Tobacco/Nicotine ...

  11. Drug Facts

    Medline Plus

    Full Text Available ... Heroin (Smack, Junk) Facts Marijuana (Weed, Pot) Facts MDMA (Ecstasy, Molly) Facts Meth (Crank, Ice) Facts Pain ... About Drugs Alcohol Bath Salts Cocaine Heroin Marijuana MDMA Meth Pain Medicines Spice (K2) Tobacco/Nicotine Other ...

  12. Drug Facts

    Medline Plus

    Full Text Available ... That People Abuse Alcohol Facts Bath Salts Facts Cocaine (Coke, Crack) Facts Heroin (Smack, Junk) Facts Marijuana ( ... Watch Videos Information About Drugs Alcohol Bath Salts Cocaine Heroin Marijuana MDMA Meth Pain Medicines Spice (K2) ...

  13. International nuclear waste management fact book

    International Nuclear Information System (INIS)

    Abrahms, C.W.; Patridge, M.D.; Widrig, J.E.

    1995-11-01

    The International Nuclear Waste Management Fact Book has been compiled to provide current data on fuel cycle and waste management facilities, R and D programs, and key personnel in 24 countries, including the US; four multinational agencies; and 20 nuclear societies. This document, which is in its second year of publication supersedes the previously issued International Nuclear Fuel Cycle Fact Book (PNL-3594), which appeared annually for 12 years. The content has been updated to reflect current information. The Fact Book is organized as follows: National summaries--a section for each country that summarizes nuclear policy, describes organizational relationships, and provides addresses and names of key personnel and information on facilities. International agencies--a section for each of the international agencies that has significant fuel cycle involvement and a list of nuclear societies. Glossary--a list of abbreviations/acronyms of organizations, facilities, and technical and other terms. The national summaries, in addition to the data described above, feature a small map for each country and some general information that is presented from the perspective of the Fact Book user in the US

  14. International nuclear waste management fact book

    Energy Technology Data Exchange (ETDEWEB)

    Abrahms, C W; Patridge, M D; Widrig, J E

    1995-11-01

    The International Nuclear Waste Management Fact Book has been compiled to provide current data on fuel cycle and waste management facilities, R and D programs, and key personnel in 24 countries, including the US; four multinational agencies; and 20 nuclear societies. This document, which is in its second year of publication supersedes the previously issued International Nuclear Fuel Cycle Fact Book (PNL-3594), which appeared annually for 12 years. The content has been updated to reflect current information. The Fact Book is organized as follows: National summaries--a section for each country that summarizes nuclear policy, describes organizational relationships, and provides addresses and names of key personnel and information on facilities. International agencies--a section for each of the international agencies that has significant fuel cycle involvement and a list of nuclear societies. Glossary--a list of abbreviations/acronyms of organizations, facilities, and technical and other terms. The national summaries, in addition to the data described above, feature a small map for each country and some general information that is presented from the perspective of the Fact Book user in the US.

  15. Drug Facts

    Medline Plus

    Full Text Available ... MDMA (Ecstasy, Molly) Facts Meth (Crank, Ice) Facts Pain Medicine (Oxy, Vike) Facts Spice (K2) Facts Tobacco ... Alcohol Bath Salts Cocaine Heroin Marijuana MDMA Meth Pain Medicines Spice (K2) Tobacco/Nicotine Other Drugs You ...

  16. Drug Facts

    Medline Plus

    Full Text Available ... Crank, Ice) Facts Pain Medicine (Oxy, Vike) Facts Spice (K2) Facts Tobacco and Nicotine Facts Other Drugs ... Salts Cocaine Heroin Marijuana MDMA Meth Pain Medicines Spice (K2) Tobacco/Nicotine Other Drugs You can call ...

  17. Drug Facts

    Medline Plus

    Full Text Available ... Ice) Facts Pain Medicine (Oxy, Vike) Facts Spice (K2) Facts Tobacco and Nicotine Facts Other Drugs of ... Cocaine Heroin Marijuana MDMA Meth Pain Medicines Spice (K2) Tobacco/Nicotine Other Drugs You can call 1- ...

  18. Drug Facts

    Medline Plus

    Full Text Available ... That People Abuse Alcohol Facts Bath Salts Facts Cocaine (Coke, Crack) Facts Heroin (Smack, Junk) Facts Marijuana (Weed, ... Watch Videos Information About Drugs Alcohol Bath Salts Cocaine Heroin Marijuana MDMA Meth Pain Medicines Spice (K2) ...

  19. Drug Facts

    Medline Plus

    Full Text Available ... Ecstasy, Molly) Facts Meth (Crank, Ice) Facts Pain Medicine (Oxy, Vike) Facts Spice (K2) Facts Tobacco and ... Bath Salts Cocaine Heroin Marijuana MDMA Meth Pain Medicines Spice (K2) Tobacco/Nicotine Other Drugs You can ...

  20. Drug Facts

    Medline Plus

    Full Text Available ... Cocaine (Coke, Crack) Facts Heroin (Smack, Junk) Facts Marijuana (Weed, Pot) Facts MDMA (Ecstasy, Molly) Facts Meth (Crank, ... Information About Drugs Alcohol Bath Salts Cocaine Heroin Marijuana MDMA Meth Pain Medicines Spice (K2) Tobacco/Nicotine ...

  1. International nuclear fuel cycle fact book. Revision 6

    International Nuclear Information System (INIS)

    Harmon, K.M.; Lakey, L.T.; Leigh, I.W.; Jeffs, A.G.

    1986-01-01

    The International Fuel Cycle Fact Book has been compiled in an effort to provide (1) an overview of worldwide nuclear power and fuel cycle programs and (2) current data concerning fuel cycle and waste management facilities, R and D programs and key personnel. Additional information on each country's program is available in the International Source Book: Nuclear Fuel Cycle Research and Development, PNL-2478, Rev. 2

  2. Fuels planning: science synthesis and integration; social issues fact sheet 01: Developing personal responsibility for fuels reduction: Building a successful program to engage property owners

    Science.gov (United States)

    Rocky Mountain Research Station USDA Forest Service

    2004-01-01

    In the course of work as a land manager, you will no doubt be involved in developing programs to achieve various objectives, including the improvement of fuels management on private lands. This fact sheet describes six steps that will help you plan and conduct a successful program.

  3. Comparison of a single-dose vectored thermal pulsation procedure with a 3-month course of daily oral doxycycline for moderate-to-severe meibomian gland dysfunction.

    Science.gov (United States)

    Hagen, Kerry B; Bedi, Raman; Blackie, Caroline A; Christenson-Akagi, Kellie J

    2018-01-01

    The aim of this study was to compare the efficacy of a single bilateral 12-minute vectored thermal pulsation (VTP) procedure versus daily oral doxycycline for 3 months for moderate-to-severe meibomian gland dysfunction (MGD). This prospective, randomized, parallel-group, single-masked study included 28 subjects who received either a single-dose VTP or 3 months of doxycycline treatment. At baseline and 3 months post treatment, all subjects were evaluated for the following: dry eye symptoms with a standard dry eye questionnaire (the Standard Patient Evaluation for Eye Dryness [SPEED]), meibomian gland (MG) function by counting the number of glands yielding liquid secretion with the MG evaluator (MGE), tear breakup time (TBUT) and corneal and conjunctival staining. In the VTP group, at 3 months, there was a significant improvement in MG function (4.00±1.47 to 7.73±5.53), SPEED score (11.00±3.30 to 5.42±2.15), TBUT (6.26±2.01 to 8.44±1.81), corneal staining (0.38±0.50 to 0.12±0.33) and conjunctival staining (1.69±1.93 to 0.62±0.85). In the doxycycline group, there was a significant improvement in MG function (4.63±1.41 to 10.63±5.91), SPEED score (13.42±4.17 to 9.42±5.47) and conjunctival staining (2.38±1.88 to 1.13±1.51), but the improvement in TBUT (6.90±2.56 to 7.59±2.03) and corneal staining (0.21±0.41 to 0.13±0.34) was not statistically significant ( p =0.262 and p =0.414, respectively). At 3 months, SPEED score was significantly better in the VTP group ( p oral doxycycline at improving the dry eye symptoms secondary to MGD. A single 12-minute VTP treatment was at least as effective as a dose of doxycycline for 3 months, in improving MG function and all measured signs of MGD. Given the minimal risk profile of the single VTP procedure over long-term doxycycline use, a single VTP presents a favorable alternative to long-term antibiotic use.

  4. International nuclear cycle fact book: Revision 9

    International Nuclear Information System (INIS)

    Leigh, I.W.

    1989-01-01

    The International Nuclear Fuel Cycle Fact Book has been compiled in an effort to provide current data concerning fuel cycle and waste management facilities, R and D programs and key personnel. The Fact Book contains: national summaries in which a section for each country which summarizes nuclear policy, describes organizational relationships and provides addresses, names of key personnel, and facilities information; and international agencies in which a section for each of the international agencies which has significant fuel cycle involvement, and a listing of nuclear societies. The national summaries, in addition to the data described above, feature a small map for each country as well as some general information. The latter is presented from the perspective of the Fact Book user in the United States

  5. International nuclear fuel cycle fact book. Revision 6

    Energy Technology Data Exchange (ETDEWEB)

    Harmon, K.M.; Lakey, L.T.; Leigh, I.W.; Jeffs, A.G.

    1986-01-01

    The International Fuel Cycle Fact Book has been compiled in an effort to provide (1) an overview of worldwide nuclear power and fuel cycle programs and (2) current data concerning fuel cycle and waste management facilities, R and D programs and key personnel. Additional information on each country's program is available in the International Source Book: Nuclear Fuel Cycle Research and Development, PNL-2478, Rev. 2.

  6. Get the Facts: Drinking Water and Intake

    Science.gov (United States)

    ... Obesity About Us Nutrition Physical Activity Overweight & Obesity Healthy Weight Breastfeeding Micronutrient Malnutrition State and Local Programs Related Links CDC Food Safety Adolescent and School Health BAM! Body and Mind Get the Facts: Drinking Water and Intake Recommend ...

  7. International nuclear fuel cycle fact book

    International Nuclear Information System (INIS)

    1992-09-01

    The International Nuclear Fuel Cycle Fact Book has been compiled in an effort to provide current data concerning fuel cycle and waste management facilities, R ampersand D programs and key personnel on 23 countries, including the US, four multi-national agencies, and 21 nuclear societies. The Fact Book is organized as follows: National summaries-a section for each country which summarizes nuclear policy, describes organizational relationships, and provides addresses and names of key personnel and information on facilities. International agencies-a section for each of the international agencies which has significant fuel cycle involvement and a listing of nuclear societies. Glossary-a list of abbreviations/acronyms of organizations, facilities, technical and other terms. The national summaries, in addition to the data described above, feature a small map for each country as well as some general information. The latter presented from the perspective of the Fact Book user in the United States

  8. Enhancing Tribal Energy Security and Clean Energy (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    2013-07-01

    This fact provides information on the Strategic Technical Assistance Response Team (START) Program, a U.S. Department of Energy Office of Indian Energy Policy and Programs (DOE-IE) initiative to provide technical expertise to support the development of next-generation energy projects in Indian Country.

  9. Light-Duty Vehicle Fuel Consumption Displacement Potential up to 2045

    Energy Technology Data Exchange (ETDEWEB)

    Moawad, Ayman [Argonne National Lab. (ANL), Argonne, IL (United States); Rousseau, Aymeric [Argonne National Lab. (ANL), Argonne, IL (United States)

    2016-04-01

    The U.S. Department of Energy (DOE) Vehicle Technologies Program (VTP) is developing more energy-efficient and environmentally friendly highway transportation technologies that will enable America to use less petroleum. The long-term aim is to develop "leapfrog" technologies that will provide Americans with greater freedom of mobility and energy security, while lowering costs and reducing impacts on the environment.

  10. Drug Facts

    Medline Plus

    Full Text Available ... form Search Menu Home Drugs That People Abuse Alcohol Facts Bath Salts Facts Cocaine (Coke, Crack) Facts ... addiction, and treatment. Watch Videos Information About Drugs Alcohol Bath Salts Cocaine Heroin Marijuana MDMA Meth Pain ...

  11. Drug Facts

    Medline Plus

    Full Text Available ... Facts Search form Search Menu Home Drugs That People Abuse Alcohol Facts Bath Salts Facts Cocaine (Coke, ... Drugs? Effects of Drugs Drug Use and Other People Drug Use and Families Drug Use and Kids ...

  12. Drug Facts

    Medline Plus

    Full Text Available ... Home Drugs That People Abuse Alcohol Facts Bath Salts Facts Cocaine (Coke, Crack) Facts Heroin (Smack, Junk) ... treatment. Watch Videos Information About Drugs Alcohol Bath Salts Cocaine Heroin Marijuana MDMA Meth Pain Medicines Spice ( ...

  13. Drug Facts

    Medline Plus

    Full Text Available ... Pain Medicine (Oxy, Vike) Facts Spice (K2) Facts Tobacco and Nicotine Facts Other Drugs of Abuse What ... Heroin Marijuana MDMA Meth Pain Medicines Spice (K2) Tobacco/Nicotine Other Drugs You can call 1-800- ...

  14. Drug Facts

    Medline Plus

    Full Text Available ... Oxy, Vike) Facts Spice (K2) Facts Tobacco and Nicotine Facts Other Drugs of Abuse What is Addiction? ... Marijuana MDMA Meth Pain Medicines Spice (K2) Tobacco/Nicotine Other Drugs You can call 1-800-662- ...

  15. International Nuclear Fuel Cycle Fact Book

    International Nuclear Information System (INIS)

    Leigh, I.W.

    1992-05-01

    As the US Department of Energy (DOE) and DOE contractors have become increasingly involved with other nations in nuclear fuel cycle and waste management cooperative activities, a need exists costs for a ready source of information concerning foreign fuel cycle programs, facilities, and personnel. This Fact Book has been compiled to meet that need. The information contained in the International Nuclear Fuel Cycle Fact Book has been obtained from many unclassified sources: nuclear trade journals and newsletters; reports of foreign visits and visitors; CEC, IAEA, and OECD/NMEA activities reports; and proceedings of conferences and workshops. The data listed typically do not reflect any single source but frequently represent a consolidation/combination of information

  16. International Nuclear Fuel Cycle Fact Book

    International Nuclear Information System (INIS)

    Leigh, I.W.; Mitchell, S.J.

    1990-01-01

    As the US Department of Energy (DOE) and DOE contractors have become increasingly involved with other nations in nuclear fuel cycle and waste management cooperative activities, a need has developed for a ready source of information concerning foreign fuel cycle programs, facilities, and personnel. This Fact Book was compiled to meet that need. The information contained in the International Nuclear Fuel Cycle Fact Book has been obtained from many unclassified sources: nuclear trade journals and newsletters; reports of foreign visits and visitors; CEC, IAEA, and OECD/NEA activities reports; proceedings of conferences and workshops, etc. The data listed do not reflect any one single source but frequently represent a consolidation/combination of information

  17. International Nuclear Fuel Cycle Fact Book

    Energy Technology Data Exchange (ETDEWEB)

    Leigh, I W; Mitchell, S J

    1990-01-01

    As the US Department of Energy (DOE) and DOE contractors have become increasingly involved with other nations in nuclear fuel cycle and waste management cooperative activities, a need has developed for a ready source of information concerning foreign fuel cycle programs, facilities, and personnel. This Fact Book was compiled to meet that need. The information contained in the International Nuclear Fuel Cycle Fact Book has been obtained from many unclassified sources: nuclear trade journals and newsletters; reports of foreign visits and visitors; CEC, IAEA, and OECD/NEA activities reports; proceedings of conferences and workshops, etc. The data listed do not reflect any one single source but frequently represent a consolidation/combination of information.

  18. Renewable Energy Project Development Assistance (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    2013-07-01

    This fact sheet provides information on the Tribes selected to receive assistance from the U.S. Department of Energy Office of Indian Energy 2013 Strategic Technical Assistance Response Team (START) Program, which provides technical expertise to support the development of next-generation energy projects on tribal lands.

  19. International nuclear fuel cycle fact book: Revision 9

    Energy Technology Data Exchange (ETDEWEB)

    Leigh, I.W.

    1989-01-01

    The International Nuclear Fuel Cycle Fact Book has been compiled in an effort to provide current data concerning fuel cycle and waste management facilities, R and D programs and key personnel. The Fact Book contains: national summaries in which a section for each country which summarizes nuclear policy, describes organizational relationships and provides addresses, names of key personnel, and facilities information; and international agencies in which a section for each of the international agencies which has significant fuel cycle involvement, and a listing of nuclear societies. The national summaries, in addition to the data described above, feature a small map for each country as well as some general information. The latter is presented from the perspective of the Fact Book user in the United States.

  20. Comparison of a single-dose vectored thermal pulsation procedure with a 3-month course of daily oral doxycycline for moderate-to-severe meibomian gland dysfunction

    Directory of Open Access Journals (Sweden)

    Hagen KB

    2018-01-01

    Full Text Available Kerry B Hagen,1 Raman Bedi,2 Caroline A Blackie,3 Kellie J Christenson-Akagi1 1EyeHealth Northwest, Portland, OR, USA; 2Iris Advanced Eye Centre, Chandigarh, India; 3TearScience, Inc., Morrisville, NC, USA Purpose: The aim of this study was to compare the efficacy of a single bilateral 12-minute vectored thermal pulsation (VTP procedure versus daily oral doxycycline for 3 months for moderate-to-severe meibomian gland dysfunction (MGD.Methods: This prospective, randomized, parallel-group, single-masked study included 28 subjects who received either a single-dose VTP or 3 months of doxycycline treatment. At baseline and 3 months post treatment, all subjects were evaluated for the following: dry eye symptoms with a standard dry eye questionnaire (the Standard Patient Evaluation for Eye Dryness [SPEED], meibomian gland (MG function by counting the number of glands yielding liquid secretion with the MG evaluator (MGE, tear breakup time (TBUT and corneal and conjunctival staining.Results: In the VTP group, at 3 months, there was a significant improvement in MG function (4.00±1.47 to 7.73±5.53, SPEED score (11.00±3.30 to 5.42±2.15, TBUT (6.26±2.01 to 8.44±1.81, corneal staining (0.38±0.50 to 0.12±0.33 and conjunctival staining (1.69±1.93 to 0.62±0.85. In the doxycycline group, there was a significant improvement in MG function (4.63±1.41 to 10.63±5.91, SPEED score (13.42±4.17 to 9.42±5.47 and conjunctival staining (2.38±1.88 to 1.13±1.51, but the improvement in TBUT (6.90±2.56 to 7.59±2.03 and corneal staining (0.21±0.41 to 0.13±0.34 was not statistically significant (p=0.262 and p=0.414, respectively. At 3 months, SPEED score was significantly better in the VTP group (p<0.05; other parameters were comparable between the two groups.Conclusion: A single 12-minute bilateral VTP procedure was significantly more effective than the 3-month daily course of oral doxycycline at improving the dry eye symptoms secondary to MGD. A single

  1. Fact Sheet: Risk Management Plan (RMP) Audit Program

    Science.gov (United States)

    Risk management programs, which consist of a hazard assessment, a prevention program, and an emergency response program; must be periodically audited to assess whether the plans are adequate or need to be revised to comply with the regulation.

  2. International Nuclear Fuel Cycle Fact Book. Revision 5

    International Nuclear Information System (INIS)

    Harmon, K.M.; Lakey, L.T.; Leigh, I.W.; Jeffs, A.G.

    1985-01-01

    This Fact Book has been compiled in an effort to provide: (1) an overview of worldwide nuclear power and fuel cycle programs; and (2) current data concerning fuel cycle and waste management facilities, R and D programs, and key personnel in countries other than the United States. Additional information on each country's program is available in the International Source Book: Nuclear Fuel Cycle Research and Development, PNL-2478, Rev. 2. The Fact Book is organized as follows: (1) Overview section - summary tables which indicate national involvement in nuclear reactor, fuel cycle, and waste management development activities; (2) national summaries - a section for each country which summarizes nuclear policy, describes organizational relationships and provides addresses, names of key personnel, and facilities information; (3) international agencies - a section for each of the international agencies which has significant fuel cycle involvement; (4) energy supply and demand - summary tables, including nuclear power projections; (5) fuel cycle - summary tables; and (6) travel aids international dialing instructions, international standard time chart, passport and visa requirements, and currency exchange rate

  3. International Nuclear Fuel Cycle Fact Book. Revision 5

    Energy Technology Data Exchange (ETDEWEB)

    Harmon, K.M.; Lakey, L.T.; Leigh, I.W.; Jeffs, A.G.

    1985-01-01

    This Fact Book has been compiled in an effort to provide: (1) an overview of worldwide nuclear power and fuel cycle programs; and (2) current data concerning fuel cycle and waste management facilities, R and D programs, and key personnel in countries other than the United States. Additional information on each country's program is available in the International Source Book: Nuclear Fuel Cycle Research and Development, PNL-2478, Rev. 2. The Fact Book is organized as follows: (1) Overview section - summary tables which indicate national involvement in nuclear reactor, fuel cycle, and waste management development activities; (2) national summaries - a section for each country which summarizes nuclear policy, describes organizational relationships and provides addresses, names of key personnel, and facilities information; (3) international agencies - a section for each of the international agencies which has significant fuel cycle involvement; (4) energy supply and demand - summary tables, including nuclear power projections; (5) fuel cycle - summary tables; and (6) travel aids international dialing instructions, international standard time chart, passport and visa requirements, and currency exchange rate.

  4. International nuclear fuel cycle fact book. Revision 4

    Energy Technology Data Exchange (ETDEWEB)

    Harmon, K.M.; Lakey, L.T.; Leigh, I.W.

    1984-03-01

    This Fact Book has been compiled in an effort to provide (1) an overview of worldwide nuclear power and fuel cycle programs and (2) current data concerning fuel cycle and waste management facilities, R and D programs, and key personnel in countries other than the United States. Additional information on each country's program is available in the International Source Book: Nuclear Fuel Cycle Research and Development, PNL-2478, Rev. 2. The Fact Book is organized as follows: (1) Overview section - summary tables which indicate national involvement in nuclear reactor, fuel cycle, and waste management development activities; (2) national summaries - a section for each country which summarizes nuclear policy, describes organizational relationships and provides addresses, names of key personnel, and facilities information; (3) international agencies - a section for each of the international agencies which has significant fuel cycle involvement; (4) energy supply and demand - summary tables, including nuclear power projections; (5) fuel cycle - summary tables; and (6) travel aids - international dialing instructions, international standard time chart, passport and visa requirements, and currency exchange rate.

  5. International nuclear fuel cycle fact book. Revision 4

    International Nuclear Information System (INIS)

    Harmon, K.M.; Lakey, L.T.; Leigh, I.W.

    1984-03-01

    This Fact Book has been compiled in an effort to provide (1) an overview of worldwide nuclear power and fuel cycle programs and (2) current data concerning fuel cycle and waste management facilities, R and D programs, and key personnel in countries other than the United States. Additional information on each country's program is available in the International Source Book: Nuclear Fuel Cycle Research and Development, PNL-2478, Rev. 2. The Fact Book is organized as follows: (1) Overview section - summary tables which indicate national involvement in nuclear reactor, fuel cycle, and waste management development activities; (2) national summaries - a section for each country which summarizes nuclear policy, describes organizational relationships and provides addresses, names of key personnel, and facilities information; (3) international agencies - a section for each of the international agencies which has significant fuel cycle involvement; (4) energy supply and demand - summary tables, including nuclear power projections; (5) fuel cycle - summary tables; and (6) travel aids - international dialing instructions, international standard time chart, passport and visa requirements, and currency exchange rate

  6. Fact Sheet: Alternative Low-Sulfur Diesel Fuel Transition Program for Alaska

    Science.gov (United States)

    This fact sheet summarizes EPA's final rule modifying the diesel fuel regulations to apply an effective date of 6-1-2010 for 15 ppm sulfur requirements for highway, nonroad, locomotive and marine diesel fuel produced/imported for, distributed

  7. What is Clean Cities? October 2011 (Brochure)

    Energy Technology Data Exchange (ETDEWEB)

    2011-10-01

    Brochure describes the Clean Cities program and includes the contact information for its 85 coalitions. Sponsored by the U.S. Department of Energy's (DOE) Vehicle Technologies Program (VTP), Clean Cities is a government-industry partnership that reduces petroleum consumption in the transportation sector. Clean Cities contributes to the energy, environmental, and economic security of the United States by supporting local decisions to reduce our dependence on imported petroleum. Established in 1993 in response to the Energy Policy Act (EPAct) of 1992, the partnership provides tools and resources for voluntary, community-centered programs to reduce consumption of petroleum-based fuels. In nearly 100 coalitions, government agencies and private companies voluntarily come together under the umbrella of Clean Cities. The partnership helps all parties identify mutual interests and meet the objectives of reducing the use of petroleum, developing regional economic opportunities, and improving air quality. Clean Cities deploys technologies and practices developed by VTP. These include idle-reduction equipment, electric-drive vehicles, fuel economy measures, and renewable and alternative fuels, such as natural gas, liquefied petroleum gas (propane), electricity, hydrogen, biofuels, and biogas. Idle-reduction equipment is targeted primarily to buses and heavy-duty trucks, which use more than 2 billion gallons of fuel every year in the United States while idling. Clean Cities fuel economy measures include public education on vehicle choice and fuel-efficient driving practices.

  8. Law Enforcement School Programs. Fact Sheet

    Science.gov (United States)

    Arkansas Safe Schools Initiative Division, 2010

    2010-01-01

    The school shooting incidents during the decade of the 1990's prompted an increase of law enforcement presence in schools. The School Violence Resource Center (SVRC) at the Criminal Justice Institute (CJI) University of Arkansas System undertook a project to determine what programs law enforcement agencies currently provide in their local schools…

  9. Energy-Saving Opportunities for Manufacturing Companies, International Fact Sheet (Spanish)

    Energy Technology Data Exchange (ETDEWEB)

    2010-08-01

    This English/Spanish fact sheet describes the Industrial Technologies Program Save Energy Now model and provides information on tools and resources to help manufacturing facilities reduce industrial energy intensity.

  10. Cost Overrun Optimism: Fact or Fiction

    Science.gov (United States)

    2016-02-29

    Base, OH. Homgren, C. T. (1990). In G. Foster (Ed.), Cost accounting : A managerial emphasis (7th ed.). Englewood Cliffs, NJ: Prentice Hall. Morrison... Accounting Office. Gansler, J. S. (1989). Affording defense. Cambridge, MA: The MIT Press. Heise, S. R. (1991). A review of cost performance index...Image designed by Diane Fleischer Cost Overrun Optimism: FACT or FICTION? Maj David D. Christensen, USAF Program managers are advocates by

  11. FY2011 Advanced Power Electronics and Electric Motors Annual Progress Report

    Energy Technology Data Exchange (ETDEWEB)

    Rogers, Susan A. [Office of Energy Efficiency and Renewable Energy (EERE), Washington, DC (United States)

    2012-01-31

    The Advanced Power Electronics and Electric Motors (APEEM) program within the DOE Vehicle Technologies Program (VTP) provides support and guidance for many cutting-edge automotive technologies now under development. Research is focused on developing revolutionary new power electronics (PE), electric motor (EM), thermal management, and traction drive system technologies that will leapfrog current on-the-road technologies. The research and development (R&D) is also aimed at achieving a greater understanding of and improvements in the way the various new components of tomorrow’s automobiles will function as a unified system to improve fuel efficiency.

  12. Drug Facts

    Medline Plus

    Full Text Available ... to main content Easy-to-Read Drug Facts Search form Search Menu Home Drugs That People Abuse Alcohol Facts ... Past Drug Use Prevention Phone Numbers and Websites Search Share Listen English Español Information about this page ...

  13. SunShot Initiative Fact Sheet

    Energy Technology Data Exchange (ETDEWEB)

    DOE Solar Energy Technologies Office

    2015-04-01

    The U.S. Department of Energy (DOE) SunShot Initiative is a collaborative national effort launched in 2011 that aggressively drives innovation to make solar energy fully cost competitive with traditional energy sources before the end of the decade. The SunShot fact sheet outlines goals and successes of the program as it works with private companies, universities, non-profit organizations, state and local governments, and national laboratories to drive down the cost of solar electricity to $0.06 per kilowatt-hour, without incentives, by the year 2020.

  14. FY2011 Oak Ridge National Laboratory Annual Progress Report for the Power Electronics and Electric Machinery Program

    Energy Technology Data Exchange (ETDEWEB)

    Olszewski, Mitchell [ORNL

    2011-10-01

    The U.S. Department of Energy (DOE) announced in May 2011 a new cooperative research effort comprising DOE, the U.S. Council for Automotive Research (composed of automakers Ford Motor Company, General Motors Company, and Chrysler Group), Tesla Motors, and representatives of the electric utility and petroleum industries. Known as U.S. DRIVE (Driving Research and Innovation for Vehicle efficiency and Energy sustainability), it represents DOE's commitment to developing public-private partnerships to fund high risk-high reward research into advanced automotive technologies. The new partnership replaces and builds upon the partnership known as FreedomCAR (derived from 'Freedom' and 'Cooperative Automotive Research') that ran from 2002 through 2010 and the Partnership for a New Generation of Vehicles initiative that ran from 1993 through 2001. The Oak Ridge National Laboratory's (ORNL's) Power Electronics and Electric Machines (PEEM) subprogram within the DOE Vehicle Technologies Program (VTP) provides support and guidance for many cutting-edge automotive technologies now under development. Research is focused on developing revolutionary new power electronics (PE), electric motor (EM), and traction drive system technologies that will leapfrog current on-the-road technologies. The research and development (R&D) is also aimed at achieving a greater understanding of and improvements in the way the various new components of tomorrow's automobiles will function as a unified system to improve fuel efficiency. In supporting the development of advanced vehicle propulsion systems, the PEEM subprogram has enabled the development of technologies that will significantly improve efficiency, costs, and fuel economy. The PEEM subprogram supports the efforts of the U.S. DRIVE partnership through a three phase approach intended to: (1) identify overall propulsion and vehicle related needs by analyzing programmatic goals and reviewing industry

  15. International nuclear fuel cycle fact book

    Energy Technology Data Exchange (ETDEWEB)

    Leigh, I.W.

    1988-01-01

    As the US Department of Energy (DOE) and DOE contractors have become increasingly involved with other nations in nuclear fuel cycle and waste management cooperative activities, a need has developed for a ready source or information concerning foreign fuel cycle programs, facilities, and personnel. This Fact Book was compiled to meet that need. The information contained has been obtained from nuclear trade journals and newsletters; reports of foreign visits and visitors; CEC, IAEA, and OECD/NEA activities reports; proceedings of conferences and workshops; and so forth. Sources do not agree completely with each other, and the data listed herein does not reflect any one single source but frequently is consolidation/combination of information. Lack of space as well as the intent and purpose of the Fact Book limit the given information to that pertaining to the Nuclear Fuel Cycle and to data considered of primary interest or most helpful to the majority of users.

  16. International nuclear fuel cycle fact book

    International Nuclear Information System (INIS)

    Leigh, I.W.

    1988-01-01

    As the US Department of Energy (DOE) and DOE contractors have become increasingly involved with other nations in nuclear fuel cycle and waste management cooperative activities, a need has developed for a ready source or information concerning foreign fuel cycle programs, facilities, and personnel. This Fact Book was compiled to meet that need. The information contained has been obtained from nuclear trade journals and newsletters; reports of foreign visits and visitors; CEC, IAEA, and OECD/NEA activities reports; proceedings of conferences and workshops; and so forth. Sources do not agree completely with each other, and the data listed herein does not reflect any one single source but frequently is consolidation/combination of information. Lack of space as well as the intent and purpose of the Fact Book limit the given information to that pertaining to the Nuclear Fuel Cycle and to data considered of primary interest or most helpful to the majority of users

  17. International nuclear fuel cycle fact book

    International Nuclear Information System (INIS)

    Leigh, I.W.; Lakey, L.T.; Schneider, K.J.; Silviera, D.J.

    1987-01-01

    As the US Department of Energy (DOE) and DOE contractors have become increasingly involved with other nations in nuclear fuel cycle and waste management cooperative activities, a need has developed for a ready source of information concerning foreign fuel cycle programs, facilities, and personnel. This Fact Book was compiled to meet that need. The information contained has been obtained from nuclear trade journals and newsletters; reports of foreign visits and visitors; CEC, IAEA, and OECD/NEA activities reports; proceedings of conferences and workshops; and so forth. Sources do not agree completely with each other, and the data listed herein does not reflect any one single source but frequently is a consolidation/combination of information. Lack of space as well as the intent and purpose of the Fact Book limit the given information to that pertaining to the Nuclear Fuel Cycle and to data considered of primary interest or most helpful to the majority of users

  18. Communicating facts through third-party partnerships

    International Nuclear Information System (INIS)

    Kearns, K.D.

    1989-01-01

    Every day in the United States people are making decisions about the future of nuclear energy, while it continues to be one of our most controversial issues. How these decisions turn out and whether they are based on fact and need or fear and misconceptions will depend in large part on how active a role knowledgeable people choose to play in the public arena. The participation of scientists and engineers, industry employees, and operators is particularly important because of the respect the public has for their knowledge of the issues. There are a number of very successful programs in which individuals participate through meaningful partnerships with larger national public information efforts. This paper reviews two such partnership programs and makes generalized conclusions about their success and their importance

  19. Systems Integration Fact Sheet

    Energy Technology Data Exchange (ETDEWEB)

    None

    2016-06-01

    This fact sheet is an overview of the Systems Integration subprogram at the U.S. Department of Energy SunShot Initiative. The Systems Integration subprogram enables the widespread deployment of safe, reliable, and cost-effective solar energy technologies by addressing the associated technical and non-technical challenges. These include timely and cost-effective interconnection procedures, optimal system planning, accurate prediction of solar resources, monitoring and control of solar power, maintaining grid reliability and stability, and many more. To address the challenges associated with interconnecting and integrating hundreds of gigawatts of solar power onto the electricity grid, the Systems Integration program funds research, development, and demonstration projects in four broad, interrelated focus areas: grid performance and reliability, dispatchability, power electronics, and communications.

  20. Incidence of Symptomatic Vertebral Fractures in Patients After Percutaneous Vertebroplasty

    International Nuclear Information System (INIS)

    Hierholzer, Johannes; Fuchs, Heiko; Westphalen, Kerstin; Baumann, Clemens; Slotosch, Christine; Schulz, Rudolf

    2008-01-01

    The aim of this study was to evaluate the incidence of secondary symptomatic vertebral compression fractures (VCFs) in patients previously treated by percutaneous vertebroplasty (VTP). Three hundred sixteen patients with 486 treated VCFs were included in the study according to the inclusion criteria. Patients were kept in regular follow-up using a standardized questionairre before, 1 day, 7 days, 6 months, and 1 year after, and, further on, on a yearly basis after VTP. The incidence of secondary symptomatic VCF was calculated, and anatomical distribution with respect to previous fractures characterized. Mean follow-up was 8 months (6-56 months) after VTP. Fifty-two of 316 (16.4 %) patients (45 female, 7 male) returned for treatment of 69 secondary VCFs adjacent to (35/69; 51%) or distant from (34/69; 49%) previously treated levels. Adjacent secondary VCF occurred significantly more often compared to distant secondary VCF. Of the total 69 secondary VCFs, 35 of 69 occurred below and 27 of 69 above pretreated VCFs. Of the 65 sandwich levels generated, in 7 of 65 (11%) secondary VCFs were observed. Secondary VCF below pretreated VCF occurred significantly earlier in time compared to VCF above and compared to sandwich body fractures. No major complication occurred during initial or follow-up intervention. We conclude that secondary VCFs do occur in individuals after VTP but the rate found in our study remains below the level expected from epidemiologic studies. Adjacent fractures occur more often and follow the cluster distribution of VCF as expected from the natural history of the underlying osteoporosis. No increased rate of secondary VCF after VTP was observed in this retrospective analysis. In accordance with the pertinent literature, short-term and also midterm clinical results are encouraging and provide further support for the usefulness and the low complication rate of this procedure as an adjunct to the spectrum of pain management in patients with severe

  1. Facts about Glaucoma

    Science.gov (United States)

    ... Information » Glaucoma » Facts About Glaucoma Listen Facts About Glaucoma This information was developed by the National Eye ... is the best person to answer specific questions. Glaucoma Defined What is Glaucoma? Glaucoma is a group ...

  2. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available ... Share the facts: Quick Facts Prevalence Mortality Caregivers Cost Special Report Alzheimer's in each state Quick Facts Share the facts: Prevalence The number of Americans living with Alzheimer's is growing — and growing fast. An ...

  3. Clean Energy Solutions Center Services (Vietnamese Translation) (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    2014-11-01

    This is the Vietnamese language translation of the Clean Energy Solutions Center (Solutions Center) fact sheet. The Solutions Center helps governments, advisors and analysts create policies and programs that advance the deployment of clean energy technologies. The Solutions Center partners with international organizations to provide online training, expert assistance, and technical resources on clean energy policy.

  4. Clean Energy Solutions Center Services (Arabic Translation) (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    2014-06-01

    This is the Arabic translation of the Clean Energy Solutions Center Services fact sheet. The Clean Energy Solutions Center (Solutions Center) helps governments, advisors and analysts create policies and programs that advance the deployment of clean energy technologies. The Solutions Center partners with international organizations to provide online training, expert assistance, and technical resources on clean energy policy.

  5. Weatherization and Intergovernmental Programs Office Fact Sheet

    Energy Technology Data Exchange (ETDEWEB)

    None

    2018-02-01

    One of the Department of Energy’s (DOE) primary forums for helping state and local governments implement costeffective and productive energy systems for American homes, communities, businesses, and industries is the Weatherization and Intergovernmental Programs Office (WIP). WIP is part of DOE’s Office of Energy Efficiency and Renewable Energy’s “all of the above” national energy strategy to create greater energy affordability, security and resiliency.

  6. Catalog of CERCLA applicable or relevant and appropriate requirements (ARARs) - fact sheets

    Energy Technology Data Exchange (ETDEWEB)

    1990-07-01

    Section 121(d) of the Comprehensive Environmental Response Compensation and Liability Act (CERCLA) as amended by the Superfund Amendments and Reauthorization Act of 1986 (SARA), requires attainment of federal and state applicable or relevant and appropriate requirements (ARARs). Subpart E, Section 300.400(g) {open_quotes}Identification of applicable or relevant and appropriate requirements{close_quotes} of the National Oil and Hazardous Substances Pollution Contingency Plan (NCP)(55 FR 8666, March 8, 1990) describes the process for attaining ARARs. The purpose of this catalog is to provide DOE Program Offices and Field Organizations with all of the {open_quotes}Quick Reference Fact Sheets{close_quotes} on attaining ARARS. These fact sheets provide overviews of ARARs for CERCLA cleanup actions pertinent to DOE environmental restoration activities. All of the fact sheets in this catalog were prepared by the Environmental Protection Agency`s Office of Solid Waste and Emergency Response. Fact sheets 1-7 discuss land disposal restrictions (LDRs) and their applicability. LDRs may pertain to a number of CERCLA response actions at DOE facilities. Fact Sheets 8-13 are based on the CERCLA Compliance with Other Laws Manual: Parts I and II and provide an overview of many other CERCLA ARARs. Overview of ARARs-Focus on ARAR Waivers (fact sheet 11), provides a good introduction to ARARS. The last two fact sheets, 14 and 15, are periodic reports that describe additional fact sheets and clarify issues.

  7. FY2010 Oak Ridge National Laboratory Annual Progress Report for the Power Electronics and Electric Machinery Program

    Energy Technology Data Exchange (ETDEWEB)

    Olszewski, Mitchell [ORNL

    2010-10-01

    The U.S. Department of Energy (DOE) and the U.S. Council for Automotive Research (composed of automakers Ford, General Motors, and Chrysler) announced in January 2002 a new cooperative research effort. Known as FreedomCAR (derived from ''Freedom'' and ''Cooperative Automotive Research''), it represents DOE's commitment to developing public-private partnerships to fund high risk, high payoff research into advanced automotive technologies. Efficient fuel cell technology, which uses hydrogen to power automobiles without air pollution, is a very promising pathway to achieve the ultimate vision. The new partnership replaces and builds upon the Partnership for a New Generation of Vehicles initiative that ran from 1993 through 2001. The Oak Ridge National Laboratory's (ORNL's) Advanced Power Electronics and Electric Machines (APEEM) subprogram within the DOE Vehicle Technologies Program (VTP) provides support and guidance for many cutting-edge automotive technologies now under development. Research is focused on developing revolutionary new power electronics (PE) and electric motor technologies that will leapfrog current on-the-road technologies. The research and development (R&D) is also aimed at achieving a greater understanding of and improvements in the way the various new components of tomorrow's automobiles will function as a unified system to improve fuel efficiency. In supporting the development of advanced vehicle propulsion systems, the APEEM subprogram has enabled the development of technologies that will significantly improve efficiency, costs, and fuel economy. The APEEM subprogram supports the efforts of the FreedomCAR and Fuel Partnership through a three phase approach intended to: (1) identify overall propulsion and vehicle related needs by analyzing programmatic goals and reviewing industry's recommendations and requirements and then develop the appropriate technical targets for systems

  8. West Valley Demonstration Project vitrification process equipment Functional and Checkout Testing of Systems (FACTS)

    International Nuclear Information System (INIS)

    Carl, D.E.; Paul, J.; Foran, J.M.; Brooks, R.

    1990-01-01

    The Vitrification Facility (VF) at the West Valley Demonstration Project was designed to convert stored radioactive waste into a stable glass for disposal in a federal repository. The Functional and Checkout Testing of Systems (FACTS) program was conducted from 1984 to 1989. During this time new equipment and processes were developed, installed, and implemented. Thirty-seven FACTS tests were conducted, and approximately 150,000 kg of glass were made by using nonradioactive materials to simulate the radioactive waste. By contrast, the planned radioactive operation is expected to produce approximately 500,000 kg of glass. The FACTS program demonstrated the effectiveness of equipment and procedures in the vitrification system, and the ability of the VF to produce quality glass on schedule. FACTS testing also provided data to validate the WVNS waste glass qualification method and verify that the product glass would meet federal repository acceptance requirements. The system was built and performed to standards which would have enabled it to be used in radioactive service. As a result, much of the VF tested, such as the civil construction, feed mixing and holding vessels, and the off-gas scrubber, will be converted for radioactive operation. The melter was still in good condition after being at temperature for fifty-eight of the sixty months of FACTS. However, the melter exceeded its recommended design life and will be replaced with a similar melter. Components that were not designed for remote operation and maintenance will be replaced with remote-use items. The FACTS testing was accomplished with no significant worker injury or environmental releases. During the last FACTS run, the VF processes approximated the remote-handling system that will be used in radioactive operations. Following this run the VF was disassembled for conversion to a radioactive process. Functional and checkout testing of new components will be performed prior to radioactive operation

  9. Brain Aneurysm Statistics and Facts

    Science.gov (United States)

    ... Statistics and Facts A- A A+ Brain Aneurysm Statistics and Facts An estimated 6 million people in ... Understanding the Brain Warning Signs/ Symptoms Brain Aneurysm Statistics and Facts Seeking Medical Attention Risk Factors Aneurysm ...

  10. The National Program for Occupational Safety and Health in Agriculture. 1992 Project Facts.

    Science.gov (United States)

    National Inst. for Occupational Safety and Health (DHHS/PHS), Cincinnati, OH.

    This book contains information about a project instituted in 1990 by the National Institute for Occupational Safety and Health (NIOSH) to prevent work-related diseases and injuries among agricultural workers. Included are facts about 25 projects within NIOSH and 42 cooperative agreements between NIOSH and institutions in 25 states. These…

  11. Federal Energy Efficiency through Utility Partnerships: Federal Energy Management Program (FEMP) Program Overview Fact Sheet

    International Nuclear Information System (INIS)

    Beattie, D.; Wolfson, M.

    2001-01-01

    This Utility Program Overview describes how the Federal Energy Management Program (FEMP) utility program assists Federal energy managers. The document identifies both a utility financing mechanism and FEMP technical assistance available to support agencies' implementation of energy and water efficiency methods and renewable energy projects

  12. Key Facts about Tularemia

    Science.gov (United States)

    ... Submit What's this? Submit Button Key Facts About Tularemia Recommend on Facebook Tweet Share Compartir This fact ... and Prevention (CDC) Tularemia Web site . What is Tularemia? Tularemia is a potentially serious illness that occurs ...

  13. Meningitis Myths and Facts

    Science.gov (United States)

    ... Diseases Infographic Prevention and Control of Meningococcal Disease Meningitis Myths and Facts Myth: Meningococcal disease is easy ... infected person, such as shaking hands. Fact: Meningococcal meningitis is spread through air droplets and direct contact ...

  14. Cocaine (Coke, Crack) Facts

    Science.gov (United States)

    ... That People Abuse » Cocaine (Coke, Crack) Facts Cocaine (Coke, Crack) Facts Listen Cocaine is a white ... 69 KB) "My life was built around getting cocaine and getting high." ©istock.com/ Marjot Stacey is ...

  15. Chlamydia - CDC Fact Sheet

    Science.gov (United States)

    ... Archive STDs Home Page Bacterial Vaginosis (BV) Chlamydia Gonorrhea Genital Herpes Hepatitis HIV/AIDS & STDs Human Papillomavirus ( ... sheet Pelvic Inflammatory Disease (PID) – CDC fact sheet Gonorrhea – CDC fact sheet STDs Home Page Bacterial Vaginosis ( ...

  16. FY2009 Annual Progress Report for Advanced Combustion Engine Research and Development

    Energy Technology Data Exchange (ETDEWEB)

    none,

    2009-12-01

    Fiscal Year 2009 Annual Progress Report for the Advanced Combustion Engine Research and Development (R&D) subprogram. The Advanced Combustion Engine R&D subprogram supports the mission of the VTP program by removing the critical technical barriers to commercialization of advanced internal combustion engines (ICEs) for passenger and commercial vehicles that meet future Federal emissions regulations. Dramatically improving the efficiency of ICEs and enabling their introduction in conventional as well as hybrid electric vehicles is the most promising and cost-effective approach to increasing vehicle fuel economy over the next 30 years.

  17. International nuclear fuel cycle fact book. [Contains glossary

    Energy Technology Data Exchange (ETDEWEB)

    Leigh, I.W.; Lakey, L.T.; Schneider, K.J.; Silviera, D.J.

    1987-01-01

    As the US Department of Energy (DOE) and DOE contractors have become increasingly involved with other nations in nuclear fuel cycle and waste management cooperative activities, a need has developed for a ready source of information concerning foreign fuel cycle programs, facilities, and personnel. This Fact Book was compiled to meet that need. The information contained has been obtained from nuclear trade journals and newsletters; reports of foreign visits and visitors; CEC, IAEA, and OECD/NEA activities reports; proceedings of conferences and workshops; and so forth. Sources do not agree completely with each other, and the data listed herein does not reflect any one single source but frequently is a consolidation/combination of information. Lack of space as well as the intent and purpose of the Fact Book limit the given information to that pertaining to the Nuclear Fuel Cycle and to data considered of primary interest or most helpful to the majority of users.

  18. High Blood Pressure Facts

    Science.gov (United States)

    ... Stroke Heart Disease Cholesterol Salt Million Hearts® WISEWOMAN High Blood Pressure Facts Recommend on Facebook Tweet Share Compartir On ... Top of Page CDC Fact Sheets Related to High Blood Pressure High Blood Pressure Pulmonary Hypertension Heart Disease Signs ...

  19. The Fabulous Fact Fan.

    Science.gov (United States)

    Couch, Jene P.

    1994-01-01

    Discusses the use and construction of "fact fans," fun and easy-to-make manipulatives that provide elementary school students with the opportunity to explore mathematics operations being studied in the classroom and to practice addition, subtraction, multiplication, and division facts. (BB)

  20. John Searle on Institutional Facts

    Directory of Open Access Journals (Sweden)

    m Abdullahi

    2010-09-01

    Here we argue that the essence of institutional facts is status functions. Humans recognize these functions which contain a set of deontic powers through collective intentionality. Therefore, institutional facts are ontologically subjective and epistemologically objective. Nevertheless, objectivity of institutional facts totally depends on language which itself is a fundamental institution for other institutions.

  1. Fact-finding survey of nosocomial infection control in hospitals in Vietnam and application to training programs.

    Science.gov (United States)

    Ohara, Hiroshi; Hung, Nguyen Viet; Thu, Truong Anh

    2009-12-01

    Nosocomial infection control is crucial for improving the quality of medical care. It is also indispensable for implementing effective control measures for severe acute respiratory syndrome (SARS) and the possible occurrence of a human influenza pandemic. The present authors, in collaboration with Vietnamese hospital staff, performed a fact-finding survey of nosocomial infection control in hospitals in northern Vietnam and compared the results with those of a survey conducted 4 years previously. Remarkable improvement was recognized in this period, although there were considerable differences between the central hospitals in Hanoi and local hospitals. In the local hospitals, basic techniques and the systems for infection control were regarded as insufficient, and it is necessary to improve these techniques and systems under the guidance of hospitals in the central area. Based on the results of the survey, programs were prepared and training courses were organized in local hospitals. Evaluation conducted after the training courses showed a high degree of satisfaction among the trainees. The results of the survey and the training courses conducted during the study period are expected to contribute to the improvement of nosocomial infection control in remote areas of Vietnam.

  2. A perspective on atomspheric nuclear tests in Nevada fact book

    International Nuclear Information System (INIS)

    Friesen, H.N.

    1992-04-01

    This Fact Book provides historical background and perspective on the nuclear testing program at the Nevada Test Site (NTS). Nuclear tests contributing to the off-site deposition of radioactive fallout are identified, and the concept of cumulative estimated exposure is explained. The difficulty of associating health effects with radiation is presented also. The status of litigation against the government and legislation (as of December 1991) are summarized

  3. Servicios del Centro de Soluciones Para la Energia Limpia (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    2014-05-01

    This is the Spanish translation of the Clean Energy Solutions Center Services fact sheet. The Clean Energy Solutions Center (Solutions Center) helps governments, advisors and analysts create policies and programs that advance the deployment of clean energy technologies. The Solutions Center partners with international organizations to provide online training, expert assistance, and technical resources on clean energy policy.

  4. PROGRAM RISET ILMIAH IMRE LAKATOS

    Directory of Open Access Journals (Sweden)

    Rizal Mustansyir

    2017-03-01

    Full Text Available The topic of this paper is related to the methodological thought of a philosopher Imre Lacatos. The methodological problem is a core problem in the area of philosophy of science. Science philosopher’s discourse shows the methodology of science as one of the scientific procedures in gaining the truth, but in fact, it caused the emergence of methodological mainstream; mono-methodology and pluri-methodology. Imre Lacatos’ tried to mediate the discourse of two fortifications by means of scientific research program. Some ideas developed by Lacatos’ in its relation to the scientific research programs are; first, Lacatos propose a sum of mathematics knowledge which is based on the heuristics idea, second, Lacatos’ criticism to Popper’s falsifiable concept, third, Lacatos’ effort in looking for a harmonious method that provides a sum of rational scientific progress, appropriately keeps its consistency with the historical fact, fourth, Lacatos’ connect the research program to scientists who protect the core of theory from falsification effort, fifth, a research program is qualified as progressive if it is signed by stunning novel facts and as deteriorative if the program is not directed to the new fact, sixth, the hard-core is determining characteristic of program, it is a general theory of hypotheses which is employed as a foundation of developed program, seventh, the negative heuristic of hard-core program is detailed program which states the basic assumption of program, eighth, the positive heuristic of hard-core program is an outline which indicates how the research program can be developed under additional assumption of new phenomenon clarification.

  5. Vitamin and Mineral Supplement Fact Sheets

    Science.gov (United States)

    ... website Submit Search NIH Office of Dietary Supplements Vitamin and Mineral Supplement Fact Sheets Search the list ... Supplements: Background Information Botanical Dietary Supplements: Background Information Vitamin and Mineral Fact Sheets Botanical Supplement Fact Sheets ...

  6. Five Indisputable Facts on Modern Power Systems

    Energy Technology Data Exchange (ETDEWEB)

    Bloom, Aaron P [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Brinkman, Gregory L [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Lopez, Anthony J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Holttinen, Hannele [VTT Technical Research Centre of Finland; Helman, Udi [Helman Analytics; Summers, Kate [Pacific Hydro; Bakke, Jordan [Midcontinent Independent System Operator

    2017-08-01

    This presentation overviews five indisputable facts about modern power systems: Fact one: The grid can handle more renewable generation than previously thought. Fact two: Geographic and resource diversity provide additional reliability to the system. Fact three: Wind and solar forecasting provide significant value. Fact four: Our electric power markets were not originally designed for variable renewables -- but they could be adapted. Fact five: Modern power electronics are creating new sources of essential reliability services.

  7. Weatherization Works: Weatherization Assistance Program Close-Up Fact Sheet

    International Nuclear Information System (INIS)

    2001-01-01

    The United States demonstrates its commitment to technology and efficiency through the Weatherization Program. Weatherization uses advanced technologies and techniques to reduce energy costs for low-income families by increasing the energy efficiency of their homes

  8. Drug Facts

    Medline Plus

    Full Text Available ... Nicotine Facts Other Drugs of Abuse What is Addiction? What are some signs and symptoms of someone ... use problem? How Does Drug Use Become an Addiction? What Makes Someone More Likely to Get Addicted ...

  9. Fast-track program in laparoscopic liver surgery: Theory or fact?

    Science.gov (United States)

    Sánchez-Pérez, Belinda; Aranda-Narváez, José Manuel; Suárez-Muñoz, Miguel Angel; Eladel-Delfresno, Moises; Fernández-Aguilar, José Luis; Pérez-Daga, Jose Antonio; Pulido-Roa, Ysabel; Santoyo-Santoyo, Julio

    2012-11-27

    To analyze our results after the introduction of a fast-track (FT) program after laparoscopic liver surgery in our Hepatobiliarypancreatic Unit. All patients (43) undergoing laparoscopic liver surgery between March 2004 and March 2010 were included and divided into two consecutive groups: Control group (CG) from March 2004 until December 2006 with traditional perioperative cares (17 patients) and fast-track group (FTG) from January 2007 until March 2010 with FT program cares (26 patients). Primary endpoint was the influence of the program on the postoperative stay, the amount of re-admissions, morbidity and mortality. Secondarily we considered duration of surgery, use of drains, conversion to open surgery, intensive cares needs and transfusion. Both groups were homogeneous in age and sex. No differences in technique, time of surgery or conversion to open surgery were found, but more malignant diseases were operated in the FTG, and then transfusions were higher in FTG. Readmissions and morbidity were similar in both groups, without mortality. Postoperative stay was similar, with a median of 3 for CG vs 2.5 for FTG. However, the 80.8% of patients from FTG left the hospital within the first 3 d after surgery (58.8% for CG). The introduction of a FT program after laparoscopic liver surgery improves the recovery of patients without increasing complications or re-admissions, which leads to a reduction of the stay and costs.

  10. Playing by Programming: Making Gameplay a Programming Activity

    Science.gov (United States)

    Weintrop, David; Wilensky, Uri

    2016-01-01

    Video games are an oft-cited reason for young learners getting interested in programming and computer science. As such, many learning opportunities build on this interest by having kids program their own video games. This approach, while sometimes successful, has its drawbacks stemming from the fact that the challenge of programming and game…

  11. Facts about Anophthalmia and Microphthalmia

    Science.gov (United States)

    ... Facts About Anophthalmia and Microphthalmia Listen Facts About Anophthalmia and Microphthalmia This information was developed by the ... is the best person to answer specific questions. Anophthalmia and Microphthalmia Defined What are anophthalmia and microphthalmia? ...

  12. Field Audit Checklist Tool (FACT)

    Science.gov (United States)

    Download EPA's The Field Audit Checklist Tool (FACT). FACT is intended to help auditors perform field audits, to easily view monitoring plan, quality assurance and emissions data and provides access to data collected under MATS.

  13. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available ... Home Text size: A A A 2018 Alzheimer's Disease Facts and Figures Download the full report: Download ... about memory loss? KNOW THE 10 SIGNS Alzheimer's Disease Facts in Each State The 2018 Alzheimer's Disease ...

  14. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available ... THE 10 SIGNS Alzheimer's Disease Facts in Each State The 2018 Alzheimer's Disease Facts and Figures report ... on the impact of this disease in every state across the nation. Click below to see the ...

  15. Vehicle Technologies’ Fact of the Week 2013

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Stacy Cagle [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Diegel, Susan W. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Moore, Sheila A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Boundy, Robert Gary [Roltek, Inc., Clinton, TN (United States)

    2014-04-01

    Each week the U.S. Department of Energy’s Vehicle Technology Office (VTO) posts a Fact of the Week on their website: http://www1.eere.energy.gov/vehiclesandfuels/ . These Facts provide statistical information, usually in the form of charts and tables, on vehicle sales, fuel economy, gasoline prices, and other transportation-related trends. Each Fact is a stand-alone page that includes a graph, text explaining the significance of the data, the supporting information on which the graph was based, and the source of the data. A link to the current week’s Fact is available on the VTO homepage, but older Facts are archived and still available at: http://www1.eere.energy.gov/vehiclesandfuels/facts/. This report is a compilation of the Facts that were posted during calendar year 2013. The Facts were written and prepared by staff in Oak Ridge National Laboratory's Center for Transportation Analysis.

  16. Vehicle Technologies Fact of the Week 2013

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Stacy Cagle [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Williams, Susan E. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Moore, Sheila A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Boundy, Robert Gary [Roltek, Inc., Clinton, TN (United States)

    2014-03-01

    Each week the U.S. Department of Energy s Vehicle Technology Office (VTO) posts a Fact of the Week on their website: http://www1.eere.energy.gov/vehiclesandfuels/ . These Facts provide statistical information, usually in the form of charts and tables, on vehicle sales, fuel economy, gasoline prices, and other transportation-related trends. Each Fact is a stand-alone page that includes a graph, text explaining the significance of the data, the supporting information on which the graph was based, and the source of the data. A link to the current week s Fact is available on the VTO homepage, but older Facts are archived and still available at: http://www1.eere.energy.gov/vehiclesandfuels/facts/. This report is a compilation of the Facts that were posted during calendar year 2013. The Facts were written and prepared by staff in Oak Ridge National Laboratory's Center for Transportation Analysis.

  17. Vehicle Technologies Fact of the Week 2015

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Stacy C. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Diegel, Susan W. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Moore, Sheila A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Boundy, Robert G. [Roltek, Inc., Clinton, TN (United States)

    2016-05-01

    Each week the U.S. Department of Energy s Vehicle Technology Office (VTO) posts a Fact of the Week on their website: http://www1.eere.energy.gov/vehiclesandfuels/ . These Facts provide statistical information, usually in the form of charts and tables, on vehicle sales, fuel economy, gasoline prices, and other transportation-related trends. Each Fact is a stand-alone page that includes a graph, text explaining the significance of the data, the supporting information on which the graph was based, and the source of the data. A link to the current week s Fact is available on the VTO homepage, but older Facts (back to 2009) are archived and still available at: http://energy.gov/eere/vehicles/current-and-past-years-facts-week. Each Fact of the Week website page includes a link to an Excel file. That file contains the data from the Supporting Information section of the page so that researchers can easily use data from the Fact of the Week in their work. Beginning in August of 2015, a subscription list is available on the DOE website so that those interested can sign up for an email to be sent each Monday which includes the text and graphic from the current week s Fact. This report is a compilation of the Facts that were posted during calendar year 2015. The Facts were created, written and prepared by staff in Oak Ridge National Laboratory's Center for Transportation Analysis.

  18. Rubella - Fact Sheet for Parents

    Science.gov (United States)

    ... and 4 through 6 years Fact Sheet for Parents Color [2 pages] Español: Rubéola The best way ... according to the recommended schedule. Fact Sheets for Parents Diseases and the Vaccines that Prevent Them Chickenpox ...

  19. Comparison of Ontology Reasoners: Racer, Pellet, Fact++

    Science.gov (United States)

    Huang, T.; Li, W.; Yang, C.

    2008-12-01

    In this paper, we examine some key aspects of three of the most popular and effective Semantic reasoning engines that have been developed: Pellet, RACER, and Fact++. While these reasonably advanced reasoners share some notable similarities, it is ultimately the creativity and unique nature of these reasoning engines that have resulted in the successes of each of these reasoners. Of the numerous dissimilarities, the most obvious example might be that while Pellet is written in Java, RACER employs the Lisp programming language and Fact++ was developed using C++. From this and many other distinctions in the system architecture, we can understand the benefits of each reasoner and potentially discover certain properties that may contribute to development of an optimal reasoner in the future. The objective of this paper is to establish a solid comparison of the reasoning engines based on their system architectures, features, and overall performances in real world application. In the end, we expect to produce a valid conclusion about the advantages and problems in each reasoner. While there may not be a decisive first place among the three reasoners, the evaluation will also provide some answers as to which of these current reasoning tools will be most effective in common, practical situations.

  20. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available ... Dementia >> Home Text size: A A A 2018 Alzheimer's Disease Facts and Figures Download the full report: Download ... worried about memory loss? KNOW THE 10 SIGNS Alzheimer's Disease Facts in Each State The 2018 Alzheimer's Disease ...

  1. Geothermal Technologies Program: Alaska

    Energy Technology Data Exchange (ETDEWEB)

    2005-02-01

    This fact sheets provides a summary of geothermal potential, issues, and current development in Alaska. This fact sheet was developed as part of DOE's GeoPowering the West initiative, part of the Geothermal Technologies Program.

  2. Shear Ram Verification Test Protocol (VTP) Best Practices

    Energy Technology Data Exchange (ETDEWEB)

    Lindley, Roy A. [Argonne National Lab. (ANL), Argonne, IL (United States); Braun, Joseph C. [Argonne National Lab. (ANL), Argonne, IL (United States)

    2017-01-01

    A blowout preventer (BOP) is a critical component used on subsea oil and gas wells during drilling, completion, and workover operations on the U. S. outer continental shelf (OCS). The purpose of the BOP is to seal oil and gas wells, and in the case of an emergency well-control event, to prevent the uncontrolled release of hydrocarbons. One of the most important components of the BOP is the hydraulically operated blind shear ram (BSR) that shears drilling-related components, such as drill pipes, casings, tubings, and wire-related tools that may have been placed in the well. In addition to shearing these components, the BSR must form a seal to keep hydrocarbons within the well bore, even when under the highest well-fluid pressures expected. The purpose of this document is for Argonne National Laboratory (ANL) to provide an independent view, based on current regulations, and best practices for testing and confirming the operability and suitability of BSRs under realistic (or actual) well conditions.

  3. Development NGOs: Basic Facts

    OpenAIRE

    Aldashev, Gani; Navarra, Cecilia

    2017-01-01

    This paper systematizes the results of the empirical literature on development non-governmental organizations (NGOs), drawing both from quantitative and qualitative analyses, and constructs a set of basic facts about these organizations. These basic facts concern the size of the development NGO sector and its evolution, the funding of NGOs, the allocation of NGO aid and projects across beneficiary countries, the relationship of NGOs with beneficiaries, and the phenomenon of globalization of d...

  4. Reptile Facts.

    Science.gov (United States)

    Steinheimer, Margaret

    1993-01-01

    Describes an award-winning bulletin board for introducing a unit on reptiles. This interactive bulletin board contains fun facts and counters common misconceptions about reptiles. Twelve true-false statements are hidden behind pull-up flaps. Four pictures ask students to identify the difference between often-confused animals. (PR)

  5. [Suicide, a social fact].

    Science.gov (United States)

    Baudelot, Christian

    2017-04-01

    Treating suicide as a social fact means disregarding its individual and dramatic dimensions. Sociologists do not reason on the basis of specific cases but by studying the variations, in space and time, of suicide rates. Their contribution relates essentially to a renewed perspective on society: suicide is in fact a very accurate indicator of the intensity and quality of the bonds which unite or isolate individuals in a society. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  6. Evaluation of the 2010 Toyota Prius Hybrid Synergy Drive System

    Energy Technology Data Exchange (ETDEWEB)

    Burress, Timothy A [ORNL; Campbell, Steven L [ORNL; Coomer, Chester [ORNL; Ayers, Curtis William [ORNL; Wereszczak, Andrew A [ORNL; Cunningham, Joseph Philip [ORNL; Marlino, Laura D [ORNL; Seiber, Larry Eugene [ORNL; Lin, Hua-Tay [ORNL

    2011-03-01

    Subsystems of the 2010 Toyota Prius hybrid electric vehicle (HEV) were studied and tested as part of an intensive benchmarking effort carried out to produce detailed information concerning the current state of nondomestic alternative vehicle technologies. Feedback provided by benchmarking efforts is particularly useful to partners of the Vehicle Technologies collaborative research program as it is essential in establishing reasonable yet challenging programmatic goals which facilitate development of competitive technologies. The competitive nature set forth by the Vehicle Technologies Program (VTP) not only promotes energy independence and economic stability, it also advocates the advancement of alternative vehicle technologies in an overall global perspective. These technologies greatly facilitate the potential to reduce dependency on depleting natural resources and mitigate harmful impacts of transportation upon the environment.

  7. Fact Book on Higher Education

    Science.gov (United States)

    Marks, Joseph L.; Diaz, Alicia A.

    2009-01-01

    The "Southern Regional Education Board (SREB) Fact Book on Higher Education" is one of the nation's most comprehensive collections of comparative data on higher education. For decades, state leaders, policy-makers, researchers and journalists have used the "Fact Book" to find useful data quickly--and to learn more about…

  8. Gene : CBRC-XTRO-01-2206 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2206 Novel UN D UNKNOWN VTP3_TTV1V 1e-11 32% dbj|BAC87052.1| unnamed protein product [Homo sapi...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLHAHTPAPIGTYMPTHLPPLAPTCPHTCPHWHLYAHTPAPIGTYMPTHLPPLAPTCPHTCPHWHLHAHTPAPIGTYM...PTHLPPLAPTCPHTCPHWHLHAHTPAPTDTYMPTHLPPLAPTCPHTCPHWHLHAHTPAPIGTYMPTHLPPLAPTCPHTCPHWHLHAHTPAPIGTYMPTHLPPLAPTCPHTCPHWHLHAHTPAPIGTYMPTHLPPLAPTCPHTCPH ...

  9. Distribution of immunodeficiency fact files with XML – from Web to WAP

    Directory of Open Access Journals (Sweden)

    Riikonen Pentti

    2005-06-01

    Full Text Available Abstract Background Although biomedical information is growing rapidly, it is difficult to find and retrieve validated data especially for rare hereditary diseases. There is an increased need for services capable of integrating and validating information as well as proving it in a logically organized structure. A XML-based language enables creation of open source databases for storage, maintenance and delivery for different platforms. Methods Here we present a new data model called fact file and an XML-based specification Inherited Disease Markup Language (IDML, that were developed to facilitate disease information integration, storage and exchange. The data model was applied to primary immunodeficiencies, but it can be used for any hereditary disease. Fact files integrate biomedical, genetic and clinical information related to hereditary diseases. Results IDML and fact files were used to build a comprehensive Web and WAP accessible knowledge base ImmunoDeficiency Resource (IDR available at http://bioinf.uta.fi/idr/. A fact file is a user oriented user interface, which serves as a starting point to explore information on hereditary diseases. Conclusion The IDML enables the seamless integration and presentation of genetic and disease information resources in the Internet. IDML can be used to build information services for all kinds of inherited diseases. The open source specification and related programs are available at http://bioinf.uta.fi/idml/.

  10. Math Fact Strategies Research Project

    Science.gov (United States)

    Boso, Annie

    2011-01-01

    An action research project was conducted in order to determine effective math fact strategies for first graders. The traditional way of teaching math facts included using timed tests and flashcards, with most students counting on their fingers or a number line. Six new research-based strategies were taught and analyzed to decide which methods…

  11. Confusing the drug facts on one nonprescription drug label with those on another: The Drug Facts Label as a text schema

    Directory of Open Access Journals (Sweden)

    Michael P Ryan

    2016-04-01

    Full Text Available The Drug Facts Label is designed to guide consumers in comparing nonprescription drugs. Undergraduates studied and recalled drug facts for three analgesic or non-analgesic labels using Drug Facts Label headings as retrieval cues. They then studied and recalled drug facts from an aspirin label. Aspirin recall was greater when the prior labels were analgesics, but prior-label intrusion errors were also greater. These two effects were associated with the number of prior drug labels on which facilitating and interfering drug facts appeared. Using the Drug Facts Label schema to read drug labels can both enhance and degrade the recall of nonprescription drug facts.

  12. Some basic facts about radioactive radon

    International Nuclear Information System (INIS)

    Duval, J.S.; Tanner, A.B.

    1990-01-01

    This article presents some basic facts about 222 Rn. These facts include: half-life; diffusion patterns; how radon enters a house; health risks; and means of definition and estimation of radon hazard potential

  13. Vehicle Technologies' Fact of the Week 2012

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Stacy Cagle [ORNL; Diegel, Susan W [ORNL; Moore, Sheila A [ORNL; Boundy, Robert Gary [ORNL

    2013-02-01

    Each week the U.S. Department of Energy s Vehicle Technology Office (VTO) posts a Fact of the Week on their website: http://www1.eere.energy.gov/vehiclesandfuels/ . These Facts provide statistical information, usually in the form of charts and tables, on vehicle sales, fuel economy, gasoline prices, and other transportation-related trends. Each Fact is a stand-alone page that includes a graph, text explaining the significance of the data, the supporting information on which the graph was based, and the source of the data. A link to the current week s Fact is available on the VTO homepage, but older Facts are archived and still available at: http://www1.eere.energy.gov/vehiclesandfuels/facts/. This report is a compilation of the Facts that were posted during calendar year 2012. The Facts were written and prepared by staff in Oak Ridge National Laboratory's Center for Transportation Analysis.

  14. Postpartum Depression Facts

    Science.gov (United States)

    ... Where can I find more information? Share Postpartum Depression Facts Download PDF Download ePub Download Mobi Order ... for herself or her family. What is postpartum depression? Postpartum depression is a mood disorder that can ...

  15. Snapple[R] Real Facts Watercolors

    Science.gov (United States)

    Hodge, Stephanie

    2007-01-01

    Did you know that a hummingbird weighs less than a penny? Or that an elephant swims twenty miles a day? These are just two of the many facts that Snapple prints on the lids of their drink bottles. When Snapple first introduced the Snapple Real Facts the author was excited to see that something so trivial was also educational. She asked herself if…

  16. Algorithms for worst-case tolerance optimization

    DEFF Research Database (Denmark)

    Schjær-Jacobsen, Hans; Madsen, Kaj

    1979-01-01

    New algorithms are presented for the solution of optimum tolerance assignment problems. The problems considered are defined mathematically as a worst-case problem (WCP), a fixed tolerance problem (FTP), and a variable tolerance problem (VTP). The basic optimization problem without tolerances...... is denoted the zero tolerance problem (ZTP). For solution of the WCP we suggest application of interval arithmetic and also alternative methods. For solution of the FTP an algorithm is suggested which is conceptually similar to algorithms previously developed by the authors for the ZTP. Finally, the VTP...... is solved by a double-iterative algorithm in which the inner iteration is performed by the FTP- algorithm. The application of the algorithm is demonstrated by means of relatively simple numerical examples. Basic properties, such as convergence properties, are displayed based on the examples....

  17. Anesthesia Fact Sheet

    Science.gov (United States)

    ... Education About NIGMS NIGMS Home > Science Education > Anesthesia Anesthesia Tagline (Optional) Middle/Main Content Area En español ... Version (464 KB) Other Fact Sheets What is anesthesia? Anesthesia is a medical treatment that prevents patients ...

  18. Facts about Omphalocele

    Science.gov (United States)

    ... label> Information For… Media Policy Makers Facts about Omphalocele Language: English (US) Español (Spanish) Recommend on Facebook ... hardly ever is open or broken. What is Omphalocele? Omphalocele, also known as exomphalos, is a birth ...

  19. Facts and Figures

    Science.gov (United States)

    ... Saves Lives Facts & Figures My Blood, Your Blood Blood Donation Types Did you know there is more than one type of blood donation? Learn more about blood donation types here. Blood Safety and Testing The blood supply ...

  20. Michigan transportation facts & figures : public transportation

    Science.gov (United States)

    2002-08-16

    This on-line document is part of a series, Transportation Facts & Figures, by the Michigan Department of Transportation (MDOT). The Public Transit section of Transportation Facts & Figures cover such topics as intercity bus service, intercity rail se...

  1. Main facts 1995

    International Nuclear Information System (INIS)

    1996-01-01

    This report presents the main facts of the studies carried out by the Direction des Etudes et Recherches (DER) of Electricite de France: new applications of electricity, classical and nuclear thermal power plants, electrical equipment, environment protection, monitoring and plants operations

  2. Main facts 1993

    International Nuclear Information System (INIS)

    1994-01-01

    This report presents the main facts of the studies carried out by the Direction des Etudes et Recherches (DER) of Electricite de France: new applications of electricity, classical and nuclear thermal power plants, electrical equipment, environment protection, network analysis, information and informatic equipment

  3. Tuberculosis Facts - You Can Prevent TB

    Science.gov (United States)

    Tuberculosis (TB) Facts You Can Prevent TB What is TB? “TB” is short for a disease called tuberculosis. TB is spread through the air from one ... Viral Hepatitis, STD, and TB Prevention Division of Tuberculosis Elimination TB Facts: You Can Prevent TB What ...

  4. Tuberculosis Facts - TB Can Be Treated

    Science.gov (United States)

    Tuberculosis (TB) Facts TB Can Be Treated What is TB? “TB” is short for a disease called tuberculosis. TB is spread through the air from one ... Viral Hepatitis, STD, and TB Prevention Division of Tuberculosis Elimination Page 1 of 2 TB Facts: TB ...

  5. FACTS device control strategy using PMU

    Directory of Open Access Journals (Sweden)

    Mohd Tauseef Khan

    2016-09-01

    Full Text Available The laying and commissioning of new transmission line is very difficult due to socio-economic problems, like environmental clearances, right of way, etc. Therefore, there is an emphasis on better utilization of available transmission infrastructure. FACTS devices can provide reactive power compensation, transmission capability enhancement, and voltage and stability improvement. FACTS devices operate under the command of system operator who analyses its demand by the data acquired through traditional SCADA system, state estimation algorithms and PMUs. SCADA together with PMU give accurate information about the operational state of power system. This paper proposes a scheme to automate the FACTS devices in collaboration with PMUs in a more efficient way. Highly precised data from PMUs can be fed to intelligent controllers for effective analyzing and automating the FACTS device through control command. Thus, this combination can provide real time control of reactive power, together with enhancement of power handling capability and stability improvement.

  6. Pseudomonas - Fact Sheet

    OpenAIRE

    Public Health Agency

    2012-01-01

    Fact sheet on Pseudomonas, including:What is Pseudomonas?What infections does it cause?Who is susceptible to pseudomonas infection?How will I know if I have pseudomonas infection?How can Pseudomonas be prevented from spreading?How can I protect myself from Pseudomonas?How is Pseudomonas infection treated?

  7. ARTiiFACT: a tool for heart rate artifact processing and heart rate variability analysis.

    Science.gov (United States)

    Kaufmann, Tobias; Sütterlin, Stefan; Schulz, Stefan M; Vögele, Claus

    2011-12-01

    The importance of appropriate handling of artifacts in interbeat interval (IBI) data must not be underestimated. Even a single artifact may cause unreliable heart rate variability (HRV) results. Thus, a robust artifact detection algorithm and the option for manual intervention by the researcher form key components for confident HRV analysis. Here, we present ARTiiFACT, a software tool for processing electrocardiogram and IBI data. Both automated and manual artifact detection and correction are available in a graphical user interface. In addition, ARTiiFACT includes time- and frequency-based HRV analyses and descriptive statistics, thus offering the basic tools for HRV analysis. Notably, all program steps can be executed separately and allow for data export, thus offering high flexibility and interoperability with a whole range of applications.

  8. Croatian non-fossil energy programme (NFE Program); Program nefosilnih energenata u Hrvatskoj (Program NFE)

    Energy Technology Data Exchange (ETDEWEB)

    Kamenski, M; Potocnik, V [Zagreb (Croatia)

    1997-12-31

    Proposed NFE Program (rational energy use and renewable energy) takes into account European Union experience and the facts of scarce fossil fuel reserves and relatively low energy efficiency in Croatia. Implementation of the NFE Program is expected to reduce fossil fuels import growth and environmental pollution, to improve import-export trade balance and to contribute to the new local jobs. (author). 4 figs., 11 refs.

  9. Electronic Nicotine Delivery Systems Key Facts Infographic

    Data.gov (United States)

    U.S. Department of Health & Human Services — Explore the Electronic Nicotine Delivery Systems Key Facts Infographic which outlines key facts related to electronic nicotine delivery systems (ENDS), including...

  10. 16 CFR 460.13 - Fact sheets.

    Science.gov (United States)

    2010-01-01

    ... INSULATION § 460.13 Fact sheets. If you are a manufacturer, you must give retailers and installers fact... uses. (b) A heading: “This is ____ insulation.” Fill in the blank with the type and form of your... compressed during installation.” (e) After the chart and any statement dealing with the specific type of...

  11. Effects of Higher-order Cognitive Strategy Training on Gist Reasoning and Fact Learning in Adolescents

    Directory of Open Access Journals (Sweden)

    Jacquelyn F Gamino

    2010-12-01

    Full Text Available Improving the reasoning skills of adolescents across the United States has become a major concern for educators and scientists who are dedicated to identifying evidence-based protocols to improve student outcome. This small sample randomized, control pilot study sought to determine the efficacy of higher-order cognitive training on gist-reasoning and fact-learning in an inner-city public middle school. The study compared gist-reasoning and fact-learning performances after training in a smaller sample when tested in Spanish, many of the students’ native language, versus English. The 54 eighth grade students who participated in this pilot study were enrolled in an urban middle school, predominantly from lower socio-economic status families, and were primarily of minority descent. The students were randomized into one of three groups, one that learned cognitive strategies promoting abstraction of meaning, a group that learned rote memory strategies, or a control group to ascertain the impact of each program on gist-reasoning and fact-learning from text-based information. We found that the students who had cognitive strategy instruction that entailed abstraction of meaning significantly improved their gist-reasoning and fact-learning ability. The students who learned rote memory strategies significantly improved their fact-learning scores from a text but not gist-reasoning ability. The control group showed no significant change in either gist-reasoning or fact-learning ability. A trend toward significant improvement in overall reading scores for the group that learned to abstract meaning as well as a significant correlation between gist-reasoning ability and the critical thinking on a state-mandated standardized reading test was also found. There were no significant differences between English and Spanish performance of gist reasoning and fact learning. Our findings suggest that teaching higher-order cognitive strategies facilitates gist

  12. Cholera Fact Sheet

    Science.gov (United States)

    ... news-room/fact-sheets/detail/cholera","@context":"http://schema.org","@type":"Article"}; العربية 中文 français русский español ... that includes feedback at the local level and information-sharing at the global level. Cholera cases are ...

  13. Hibernia fact sheet

    International Nuclear Information System (INIS)

    Anon.

    1994-01-01

    This fact sheet gives details of the Hibernia oil field including its location, discovery date, oil company's interests in the project, the recoverable reserves of the two reservoirs, the production system used, capital costs of the project, and overall targets for Canadian benefit. Significant dates for the Hibernia project are listed. (UK)

  14. Emotion regulation in patients with rheumatic diseases: validity and responsiveness of the Emotional Approach Coping Scale (EAC

    Directory of Open Access Journals (Sweden)

    Mowinckel Petter

    2009-09-01

    Full Text Available Abstract Background Chronic rheumatic diseases are painful conditions which are not entirely controllable and can place high emotional demands on individuals. Increasing evidence has shown that emotion regulation in terms of actively processing and expressing disease-related emotions are likely to promote positive adjustment in patients with chronic diseases. The Emotional Approach Coping Scale (EAC measures active attempts to acknowledge, understand, and express emotions. Although tested in other clinical samples, the EAC has not been validated for patients with rheumatic diseases. This study evaluated the data quality, internal consistency reliability, validity and responsiveness of the Norwegian version of the EAC for this group of patients. Methods 220 patients with different rheumatic diseases were included in a cross-sectional study in which data quality and internal consistency were assessed. Construct validity was assessed through comparisons with the Brief Approach/Avoidance Coping Questionnaire (BACQ and the General Health Questionnaire (GHQ-20. Responsiveness was tested in a longitudinal pretest-posttest study of two different coping interventions, the Vitality Training Program (VTP and a Self-Management Program (SMP. Results The EAC had low levels of missing data. Results from principal component analysis supported two subscales, Emotional Expression and Emotional Processing, which had high Cronbach's alphas of 0.90 and 0.92, respectively. The EAC had correlations with approach-oriented items in the BACQ in the range 0.17-0.50. The EAC Expression scale had a significant negative correlation with the GHQ-20 of -0.13. As hypothesized, participation in the VTP significantly improved EAC scores, indicating responsiveness to change. Conclusion The EAC is an acceptable and valid instrument for measuring emotional processing and expression in patients with rheumatic diseases. The EAC scales were responsive to change in an intervention

  15. Cerebral Palsy: General Information. Fact Sheet Number 2 = La Paralisis Cerebral: Informacion General. Fact Sheet Number 18.

    Science.gov (United States)

    Interstate Research Associates, McLean, VA.

    This fact sheet on cerebral palsy is offered in both English and Spanish. First, it provides a definition and considers various causes (e.g., an insufficient amount of oxygen reaching the fetal or newborn brain). The fact sheet then offers incidence figures and explains characteristics of the three main types of cerebral palsy: spastic, athetoid,…

  16. Tinnitus: Understanding the Facts

    Science.gov (United States)

    American Tinnitus Association Donate Become A Member Member Login Find A Provider Support Search form Search Menu Close Understanding The Facts Managing Your Tinnitus Research Toward A Cure About Us Initiatives News & ...

  17. Whooping Cough (Pertussis) - Fact Sheet for Parents

    Science.gov (United States)

    ... months 4 through 6 years Fact Sheet for Parents Color [2 pages] Español: Tosferina (pertussis) The best ... according to the recommended schedule. Fact Sheets for Parents Diseases and the Vaccines that Prevent Them Chickenpox ...

  18. How to Read a Nutrition Facts Label

    Medline Plus

    Full Text Available ... Educators Search English Español How to Read a Nutrition Facts Label (Video) KidsHealth / For Parents / How to Read a Nutrition Facts Label (Video) Print en español Cómo leer ...

  19. Structural Biology Fact Sheet

    Science.gov (United States)

    ... NIGMS NIGMS Home > Science Education > Structural Biology Structural Biology Tagline (Optional) Middle/Main Content Area PDF Version (688 KB) Other Fact Sheets What is structural biology? Structural biology is the study of how biological ...

  20. Cholesterol Facts and Statistics

    Science.gov (United States)

    ... Managing High Cholesterol Cholesterol-lowering Medicine High Cholesterol Statistics and Maps High Cholesterol Facts High Cholesterol Maps ... Deo R, et al. Heart disease and stroke statistics—2017 update: a report from the American Heart ...

  1. Nuclear fact book

    Energy Technology Data Exchange (ETDEWEB)

    Hill, O. F.; Platt, A. M.; Robinson, J. V. [comps

    1983-05-01

    This reference provides significant highlights and summary facts in the following areas: general energy; nuclear energy; nuclear fuel cycle; uranium supply and enrichment; nuclear reactors; spent fuel and advanced repacking concepts; reprocessing; high-level waste; gaseous waste; transuranic waste; low-level waste; remedial action; transportation; disposal; radiation information; environment; legislation; socio-political aspects; conversion factors; and a glossary. (GHT)

  2. Alcohol Facts and Statistics

    Science.gov (United States)

    ... Standard Drink? Drinking Levels Defined Alcohol Facts and Statistics Print version Alcohol Use in the United States: ... 1238–1245, 2004. PMID: 15010446 National Center for Statistics and Analysis. 2014 Crash Data Key Findings (Traffic ...

  3. Food Preparation. I: Food Facts for Home. II: Facts about Foodservice.

    Science.gov (United States)

    Procter and Gamble Educational Services, Cincinnati, OH.

    This package is intended for use in home economics classes focusing on nutrition and food preparation and service. The teaching guide is divided into two parts. The first centers on selected first-time facts on nutrition, meal planning, and basic food preparation skills. It includes modules on nutrition, meal management, initial steps in food…

  4. Facts about Birth Defects

    Science.gov (United States)

    ... label> Information For… Media Policy Makers Facts about Birth Defects Language: English (US) Español (Spanish) Recommend on ... having a baby born without a birth defect. Birth Defects Are Common Every 4 ½ minutes, a ...

  5. How to Read a Nutrition Facts Label

    Medline Plus

    Full Text Available ... A) Staying Safe Videos for Educators Search English Español How to Read a Nutrition Facts Label (Video) ... Read a Nutrition Facts Label (Video) Print en español Cómo leer las etiquetas de datos nutricionales (video) ...

  6. Community Renewable Energy Deployment Provides Replicable Examples of Clean Energy Projects (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    2012-09-01

    This fact sheet describes the U.S. Department of Energy's Community Renewable Energy Deployment (CommRE) program, which is a more than $20 million effort funded through the American Recovery and Reinvestment Act of 2009, to promote investment in clean energy solutions and provide real-life examples for other local governments, campuses, and small utilities to replicate. Five community-based renewable energy projects received funding from DOE through the CommRE and their progress is detailed.

  7. Facts about Type 2

    Medline Plus

    Full Text Available ... Day Diabetes Basics Home Symptoms Diagnosis America's Diabetes Challenge Type 1 Type 2 Facts About Type 2 ... Planner, and tips from experts Let's Be Well: Products to help you thrive with diabetes - lets-be- ...

  8. Facts about Type 2

    Medline Plus

    Full Text Available ... Your Risk Alert Day Diabetes Basics Home Symptoms Diagnosis America's Diabetes Challenge Type 1 Type 2 Facts ... Online Community Site Menu Are You at Risk? Diagnosis Lower Your Risk Risk Test Alert Day Prediabetes ...

  9. Facts about Folic Acid

    Science.gov (United States)

    ... Information For… Media Policy Makers Facts About Folic Acid Language: English (US) Español (Spanish) Recommend on Facebook ... of the baby’s brain and spine. About folic acid Folic acid is a B vitamin. Our bodies ...

  10. Facts about Type 2

    Medline Plus

    Full Text Available ... August 1, 2013 Last Edited: October 27, 2015 Articles from Diabetes Forecast® magazine: lp-type-2, . In this section Diabetes Basics Type 2 Facts About Type 2 Recently Diagnosed Treatment and Care Blood ...

  11. CMS fact sheet : to give an overview of the basic facts on the CMS Detector, its aims and collaboration

    CERN Multimedia

    CMS, Outreach

    2010-01-01

    2-sided color print A4 size sheet containing the facts on the CMS Detector, its name, what it is designed to do, questions scientists hope to answer, collaboration members, detector parts and their functions, and other miscellaneous facts on the CMS detector

  12. Waste generation and pollution prevention progress fact sheet: Nevada Test Site

    International Nuclear Information System (INIS)

    1994-01-01

    The Nevada Test Site is responsible for maintaining nuclear testing capability, supporting science-based Stockpile Stewardship experiments, maintaining nuclear agency response capability, applying environmental restoration techniques to areas affected by nuclear testing, managing low-level and mixed radioactive waste, investigating demilitarization technologies, investigating counter- proliferation technologies, supporting work-for-others programs and special Department of Defense activities, operating a hazardous materials spill test center, and providing for the commercial development of the site. This fact sheet provides information on routine waste generation and projected reduction by waste type. Also, materials recycled by the Nevada Test Site in 1994 are listed

  13. Facts about Type 2

    Medline Plus

    Full Text Available ... org > Diabetes Basics > Type 2 Share: Print Page Text Size: A A A Listen En Español Facts ... Type 2 Education Series Hear audio clips and full recordings of past Q&A events at your ...

  14. Facts about Type 2

    Medline Plus

    Full Text Available ... for Association Events Messaging Tools Recruiting Advocates Local Market Planning Training Webinars News & Events Advocacy News Call ... Diabetes Basics > Type 2 Share: Print Page Text Size: A A A Listen En Español Facts About ...

  15. Facts about food irradiation: Controlling the process

    International Nuclear Information System (INIS)

    1991-01-01

    This fact sheet briefly reviews the procedures that exist to control the process of food irradiation. It also summarizes the difficulties in identifying irradiated food, which stem from the fact that irradiation does not physically change the food or cause significant chemical changes in foods. 4 refs

  16. McGovern-Dole International Food for Education and Child Nutrition Program. Fact Sheet

    Science.gov (United States)

    US Department of Agriculture, 2009

    2009-01-01

    The McGovern-Dole International Food for Education and Child Nutrition Program (McGovern-Dole program) helps support education, child development, and food security for some of the world's poorest children. It provides for donations of U.S. agricultural products, as well as financial and technical assistance, for school feeding and maternal and…

  17. Energy in Sweden. Facts and figures 2005

    International Nuclear Information System (INIS)

    2005-12-01

    Energy in Sweden. Facts and Figures 2005 contains the tabular data for most of the diagrams in the main publication. These data consist primarily of the results of the Agency's processing of basic data from Statistics Sweden. Facts and Figures is available at www.stem.se in pdf- and excel file formats. With effect from the 2001 edition, statistics are of preliminary character for the two preceding years (2003 and 2004). Breakdowns into certain types of fuels vary somewhat depending on whether preliminary or final data has been used. Further information about the statistics can be found in Energy in Sweden, chapter 8 Energy Facts

  18. Some Surprising Introductory Physics Facts and Numbers

    Science.gov (United States)

    Mallmann, A. James

    2016-01-01

    In the entertainment world, people usually like, and find memorable, novels, short stories, and movies with surprise endings. This suggests that classroom teachers might want to present to their students examples of surprising facts associated with principles of physics. Possible benefits of finding surprising facts about principles of physics are…

  19. Facts about Type 2

    Medline Plus

    Full Text Available ... Alert Day Diabetes Basics Home Symptoms Diagnosis America's Diabetes Challenge Type 1 Type 2 Facts About Type 2 Enroll in ... Where Do I Begin With Type2? Living With Type 1 Diabetes Enroll in the Living WIth Type 2 Diabetes ...

  20. Clean Coal Technology Demonstration Program. Program update 1994

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-04-01

    The Clean Coal Technology Demonstration Program (CCT Program) is a $7.14 billion cost-shared industry/government technology development effort. The program is to demonstrate a new generation of advanced coal-based technologies, with the most promising technologies being moved into the domestic and international marketplace. Clean coal technologies being demonstrated under the CCT program are creating the technology base that allows the nation to meet its energy and environmental goals efficiently and reliably. The fact that most of the demonstrations are being conducted at commercial scale, in actual user environments, and under conditions typical of commercial operations allows the potential of the technologies to be evaluated in their intended commercial applications. The technologies are categorized into four market sectors: advanced electric power generation systems; environmental control devices; coal processing equipment for clean fuels; and industrial technologies. Sections of this report describe the following: Role of the Program; Program implementation; Funding and costs; The road to commercial realization; Results from completed projects; Results and accomplishments from ongoing projects; and Project fact sheets. Projects include fluidized-bed combustion, integrated gasification combined-cycle power plants, advanced combustion and heat engines, nitrogen oxide control technologies, sulfur dioxide control technologies, combined SO{sub 2} and NO{sub x} technologies, coal preparation techniques, mild gasification, and indirect liquefaction. Industrial applications include injection systems for blast furnaces, coke oven gas cleaning systems, power generation from coal/ore reduction, a cyclone combustor with S, N, and ash control, cement kiln flue gas scrubber, and pulse combustion for steam coal gasification.

  1. Facts about Volunteers. NCJW Center for the Child Fact Sheet Number 5.

    Science.gov (United States)

    National Council of Jewish Women, New York, NY. Center for the Child.

    Volunteering is a vital and widespread activity in the United States; in fact, volunteers perform many essential community functions. Those who believe that most volunteers are women with time on their hands, that volunteers just do "charity work," and that volunteers are a source of cheap labor who can replace paid professionals and…

  2. Facts about Type 2

    Medline Plus

    Full Text Available ... from Diabetes Forecast® magazine: lp-type-2, . In this section Diabetes Basics Type 2 Facts About Type ... ensureArray(data.submitSurveyResponse.errors); $.each(surveyErrors, function () { if (this.errorField) { $('input[name="' + this.errorField + '"]').closest('.form-group') . ...

  3. Homosexuality: Facts for Teens

    Science.gov (United States)

    ... Talking to Your Kids About VirginityTalking to Your Kids About Sex Home Family Health Kids and Teens Homosexuality: Facts ... by: familydoctor.org editorial staff Categories: Family Health, Kids and Teens, Prevention and Wellness, Sex and Birth Control, Sex and SexualityTags: female, Gay ...

  4. A Quasi-Experimental Study Investigating the Effect of Scent on Students' Memory of Multiplication Facts and Math Anxiety

    Science.gov (United States)

    Leap, Evelyn M.

    2013-01-01

    This quasi-experimental study was conducted with two fifth grade classrooms to investigate the effect of scent on students' acquisition and retention of multiplication facts and math anxiety. Forty participants received daily instruction for nine weeks, using a strategy-rich multiplication program called Factivation. Students in the Double Smencil…

  5. Chernobyl: the facts

    International Nuclear Information System (INIS)

    Radicella, Renato

    2007-01-01

    The Chernobyl accident and its consequences are briefly outlined in order to provide a synthesis of the facts from the most reliable sources. The paper describes in main lines the accident and the measures that were taken to mitigate its effects. The data on the radiation doses received by the population and the effects of the accident on the human health as well as on the environment are summarized. (author) [es

  6. Fake facts and alternative truths in medical research.

    Science.gov (United States)

    Hofmann, Bjørn

    2018-01-27

    Fake news and alternative facts have become commonplace in these so-called "post-factual times." What about medical research - are scientific facts fake as well? Many recent disclosures have fueled the claim that scientific facts are suspect and that science is in crisis. Scientists appear to engage in facting interests instead of revealing interesting facts. This can be observed in terms of what has been called polarised research, where some researchers continuously publish positive results while others publish negative results on the same issue - even when based on the same data. In order to identify and address this challenge, the objective of this study is to investigate how polarised research produce "polarised facts." Mammography screening for breast cancer is applied as an example. The main benefit with mammography screening is the reduced breast cancer mortality, while the main harm is overdiagnosis and subsequent overtreatment. Accordingly, the Overdiagnosis to Mortality Reduction Ratio (OMRR) is an estimate of the risk-benefit-ratio for mammography screening. As there are intense interests involved as well as strong opinions in debates on mammography screening, one could expect polarisation in published results on OMRR. A literature search identifies 8 studies publishing results for OMRR and reveals that OMRR varies 25-fold, from 0.4 to 10. Two experts in polarised research were asked to rank the attitudes of the corresponding authors to mammography screening of the identified publications. The results show a strong correlation between the OMRR and the authors' attitudes to screening (R = 0.9). Mammography screening for breast cancer appears as an exemplary field of strongly polarised research. This is but one example of how scientists' strong professional interests can polarise research. Instead of revealing interesting facts researchers may come to fact interests. In order to avoid this and sustain trust in science, researchers should disclose

  7. Power system stability enhancement using facts controllers: a review

    International Nuclear Information System (INIS)

    Abido, M. A

    2009-01-01

    In recent years, power demand has increased substantially while the expansion of power generation and transmission has been severely limited due to limited resources and environmental restrictions. As a consequence, some transmission lines are heavily loaded and the system stability becomes a power transfer-limiting factor. Flexible AC transmission systems (FACTS) controllers have been mainly used for solving various power system steady state control problems. However, recent studies reveal that FACTS controllers could be employed to enhance power system stability in addition to their main function of power flow control. The literature shows an increasing interest in this subject for the last two decades, where the enhancement of system stability using FACTS controllers has been extensively investigated. This paper presents a comprehensive review on the research and developments in the power system stability enhancement using FACTS damping controllers. Several technical issues related to FACTS installations have been highlighted and performance comparison of different FACTS controllers has been discussed. In addition, some of the utility experience, real-world installations, and semiconductor technology development have been reviewed and summarized. Applications of FACTS to other power system studies have also been discussed. About two hundred twenty seven research publications have been classified and appended for a quick reference. (author)

  8. Facts in nuclear engineering

    International Nuclear Information System (INIS)

    Buenemann, D.

    1979-07-01

    This compilation of facts has been published on behalf of Kerntechnische Gesellschaft (Society for Nuclear Engineering), as a basis for the discussion between promoters and opponents of nuclear power. It intends to make the nuclear discussion less emotional by providing relevant data material. (orig./HP) [de

  9. Facts about Vitamin K

    Science.gov (United States)

    Facts about Vitamin K 1 R. Elaine Turner and Wendy J. Dahl 2 FCS8666 Figure 1. Vitamin K is mostly found in vegetables, especially green ... ColognePhotos/iStock/Thinkstock, © ColognePhotos Why do we need vitamin K? Vitamin K is one of the fat- ...

  10. Diet myths and facts

    Science.gov (United States)

    ... night will make you fat. FACT: People who eat late at night do tend to put on extra weight. One possible reason is that late-night eaters tend to choose high-calorie treats. Some people who snack after dinner do not sleep well, which can lead to ...

  11. 31 CFR 306.95 - Attorneys in fact.

    Science.gov (United States)

    2010-07-01

    ... recognized until the Bureau receives proof of revocation or proof of the grantor's death or incompetency. (b... to by an officer who has access to the records: (1) A copy of the resolution of the governing body... fact, or (3) A copy of the resolution of the governing body directly appointing an attorney in fact. If...

  12. Mixmaster: fact and belief

    International Nuclear Information System (INIS)

    Heinzle, J Mark; Uggla, Claes

    2009-01-01

    We consider the dynamics towards the initial singularity of Bianchi type IX vacuum and orthogonal perfect fluid models with a linear equation of state. Surprisingly few facts are known about the 'Mixmaster' dynamics of these models, while at the same time most of the commonly held beliefs are rather vague. In this paper, we use Mixmaster facts as a base to build an infrastructure that makes it possible to sharpen the main Mixmaster beliefs. We formulate explicit conjectures concerning (i) the past asymptotic states of type IX solutions and (ii) the relevance of the Mixmaster/Kasner map for generic past asymptotic dynamics. The evidence for the conjectures is based on a study of the stochastic properties of this map in conjunction with dynamical systems techniques. We use a dynamical systems formulation, since this approach has so far been the only successful path to obtain theorems, but we also make comparisons with the 'metric' and Hamiltonian 'billiard' approaches.

  13. Advancing Sustainable Materials Management: Facts and Figures Report

    Science.gov (United States)

    Each year EPA releases the Advancing Sustainable Materials Management: Facts and Figures report, formerly called Municipal Solid Waste in the United States: Facts and Figures. It includes information on Municipal Solid Waste generation, recycling, an

  14. Getting a New Pancreas: Facts about Pancreas Transplants

    Science.gov (United States)

    ... 2003 December 2006 March 2012 Getting A New Pancreas Facts About Pancreas Transplants American Society of Transplantation 1120 Route 73, ... the views of the Society. _________________________________________________________________ Getting a New Pancreas Facts About Pancreas Transplants When you get a ...

  15. Energy in Sweden. Facts and figures 2004

    International Nuclear Information System (INIS)

    2004-12-01

    Energy in Sweden 2004: Facts and Figures contains the tabular data for most of the diagrams in the main publication. These data consist primarily of the results of the Agency's processing of basic data from Statistics Sweden. Facts and Figures is available at www.stem.se in pdf- and excel file formats. Since the year 2001 statistics for the period 1983-1998 are revised compared to data for previous editions. With effect from the 2001 edition, statistics are of preliminary character for the two preceding years. Breakdowns into certain types of fuels vary somewhat depending on whether preliminary or final data has been used. Further information about the statistics can be found in Energy in Sweden, chapter 8 Energy Facts.

  16. Probabilistic Programming (Invited Talk)

    OpenAIRE

    Yang, Hongseok

    2017-01-01

    Probabilistic programming refers to the idea of using standard programming constructs for specifying probabilistic models from machine learning and statistics, and employing generic inference algorithms for answering various queries on these models, such as posterior inference and estimation of model evidence. Although this idea itself is not new and was, in fact, explored by several programming-language and statistics researchers in the early 2000, it is only in the last few years that proba...

  17. Leadership: sad facts and silver linings.

    Science.gov (United States)

    Peters, T J

    1979-01-01

    The typical CEO has endless interruptions and limited options for action. In addition, he may not even hear about his choices, or any bad news that might require action, until it is almost too late. Finally, any decision he does make will probably require months or years to implement fully. This author suggests that this gloomy picture has another side. In fact, each of these "sad facts" of managerial life can be turned into an opportunity to communicate values and to persuade, and they add up to a new notion of the chief executive's function.

  18. Mastering the Multiplication Facts

    Science.gov (United States)

    D'Ettorre, Jenna

    2009-01-01

    The purpose of this paper is to share the results of a six-week research project (after baseline data was collected) that focused on three different strategies (flashcards, interactive games, and music) and their effectiveness in helping fifth grade students memorize the basic multiplication facts. Many teachers face a serious problem when their…

  19. Thorndike Revisited--Some Facts

    Science.gov (United States)

    Tuinman, J. Jaap

    1971-01-01

    Examines some historical facts surrounding Thorndike's 1917 article, Reading as Reasoning: A Study of Mistakes in Paragraph Reading," (republished in Reading Research Quarterly, 1971, 6, 425-48), in an attempt to put the article in its proper perspective both as a research study and as a contribution to the psychology of reading. (VJ)

  20. Best Management Practice Fact Sheet. 12, Filtering Practices

    OpenAIRE

    Sample, David; Barlow, Stefani

    2013-01-01

    This fact sheet is one of a 15-part series on urban stormwater management practices. This fact sheet discusses filtering practices, what they are, where they are used, how they work, maintenance, limitations, performance, expected costs and includes a glossary of terms.

  1. Best Management Practice Fact Sheet. 10, Dry Swale

    OpenAIRE

    Sample, David; Doumar, Lia

    2013-01-01

    This fact sheet is one of a 15-part series on urban stormwater management practices. This fact sheet discusses dry swales, what they are, where they are used, how they work, maintenance, limitations, performance, expected costs and includes a glossary of terms.

  2. Best Management Practice Fact Sheet. 11, Wet Swale

    OpenAIRE

    Sample, David; Doumar, Lia

    2013-01-01

    This fact sheet is one of a 15-part series on urban stormwater management practices. This fact sheet discusses wet swales, what they are, where they are used, how they work, maintenance, limitations, performance, expected costs and includes a glossary of terms.

  3. NJ transportation fact book, 2007

    Science.gov (United States)

    2010-01-01

    The New Jersey Transportation Fact Book 2006-07 presents information about the New Jersey Department of Transportation : and other agencies that provide transportation services in New Jersey. We hope it will prove helpful.

  4. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available ... Join the Cause alz.org >> Alzheimer's & Dementia >> Home Text size: A A A 2018 Alzheimer's Disease Facts and Figures Download the full report: Download the Infographic: English Spanish Share the ...

  5. Clean Coal Technology Programs: Program Update 2009

    Energy Technology Data Exchange (ETDEWEB)

    None

    2009-10-01

    The purpose of the Clean Coal Technology Programs: Program Update 2009 is to provide an updated status of the U.S. Department of Energy (DOE) commercial-scale demonstrations of clean coal technologies (CCT). These demonstrations have been performed under the Clean Coal Technology Demonstration Program (CCTDP), the Power Plant Improvement Initiative (PPII), and the Clean Coal Power Initiative (CCPI). Program Update 2009 provides: (1) a discussion of the role of clean coal technology demonstrations in improving the nation’s energy security and reliability, while protecting the environment using the nation’s most abundant energy resource—coal; (2) a summary of the funding and costs of the demonstrations; and (3) an overview of the technologies being demonstrated, along with fact sheets for projects that are active, recently completed, or recently discontinued.

  6. Dental Health: The Basic Facts

    Science.gov (United States)

    Dental Health THE BASIC FACTS MULTIPLE SCLEROSIS Kim, diagnosed in 1986 People with a chronic disease may neglect their general health and wellness, research shows. Dental care is no exception. A tendency to focus ...

  7. 2008 public transportation fact book

    Science.gov (United States)

    2008-06-01

    This Public Transportation Fact Book presents statistics describing the entire United States transit industry for 1995 : through 2006 with additional detail and overview presentations for 2006. Also included are definitions of reported data : items.

  8. 2010 public transportation fact book

    Science.gov (United States)

    2010-04-01

    The Public Transportation Fact Book, published annually, contains national aggregate statistical data covering all aspects of the transit industry in the United States and Canada. Two appendices, also available, provide additional in-depth informatio...

  9. Facts about Jaundice and Kernicterus

    Science.gov (United States)

    ... Search Form Controls Cancel Submit Search the CDC Jaundice & Kernicterus Note: Javascript is disabled or is not ... Websites Information For… Media Policy Makers Facts about Jaundice and Kernicterus Recommend on Facebook Tweet Share Compartir ...

  10. Back Pain Facts and Statistics

    Science.gov (United States)

    ... Marketing Patient Fact Sheets Contact the ACA State Licensing Boards Research JMPT Abstracts Latest Issue Evidence in ... Chiropractic Posture Backpack Safety Spinal Health Winter Activities Kids and Sports Exercising Outdoors with Baby Gardening Chronic ...

  11. Definition and Facts for Constipation

    Science.gov (United States)

    ... Causes Diagnosis Treatment Eating, Diet, & Nutrition Clinical Trials Definition & Facts for Constipation What is constipation? Constipation is ... and Treatment. New York, NY: Springer Science and Business Media; 2014. May 2018 Share Previous: Constipation Next: ...

  12. Chemical Agents: Facts about Evacuation

    Science.gov (United States)

    ... What CDC is Doing Blog: Public Health Matters Chemical Agents: Facts About Evacuation Format: Select One PDF [ ... on Facebook Tweet Share Compartir Some kinds of chemical accidents or attacks, such as a train derailment ...

  13. Alzheimer's Disease Facts and Figures

    Science.gov (United States)

    ... Dementia >> Home Text size: A A A 2018 Alzheimer's Disease Facts and Figures Download the full report: ... twice as high. Invest in a world without Alzheimer's. Donate Caregivers Eighty-three percent of the help ...

  14. State Fact Sheets on COPD

    Science.gov (United States)

    ... Submit Search The CDC Chronic Obstructive Pulmonary Disease (COPD) Note: Javascript is disabled or is not supported ... message, please visit this page: About CDC.gov . COPD Homepage Data and Statistics Fact Sheets Publications Publications ...

  15. Program evaluation

    Energy Technology Data Exchange (ETDEWEB)

    1988-01-01

    This book contains the proceedings from the panel on program evaluation. Some of the papers included are the following: Seattle City Light's Industrial Retrofit Demonstration Project Uses Quasi-Experimental Research Design and Metering to Measure Savings, Evaluation for PUCs, and The Takeback Effect Low-income Weatherizations Fact or Fiction

  16. Enriching Addition and Subtraction Fact Mastery through Games

    Science.gov (United States)

    Bay-Williams, Jennifer M.; Kling, Gina

    2014-01-01

    The learning of "basic facts"--single-digit combinations for addition, subtraction, multiplication, and division--has long been a focus of elementary school mathematics. Many people remember completing endless worksheets, timed tests, and flash card drills as they attempted to "master" their basic facts as children. However,…

  17. Type 1 Diabetes Facts

    Science.gov (United States)

    ... Affiliates JDRF Celebrity Ambassadors JDRF Logo Usage Contact Us Donate Events More Type 1 Diabetes Facts Type 1 diabetes (T1D) is an autoimmune ... about Insulin and T1D Learn More What Is Diabetes? Causes of T1D The Complexity of Diagnosing ... US CAREERS NEWSROOM FOR RESEARCHERS © JDRF 2018 • Privacy Policy • ...

  18. DER 86: main facts

    International Nuclear Information System (INIS)

    1987-01-01

    This report presents the important facts among the studies carried out by the Direction des Etudes et Recherches (E.D.F.): new applications of electric power for customers, protection of environment, classical equipments for power plants and nuclear equipments, monitoring and control of power plants, electrical equipments, development and operation of electrical networks, informatics and office automation [fr

  19. Gun Sales. Firearm Facts.

    Science.gov (United States)

    Duker, Laurie, Ed.

    Minimal federal regulations on firearm sales have facilitated the proliferation of guns, gun owners, and gun dealers in the United States. This fact sheet offers data on the growing number of firearm dealers, the relative ease of obtaining and keeping a license to sell guns from the Federal Bureau of Alcohol, Tobacco, and Firearms, the lack of…

  20. Filtering Dialysis Myths from Facts

    Science.gov (United States)

    ... to work. Fact: Many dialysis patients continue to work, go to school, or volunteer . Some take time off when they first start dialysis treatment and back to work or school after they have gotten used to ...

  1. Tuberculosis Facts - Exposure to TB

    Science.gov (United States)

    Tuberculosis (TB) Facts Exposure to TB What is TB? “TB” is short for a disease called tuberculosis. TB is spread through the air from one ... Viral Hepatitis, STD, and TB Prevention Division of Tuberculosis Elimination

  2. Tuberculosis Facts - Testing for TB

    Science.gov (United States)

    Tuberculosis (TB) Facts Testing for TB What is TB? “TB” is short for a disease called tuberculosis. TB is spread through the air from one ... Viral Hepatitis, STD, and TB Prevention Division of Tuberculosis Elimination

  3. Facts about food irradiation. A series of fact sheets from the International Consultative Group on Food Irradiation

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1991-12-01

    The safety and benefits of foods processed by ionizing radiation are well documented. In an effort to provide governments, especially those of developing countries, with scientifically accurate information on issues of general interest to the public, the International Consultative Group on Food Irradiation (ICGFI), which was established under the aegis of the Food and Agriculture Organization of the United Nations (FAO), the World Health Organization (WHO), and the IAEA, decided at its 7th Annual Meeting in Rome, Italy, on October 1990, to issue a series of ''Fact Sheets'' on the subject. ICGFI, an inter-governmental body with a membership of 37 governments, has as one of its mandates the function to provide information to Member States of the FAO, WHO, and IAEA and to the three organizations themselves on the safe and proper use of food irradiation technology. The Fact Sheets included here cover issues relating to: status and trends; scientific and technical terms; food irradiation and radioactivity; chemical changes in irradiated food; nutritional quality of irradiated foods; genetic studies; microbiological safety of irradiated food; irradiation and food safety; irradiation and food additives and residues; packaging of irradiated foods; safety of irradiation facilities; controlling the process; food irradiation costs; and irradiated foods and the consumer. The Fact Sheets have been separately indexed and included in the INIS Database under Reference Numbers 23011206-23011217, 23011319 and 23012743. The Fact Sheets were first issued by the ICGFI Secretariat (Joint FAO/IAEA Division of Nuclear Techniques in Food and Agriculture, Vienna, Austria) in May 1991.

  4. Facts about food irradiation. A series of fact sheets from the International Consultative Group on Food Irradiation

    International Nuclear Information System (INIS)

    1991-12-01

    The safety and benefits of foods processed by ionizing radiation are well documented. In an effort to provide governments, especially those of developing countries, with scientifically accurate information on issues of general interest to the public, the International Consultative Group on Food Irradiation (ICGFI), which was established under the aegis of the Food and Agriculture Organization of the United Nations (FAO), the World Health Organization (WHO), and the IAEA, decided at its 7th Annual Meeting in Rome, Italy, on October 1990, to issue a series of ''Fact Sheets'' on the subject. ICGFI, an inter-governmental body with a membership of 37 governments, has as one of its mandates the function to provide information to Member States of the FAO, WHO, and IAEA and to the three organizations themselves on the safe and proper use of food irradiation technology. The Fact Sheets included here cover issues relating to: status and trends; scientific and technical terms; food irradiation and radioactivity; chemical changes in irradiated food; nutritional quality of irradiated foods; genetic studies; microbiological safety of irradiated food; irradiation and food safety; irradiation and food additives and residues; packaging of irradiated foods; safety of irradiation facilities; controlling the process; food irradiation costs; and irradiated foods and the consumer. The Fact Sheets have been separately indexed and included in the INIS Database under Reference Numbers 23011206-23011217, 23011319 and 23012743. The Fact Sheets were first issued by the ICGFI Secretariat (Joint FAO/IAEA Division of Nuclear Techniques in Food and Agriculture, Vienna, Austria) in May 1991

  5. Publication bias and the canonization of false facts

    DEFF Research Database (Denmark)

    Nissen, Silas Boye; Magidson, Tali; Gross, Kevin

    2016-01-01

    canonized as fact. Data-dredging, p-hacking, and similar behaviors exacerbate the problem. Should negative results become easier to publish as a claim approaches acceptance as a fact, however, true and false claims would be more readily distinguished. To the degree that the model reflects the real world...

  6. 50 Facts about Oral, Head and Neck Cancer

    Science.gov (United States)

    ... Marketplace Find an ENT Doctor Near You 50 Facts about Oral, Head and Neck Cancer 50 Facts about Oral, Head and Neck Cancer Patient Health ... cancer has increased in all races and both sexes. Thyroid cancers account for ... who work in environments with dust, glues, formaldehyde, mustard gas, ...

  7. 75 FR 55340 - Recovery Fact Sheet 9580.100, Mold Remediation

    Science.gov (United States)

    2010-09-10

    ...] Recovery Fact Sheet 9580.100, Mold Remediation AGENCY: Federal Emergency Management Agency, DHS. ACTION... accepting comments on Recovery Fact Sheet RP9580.100, Mold Remediation. DATES: Comments must be received by... 20472-3100. II. Background The Recovery Fact Sheet RP9580.100, Mold Remediation, identifies the expenses...

  8. Optimal placement of FACTS devices using optimization techniques: A review

    Science.gov (United States)

    Gaur, Dipesh; Mathew, Lini

    2018-03-01

    Modern power system is dealt with overloading problem especially transmission network which works on their maximum limit. Today’s power system network tends to become unstable and prone to collapse due to disturbances. Flexible AC Transmission system (FACTS) provides solution to problems like line overloading, voltage stability, losses, power flow etc. FACTS can play important role in improving static and dynamic performance of power system. FACTS devices need high initial investment. Therefore, FACTS location, type and their rating are vital and should be optimized to place in the network for maximum benefit. In this paper, different optimization methods like Particle Swarm Optimization (PSO), Genetic Algorithm (GA) etc. are discussed and compared for optimal location, type and rating of devices. FACTS devices such as Thyristor Controlled Series Compensator (TCSC), Static Var Compensator (SVC) and Static Synchronous Compensator (STATCOM) are considered here. Mentioned FACTS controllers effects on different IEEE bus network parameters like generation cost, active power loss, voltage stability etc. have been analyzed and compared among the devices.

  9. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available ... 2018 Alzheimer's Disease Facts and Figures report contains data on the impact of this disease in every ... with third parties. Please read our security and privacy policy . Plan ahead Get help and support I ...

  10. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available ... home care. Take action. Become an advocate SPECIAL REPORT: FINANCIAL AND PERSONAL BENEFITS OF EARLY DIAGNOSIS Early ... State The 2018 Alzheimer's Disease Facts and Figures report contains data on the impact of this disease ...

  11. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available ... 272.3900 Donate Alzheimer's & Dementia What Is Alzheimer's? Brain Tour Younger/Early Onset Risk Factors Genetics Myths ... Dementia Korsakoff Syndrome Related Conditions CTE MCI Traumatic Brain Injury Facts and Figures Know the 10 Signs ...

  12. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available ... Dementia >> Home Text size: A A A 2018 Alzheimer's Disease Facts and Figures Download the full report: ... twice as high. Invest in a world without Alzheimer's. Donate Caregivers Eighty-three percent of the help ...

  13. Chernobyl: the facts

    International Nuclear Information System (INIS)

    Stanbridge, R.; Dept. of Journalism, Media and Communication Studies)

    1993-01-01

    In these Search Strategies, searchers from different countries and professions are given a question to answer, a budget of Pounds 50 and a time in which to produce their report. We hope that these blow-by-blow accounts, together with the hints and tips picked up along the way, will help readers to develop their own search strategies. Journalists are more and more coming to use online services and here the author gives a journalist's account of tracking down the elusive facts surrounding the Chernobyl disaster. (author)

  14. Teaching English as A Foreign Language at Madrasah Ibtidaiyyah: Facts and Challenges

    Directory of Open Access Journals (Sweden)

    Wakhid Nashruddin

    2015-06-01

    Full Text Available The mastery of English as a tool of communication among nations, cultures, and people around the globe is an undeniable fact. This is just like an unstoppable virus spreading worldwide. It is rather difficult to emerge new languages to stop or even just to slow down the wide use of English. Islam world also needs to follow this by equipping its people with English as a communication tool. As Arabic is used for the communication inside Islam, English is needed to communicate Islam to other people around the earth both to Muslims or Non-Muslims. Teaching English has become an increasingly significant element in Islamic education. For this, the issue of teaching English at madrasah is an important concern for practitioners in the area of TEFL in Islamic institutions. This paper will explore the writer’s ten-year experience in teaching English at a madrasah ibtidaiyyah in Cirebon, West Java-Indonesia. The conditions that will be pictured are the culture, the students, the teaching and learning process, and the outcome of the current practices in madrasah ibtidaiyyah, mainly in the area of TEFL. Then, all these conditions will be contrasted to up to date research findings and theories so that the facts and the challenges can be clearly seen. This will also be seen from the perspective of current curriculum in Indonesia, namely curriculum 2013, which bears contradictions with the presence of it. In fact, the curriculum 2013 eliminates English as a subject learned at primary school level. What madrasah ibtidaiyyah will do in the next coming years can direct the expected outcome of the teaching of English at this level. Kinds of program that can be designed to empower the state of English mastery are an essential case to discuss. This all facts and challenges can provide insights so that people working in and with madrasah ibtidaiyyah understand and are ready to face the global communication era.

  15. Darwinism Defined: The Difference Between Fact and Theory.

    Science.gov (United States)

    Gould, Stephen Jay

    1987-01-01

    Discusses various developments in both science and theology following the work of Charles Darwin on evolution. Differentiates between the facts regarding evolution and the theory of natural selection as a mechanism for evolutionary change. Warns that the differences between facts and theory have not been adequately emphasized by scientists. (TW)

  16. 2012 Swimming Season Fact Sheets

    Science.gov (United States)

    To help beachgoers make informed decisions about swimming at U.S. beaches, EPA annually publishes state-by-state data about beach closings and advisories for the previous year's swimming season. These fact sheets summarize that information by state.

  17. Are Stabilization Programs Expansionary?

    OpenAIRE

    Federico Echenique; Alvaro Forteza

    1997-01-01

    The empirical evidence presented in this paper casts serious doubts on the by now widely accepted "stylized facts" of the exchange rate based stabilization programs (ERBS) as they are stated in Kiguel and Liviatan (1992) and in Végh (1992). Even though the ERBS programs were associated with output booms, no evidence of booms provoked by the stabilization programs is found. Rather, exogenous capital inflows to Latin America seem to have caused both the output booms and the stabilization progra...

  18. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available ... health and long-term care costs. worried about memory loss? KNOW THE 10 SIGNS Alzheimer's Disease Facts ... Copyright © 2018 Alzheimer's Association ® . All rights reserved. Our vision is a world without Alzheimer's Formed in 1980, ...

  19. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available ... health and long-term care costs. worried about memory loss? KNOW THE 10 SIGNS Alzheimer's Disease Facts ... is a not-for-profit 501(c)(3) organization. Copyright © 2018 Alzheimer's Association ® . All rights reserved. Our ...

  20. The Accountability Turn in Third Wave Human Rights Fact-Finding

    Directory of Open Access Journals (Sweden)

    Federica D'Alessandra

    2017-04-01

    Full Text Available Whereas the characteristics of human rights fact-finding largely vary depending on the typology and scope of the entity that carries it out, consensus seems to be developing that a common set of challenges to human rights fact-finding exists. This is especially so when carried out under United Nations auspices. For example, it has long been acknowledged that the very nature of the institution, sitting as it does at the crossroads of international politics, as well as the seemingly irresolvable tension between calls for human rights protection on the one hand, and State sovereignty on the other, present some structural challenges to human rights fact-finding. Furthermore, issues of coordination between the United Nations and other institutions (such as international governmental and non-governmental organisations, or international tribunals, as well as what some have called a ‘lack of institutional memory’ arguably often feature as regular traits among fact-finding mechanisms. In recent years, a further set of challenges has been added to the mix by additional requirements, featuring increasingly often in mandates, that instruct fact-finding mechanisms to make further determinations of facts (concerning, 'e.g.', the identity of those most responsible for the violations being documented, or the existence of an armed conflict and even consider questions of law ('e.g.' the qualification of the violations as crimes under international law. Building on an expanding body of scholarship on the subject, as well as the author’s own experience with fact-finding efforts sitting at the intersection between traditional international human rights law and international criminal justice, this article argues: (i that human rights fact-finding has evolved in three waves; (ii that the third wave of human rights fact-finding is characterised by an “accountability turn”; and that (iii this turn has brought about an additional set of challenges to the

  1. The legitimating fact in the transcendental deduction of the categories: on Dieter Henrich's reading of Kant

    Directory of Open Access Journals (Sweden)

    Christian Klotz

    Full Text Available This article reconstructs the principal moments of Dieter Henrich's work on Immanuel Kant's theoretical philosophy. Henrich seeks to clarify and regain the fundaments of Kant's theory of knowledge - from which his followers, according to him, have distanced themselves - based on the analysis of the "transcendental deduction of the categories". Firstly, Henrich investigates the proof structure of deduction, comparing the first and the second edition of Critique of Pure Reason. Secondly, he investigates, in the Kantian argument, the relationship between the identity principle of self-consciousness and objectivity. Finally, extending the comparison to Critique of Practical Reason, Henrich elucidates the program and methodology in deduction, showing that the idea of a legitimating fact, borrowed from the juridical notion of a deduction, becomes the fundamental element. We analyse the problems raised by the conception of a philosophical argument based on fundamental "facts".

  2. FACT. Energy spectrum of the Crab Nebula

    Energy Technology Data Exchange (ETDEWEB)

    Temme, Fabian; Einecke, Sabrina; Buss, Jens [TU Dortmund, Experimental Physics 5, Otto-Hahn-Str.4, 44221 Dortmund (Germany); Collaboration: FACT-Collaboration

    2016-07-01

    The First G-APD Cherenkov Telescope is the first Imaging Air Cherenkov Telescope which uses silicon photon detectors (G-APDs aka SiPM) as photo sensors. With more than four years of operation, FACT proved an application of SiPMs is suitable for the field of ground-based gamma-ray astronomy. Due to the stable flux at TeV energies, the Crab Nebula is handled as a ''standard candle'' in Cherenkov astronomy. The analysis of its energy spectrum and comparison with other experiments, allows to evaluate the performance of FACT. A modern analysis chain, based on data stream handling and multivariate analysis methods was developed in close cooperation with the department of computer science at the TU Dortmund. In this talk, this analysis chain and its application are presented. Further to this, results, including the energy spectrum of the Crab Nebula, measured with FACT, are shown.

  3. AutoFACT: An Automatic Functional Annotation and Classification Tool

    Directory of Open Access Journals (Sweden)

    Lang B Franz

    2005-06-01

    Full Text Available Abstract Background Assignment of function to new molecular sequence data is an essential step in genomics projects. The usual process involves similarity searches of a given sequence against one or more databases, an arduous process for large datasets. Results We present AutoFACT, a fully automated and customizable annotation tool that assigns biologically informative functions to a sequence. Key features of this tool are that it (1 analyzes nucleotide and protein sequence data; (2 determines the most informative functional description by combining multiple BLAST reports from several user-selected databases; (3 assigns putative metabolic pathways, functional classes, enzyme classes, GeneOntology terms and locus names; and (4 generates output in HTML, text and GFF formats for the user's convenience. We have compared AutoFACT to four well-established annotation pipelines. The error rate of functional annotation is estimated to be only between 1–2%. Comparison of AutoFACT to the traditional top-BLAST-hit annotation method shows that our procedure increases the number of functionally informative annotations by approximately 50%. Conclusion AutoFACT will serve as a useful annotation tool for smaller sequencing groups lacking dedicated bioinformatics staff. It is implemented in PERL and runs on LINUX/UNIX platforms. AutoFACT is available at http://megasun.bch.umontreal.ca/Software/AutoFACT.htm.

  4. Facts about Tetralogy of Fallot

    Science.gov (United States)

    ... Websites Information For… Media Policy Makers Facts about Tetralogy of Fallot Language: English (US) Español (Spanish) Recommend on Facebook ... in the mother’s womb during pregnancy. What is Tetralogy of Fallot? Tetralogy of Fallot is made up of the ...

  5. Related Fact Checks: a tool for combating fake news

    OpenAIRE

    Guha, Sreya

    2017-01-01

    The emergence of "Fake News" and misinformation via online news and social media has spurred an interest in computational tools to combat this phenomenon. In this paper we present a new "Related Fact Checks" service, which can help a reader critically evaluate an article and make a judgment on its veracity by bringing up fact checks that are relevant to the article. We describe the core technical problems that need to be solved in building a "Related Fact Checks" service, and present results ...

  6. Myths and Facts about SIDS and Safe Infant Sleep

    Science.gov (United States)

    ... Myths and Facts About SIDS and Safe Infant Sleep Page Content Myth: Babies can “catch” SIDS. Fact: ... sleep environment for your baby. Myth: Babies who sleep on their backs will choke if they spit ...

  7. MIT Lincoln Laboratory Facts 2013

    Science.gov (United States)

    2012-12-01

    creativity . Representative Technical Positions ■■ Aerospace engineer ■■ Applications engineer ■■ Bioengineer ■■ Biologist 16 Facts 2012–2013...schedules, part-time employment, and telecommuting opportunities. Child Care The Technology Children’s Center facility in Lexington (TCC Lincoln

  8. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available ... and support I have Alzheimer's I am a caregiver I am a care professional I am a physician I am a researcher Message boards Get the facts 10 warning signs & symptoms What is dementia What is Alzheimer's 7 stages of ...

  9. FACT — LONGTERM MONITORING OF BRIGHT TeV BLAZARS

    Directory of Open Access Journals (Sweden)

    Katja Meier

    2014-06-01

    Full Text Available The First G-APD Cherenkov Telescope (FACT, located on the Canary Island of La Palma, has been taking data since October 2011. FACT has been optimized for longterm monitoring of bright TeV blazars, to study their variability time scales and flare probability. G-APD photo-sensors allow for observations even under strong moonlight conditions, and the telescope can be operated remotely. The monitoring strategy of FACT is discussed and preliminary results of the flare of Mrk501 in June 2012 are shown.

  10. Considering FACTS in Optimal Transmission Expansion Planning

    Directory of Open Access Journals (Sweden)

    K. Soleimani

    2017-10-01

    Full Text Available The expansion of power transmission systems is an important part of the expansion of power systems that requires enormous investment costs. Since the construction of new transmission lines is very expensive, it is necessary to choose the most efficient expansion plan that ensures system security with a minimal number of new lines. In this paper, the role of Flexible AC Transmission System (FACTS devices in the effective operation and expansion planning of transmission systems is examined. Effort was taken to implement a method based on sensitivity analysis to select the optimal number and location of FACTS devices, lines and other elements of the transmission system. Using this method, the transmission expansion plan for a 9 and a 39 bus power system was performed with and without the presence of FACTS with the use of DPL environment in Digsilent software 15.1. Results show that the use of these devices reduces the need for new transmission lines and minimizes the investment cost.

  11. Norms and facts in measurement

    NARCIS (Netherlands)

    Brakel, J. van

    1984-01-01

    Publications concerned with the foundations of measurement often accept uncritically the theory/observation and the norm/fact distinction. However, measurement is measurement-in-a-context. This is analysed in the first part of the paper. Important aspects of this context are: the purpose of the

  12. Autism: General Information. Fact Sheet Number 1 = Autismo: Informacion General. Fact Sheet Number 22.

    Science.gov (United States)

    Interstate Research Associates, McLean, VA.

    This fact sheet on autism is offered in both English and Spanish, and is the same in both languages although numbered differently. It provides a definition, information on incidence, typical characteristics, and educational implications. It notes that autism is listed as a separate category under the Individuals with Disabilities Education Act.…

  13. Social constructivism and positive epistemology: On establishing of scientific facts

    Directory of Open Access Journals (Sweden)

    Brdar Milan

    2009-01-01

    Full Text Available In this article author is dealing with the problem of genesis and establishing of scientific fact. In the first part is given philosophical treatment of the problem and its futility, for the reason given in Minhausen trilema as a conclusion of this kind of treatment. Second part of the article contains the review of Ludvik Fleck's positive epistemology and of social constructivism. After the short historical review of the roots of social constructivism in the Mannheim's sociology of knowledge, author describes how it goes with erstablishing of scientific fact. Solution is set forth by elaboration of triad physis-nomos-logos within the constitutive elements of society known as authority-institution-reason-discourse. Author's concluding thesis claims that there is no fact without convention, i.e. that nature and scientific fact are connected by institution (scientific or social. It does not mean that there is no sound established facts but that obstacle toward it is provided just with institutional mediation that make condition of possibility of very truth. Therefore, the question: what among known facts are really truthful amounts to eternal problem of science and common sense in every epoch of history. .

  14. Comparação entre os valores teóricos para alguns dados espirométricos em crianças determinados pelas equações de Mallozi e de Polgar

    Directory of Open Access Journals (Sweden)

    LADOSKY WALDEMAR

    2002-01-01

    Full Text Available Objetivo: O presente trabalho dá prosseguimento ao estudo da validade de equações para valores teóricos (VT para cálculos espirométricos na população brasileira. Foi feita a comparação entre as equações propostas por Mallozzi (VT-M para população brasileira e as de Polgar (VT-P, utilizadas especialmente na Europa e Estados Unidos. Métodos: Foram analisados os VT medidos em 185 pacientes de ambos os sexos, com idade entre 6 e 17 anos, sendo 89 meninos e 96 meninas. Para cada paciente foi feito o cálculo do VT para CVF, VEF1 e FEF25-75 segundo as equações de Mallozi VT-M e de Polgar VT-P. Em seguida foram comparados os laudos obtidos por um e por outro, segundo o Consenso de Espirometria da SBPT. Resultados: O VT-M para CVF é 0,38% maior para os meninos e 2,19% para as meninas que o calculado segundo Polgar. Os VT-P para o VEF1 são 6,67% (p < 0,05 menores para as meninas e 7,26% para os meninos. Para o FEF25-75 os valores diferem apenas em 0,35 e 0,43% para cada um dos sexos, sem significância estatística. Conclusão: Os VTs de CVF e VEF1 para crianças brasileiras, avaliados segundo Mallozzi, diferem significativamente quanto aos VTs de Polgar. Como conseqüência, encontramos, utilizando as equações de Mallozzi, tendência maior em diagnosticar dificuldade obstrutiva e menor em achados de insuficiência ventilatória restritiva.

  15. Treatment planning and dose analysis for interstitial photodynamic therapy of prostate cancer

    Energy Technology Data Exchange (ETDEWEB)

    Davidson, Sean R H; Gertner, Mark R; Bogaards, Arjen; Sherar, Michael D; Wilson, Brian C [Division of Biophysics and Bioimaging, Ontario Cancer Institute, University Health Network, 610 University Avenue, Toronto, Ontario M5G 2M9 (Canada); Weersink, Robert A; Giewercer, David [Laboratory for Applied Biophysics, Ontario Cancer Institute, University Health Network, 610 University Avenue, Toronto, Ontario M5G 2M9 (Canada); Haider, Masoom A [Joint Department of Medical Imaging, University Health Network, 610 University Avenue, Toronto, Ontario M5G 2M9 (Canada); Scherz, Avigdor [Department of Plant Science, Weizmann Institute of Science, PO Box 26, Rehovot 76100 (Israel); Elhilali, Mostafa [Department of Surgery, McGill University, 3655 Promenade Sir William Osler, Montreal, Quebec H3G 1Y6 (Canada); Chin, Joseph L [Department of Oncology, University of Western Ontario, 800 Commissioners Road East, PO Box 5010, London, Ontario N6A 5W9 (Canada); Trachtenberg, John [Department of Urology, University Health Network, 610 University Avenue, Toronto, Ontario M5G 2M9 (Canada)], E-mail: wilson@uhnres.utoronto.ca

    2009-04-21

    With the development of new photosensitizers that are activated by light at longer wavelengths, interstitial photodynamic therapy (PDT) is emerging as a feasible alternative for the treatment of larger volumes of tissue. Described here is the application of PDT treatment planning software developed by our group to ensure complete coverage of larger, geometrically complex target volumes such as the prostate. In a phase II clinical trial of TOOKAD vascular targeted photodynamic therapy (VTP) for prostate cancer in patients who failed prior radiotherapy, the software was used to generate patient-specific treatment prescriptions for the number of treatment fibres, their lengths, their positions and the energy each delivered. The core of the software is a finite element solution to the light diffusion equation. Validation against in vivo light measurements indicated that the software could predict the location of an iso-fluence contour to within approximately {+-}2 mm. The same software was used to reconstruct the treatments that were actually delivered, thereby providing an analysis of the threshold light dose required for TOOKAD-VTP of the post-irradiated prostate. The threshold light dose for VTP-induced prostate damage, as measured one week post-treatment using contrast-enhanced MRI, was found to be highly heterogeneous, both within and between patients. The minimum light dose received by 90% of the prostate, D{sub 90}, was determined from each patient's dose-volume histogram and compared to six-month sextant biopsy results. No patient with a D{sub 90} less than 23 J cm{sup -2} had complete biopsy response, while 8/13 (62%) of patients with a D{sub 90} greater than 23 J cm{sup -2} had negative biopsies at six months. The doses received by the urethra and the rectal wall were also investigated.

  16. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available ... get Alzheimer's disease were diagnosed in the mild cognitive impairment (MCI) stage — before dementia — it would collectively save $7 trillion to $7.9 trillion in health and long-term care costs. worried about memory loss? KNOW THE 10 SIGNS Alzheimer's Disease Facts ...

  17. Facts about Infectious Diseases (ID)

    Science.gov (United States)

    ... an ID Specialist? Facts about ID Pocketcard Infectious diseases are caused by microscopic organisms that penetrate the body’s natural ... from diseases such as AIDS or treatment of diseases such as cancer, may allow ... of contaminated food or water, bites from vectors such as ticks or mosquitoes ...

  18. FY2010 Annual Progress Report for Vehicle and Systems Simulation and Testing

    Energy Technology Data Exchange (ETDEWEB)

    Slezak, Lee [Office of Energy Efficiency and Renewable Energy (EERE), Washington, DC (United States)

    2011-01-15

    The VSST team evaluates the technologies and performance characteristics of advanced automotive powertrain components and subsystems in an integrated vehicle systems context, covering light to heavy platforms. This work is directed toward evaluating and verifying the targets of the VTP R&D teams and to provide guidance in establishing roadmaps for achievement of these goals.

  19. CERN Quick Facts 2017 (French version)

    CERN Multimedia

    Mobs, Esma

    2017-01-01

    Facts about CERN, the contributions of its Member States, its machines and experiments, the number of its employees and users, management structure, etc. Previously called "CERN General Information Sheet"

  20. CERN Quick Facts 2016 (French version)

    CERN Multimedia

    AUTHOR|(CDS)2070305

    2016-01-01

    Facts about CERN, the contributions of its Member States, its machines and experiments, the number of its employees and users, management structure, etc. Previously called "CERN General Information Sheet"

  1. CERN Quick Facts 2016 (English version)

    CERN Multimedia

    AUTHOR|(CDS)2070305

    2016-01-01

    Facts about CERN, the contributions of its Member States, its machines and experiments, the number of its employees and users, management structure, etc. Previously called "CERN General Information Sheet"

  2. CERN Quick Facts 2017 (English version)

    CERN Multimedia

    Mobs, Esma

    2017-01-01

    Facts about CERN, the contributions of its Member States, its machines and experiments, the number of its employees and users, management structure, etc. Previously called "CERN General Information Sheet"

  3. 75 FR 24740 - Recovery Fact Sheet RP9580.102, Permanent Relocation

    Science.gov (United States)

    2010-05-05

    ... DEPARTMENT OF HOMELAND SECURITY Federal Emergency Management Agency [Docket ID FEMA-2010-0028] Recovery Fact Sheet RP9580.102, Permanent Relocation AGENCY: Federal Emergency Management Agency, DHS... Management Agency (FEMA). DATES: This fact sheet is effective April 14, 2010. ADDRESSES: This final fact...

  4. An overview of solution methods for multi-objective mixed integer linear programming programs

    DEFF Research Database (Denmark)

    Andersen, Kim Allan; Stidsen, Thomas Riis

    Multiple objective mixed integer linear programming (MOMIP) problems are notoriously hard to solve to optimality, i.e. finding the complete set of non-dominated solutions. We will give an overview of existing methods. Among those are interactive methods, the two phases method and enumeration...... methods. In particular we will discuss the existing branch and bound approaches for solving multiple objective integer programming problems. Despite the fact that branch and bound methods has been applied successfully to integer programming problems with one criterion only a few attempts has been made...

  5. Faith, Fact, and Behaviorism.

    Science.gov (United States)

    Staddon, J E R

    2013-01-01

    David Hume argued that ought cannot be derived from is . That is, no set of facts, no amount of scientific knowledge, is by itself sufficient to urge us to action. Yet generations of well-meaning scientists (more and more as secular influences grow in the West) seem to have forgotten Hume's words of wisdom. All motivated action depends ultimately on beliefs that cannot be proved by the methods of science, that is, on faith.

  6. Biomolecular Science (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    2012-04-01

    A brief fact sheet about NREL Photobiology and Biomolecular Science. The research goal of NREL's Biomolecular Science is to enable cost-competitive advanced lignocellulosic biofuels production by understanding the science critical for overcoming biomass recalcitrance and developing new product and product intermediate pathways. NREL's Photobiology focuses on understanding the capture of solar energy in photosynthetic systems and its use in converting carbon dioxide and water directly into hydrogen and advanced biofuels.

  7. Location of facts devices from a dynamic perspective; Ubicacion de dispositivos FACTS desde una perspectiva dinamica

    Energy Technology Data Exchange (ETDEWEB)

    Coronado Gallegos, Ixtlahuatl

    2001-09-15

    In this work techniques for the location of FACTS devices (Flexible Systems of AC Transmission) in a multi-machine power system in order to improve the electromechanical transient behavior is presented. In the first part, a brief introduction is presented about the FACTS devices, in which are mentioned some of the main characteristics, classification and advantages that their utilization represents. In the next part, the formulation of the matrix of state in the context of machine-infinite bar considering the possibility of including a power system stabilizer is developed. Later the formulation is extended to a multi-machine system. Additionally the form of including a series capacitor controlled by thyristors (TCSC) as well as a unified controller of power flows (UPFC) is analyzed. An analysis of the UPFC is carried out in conditions of stationary and dynamic state in a system machine-infinite bar in order to know its operating characteristics and its capacity for dampening power oscillations through its entrances of control when using local signals. In the last part of the work a methodology is proposed to attack the problem of the location of FACTS devices, which is based in the technique of response to the system frequency. In order to validate this proposal some cases of study are used and the results obtained with the ones provided by other techniques are compared. Also some auxiliary means are proposed for obtaining the feasible locations utilizing other mathematical tools such as the singular values and the sensitivities. Finally, simulations in the time are carried out to corroborate the results obtained. [Spanish] En este trabajo se presentan tecnicas para la localizacion de dispositivos FACTS (Sistemas Flexibles de Transmision de C.A) en un sistema de potencia multimaquinas a fin de mejorar el comportamiento transitorio electromecanico. En la primera parte se presenta una breve introduccion acerca de los dispositivos FACTS, en la cual se mencionan

  8. Nanotechnology for Site Remediation: Fact Sheet

    Science.gov (United States)

    This fact sheet presents a snapshot of nanotechnology and its current uses in remediation. It presents information to help site project managers understand the potential applications of this group of technologies at their sites.

  9. HIV and AIDS: Know the Facts

    Science.gov (United States)

    ... Special Issues Subscribe June 2015 Print this issue HIV and AIDS: Know the Facts Treatments Work, but ... Biological Blueprints Wise Choices Should You Get an HIV Test? HIV tests involve a simple cheek swab, ...

  10. HIV/AIDS Clinical Trials Fact Sheet

    Science.gov (United States)

    ... AIDS Drugs Clinical Trials Apps skip to content HIV Overview Home Understanding HIV/AIDS Fact Sheets HIV/ ... 4 p.m. ET) Send us an email HIV/AIDS Clinical Trials Last Reviewed: August 25, 2017 ...

  11. Epilepsy: General Information. Fact Sheet Number 6 = La Epilepsia: Informacion General. Fact Sheet Number 20.

    Science.gov (United States)

    Interstate Research Associates, McLean, VA.

    This fact sheet on epilepsy is offered in both English and Spanish. It provides a definition, information on incidence, typical characteristics, and educational implications. It notes that epilepsy is classified as "other health impaired" under the Individuals with Disabilities Education Act and that students with epilepsy are eligible for special…

  12. Depth of Information Processing and Memory for Medical Facts.

    Science.gov (United States)

    Slade, Peter D.; Onion, Carl W. R.

    1995-01-01

    The current emphasis in medical education is on engaging learners in deep processing of information to achieve better understanding of the subject matter. Traditional approaches aimed for memorization of medical facts; however, a good memory for medical facts is still essential in clinical practice. This study demonstrates that deep information…

  13. Creutzfeldt-Jakob Disease Fact Sheet for Healthcare Workers and Morticians

    Science.gov (United States)

    ... here Home » Disorders » Patient & Caregiver Education » Fact Sheets Creutzfeldt-Jakob Disease Fact Sheet for Healthcare Workers and Morticians Creutzfeldt-Jakob disease (CJD) is a rare, fatal brain disorder that ...

  14. NASA Facts, The Viking Mission.

    Science.gov (United States)

    National Aeronautics and Space Administration, Washington, DC. Educational Programs Div.

    Presented is one of a series of publications of National Aeronautics and Space Administration (NASA) facts about the exploration of Mars. The Viking mission to Mars, consisting of two unmanned NASA spacecraft launched in August and September, 1975, is described. A description of the spacecraft and their paths is given. A diagram identifying the…

  15. Key Facts about Seasonal Flu Vaccine

    Science.gov (United States)

    ... Swine Variant Pandemic Other Key Facts About Seasonal Flu Vaccine Language: English (US) Español Recommend on Facebook ... the flu is to get vaccinated each year. Flu Vaccination Why should people get vaccinated against the ...

  16. A role for FACT in repopulation of nucleosomes at inducible genes.

    Directory of Open Access Journals (Sweden)

    Warren P Voth

    Full Text Available Xenobiotic drugs induce Pleiotropic Drug Resistance (PDR genes via the orthologous Pdr1/Pdr3 transcription activators. We previously identified the Mediator transcription co-activator complex as a key target of Pdr1 orthologs and demonstrated that Pdr1 interacts directly with the Gal11/Med15 subunit of the Mediator complex. Based on an interaction between Pdr1 and the FACT complex, we show that strains with spt16 or pob3 mutations are sensitive to xenobiotic drugs and display diminished PDR gene induction. Although FACT acts during the activation of some genes by assisting in the nucleosomes eviction at promoters, PDR promoters already contain nucleosome-depleted regions (NDRs before induction. To determine the function of FACT at PDR genes, we examined the kinetics of RNA accumulation and changes in nucleosome occupancy following exposure to a xenobiotic drug in wild type and FACT mutant yeast strains. In the presence of normal FACT, PDR genes are transcribed within 5 minutes of xenobiotic stimulation and transcription returns to basal levels by 30-40 min. Nucleosomes are constitutively depleted in the promoter regions, are lost from the open reading frames during transcription, and the ORFs are wholly repopulated with nucleosomes as transcription ceases. While FACT mutations cause minor delays in activation of PDR genes, much more pronounced and significant defects in nucleosome repopulation in the ORFs are observed in FACT mutants upon transcription termination. FACT therefore has a major role in nucleosome redeposition following cessation of transcription at the PDR genes, the opposite of its better-known function in nucleosome disassembly.

  17. Tuberculosis Facts - TB and HIV/AIDS

    Science.gov (United States)

    Tuberculosis (TB) Facts TB and HIV/AIDS What is TB? “TB” is short for a disease called tuberculosis. TB is spread through the air from one ... Viral Hepatitis, STD, and TB Prevention Division of Tuberculosis Elimination

  18. Youth Violence: Facts at a Glance

    Science.gov (United States)

    Youth Violence Facts at a Glance 2016 Yout h Vi olence • In 2014, 4,300 young people ages 10 ... in combined medical and work loss costs. 1 Violence-related Behaviors In a 2015 nationally-representative sample ...

  19. Case Management for Individuals with Mental Retardation. ARC Facts.

    Science.gov (United States)

    Association for Retarded Citizens, Arlington, TX.

    A question-and-answer format is used in this fact sheet to provide information on case management for individuals with mental retardation. The fact sheet describes the major components of a case management system, the role of the case manager, the individual's or family's role in case management, providers of case management services and systems…

  20. Assessing the FACTS at Kayenta

    Energy Technology Data Exchange (ETDEWEB)

    Pereira, M.; Renz, K.; Unterla, F. (Siemens AG Unternehmensbereich KWU, Erlangen (Germany))

    1993-12-01

    The world's first advanced series compensator with controllable series impedance as a flexible AC transmission (FACTS) device has been introduced at Western Area Power Administration's Kayenta substation in Arizona, USA. The system, which has been in operation for a year, allows existing transmission lines to carry up to 33 per cent more power. (author)

  1. Imitating manual curation of text-mined facts in biomedicine.

    Directory of Open Access Journals (Sweden)

    Raul Rodriguez-Esteban

    2006-09-01

    Full Text Available Text-mining algorithms make mistakes in extracting facts from natural-language texts. In biomedical applications, which rely on use of text-mined data, it is critical to assess the quality (the probability that the message is correctly extracted of individual facts--to resolve data conflicts and inconsistencies. Using a large set of almost 100,000 manually produced evaluations (most facts were independently reviewed more than once, producing independent evaluations, we implemented and tested a collection of algorithms that mimic human evaluation of facts provided by an automated information-extraction system. The performance of our best automated classifiers closely approached that of our human evaluators (ROC score close to 0.95. Our hypothesis is that, were we to use a larger number of human experts to evaluate any given sentence, we could implement an artificial-intelligence curator that would perform the classification job at least as accurately as an average individual human evaluator. We illustrated our analysis by visualizing the predicted accuracy of the text-mined relations involving the term cocaine.

  2. Stylized facts in social networks: Community-based static modeling

    Science.gov (United States)

    Jo, Hang-Hyun; Murase, Yohsuke; Török, János; Kertész, János; Kaski, Kimmo

    2018-06-01

    The past analyses of datasets of social networks have enabled us to make empirical findings of a number of aspects of human society, which are commonly featured as stylized facts of social networks, such as broad distributions of network quantities, existence of communities, assortative mixing, and intensity-topology correlations. Since the understanding of the structure of these complex social networks is far from complete, for deeper insight into human society more comprehensive datasets and modeling of the stylized facts are needed. Although the existing dynamical and static models can generate some stylized facts, here we take an alternative approach by devising a community-based static model with heterogeneous community sizes and larger communities having smaller link density and weight. With these few assumptions we are able to generate realistic social networks that show most stylized facts for a wide range of parameters, as demonstrated numerically and analytically. Since our community-based static model is simple to implement and easily scalable, it can be used as a reference system, benchmark, or testbed for further applications.

  3. Oxide fuel fabrication technology development of the FaCT project (1). Overall review of fuel technology development of the FaCT project

    International Nuclear Information System (INIS)

    Abe, Tomoyuki; Namekawa, Takashi; Tanaka, Kenya

    2011-01-01

    The FaCT project is in progress in Japan for the commercialization of fast reactor cycle system. The development goal of the fuel in the FaCT project is a low-decontaminated TRU homo-recycling in a closed cycle and extension in average discharge burn-up to 150 GWd/t. Research and development on innovative technologies concerning the short process, remote maintenance and cooling system of automatic fuel production equipments, long life cladding material and control of oxygen potential have been conducted in phase I of the FaCT project. As the result of various test including 600 g batch MOX tests, it is concluded that the short process is available to fuel pellet fabrication of the FaCT project. Although cold mock-up tests on test model of some typical process equipments suggest possibilities of remote maintenance of automatic fuel fabrication equipment, it is concluded that it still needs further efforts to judge the operability of the completely remote fabrication for low-decontaminated TRU fuel. A cold mock-up test on fuel pin assembling equipment show that influence of decay heat of MA can be managed by cooling system. Irradiation tests in BOR-60 indicate that 9Cr-ODS possess the satisfactory in-reactor performance as the long life cladding material if homogeneity of alloy element is adequately controlled. Modification of cladding tube fabrication process to ensure homogeneity and further development of measures to control oxygen potential inside the fuel pin are necessary to reach the burn-up target of the FaCT project. (author)

  4. Myths and Facts about Suicide from Individuals Involved in Suicide Prevention

    Science.gov (United States)

    Schurtz, David R.; Cerel, Julie; Rodgers, Philip

    2010-01-01

    Myth-busting, in which a so-called myth is presented and dispelled by facts, is used in suicide prevention gatekeeper trainings such as QPR. Evidence from other areas of public health shows this technique leads to memory for myths and not facts. An internet survey was used to determine if the "myths" and "facts" presented in QPR are endorsed as…

  5. Historical Review of the Transportation Analysis Fact of the Week, 1996-2017

    Energy Technology Data Exchange (ETDEWEB)

    Gohlke, David [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Davis, Stacy Cagle [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-10-01

    The Vehicle Technologies Office in the United States Department of Energy hosts a transportation analysis fact of the week on its webpage. As of October 2017, one thousand facts have been published since 1996. Examining the themes of published facts allows one to trace analytical trends determined to be of interest to the public over this time. The most popular themes addressed in the Fact of the Week were vehicle fuel economy, petroleum use and production, vehicle sales, and traveler behavior. Facts on vehicle electrification and advanced combustion technologies have been more popular in the last few years, showing their relevance to the Department of Energy mission.

  6. Photovoltaics Fact Sheet

    Energy Technology Data Exchange (ETDEWEB)

    None

    2016-02-01

    This fact sheet is an overview of the Photovoltaics (PV) subprogram at the U.S. Department of Energy SunShot Initiative. The U.S. Department of Energy (DOE)’s Solar Energy Technologies Office works with industry, academia, national laboratories, and other government agencies to advance solar PV, which is the direct conversion of sunlight into electricity by a semiconductor, in support of the goals of the SunShot Initiative. SunShot supports research and development to aggressively advance PV technology by improving efficiency and reliability and lowering manufacturing costs. SunShot’s PV portfolio spans work from early-stage solar cell research through technology commercialization, including work on materials, processes, and device structure and characterization techniques.

  7. FACT facilitates chromatin transcription by RNA polymerases I and III

    DEFF Research Database (Denmark)

    Birch, Joanna L; Tan, Bertrand C-M; Panov, Kostya I

    2009-01-01

    Efficient transcription elongation from a chromatin template requires RNA polymerases (Pols) to negotiate nucleosomes. Our biochemical analyses demonstrate that RNA Pol I can transcribe through nucleosome templates and that this requires structural rearrangement of the nucleosomal core particle....... The subunits of the histone chaperone FACT (facilitates chromatin transcription), SSRP1 and Spt16, co-purify and co-immunoprecipitate with mammalian Pol I complexes. In cells, SSRP1 is detectable at the rRNA gene repeats. Crucially, siRNA-mediated repression of FACT subunit expression in cells results...... in a significant reduction in 47S pre-rRNA levels, whereas synthesis of the first 40 nt of the rRNA is not affected, implying that FACT is important for Pol I transcription elongation through chromatin. FACT also associates with RNA Pol III complexes, is present at the chromatin of genes transcribed by Pol III...

  8. Clean Coal Technology Demonstration Program: Project fact sheets 2000, status as of June 30, 2000

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-09-01

    The Clean Coal Technology Demonstration Program (CCT Program), a model of government and industry cooperation, responds to the Department of Energy's (DOE) mission to foster a secure and reliable energy system that is environmentally and economically sustainable. The CCT Program represents an investment of over $5.2 billion in advanced coal-based technology, with industry and state governments providing an unprecedented 66 percent of the funding. With 26 of the 38 active projects having completed operations, the CCT Program has yielded clean coal technologies (CCTs) that are capable of meeting existing and emerging environmental regulations and competing in a deregulated electric power marketplace. The CCT Program is providing a portfolio of technologies that will assure that U.S. recoverable coal reserves of 274 billion tons can continue to supply the nation's energy needs economically and in an environmentally sound manner. As the nation embarks on a new millennium, many of the clean coal technologies have realized commercial application. Industry stands ready to respond to the energy and environmental demands of the 21st century, both domestically and internationally, For existing power plants, there are cost-effective environmental control devices to control sulfur dioxide (S02), nitrogen oxides (NO,), and particulate matter (PM). Also ready is a new generation of technologies that can produce electricity and other commodities, such as steam and synthetic gas, and provide efficiencies and environmental performance responsive to global climate change concerns. The CCT Program took a pollution prevention approach as well, demonstrating technologies that remove pollutants or their precursors from coal-based fuels before combustion. Finally, new technologies were introduced into the major coal-based industries, such as steel production, to enhance environmental performance. Thanks in part to the CCT Program, coal--abundant, secure, and economical

  9. Main facts 1995; Faits marquants 1995

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-11-01

    This report presents the main facts of the studies carried out by the Direction des Etudes et Recherches (DER) of Electricite de France: new applications of electricity, classical and nuclear thermal power plants, electrical equipment, environment protection, monitoring and plants operations.

  10. 16 CFR 460.15 - How installers must handle fact sheets.

    Science.gov (United States)

    2010-01-01

    ... ADVERTISING OF HOME INSULATION § 460.15 How installers must handle fact sheets. If you are an installer, you... from you, you must show them the fact sheet(s) for the type(s) of insulation they want. You can decide...

  11. Energy: facts and figures in 2006

    International Nuclear Information System (INIS)

    Lavergne, R.; Nanot, B.; Scherrer, S.; Paquel, V.; Louati, S.; Thienard, H.

    2007-01-01

    The consumption of final energy in France in 2006 increased slightly on the whole (+0.6%) and in all sectors except the industry (-0.7%). The final energy consumption is defined as the difference between the total consumption of primary energy and the consumption of the energy production sector. The evolution of the consumption of final energy is different according to the type of energy: +4.1% for coal (due to the strong demand in the iron and steel industry), +3.6% for renewable energies (due to specific development programs), +1.5% for electrical power and no change for oil and natural gas. Despite high prices, sales of car fuels rose by 0.4%, this figure hides the fact that the sales of fuels for diesel cars rose by 2.7% (because of the growing population of diesel cars) while those of grade petrol kept on plummeting (-5.9%). It is important to note that the releases of CO 2 due to energy went down by -1.4% in 2006. The energy bill increased by +18.5% to fetch 46.2*10 9 euros despite the decrease of the imported volumes. This articles details the energy figures for France in 2006 and sheds light particularly on 3 aspects: first, the annual trends in energy since 1973, secondly, the energy bill and thirdly the figures for electricity, natural gas, solid mineral fuels, hydrocarbons and renewable sources of energy. (A.C.)

  12. D.E.R. 91 main facts

    International Nuclear Information System (INIS)

    Schmidt, N.

    1991-01-01

    This report presents the main facts of the studies carried out by the Direction des Etudes et Recherches (DER) of Electricite de France: New applications of electricity, classical and nuclear thermal power plants, electrical equipment, environment protection, network analysis, information and informatic equipment

  13. D.E.R. 92 - Main facts

    International Nuclear Information System (INIS)

    1992-01-01

    This report presents the main facts of the studies carried out by the Direction des Etudes et Recherches (DER) of Electricite de France: new applications of electricity, classical and nuclear thermal power plants, electrical equipment, environment protection, network analysis, information and informatic equipment

  14. Physical Therapy and Occupational Therapy: Suggested Readings [and] Physical Therapy: Supply/Demand--Some Facts [and] Occupational Therapy: Supply and Demand--Some Facts. Information on Personnel Supply and Demand.

    Science.gov (United States)

    National Clearinghouse for Professions in Special Education, Reston, VA.

    Brought together are two fact sheets on the supply of and demand for physical therapists and occupational therapists. The fact sheets cite statistical data from the National Easter Seal Society, the American Physical Therapy Association, and the American Occupational Therapy Association. The cited facts focus on the need to recruit and retain…

  15. Water: Facts without Myths

    Directory of Open Access Journals (Sweden)

    Marc Henry

    2009-08-01

    Full Text Available Among all the chemical substances available in the universe, water, with its deceptively simple formula H2O, is the most discussed subject either in science or in philosophy [1]. If you are not convinced by this affirmation, a little experiment at no cost may help you change your mind. Just open your favorite web browser and type the word “water” in any search engine. When I have done that using Google, the number of hits was about 682,000,000 (please do not try to read all the pages. In fact, the only words that seem to beat water at this little game are “air” (770,000,000 hits with Google and 3,120,000,000 with Yahoo, and “food” (689,000,000 hits with Google and 3,820,000,000 with Yahoo. Of course this should not be a surprise, as breathing, eating, drinking just mean that you are a living entity. In fact extending the water search to “eau” (French, “wasser” (German, “agua” (Spanish, Portuguese and “acqua” (Italian leads to 978,900,000 hits under Google and 3,426,000,000 hits under Yahoo, showing now that water is about as important as food. After all, as everybody knows, “water is life”, and do we really have to read about one billion documents to know at least what water really is? [...

  16. A proposal for investment recovery of FACTS devices in deregulated electricity markets

    International Nuclear Information System (INIS)

    Mithulananthan, Nadarajah; Acharya, Naresh

    2007-01-01

    The paper presents a methodology to quantify the benefits, in terms of monetary values, of FACTS devices when used in deregulated electricity market for congestion management. The proposed methodology is used in the proposal for investment recovery of FACTS devices. Despite the long history of development and mature technology, the practical installations of FACTS devices are still limited. The main reasons for few installations are high investment cost and lack of viable measures to quantify the long list of benefits offered by FACTS device. In this respect, the methodology proposed in the paper provides a promising solution. The proposed methodology is based on establishing pricing schemes with and without FACTS devices using OPF formulation. The volume of market with FACTS devices and the increase in surplus due to them forms the basis of quantifying their benefits. The pricing scheme does not destroy the incentive effect in short run and also makes possible the provision of merchant FACTS. The proposed concept was tested and validated with TCSC in five-bus test system. Result shows that, when TCSC is used to relieve congestion in the system and the investment on TCSC can be recovered. (author)

  17. Florida Atlantic Coast Telemetry (FACT) Array: A Working Partnership

    Science.gov (United States)

    Scheidt, Douglas; Ault, Erick; Ellis, Robert D.; Gruber, Samuel; Iafrate, Joseph; Kalinowsky, Chris; Kessel, Steven; Reyier, Eric; Snyder, David; Watwood, Stephanie; hide

    2015-01-01

    The Florida Atlantic Coast Telemetry (FACT) Array is a collaborative partnership of researchers from 24 different organizations using passive acoustic telemetry to document site fidelity, habitat preferences, seasonal migration patterns, and reproductive strategies of valuable sportfish, sharks, and marine turtles. FACT partners have found that by bundling resources, they can leverage a smaller investment to track highly mobile animals beyond a study area typically restrained in scale by funds and manpower. FACT is guided by several simple rules: use of the same type of equipment, locate receivers in areas that are beneficial to all researchers when feasible, maintain strong scientific ethics by recognizing that detection data on any receiver belongs to the tag owner, do not use other members detection data without permission and acknowledge FACT in publications. Partners have access to a network of 480 receivers deployed along a continuum of habitats from freshwater rivers to offshore reefs and covers 1100 km of coastline from the Dry Tortugas, Florida to South Carolina and extends to the Bahamas. Presently, 49 species, (25 covered by Fisheries Management Plans and five covered by the Endangered Species Act) have been tagged with 2736 tags in which 1767 tags are still active.

  18. Fuels planning: science synthesis and integration; social issues fact sheet 02: Developing personal responsibility for fuels reduction: Types of information to encourage proactive behavior

    Science.gov (United States)

    Rocky Mountain Research Station USDA Forest Service

    2004-01-01

    Fuels management responsibilities may include providing local property owners with the information for taking responsibility for reducing fuels on their land. This fact sheet discusses three different types of information that may be useful in programs to engage property owners in fuel reduction activities.

  19. STREAM: A First Programming Process

    DEFF Research Database (Denmark)

    Caspersen, Michael Edelgaard; Kölling, Michael

    2009-01-01

    to derive a programming process, STREAM, designed specifically for novices. STREAM is a carefully down-scaled version of a full and rich agile software engineering process particularly suited for novices learning object-oriented programming. In using it we hope to achieve two things: to help novice......Programming is recognized as one of seven grand challenges in computing education. Decades of research have shown that the major problems novices experience are composition-based—they may know what the individual programming language constructs are, but they do not know how to put them together....... Despite this fact, textbooks, educational practice, and programming education research hardly address the issue of teaching the skills needed for systematic development of programs. We provide a conceptual framework for incremental program development, called Stepwise Improvement, which unifies best...

  20. Oil Notifications: Emergency Response Notification System (ERNS) fact sheet

    International Nuclear Information System (INIS)

    1992-04-01

    The Emergency Response Notification System (ERNS) is a national computer database which provides the only centralized mechanism for documenting and verifying incident notification information as initially reported to the National Response Center (NRC), the U.S. Environmental Protection Agency (EPA), and to a limited extent, the U.S. Coast Guard (USCG). The initial notification data may be followed up with updated information from various Federal, State and local response authorities, as appropriate. ERNS contains data that can be used to analyze release notifications, support emergency planning efforts, and assist decision makers in developing spill prevention programs. The fact sheet provides summary information on notifications of releases of oil reported in accordance with the Clean Water Act (CWA). Under Section 311 of the CWA, discharges of oil which: (1) cause a sheen to appear on the surface of the water; (2) violate applicable water quality standards; or (3) cause sludge or emulsion to be deposited beneath the surface of the water or adjoining shoreline, must be reported to the NRC

  1. NuclearFACTS: public engagement about the impacts of nuclear research

    Energy Technology Data Exchange (ETDEWEB)

    Dalzell, M.T.J.; Alexander, R.N.; Main, M.G., E-mail: matthew.dalzell@fedorukcentre.ca [Sylvia Fedoruk Canadian Centre for Nuclear Innovation, Saskatoon, SK, (Canada)

    2015-07-01

    The Forum for Accountability and Communities Talking nuclear Science - nuclearFACTS - is a cornerstone of the Sylvia Fedoruk Canadian Centre for Nuclear Innovation's efforts to engage the people of Saskatchewan in evidence-based conversations about the impacts of the nuclear research, development and training activities supported by the Fedoruk Centre. The second annual nuclearFACTS public colloquium was held 20 November 2014, and featured the participation of 16 research projects. This paper discusses the continued development of the nuclearFACTS concept and its role in the Fedoruk Centre's upstream engagement efforts. (author)

  2. EU AND GLOBALIZATION: SOME STYLIZED FACTS

    Directory of Open Access Journals (Sweden)

    Scamuffa Domenico

    2009-05-01

    Full Text Available Most of the people all over the world claim that globalization is a result of dynamic interactions between economic, technological, social and political factors. The aim of this paper is to document some stylized facts on this phenomenon in order to take

  3. Moving Facts in an Arctic field

    DEFF Research Database (Denmark)

    Hastrup, Kirsten Blinkenberg; Flora, Janne; Andersen, Astrid Oberborbeck

    2016-01-01

    , and an engagement with other disciplinary practices. The gain of our cross-disciplinary experiment was therefore not only to know more about the makings of a particular landscape in a multi-disciplinary perspective, but also to understand how anthropology makes sense of inherently moving facts....

  4. Data analysis unveils a new stylized fact in foreign currency markets

    Science.gov (United States)

    Nacher, J. C.; Ochiai, T.

    2012-09-01

    The search for stylized facts (i.e., simplified empirical facts) is of capital importance in econophysics because the stylized facts constitute the experimental empirical body on which theories and models should be tested. At the moment they are too few and this is an important limitation to the progress in the field. In this work, we unveil a new stylized fact, which consists of resistance effect and breaking-acceleration effect that implicitly requires a long memory feature in price movement. By analyzing a vast amount of historical data, we demonstrate that the financial market tends to exceed a past (historical) extreme price less often than expected by a classic short-memory model (e.g., Black-Scholes model). We call it resistance effect. However, when the market does it, we predict that the average volatility at that time point will be much higher (accelerates more). It means, in average, volatility accelerates more when the price breaks the highest (lowest) value. We refer to this as breaking-acceleration effect. These observed empirical facts are actually an effect which may arise from technical trading and psychological effects. Taken together, these results indicate that, beyond the predictive capability of this unveiled stylized fact, traditional short-memory models do not faithfully capture the market dynamics.

  5. Facts about Type 2

    Medline Plus

    Full Text Available ... education program Calendar of Events Wellness Lives Here Awareness Programs Hispanic Heritage Month African American Programs Latino ... Offices Volunteer Opportunities Signature Events Camps Diabetes EXPOs Awareness Programs Wellness Lives Here Become a Member American ...

  6. Spina Bifida. Fact Sheet = Espina Bifida. Hojas Informativas Sobre Discapacidades.

    Science.gov (United States)

    National Information Center for Children and Youth with Disabilities, Washington, DC.

    This fact sheet offers definitions of the three types of spina bifida (spina bifida occulta, meningocele, and myelomeningocele), outlines their incidence, describes characteristics of individuals with spina bifida, and reviews educational implications. The fact sheet discusses the need for many children with myelomeningocele to learn to manage…

  7. More Cancer Types - SEER Cancer Stat Facts

    Science.gov (United States)

    Cancer Statistical Fact Sheets are summaries of common cancer types developed to provide an overview of frequently-requested cancer statistics including incidence, mortality, survival, stage, prevalence, and lifetime risk.

  8. Contribution of Content Knowledge and Learning Ability to the Learning of Facts.

    Science.gov (United States)

    Kuhara-Kojima, Keiko; Hatano, Giyoo

    1991-01-01

    In 3 experiments, 1,598 Japanese college students were examined concerning the learning of facts in 2 content domains, baseball and music. Content knowledge facilitated fact learning only in the relevant domain; learning ability facilitated fact learning in both domains. Effects of content knowledge and learning ability were additive. (SLD)

  9. Subtle Implicit Language Facts Emerge from the Functions of Constructions.

    Science.gov (United States)

    Goldberg, Adele E

    2015-01-01

    Much has been written about the unlikelihood of innate, syntax-specific, universal knowledge of language (Universal Grammar) on the grounds that it is biologically implausible, unresponsive to cross-linguistic facts, theoretically inelegant, and implausible and unnecessary from the perspective of language acquisition. While relevant, much of this discussion fails to address the sorts of facts that generative linguists often take as evidence in favor of the Universal Grammar Hypothesis: subtle, intricate, knowledge about language that speakers implicitly know without being taught. This paper revisits a few often-cited such cases and argues that, although the facts are sometimes even more complex and subtle than is generally appreciated, appeals to Universal Grammar fail to explain the phenomena. Instead, such facts are strongly motivated by the functions of the constructions involved. The following specific cases are discussed: (a) the distribution and interpretation of anaphoric one, (b) constraints on long-distance dependencies, (c) subject-auxiliary inversion, and (d) cross-linguistic linking generalizations between semantics and syntax.

  10. Electron Beam Processing of Polymers: Facts and Opportunities

    International Nuclear Information System (INIS)

    Gielenz, G.

    2006-01-01

    Electron Beam (EB) processing of polymers is a well established and mature technology in a multitude of industrial polymer applications for more than 40 years. Constant research effort in combination with emerging tailored EB process technologies, have led to numerous new (niche) applications and products within the past decade. Nonetheless, and despite the fact, that nowadays a large variety of EB and related process equipment is readily available for use by the respective industries, EB processing of polymers still takes up only a small niche in comparison to the overall polymer business. In this lecture the author attempts to present a short overview on the current industrial established and emerging radiation processing applications and the related EB equipment suppliers. Then some selected plastics business facts and figures with a forecast of the global plastics consumption situation up to 2010 will be shown. As a conclusion from these facts, some comments will be deduced, regarding the future potential, attractiveness and economical relevance of irradiation processing technologies in present day competitive global markets

  11. FACTS controllers and the deregulated electric utility environment

    International Nuclear Information System (INIS)

    Ooi, B. T.; Galiana, F. D.; McGillis, D.; Joos, G.; Marceau, R.

    1998-01-01

    The concept of Flexible AC Transmission Systems (FACTS) is explored and the potential of power electronic converters to increase flexibility and reliability of modern power systems is explored. Power electronic controllers can reduce the required safety margin in electric power generation capacity through the use of faster controllers based on exploiting the high-power solid-state switches with gate-turn-off capabilities. The FACTS concept makes it possible to postpone the financial investment needed to build more power lines, and also offers a solution to securing the right-of-way to build new lines. Currently available FACTS controllers such as the Static var Compensator (STATCOM) and the Unified Power Flow Controller (UPFC) are described, including their function, structure and relevant implementation issues. Since they can produce the required amount of reactive power independently of line voltage or current, and if equipped with energy storing devices they can supply real power as required, they are a necessary element for the control of power systems in a deregulated environment. 15 refs., 3 figs

  12. Weatherization in Arkansas: A Gem of a Program: Weatherization Assistance Close-Up Fact Sheet

    International Nuclear Information System (INIS)

    2001-01-01

    Arkansas demonstrates its commitment to technology and efficiency through the Weatherization Program. Weatherization uses advanced technologies and techniques to reduce energy costs for low-income families by increasing the energy efficiency of their homes

  13. 32 CFR 199.23 - Special Supplemental Food Program.

    Science.gov (United States)

    2010-07-01

    ... years of age; or (B) Incapable of self-support because of mental or physical incapacity and is in fact... prescribed by Domestic WIC programs, as required by 10 U.S.C. 1060a(c)(1)(B). (27) Verification. Verification... who presents a valid WIC Program Verification of Certification card, which is issued to participants...

  14. Recent facts about photovoltaics in Germany

    International Nuclear Information System (INIS)

    Wirth, Harry

    2015-01-01

    Germany is leaving the age of fossil fuel behind. In building a sustainable energy future, photovoltaics is going to have an important role. The following summary consists of the most recent facts, figures and findings and shall assist in forming an overall assessment of the photovoltaic expansion in Germany.

  15. Rural electrification program with renewable energy sources: An analysis of China’s Township Electrification Program

    International Nuclear Information System (INIS)

    Shyu, Chian-Woei

    2012-01-01

    Given the fact that 1.4 billion people, over 20% of the world’s population, lack access to electricity, rural electrification remains a common challenge for many developing countries. The ‘Township Electrification Program’ launched by the Chinese government in 2002 is known as the world’s largest renewable energy-based rural electrification program in terms of investment volume ever carried out by a country. This study gives an in-depth examination of the program implemented in two selected townships in remote of rural areas of western China. The results showed that the implementation of the program possessed a technical orientation (e.g., construction of stations, installation of systems), and underestimated the financial implications (e.g., electricity tariff, households’ ability to pay electricity fees, financial management) as well as human resources available (e.g., training for operators, household participation) and institutional capacity building (e.g., good governance, regulatory framework) at the local level. Even though electricity was provided by the solar PV power stations, households still relied on traditional energy sources, such as candles and dry cell batteries, due to the fact that electricity service was unreliable and electricity supply was not sufficient for households’ needs. - Highlights: ► China’s electrification rate has reached the level of OECD countries. ► Township Electrification Program is the world’s largest electrification program. ► The program possessed a technical orientation and underestimated other aspects. ► Households still relied on traditional energy, such as candles and batteries. ► Having electricity access did not mean that electricity was actually used.

  16. Digital Learning in California's K-12 Schools. Just the Facts

    Science.gov (United States)

    Gao, Niu

    2015-01-01

    This fact page briefly discusses the following facts on digital learning in California's K-12: (1) As California implements new tests in its K-12 schools, technology infrastructure is a key concern; (2) Many districts are confident that they had enough bandwidth for online field tests; (3) Digital learning will require significantly greater…

  17. Institutional Facts and the NaturalisticFallacy : Confronting Searle with Searle

    NARCIS (Netherlands)

    Hindriks, Frank

    2002-01-01

    In 1964 Searle argued against the naturalistic fallacy thesis that an ought-statement can in fact be derived from is-statements. From an analysis of this argument and of Searle’s social ontology of 1995 – which includes a full-blown theory of institutional facts – I conclude that this argument is

  18. Advancing Concentrating Solar Power Research (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2014-02-01

    Researchers at the National Renewable Energy Laboratory (NREL) provide scientific, engineering, and analytical expertise to help advance innovation in concentrating solar power (CSP). This fact sheet summarizes how NREL is advancing CSP research.

  19. Mastering Fact Fluency: Are They Game?

    Science.gov (United States)

    Godfrey, Connie J.; Stone, Jamalee

    2013-01-01

    Math games can be powerful tools in helping students achieve automaticity in basic addition and related subtraction facts if both teachers and students use them purposefully. According to the National Council of Teachers of Mathematics (NCTM 2000), developing a solid mathematical foundation is essential for every child in prekindergarten through…

  20. The Manager's Job: Folklore and Fact

    Science.gov (United States)

    Mintzberg, Henry

    1975-01-01

    Contrasts popular myths about managers' duties with the facts, as indicated by various studies of managers and how they function. The author argues that managers often have distorted views of their role, and that they must first recognize what their job really involves in order to perform it effectively. (JG)

  1. New technology for sulfide reductions and increased oil recovery: Petroleum project fact sheet

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-12-14

    This Fact Sheet is written for the Inventions and Innovations Program about a new technology for sulfide reduction and increased oil recovery. The new technology, called Bio-Competitive Exclusion (BCX), results in greater oil production and prevents the production of corrosive hydrogen sulfide in oil and gas reservoirs. This BCX process is initiated and maintained by a new product, called Max-Well 2000, in which nutrients are custom designed to stimulate targeted beneficial microorganisms that live in every oil and gas reservoir. Rapid growth of these microorganisms excludes activity of harmful sulfide-producing bacteria and produces by-products that serve as effective tertiary oil recovery agents and as sulfide degradation agents. Oil and gas production is both increased and sweetened.

  2. Programs as Polypeptides.

    Science.gov (United States)

    Williams, Lance R

    2016-01-01

    Object-oriented combinator chemistry (OOCC) is an artificial chemistry with composition devices borrowed from object-oriented and functional programming languages. Actors in OOCC are embedded in space and subject to diffusion; since they are neither created nor destroyed, their mass is conserved. Actors use programs constructed from combinators to asynchronously update their own states and the states of other actors in their neighborhoods. The fact that programs and combinators are themselves reified as actors makes it possible to build programs that build programs from combinators of a few primitive types using asynchronous spatial processes that resemble chemistry as much as computation. To demonstrate this, OOCC is used to define a parallel, asynchronous, spatially distributed self-replicating system modeled in part on the living cell. Since interactions among its parts result in the construction of more of these same parts, the system is strongly constructive. The system's high normalized complexity is contrasted with that of a simple composome.

  3. [Burden of proof in medical cases--presumption of fact and prima facie evidence. II. Presumption of fact and prima facie evidence].

    Science.gov (United States)

    Sliwka, Marcin

    2004-01-01

    The aim of this paper was to present the main rules concerning the burden of proof in polish civil trials, including medical cases. The standard rules were presented with all the important exclusions such as presumption of law and fact or prima facie evidence. The author analyses the effect of these institutions on burden of proof in medical cases. The difference between presumptions of fact and prima facie evidence was analysed and explained. This paper also describes the importance of the res ipsa loquitur rule in United Kingdom and USA. This paper includes numerous High Court sentences on evidential and medical issues.

  4. Fact-dependent policy disagreements and political legitimacy

    DEFF Research Database (Denmark)

    Kappel, Klemens

    2017-01-01

    Suppose we have a persistent disagreement about a particular set of policy options, not because of an underlying moral disagreement, or a mere conflict of interest, but rather because we disagree about a crucial non-normative factual assumption underlying the justification of the policy choices...... on value disagreements and proposed theories of legitimate coercive legislation in valuedependent disagreements. The paper presents an argument showing that under certain plausible assumptions regarding legitimacy, there are serious difficulties in identifying legitimate choices in fact-dependent policy...... should care about legitimacy et al.l, then it is by no means clear why we should ignore issues of legitimacy in policy-disputes that depend on factual disagreements. The paper ends by defining a set of possibilities that merit further exploration in search of a theory of legitimacy in fact...

  5. Fishing Facts Unlimited. Enterprise: Man & Technology.

    Science.gov (United States)

    Southern Illinois Univ., Carbondale. Dept. of Technical and Industrial Education.

    Fishing Facts Unlimited, a student conducted enterprise in Technical and Industrial Education at Southern Illinois University, Carbondale has been a very successful operation, both financially and in providing a community service. The service provided by the enterprise was the production and sales of a 48-page fishing guide to Southern Illinois.…

  6. Fact Sheets on Pesticides in Schools.

    Science.gov (United States)

    National Coalition against the Misuse of Pesticides, Washington, DC.

    This document consists of a collection of fact sheets about the use of pesticides in schools and how to reduce it. The sheets are: (1) "Alternatives to Using Pesticides in Schools: What Is Integrated Pest Management?"; (2) "Health Effects of 48 Commonly Used Pesticides in Schools"; (3) "The Schooling of State Pesticide…

  7. Facts and interpretation on the subject of nuclear energy

    International Nuclear Information System (INIS)

    Kleinrath, H.

    1977-01-01

    This report analyses facts and their interpretations on nuclear-energy. Due to the fact that the discussion on nuclear energy was very controversial in the 1970s in Austria, there were various opinions. This report includes always two interpretations for each fact. Content overview: How high is the risk of the operation of nuclear-power-plants compared to other possibilities to produce electricity? How dangerous is the nuclear waste, which is produced during the operation of nuclear-power-plants? Which risks entail reprocessing-plants? How far is the question of final repository of nuclear waste solved? Is there any sense for Austria to do without nuclear-power-plants? Is electricity generated by nuclear power cheap? Are there alternatives in the generation of electricity to nuclear-power-plants? Does a waiver of nuclear-power-plants mean a social risk – hazard of our economic stability, hazard of jobs? Literature(kancsar)

  8. Oral Health in the US: Key Facts

    Science.gov (United States)

    ... national health issues… Prescription Drugs Waivers Puerto Rico/Virgin Islands Recovery Disparities Policy Search Graphics & Interactives Polls ... Medicare Private Insurance Uninsured Women’s Health Policy Nav Group Polling Perspectives State Health Facts Graphics & Interactives Charts & ...

  9. Clean Air Markets - Quick Facts and Trends

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Quick Facts and Trends module is part of a suite of Clean Air Markets-related tools that are accessible at http://camddataandmaps.epa.gov/gdm/index.cfm. The...

  10. Chemical Agents: Facts about Sheltering in Place

    Science.gov (United States)

    ... What CDC is Doing Blog: Public Health Matters Chemical Agents: Facts About Sheltering in Place Format: Select ... What “sheltering in place” means Some kinds of chemical accidents or attacks may make going outdoors dangerous. ...

  11. Particle tracking at 4 K: The Fast Annihilation Cryogenic Tracking (FACT) detector for the AEgIS antimatter gravity experiment

    Energy Technology Data Exchange (ETDEWEB)

    Storey, J., E-mail: james.storey@cern.ch [Albert Einstein Center for Fundamental Physics, Laboratory for High Energy Physics, University of Bern, 3012 Bern (Switzerland); Canali, C. [University of Zurich, Physics Institute, Winterthurerstrasse 190, 8057 Zurich (Switzerland); Aghion, S. [Politecnico di Milano, Piazza Leonardo da Vinci 32, 20133 Milano (Italy); Istituto Nazionale di Fisica Nucleare, Sez. di Milano, Via Celoria 16, 20133 Milano (Italy); Ahlén, O. [European Organisation for Nuclear Research, Physics Department, 1211 Geneva 23 (Switzerland); Amsler, C.; Ariga, A.; Ariga, T. [Albert Einstein Center for Fundamental Physics, Laboratory for High Energy Physics, University of Bern, 3012 Bern (Switzerland); Belov, A.S. [Institute for Nuclear Research of the Russian Academy of Sciences, Moscow 117312 (Russian Federation); Bonomi, G. [University of Brescia, Department of Mechanical and Industrial Engineering, Via Branze 38, 25133 Brescia (Italy); Istituto Nazionale di Fisica Nucleare, Sez. di Pavia, Via Agostino Bassi 6, 27100 Pavia (Italy); Bräunig, P. [University of Heidelberg, Kirchhoff Institute for Physics, Im Neuenheimer Feld 227, 69120 Heidelberg (Germany); Bremer, J. [European Organisation for Nuclear Research, Physics Department, 1211 Geneva 23 (Switzerland); Brusa, R.S. [Dipartimento di Fisica, Università di Trento and INFN, Gruppo Collegato di Trento, Via Sommarive 14, 38050 Povo, Trento (Italy); Burghart, G. [European Organisation for Nuclear Research, Physics Department, 1211 Geneva 23 (Switzerland); Cabaret, L. [Laboratoire Aimé Cotton, CNRS, Université Paris Sud, ENS Cachan, Bâtiment 505, Campus d' Orsay, 91405 Orsay Cedex (France); Carante, M. [Istituto Nazionale di Fisica Nucleare, Sez. di Pavia, Via Agostino Bassi 6, 27100 Pavia (Italy); Caravita, R. [University of Milano, Department of Physics, Via Celoria 16, 20133 Milano (Italy); and others

    2013-12-21

    The AEgIS experiment is an international collaboration with the main goal of performing the first direct measurement of the Earth's gravitational acceleration on antimatter. Critical to the success of AEgIS is the production of cold antihydrogen (H{sup ¯}) atoms. The FACT detector is used to measure the production and temperature of the H{sup ¯} atoms and for establishing the formation of a H{sup ¯} beam. The operating requirements for this detector are very challenging: it must be able to identify each of the thousand or so annihilations in the 1 ms period of pulsed H{sup ¯} production, operate at 4 K inside a 1 T solenoidal field and not produce more than 10 W of heat. The FACT detector consists of two concentric cylindrical layers of 400 scintillator fibres with a 1 mm diameter and a 0.6 mm pitch. The scintillating fibres are coupled to clear fibres which transport the scintillation light to 800 silicon photomultipliers. Each silicon photomultiplier signal is connected to a linear amplifier and a fast discriminator, the outputs of which are sampled continuously by Field Programmable Gate Arrays (FPGAs). In the course of the developments for the FACT detector we have established the performance of scintillating fibres at 4 K by means of a cosmic-ray tracker operating in a liquid helium cryostat. The FACT detector was installed in the AEgIS apparatus in December 2012 and will be used to study the H{sup ¯} formation when the low energy antiproton physics programs resume at CERN in the Summer of 2014. This paper presents the design requirements and construction methods of the FACT detector and provides the first results of the detector commissioning.

  12. Particle tracking at 4 K: The Fast Annihilation Cryogenic Tracking (FACT) detector for the AEgIS antimatter gravity experiment

    International Nuclear Information System (INIS)

    Storey, J.; Canali, C.; Aghion, S.; Ahlén, O.; Amsler, C.; Ariga, A.; Ariga, T.; Belov, A.S.; Bonomi, G.; Bräunig, P.; Bremer, J.; Brusa, R.S.; Burghart, G.; Cabaret, L.; Carante, M.; Caravita, R.

    2013-01-01

    The AEgIS experiment is an international collaboration with the main goal of performing the first direct measurement of the Earth's gravitational acceleration on antimatter. Critical to the success of AEgIS is the production of cold antihydrogen (H ¯ ) atoms. The FACT detector is used to measure the production and temperature of the H ¯ atoms and for establishing the formation of a H ¯ beam. The operating requirements for this detector are very challenging: it must be able to identify each of the thousand or so annihilations in the 1 ms period of pulsed H ¯ production, operate at 4 K inside a 1 T solenoidal field and not produce more than 10 W of heat. The FACT detector consists of two concentric cylindrical layers of 400 scintillator fibres with a 1 mm diameter and a 0.6 mm pitch. The scintillating fibres are coupled to clear fibres which transport the scintillation light to 800 silicon photomultipliers. Each silicon photomultiplier signal is connected to a linear amplifier and a fast discriminator, the outputs of which are sampled continuously by Field Programmable Gate Arrays (FPGAs). In the course of the developments for the FACT detector we have established the performance of scintillating fibres at 4 K by means of a cosmic-ray tracker operating in a liquid helium cryostat. The FACT detector was installed in the AEgIS apparatus in December 2012 and will be used to study the H ¯ formation when the low energy antiproton physics programs resume at CERN in the Summer of 2014. This paper presents the design requirements and construction methods of the FACT detector and provides the first results of the detector commissioning

  13. Using the Frailty Assessment for Care Planning Tool (FACT) to screen elderly chronic kidney disease patients for frailty: the nurse experience.

    Science.gov (United States)

    Moffatt, Heather; Moorhouse, Paige; Mallery, Laurie; Landry, David; Tennankore, Karthik

    2018-01-01

    Recent evidence supports the prognostic significance of frailty for functional decline and poor health outcomes in patients with chronic kidney disease. Yet, despite the development of clinical tools to screen for frailty, little is known about the experiential impact of screening for frailty in this setting. The Frailty Assessment for Care Planning Tool (FACT) evaluates frailty across 4 domains: mobility, function, social circumstances, and cognition. The purpose of this qualitative study was as follows: 1) explore the nurse experience of screening for frailty using the FACT tool in a specialized outpatient renal clinic; 2) determine how, if at all, provider perceptions of frailty changed after implementation of the frailty screening tool; and 3) determine the perceived factors that influence uptake and administration of the FACT screening tool in a specialized clinical setting. A semi-structured interview of 5 nurses from the Nova Scotia Health Authority, Central Zone Renal Clinic was conducted. A grounded theory approach was used to generate thematic categories and analysis models. Four primary themes emerged in the data analysis: "we were skeptical", "we made it work", "we learned how", and "we understand". As the renal nurses gained a sense of confidence in their ability to implement the FACT tool, initial barriers to implementation were attenuated. Implementation factors - such as realistic goals, clear guidelines, and ongoing training - were important factors for successful uptake of the frailty screening initiative. Nurse participants reported an overall positive experience using the FACT method to screen for frailty and indicated that their understanding of the multiple dimensions and subtleties of "frailty" were enhanced. Future nurse-led FACT screening initiatives should incorporate those factors identified as being integral to program success: realistic goals, clear guidelines, and ongoing training. Adopting the evaluation of frailty as a priority

  14. Spina Bifida: General Information. Fact Sheet Number 12 = La Espina Bifida: Informacion General. Fact Sheet Number 21.

    Science.gov (United States)

    Interstate Research Associates, McLean, VA.

    This fact sheet on spina bifida is offered in both English and Spanish. It provides definitions of the three types of spina bifida (spina bifida occulta, meningocele, and myelomeningocele). Incidence figures are given as are typical characteristics of children with spina bifida. Educational implications are briefly noted, including the need to…

  15. Numerical Procedures for Analyzing Dynamical Processes.

    Science.gov (United States)

    1992-02-29

    7 < I - 2/p ’’ Clatm. For fixed , < . with - sufficiently small, there ex- ists a .E F( ) such that the nth iterate of the primary parabola...4a. 1,4’ ,jh))<.,((P ,ia))< v,(a)= vIh ). and \\, 0 ,c)) < v,tP ;it)) < ic ) = \\,(. Setting F= F(x,. ’t. T). this means that in the reconstruction , pace

  16. FY2011 Annual Progress Report for Vehicle and Systems Simulation and Testing

    Energy Technology Data Exchange (ETDEWEB)

    None

    2012-01-15

    The VSST team's mission is to evaluate the technologies and performance characteristics of advanced automotive powertrain components and subsystems in an integrated vehicle systems context. These evaluations address light-, medium-, and heavy-duty vehicle platforms. This work is directed toward evaluating and verifying the targets of the VTP R&D teams and to providing guidance in establishing roadmaps for achievement of these goals.

  17. How to Read a Nutrition Facts Label

    Medline Plus

    Full Text Available ... Answers (Q&A) Staying Safe Videos for Educators ... packaged foods come with a Nutrition Facts label. These labels have a lot of important information — on fat and calories, serving sizes, sodium content, ...

  18. College Experience and Volunteering. Fact Sheet

    Science.gov (United States)

    Marcelo, Karlo Barrios

    2007-01-01

    College experience and volunteering are positively correlated. Measurable differences in civic activity exist between young people who attend college and young people who do not. This fact sheet explores volunteering as civic engagement among youth with college experience, ages 19-25, which was down for the second year in a row in 2006. The…

  19. Asheville, North Carolina: Reducing Electricity Demand through Building Programs & Policies (City Energy: From Data to Decisions)

    Energy Technology Data Exchange (ETDEWEB)

    Office of Strategic Programs, Strategic Priorities and Impact Analysis Team

    2017-09-29

    This fact sheet "Asheville, North Carolina: Reducing Electricity Demand through Building Programs & Policies" explains how the City of Asheville used data from the U.S. Department of Energy's Cities Leading through Energy Analysis and Planning (Cities-LEAP) and the State and Local Energy Data (SLED) programs to inform its city energy planning. It is one of ten fact sheets in the "City Energy: From Data to Decisions" series.

  20. Nonthermal Ablation by Using Intravascular Oxygen Radical Generation with WST11: Dynamic Tissue Effects and Implications for Focal Therapy

    Science.gov (United States)

    Kimm, Simon Y.; Tarin, Tatum V.; Monette, Sébastien; Srimathveeravalli, Govindarajan; Gerber, Daniel; Durack, Jeremy C.; Solomon, Stephen B.; Scardino, Peter T.; Scherz, Avigdor

    2016-01-01

    Purpose To examine the hypothesis that vascular-targeted photodynamic therapy (VTP) with WST11 and clinically relevant parameters can be used to ablate target tissues in a non–tumor-bearing large-animal model while selectively sparing blood vessels and collagen. Materials and Methods By using an institutional animal care and use committee–approved protocol, 68 ablations were performed in the kidneys (cortex and medulla) and livers of 27 adult pigs. Posttreatment evaluation was conducted with contrast material–enhanced computed tomography in the live animals at 24 hours. Immunohistochemistry was evaluated and histologic examination with hematoxylin-eosin staining was performed at 4 hours, 24 hours, and 7 days. Intravenous infusion of WST11 (4 mg per kilogram of body weight) was followed by using near-infrared illumination (753 nm for 20 minutes) through optical fibers prepositioned in target tissues by using a fixed template. Treated areas were scanned, measured, and statistically analyzed by using the Student t test and two-way analysis of variance. Results Focal WST11 VTP treatment in the liver and kidney by using a single optical fiber resulted in well-demarcated cylindrical zones of nonthermal necrosis concentrically oriented around the light-emitting diffuser, with no intervening viable parenchymal cells. The radius of ablated tissue increased from approximately 5 mm at 150 mW to approximately 7 mm at 415 mW (P necrosis. Patterns of acute injury within 24 hours were consistent with microcirculatory flow arrest and collagen preservation (demonstrated with trichrome staining). In the peripheral ablation zone, blood vessels at least 40 μm in diameter were selectively preserved and remained functional at 7 days. Ablated tissues exhibited progressive fibrosis and chronic inflammatory cell infiltrates. No histologic changes consistent with thermal injury were observed in blood vessels or collagen. The renal hilum and collecting system did not show treatment

  1. Supporting Documentation for the 2008 Update to the Insulation Fact Sheet

    Energy Technology Data Exchange (ETDEWEB)

    Stovall, Therese K [ORNL

    2008-02-01

    The Insulation Fact Sheet provides consumers for general guidance and recommended insulation levels for their home. This fact sheet has been on-line since 1995 and this update addresses new insulation materials, as well as updated costs for energy and materials.

  2. Multi-objective optimal power flow with FACTS devices

    International Nuclear Information System (INIS)

    Basu, M.

    2011-01-01

    This paper presents multi-objective differential evolution to optimize cost of generation, emission and active power transmission loss of flexible ac transmission systems (FACTS) device-equipped power systems. In the proposed approach, optimal power flow problem is formulated as a multi-objective optimization problem. FACTS devices considered include thyristor controlled series capacitor (TCSC) and thyristor controlled phase shifter (TCPS). The proposed approach has been examined and tested on the modified IEEE 30-bus and 57-bus test systems. The results obtained from the proposed approach have been compared with those obtained from nondominated sorting genetic algorithm-II, strength pareto evolutionary algorithm 2 and pareto differential evolution.

  3. Large truck and bus crash facts, 2010.

    Science.gov (United States)

    2012-09-01

    This annual edition of Large Truck and Bus Crash Facts contains descriptive statistics about fatal, injury, and : property damage only crashes involving large trucks and buses in 2010. Selected crash statistics on passenger : vehicles are also presen...

  4. Large truck and bus crash facts, 2012.

    Science.gov (United States)

    2014-06-01

    This annual edition of Large Truck and Bus Crash Facts contains descriptive statistics about fatal, injury, and property damage only crashes involving large trucks and buses in 2012. Selected crash statistics on passenger vehicles are also presented ...

  5. Large truck and bus crash facts, 2013.

    Science.gov (United States)

    2015-04-01

    This annual edition of Large Truck and Bus Crash Facts contains descriptive statistics about fatal, injury, and property damage only crashes involving large trucks and buses in 2013. Selected crash statistics on passenger vehicles are also presented ...

  6. Large truck and bus crash facts, 2009.

    Science.gov (United States)

    2011-10-01

    This annual edition of Large Truck and Bus Crash Facts contains descriptive statistics about fatal, injury, and : property damage only crashes involving large trucks and buses in 2009. Selected crash statistics on passenger : vehicles are also presen...

  7. Large truck and bus crash facts, 2011.

    Science.gov (United States)

    2013-10-01

    This annual edition of Large Truck and Bus Crash Facts contains descriptive statistics about fatal, injury, and : property damage only crashes involving large trucks and buses in 2011. Selected crash statistics on passenger : vehicles are also presen...

  8. How to Read a Nutrition Facts Label

    Medline Plus

    Full Text Available ... site Sitio para adolescentes Body Mind Sexual Health Food & Fitness Diseases & Conditions Infections Drugs & Alcohol School & Jobs ... las etiquetas de datos nutricionales (video) Most packaged foods come with a Nutrition Facts label. These labels ...

  9. FACT. Flare alerts from blazar monitoring

    Energy Technology Data Exchange (ETDEWEB)

    Dorner, Daniela [Universitaet Wuerzburg (Germany); Bretz, Thomas [RWTH Aachen (Germany); Collaboration: FACT-Collaboration

    2015-07-01

    One of the major goals of the First G-APD Cherenkov Telescope is the longterm monitoring of bright TeV blazars. For more than three years, FACT has observed the blazars Mrk 421 and Mrk 501 and a few other sources on a regular basis. To understand these highly variable objects, simultaneous data at different wavelengths are very useful. FACT is not only taking part in multi-wavelength campaigns, but also sending alerts to other instruments in case of enhanced flux, to study flares within the multi-wavelength frame. To send fast alerts, an automatic quick look analysis was set up on site. Once the data are written on disk, they are automatically processed, and the analysis results are published on a website where other observers can monitor the activity of the source in the very high energy band. In addition, alerts are sent in case the flux is higher than a certain predefined value. In 2014, more than five alerts have been sent. Results from three years of monitoring are presented.

  10. Facts on Nirex

    International Nuclear Information System (INIS)

    1987-01-01

    This folder contains twelve two-page leaflets (fact sheets) which answer questions posed about UK NIREX Ltd, its operations and radioactive waste. NIREX (the Nuclear Industry Radioactive Waste Executive) is the organisation responsible for implementing the British Government's policy for the disposal of most low- and intermediate-level radioactive waste produced in the United Kingdom. The questions posed are; what is NIREX. What is radioactivity. What is radioactive waste. Radioactive waste, what are the options. What is a radioactive waste repository. Some aspects of such a repository are then explained - how engineered barriers work, how geological barriers work, how long can concrete last, how is the radioactive waste transported, how are repository sites identified. The last two leaflets consider why do we need research, and look at radioactive waste management worldwide. The answers are in non-technical language and are short. (UK)

  11. Facts about Type 2

    Medline Plus

    Full Text Available ... of Events Wellness Lives Here Awareness Programs Hispanic Heritage Month African American Programs Latino Programs Asian Americans, ... 1 Type 2 Gestational Myths Statistics Common Terms Genetics Living With Diabetes Recently Diagnosed Treatment & Care Complications ...

  12. Vietnamese Hurricane Response Fact Sheets

    Science.gov (United States)

    Các tờ dữ kiện được cung cấp nơi đây mô tả vai trò của EPA trong việc đáp ứng với bão và cách các chương trình cụ thể cung cấp sự hỗ trợ. The Vietnamese fact sheets provided here describe EPA's role in a hurricane response.

  13. Hispanics/Latinos & Cardiovascular Disease: Statistical Fact Sheet

    Science.gov (United States)

    Statistical Fact Sheet 2013 Update Hispanics/Latinos & Cardiovascular Diseases Cardiovascular Disease (CVD) (ICD/10 codes I00-I99, Q20-Q28) (ICD/9 codes 390-459, 745-747)  Among Mexican-American adults age 20 ...

  14. Reactive power control of wind farm using facts devices

    International Nuclear Information System (INIS)

    Ashfaq, S.; Arif, A.; Shakeel, A.; Mahmood, T.

    2014-01-01

    Wind energy is an attainable option to complement other types of pollution-free green generation Grid connections of renewable energy resources are vital if they are to be effectively exploited, but grid connection brings problems of voltage fluctuation and harmonic distortion. FACTs devices are one of the power electronics revolutions to improve voltage profile, system stability, and reactive power control and to reduce transmission losses. The studied system here is a variable speed wind generation system based on Induction Generator (IG) with integration of different FACTs controllers in the wind farm. To harness the wind power efficiently the most reliable and expensive system in the present era is grid connected doubly fed induction generator. Induction generator with FACTs devices is a suitable economical replacement. The suggested scheme is implemented in MATLAB Simulink with real time parameters of GHARO wind power plant in Sind, and corresponding results and output waveforms proves the potential strength of proposed methodology. (author)

  15. Financial Stylized Facts in the Word of Mouth Model

    Science.gov (United States)

    Misawa, Tadanobu; Watanabe, Kyoko; Shimokawa, Tetsuya

    Recently, we proposed an agent-based model called the word of mouth model to analyze the influence of an information transmission process to price formation in financial markets. Especially, the short-term predictability of asset return was focused on and an explanation in the view of information transmission was provided to the question why the predictability was much clearly observed in the small-sized stocks. This paper, to extend the previous study, demonstrates that the word of mouth model also has a consistency with other important financial stylized facts. This strengthens the possibility that the information transmission among investors plays a crucial role in price formation. Concretely, this paper addresses two famous statistical features of returns; the leptokurtic distribution of return and the autocorrelation of return volatility. The reasons why these statistical facts receive especial attentions of researchers among financial stylized facts are their statistical robustness and practical importance, such as the applications to the derivative pricing problems.

  16. D.E.R. 85: main facts

    International Nuclear Information System (INIS)

    1986-01-01

    This report presents the important facts among the studies carried out by the ''Direction des Etudes et Recherches'' (E.D.F.): new applications of electric power for customers, protection of environment, classical equipments for power plants and nuclear equipments, monitoring and control of power plants, electrical equipments, development and operation of electrical networks, informatics and office automation [fr

  17. World War II Informational Fact Sheets.

    Science.gov (United States)

    Department of Defense, Washington, DC.

    This commemorative book provides numerous fact sheets on various aspects of World War II, both on the fighting front and the homefront. Replicas of posters of the war era, descriptions of battles with maps, contributions of women and minorities to the war effort, even music of the wartime era, add to this collection of resource materials useful to…

  18. The Contingent Unknowability of Facts and its Relation with Informal, Epistemological Contexts

    Directory of Open Access Journals (Sweden)

    Stanley Kreiter Bezerra Medeiros

    2017-11-01

    Full Text Available This paper focuses on elements that are involved in a specific type of judgment, namely, those involving facts that, in virtue of contingent reasons, are out of our epistemic reach. Its goal is to propose a philosophical explanation about why we, in informal contexts, take some facts as contingently unknowable. In order to accomplish that goal, we develop a theory that defines contingently unknowable facts in a very specific way. We establish three clauses that are jointly necessary and sufficient — so we argue — for taking an arbitrary fact as contingently unknowable. In a variety of contexts, this strategy has the potential of reducing efforts in an epistemological analysis of this particular type of unknowability.

  19. Chemical Data Reporting Fact Sheet: Chemicals Snapshot

    Science.gov (United States)

    This fact sheet provides a brief overview of the chemical manufacturing, processing, and use information collected for the 2012 Chemical Data Reporting (CDR) rule. Users do not have access to the complete CDR data set and should draw conclusions with care.

  20. Facts about Cleft Lip and Cleft Palate

    Science.gov (United States)

    ... Information For… Media Policy Makers Facts about Cleft Lip and Cleft Palate Language: English (US) Español (Spanish) Recommend on Facebook ... can make referrals to cleft/craniofacial treatment teams. Cleft Lip & Palate Foundation of Smiles Cleft Lip & Palate Foundation of ...

  1. How to Read a Nutrition Facts Label

    Medline Plus

    Full Text Available ... Fitness Diseases & Conditions Infections Drugs & Alcohol School & Jobs Sports Expert Answers (Q&A) Staying Safe Videos for Educators Search English Español How to Read a Nutrition Facts Label (Video) KidsHealth / For Parents / How to ...

  2. Transplantation: fantasy, fiction and fact.

    Science.gov (United States)

    Magee, Reginald

    2004-03-01

    Today organ transplantation is considered a routine surgical procedure. The idea of transferring tissues from one person to another has been inspiring to the minds of artists depicting the Saints Cosmos and Damian and also writers such as Mary Shelley. Early attempts at tissue transplantation were unsuccessful but in the last 50 years medical research has brought it into reality. The present paper looks at the subject from the realms of fantasy through the works of fiction and finally into everyday fact.

  3. Nuclear economics: Issues and facts

    International Nuclear Information System (INIS)

    Hudson, C.R.

    1993-01-01

    Nuclear economics has become on the more prominent topics related to nuclear power. Beyond the subjects of nuclear safety and waste disposal, questions and concerns of nuclear power economics have emerged with growing frequency in utility board rooms, in state and federal regulatory proceedings, and in the media. What has caused nuclear power economics to become such a popular topic? This paper addresses issues and facts related to historical nuclear plant costs, new nuclear plant projections, and warning signals for future plants

  4. Facts for Families from the American Academy of Child and Adolescent Psychiatry [1991].

    Science.gov (United States)

    American Academy of Child and Adolescent Psychiatry, Washington, DC.

    Nine fact sheets relevant to children's emotional well-being are presented in this document. The first fact sheet, "Teenagers with Eating Disorders" focuses on anorexia nervosa and bulimia. The second fact sheet, "Children and Grief" describes age-related responses to death, and ways of coping with a death in a family that…

  5. FACT. New image parameters based on the watershed-algorithm

    Energy Technology Data Exchange (ETDEWEB)

    Linhoff, Lena; Bruegge, Kai Arno; Buss, Jens [TU Dortmund (Germany). Experimentelle Physik 5b; Collaboration: FACT-Collaboration

    2016-07-01

    FACT, the First G-APD Cherenkov Telescope, is the first imaging atmospheric Cherenkov telescope that is using Geiger-mode avalanche photodiodes (G-APDs) as photo sensors. The raw data produced by this telescope are processed in an analysis chain, which leads to a classification of the primary particle that induce a shower and to an estimation of its energy. One important step in this analysis chain is the parameter extraction from shower images. By the application of a watershed algorithm to the camera image, new parameters are computed. Perceiving the brightness of a pixel as height, a set of pixels can be seen as 'landscape' with hills and valleys. A watershed algorithm groups all pixels to a cluster that belongs to the same hill. From the emerging segmented image, one can find new parameters for later analysis steps, e.g. number of clusters, their shape and containing photon charge. For FACT data, the FellWalker algorithm was chosen from the class of watershed algorithms, because it was designed to work on discrete distributions, in this case the pixels of a camera image. The FellWalker algorithm is implemented in FACT-tools, which provides the low level analysis framework for FACT. This talk will focus on the computation of new, FellWalker based, image parameters, which can be used for the gamma-hadron separation. Additionally, their distributions concerning real and Monte Carlo Data are compared.

  6. Canada and the Kyoto Protocol: Fact Sheet No. 5 - Developing countries

    International Nuclear Information System (INIS)

    2000-11-01

    This fact sheet acknowledges that global change affects developed and developing countries alike, and the fact that most developing countries do not have the human, financial and technical capacity to effectively address climate change issues without help from the industrialized nations. The fact sheet also puts Canada on record as being in agreement with the spirit of the Kyoto Protocol to encourage the participation of developing countries in global efforts to combat climate change and promote sustainable development and reaffirms Canada's willingness to provide financial and technical assistance to developing countries to enable them to play a meaningful part in this global effort. In this context, the fact sheet briefly describes the new Canada Climate Change Development Fund which has been set up to reduce the growth of GHG emissions and support carbon sink activities in developing countries, to strengthen the capacity of developing conuntries to reduce their vulnerability to adverse effects of climate change, and to participate in global efforts to combat them

  7. 75 FR 13777 - Disaster Assistance Fact Sheet DAP9580.107, Child Care Services

    Science.gov (United States)

    2010-03-23

    ...] Disaster Assistance Fact Sheet DAP9580.107, Child Care Services AGENCY: Federal Emergency Management Agency... (FEMA) is providing notice of the availability of the final Disaster Assistance Fact Sheet DAP9580.107...'s Web site at http://www.fema.gov . You may also view a hard copy of the fact sheet at the Office of...

  8. Large Fleets Lead in Petroleum Reduction (Fact Sheet)

    Energy Technology Data Exchange (ETDEWEB)

    Proc, H.

    2011-03-01

    Fact sheet describes Clean Cities' National Petroleum Reduction Partnership, an initiative through which large private fleets can receive support from Clean Cities to reduce petroleum consumption.

  9. Teaching Science Fact with Science Fiction

    Science.gov (United States)

    Raham, R. Gary

    2004-01-01

    The literature of science fiction packs up the facts and discoveries of science and runs off to futures filled with both wonders and warnings. Kids love to take the journeys it offers for the thrill of the ride, but they can learn as they travel, too. This book will provide the reader with: (1) an overview of the past 500 years of scientific…

  10. Myths & Facts about Value-Added Analysis

    Science.gov (United States)

    TNTP, 2011

    2011-01-01

    This paper presents myths as well as facts about value-added analysis. These myths include: (1) "Value-added isn't fair to teachers who work in high-need schools, where students tend to lag far behind academically"; (2) "Value-added scores are too volatile from year-to-year to be trusted"; (3) "There's no research behind value-added"; (4) "Using…

  11. An agent-based approach to financial stylized facts

    Science.gov (United States)

    Shimokawa, Tetsuya; Suzuki, Kyoko; Misawa, Tadanobu

    2007-06-01

    An important challenge of the financial theory in recent years is to construct more sophisticated models which have consistencies with as many financial stylized facts that cannot be explained by traditional models. Recently, psychological studies on decision making under uncertainty which originate in Kahneman and Tversky's research attract a lot of interest as key factors which figure out the financial stylized facts. These psychological results have been applied to the theory of investor's decision making and financial equilibrium modeling. This paper, following these behavioral financial studies, would like to propose an agent-based equilibrium model with prospect theoretical features of investors. Our goal is to point out a possibility that loss-averse feature of investors explains vast number of financial stylized facts and plays a crucial role in price formations of financial markets. Price process which is endogenously generated through our model has consistencies with, not only the equity premium puzzle and the volatility puzzle, but great kurtosis, asymmetry of return distribution, auto-correlation of return volatility, cross-correlation between return volatility and trading volume. Moreover, by using agent-based simulations, the paper also provides a rigorous explanation from the viewpoint of a lack of market liquidity to the size effect, which means that small-sized stocks enjoy excess returns compared to large-sized stocks.

  12. Facts for Families from the American Academy of Child and Adolescent Psychiatry [1989].

    Science.gov (United States)

    American Academy of Child and Adolescent Psychiatry, Washington, DC.

    Six fact sheets on issues relevant to children's emotional well being are presented in this document. The first fact sheet, "Children and Divorce" provides information for parents to consider when getting a divorce. Parents are encouraged to be aware of the stress that the events surrounding a divorce cause for the child. The second fact sheet,…

  13. 48 CFR 750.7109-3 - Facts and evidence.

    Science.gov (United States)

    2010-10-01

    ... CONTRACT MANAGEMENT EXTRAORDINARY CONTRACTUAL ACTIONS Extraordinary Contractual Actions To Protect Foreign Policy Interests of the United States 750.7109-3 Facts and evidence. The contracting officer or the...

  14. Low-level radiation effects: a fact book

    International Nuclear Information System (INIS)

    Brill, A.B.; Adelstein, S.J.; Saenger, E.L.; Webster, E.W.

    1982-01-01

    Low Level Raidation Effects: A Fact Book, prepared by the Society of Nuclear Medicine Subcommittee on the Risks of Low-Level Ionizing Radiation, attempts to examine the health effects of small doses of radiation. For immediate questions, this work provides a well-organized brief summary of recent radiologic data from refereed scientific literature and from the publications of advisory groups such as the National Council of Radiation Protection and Measurement (NCRP), the International Commission on Radiological Protection (ICRP), the United Nations Scientific Committee on the Effects of Atomic Radiation (UNSCEAR), and the National Academy of Sciences (NAS). Since it consists almost entirely of tables and graphs from the above-mentioned sources along with summary paragraphs, the Fact Book is very useful in the preparation of lectures. The book is divided into seven sections. Chapter One, Glossary, Units and Conversion Factors, is useful because nearly all data given in the rest of the book is in conventional units and should be converted to SI units for future technical audiences. Chapter 2, Radiobiology, covers the fundamental principles of the field. Chapter 3, Radiation Doses, can be used to help an audience appreciate the relative magnitudes of radiation exposures they may read about or encounter. Chapter 4, Late Somatic Effects of Low Doses of Ionizing Radiation, gives data concerning cancer induction and embryonic effects, and Chapter 5 provides data on genetic effects Chapter 6, Risks, Statistical Facts and Public Perception can be used to compare the risks of radiation exposure with more commonly encountered risks

  15. Status of JSFR development in phase I FaCT project

    International Nuclear Information System (INIS)

    Aoto, Kazumi; Chikazawa, Yoshitaka; Kotake, Shoji; Ito, Takaya

    2011-01-01

    The Fast Reactor Cycle Technology Development (FaCT) project is pursuing commercialization of fast reactor cycle system around 2050 under cooperation of MEXT (Ministry of Education, Culture, Sports, Science and Technology), METI (Ministry of Economy, Trade and Industry), utilities, venders and JAEA (Japan Atomic Energy Agency). As results of the FaCT Phase I, the key technologies for Japan Sodium-cooled Fast Reactor (JSFR) has been evaluated. (author)

  16. CONSIDERATIONS ON OBJECT-ORIENTED PROGRAMMING ENVIRONMENT AUTOCAD DRAWINGS

    OpenAIRE

    PINTILIE Alexandru; AVRAM Elena Rita

    2015-01-01

    In recent years, Low Cost CAD systems are widespread in the technical world. Currently, the highest-rated CAD system is AutoCAD due to the fact that in association with AutoLISP programming language covered a broad range of production needs. As a high-level programming language, AutoLISP provides an easy and efficient programming technique that leads to automation and parameterization of AutoCAD commands and reduces the time spending for designing the drawings. This paper aims to highlight th...

  17. Soft Costs Fact Sheet

    Energy Technology Data Exchange (ETDEWEB)

    None

    2016-05-01

    This fact sheet is an overview of the systems integration subprogram at the U.S. Department of Energy SunShot Initiative. Soft costs can vary significantly as a result of a fragmented energy marketplace. In the U.S., there are 18,000 jurisdictions and 3,000 utilities with different rules and regulations for how to go solar. The same solar equipment may vary widely in its final installation price due to process and market variations across jurisdictions, creating barriers to rapid industry growth. SunShot supports the development of innovative solutions that enable communities to build their local economies and establish clean energy initiatives that meet their needs, while at the same time creating sustainable solar market conditions.

  18. DESIGN AND LICENSING TRENDS OF THE GENERAL EDUCATIONAL PROGRAMS IN LATVIA

    OpenAIRE

    Mihailovs, Ivans Jānis; Krūmiņa, Aira Aija

    2016-01-01

    The general education program designing and licensing trends in Latvia in the period from 2010 to 2014 are analyzed in the article. Based on the general education program licensing data, it found that there isn’t a trend to license author’s program in primary education, while the secondary level of education author's programs are designed and licensed more often. The fact that primary education is more licensed programs in mathematics, science and technology, but in general secondary educatio...

  19. Getting the Facts on Food Allergy Testing

    Science.gov (United States)

    Getting the Facts on Food Allergy Testing This article has been reviewed by Thanai Pongdee, MD, FAAAAI If you have ever experienced red, itchy skin, swell- ... food, you may wonder if you have a food allergy. While diagnosing food allergies can be tricky, an ...

  20. Preventing Smoking among Hispanic Preadolescents: Program Orientation, Participant Individualism-Collectivism, and Acculturation

    Science.gov (United States)

    Lopez, Stella G.; Garza, Raymond T.; Gonzalez-Blanks, Ana G.

    2012-01-01

    The present study examined the role of individualism-collectivism (IC) and acculturation in smoking prevention programs for Hispanic preadolescents. The sixth graders received a collectivist or individualist curriculum. Both programs contained knowledge-based facts about smoking. The collectivist condition included an interdependent…

  1. FACT. Influence of night sky background photons and crosstalk

    Energy Technology Data Exchange (ETDEWEB)

    Buss, Jens; Temme, Fabian [Experimentelle Physik 5b, TU Dortmund (Germany); Mueller, Sebastian [IPP, ETH Zuerich (Switzerland); Collaboration: FACT-Collaboration

    2016-07-01

    During the last four years, the First G-APD Cherenkov Telescope (FACT) established silicon-based photo detectors as a valid concept for the imaging atmospheric Cherenkov technique. These detectors, namely silicon photo multipliers (SiPMs), are more robust to bright light conditions than conventional photo multiplier tubes (PMTs). At the same time, SiPMs feature a high photon detection efficiency. As a consequence, this technology yields observations at bright light conditions where PMTs would be damaged. However, dark counts and night sky background light (NSB), in combination with optical crosstalk and after-pulses contribute to the extracted signal from Cherenkov photons. Therefore, they cause a bias on the photon charge extraction and any subsequent analysis steps. Consequently, it is necessary to understand their impact on the data of FACT. This presentation will show the influence of changing NSB and crosstalk conditions on the performance of FACT. Therefore, the influence on the analysis chain is investigated on basis of data that were taken at different NSB conditions as well as dedicated Monte Carlo simulations.

  2. Down Syndrome: General Information. Fact Sheet Number 4 = El Sindrome de Down: Informacion General. Fact Sheet Number 15.

    Science.gov (United States)

    Interstate Research Associates, McLean, VA.

    This fact sheet on Down Syndrome is offered in both English and Spanish. First it provides a definition and description of this syndrome, noting its etiology in a chromosomal abnormality. Incidence figures are then given. Typical characteristics of people with Down Syndrome are listed. Commonly associated health-related problems are noted,…

  3. Fact Sheets: Air Toxics Rules for the Manufacture of Amino/Phenolic Resins

    Science.gov (United States)

    This page contains a December 1999 fact sheet for the proposed National Emission Standards for Hazardous Air Pollutants (NESHAP): Manufacture of Amino/Phenolic Resins and a September 2014 fact sheet with information regarding the final NESHAP

  4. How to Read a Nutrition Facts Label

    Medline Plus

    Full Text Available ... Behavior School & Family Life First Aid & Safety Doctors & Hospitals Videos Recipes for Kids Kids site Sitio para ... nutricionales (video) Most packaged foods come with a Nutrition Facts label. These labels have a lot of important ... Policy Permissions Guidelines Privacy Policy & Terms of Use Notice ...

  5. FACT. Multivariate extraction of muon ring images

    Energy Technology Data Exchange (ETDEWEB)

    Noethe, Maximilian; Temme, Fabian; Buss, Jens [Experimentelle Physik 5b, TU Dortmund, Dortmund (Germany); Collaboration: FACT-Collaboration

    2016-07-01

    In ground-based gamma-ray astronomy, muon ring images are an important event class for instrument calibration and monitoring of its properties. In this talk, a multivariate approach will be presented, that is well suited for real time extraction of muons from data streams of Imaging Atmospheric Cherenkov Telescopes (IACT). FACT, the First G-APD Cherenkov Telescope is located on the Canary Island of La Palma and is the first IACT to use Silicon Photomultipliers for detecting the Cherenkov photons of extensive air showers. In case of FACT, the extracted muon events are used to calculate the time resolution of the camera. In addition, the effect of the mirror alignment in May 2014 on properties of detected muons is investigated. Muon candidates are identified with a random forest classification algorithm. The performance of the classifier is evaluated for different sets of image parameters in order to compare the gain in performance with the computational costs of their calculation.

  6. Hemophilia Facts

    Science.gov (United States)

    ... public health webinars on blood disorders Basics About Hemophilia Language: English (US) Español (Spanish) Recommend on Facebook ... the 5" Key prevention messages from the National Hemophilia Foundation’s National Prevention Program Tips for Healthy Living ...

  7. Food irradiation: Facts or fiction?

    International Nuclear Information System (INIS)

    Loaharanu, P.

    1990-01-01

    Food irradiation is at a political crossroad. In one direction, it is moving forward supported by overwhelming scientific evidence of its safety and benefits to economy and health. In the opposite direction, it threatens to be derailed by misleading claims about its safety and usefulness. Whether people will ultimately benefit from the use of irradiation to help fight serious food problems, or whether they will allow the technology to go to waste, will be determined by how successful people are in separating the facts from the fiction of food irradiation

  8. Cerebral Palsy. Fact Sheet = La Paralisis Cerebral. Hojas Informativas Sobre Discapacidades.

    Science.gov (United States)

    National Information Center for Children and Youth with Disabilities, Washington, DC.

    This fact sheet on cerebral palsy is written in both English and Spanish. First, it provides a definition of cerebral palsy and considers various causes (e.g., an insufficient amount of oxygen reaching the fetal or newborn brain). The fact sheet then offers incidence figures and explains characteristics of the three main types of cerebral palsy:…

  9. Mistake and non-disclosure of facts: models for English contract law

    NARCIS (Netherlands)

    Beale, H.

    2012-01-01

    This book examines the case for reforming the law on mistake and non-disclosure of fact to bring English law closer to the law in much of continental Europe. There, and in common law countries like the US, a party may avoid a contract for mistake of fact on a more liberal basis, and a party who

  10. Impact of Augmented Reality on Programming Language Learning: Efficiency and Perception

    Science.gov (United States)

    Teng, Chin-Hung; Chen, Jr-Yi; Chen, Zhi-Hong

    2018-01-01

    Although the learning of programming language is critical in science and technology education, it might be difficult for some students, especially novices. One possible reason might be the fact that programming language, especially for three-dimensional (3D) applications, is too complex and abstract for these students to understand. Programming…

  11. (facts) to improve the power flow control in the nigeria transmission n

    African Journals Online (AJOL)

    BARTH EKWUEME

    from FACTS devices over conventional control devices employed in the present network in Nigeria. The study ... Deregulation in the power industry has led to an ... losses added to the cost of FACTS shows that the new .... mainly gas fired1[6].

  12. Fact or fallacy? Immunisation arguments in the New Zealand print media.

    Science.gov (United States)

    Petousis-Harris, Helen A; Goodyear-Smith, Felicity A; Kameshwar, Kamya; Turner, Nikki

    2010-10-01

    To explore New Zealand's four major daily newspapers' coverage of immunisation with regards to errors of fact and fallacy in construction of immunisation-related arguments. All articles from 2002 to 2007 were assessed for errors of fact and logic. Fact was defined as that which was supported by the most current evidence-based medical literature. Errors of logic were assessed using a classical taxonomy broadly based in Aristotle's classifications. Numerous errors of both fact and logic were identified, predominantly used by anti-immunisation proponents, but occasionally by health authorities. The proportion of media articles reporting exclusively fact changes over time during the life of a vaccine where new vaccines incur little fallacious reporting and established vaccines generate inaccurate claims. Fallacious arguments can be deconstructed and classified into a classical taxonomy including non sequitur and argumentum ad Hominem. Most media 'balance' given to immunisation relies on 'he said, she said' arguments using quotes from opposing spokespersons with a failure to verify the scientific validity of both the material and the source. Health professionals and media need training so that recognising and critiquing public health arguments becomes accepted practice: stronger public relations strategies should challenge poor quality articles to journalists' code of ethics and the health sector needs to be proactive in predicting and pre-empting the expected responses to introduction of new public health initiatives such as a new vaccine. © 2010 The Authors. Journal Compilation © 2010 Public Health Association of Australia.

  13. TSCA Chemical Data Reporting Fact Sheet: Imported Articles

    Science.gov (United States)

    This fact sheet provides guidance and sample reporting scenarios on the reporting exemption for the import of a chemical substance as part of an article, for purposes of the Chemical Data Reporting (CDR) rule.

  14. Implementasi Program Bimbngan dan Konseling

    Directory of Open Access Journals (Sweden)

    Annas Kamil

    2016-10-01

    Full Text Available Abstract: Basic tasks the teacher supervisor is compiling the program guidance and counseling, implement the program guidance and counseling, evaluate program implementation guidance and counseling, analysis of the results of the implementation of the guidance and counseling and follow-up program implementation guidance and counseling to learners who becomes his responsibility. In fact guidance and counseling teachers of government senior high schools in Solok Regency did not elaborate on the program guidance and counseling in accordance with the types of services and areas of development without any elaboration time allocation, class of service to be provided, the material will be presented and didn’t have the weekly program of guidance and counseling. This study used a descriptive approach. The population of the research is all of guidance and counseling teachers in government senior high schools in Solok Regency, totally 49 people with sampling techniques namely the sampling area of 32 people. Data collection techniques using question form. The Data were analyzed using percentage technique.

  15. Toxicity of Pesticides. Agrichemical Fact Sheet 2.

    Science.gov (United States)

    Hock, Winand K.

    This fact sheet gives the acute oral and dermal toxicity (LD 50) of over 250 pesticides in lab animals. The chemicals are categorized as fungicides, herbicides, insecticides, or miscellaneous compounds. One or more trade names are given for each pesticide. In addition, a brief explanation of toxicity determination is given. (BB)

  16. Hippocrates: facts and fiction | Retief | Acta Theologica

    African Journals Online (AJOL)

    Hippocrates, the Father of Medicine, is reviewed as a historical person and in terms of his contribution to medicine in order to distinguish fact from fiction. Contemporary and later sources reveal that many (possibly untrue) legends accumulated around this enigmatic figure. The textual tradition and the composition of the ...

  17. Facts against nuclear electricity generation. 2. enlarged ed.

    International Nuclear Information System (INIS)

    Buechele, C.

    1986-01-01

    The book destroys a legend. The nuclear cartel still goes on telling the tale of safety, environmental compatibility and economic efficiency of nuclear electricity generation. But nothing in this story stands the test: Bare facts destroy the legend. Up to now, only insiders have been able to state counterarguments. The book in hand now presents in a nutshell all results and experience and facts to be brought forward against nuclear electricity generation. The material is presented in a problem-oriented, reliable and comprehensible manner. Anyone who long since suspected lies and malinformation of the public will step by step find the arguments justifying his suspicion. In an annex, Harald Gaber explains the Chernobyl disaster and its consequences. A literature index with comments is a helpful guide for further reading. (orig.) [de

  18. NASA Aviation Safety Program Systems Analysis/Program Assessment Metrics Review

    Science.gov (United States)

    Louis, Garrick E.; Anderson, Katherine; Ahmad, Tisan; Bouabid, Ali; Siriwardana, Maya; Guilbaud, Patrick

    2003-01-01

    The goal of this project is to evaluate the metrics and processes used by NASA's Aviation Safety Program in assessing technologies that contribute to NASA's aviation safety goals. There were three objectives for reaching this goal. First, NASA's main objectives for aviation safety were documented and their consistency was checked against the main objectives of the Aviation Safety Program. Next, the metrics used for technology investment by the Program Assessment function of AvSP were evaluated. Finally, other metrics that could be used by the Program Assessment Team (PAT) were identified and evaluated. This investigation revealed that the objectives are in fact consistent across organizational levels at NASA and with the FAA. Some of the major issues discussed in this study which should be further investigated, are the removal of the Cost and Return-on-Investment metrics, the lack of the metrics to measure the balance of investment and technology, the interdependencies between some of the metric risk driver categories, and the conflict between 'fatal accident rate' and 'accident rate' in the language of the Aviation Safety goal as stated in different sources.

  19. Stabilization of Nucleosomes by Histone Tails and by FACT Revealed by spFRET Microscopy

    Directory of Open Access Journals (Sweden)

    Maria E. Valieva

    2017-01-01

    Full Text Available A correct chromatin structure is important for cell viability and is tightly regulated by numerous factors. Human protein complex FACT (facilitates chromatin transcription is an essential factor involved in chromatin transcription and cancer development. Here FACT-dependent changes in the structure of single nucleosomes were studied with single-particle Förster resonance energy transfer (spFRET microscopy using nucleosomes labeled with a donor-acceptor pair of fluorophores, which were attached to the adjacent gyres of DNA near the contact between H2A-H2B dimers. Human FACT and its version without the C-terminal domain (CTD and the high mobility group (HMG domain of the structure-specific recognition protein 1 (SSRP1 subunit did not change the structure of the nucleosomes, while FACT without the acidic C-terminal domains of the suppressor of Ty 16 (Spt16 and the SSRP1 subunits caused nucleosome aggregation. Proteolytic removal of histone tails significantly disturbed the nucleosome structure, inducing partial unwrapping of nucleosomal DNA. Human FACT reduced DNA unwrapping and stabilized the structure of tailless nucleosomes. CTD and/or HMG domains of SSRP1 are required for this FACT activity. In contrast, previously it has been shown that yeast FACT unfolds (reorganizes nucleosomes using the CTD domain of SSRP1-like Pol I-binding protein 3 subunit (Pob3. Thus, yeast and human FACT complexes likely utilize the same domains for nucleosome reorganization and stabilization, respectively, and these processes are mechanistically similar.

  20. Research program with no ''measurement problem''

    International Nuclear Information System (INIS)

    Noyes, H.P.; Gefwert, C.; Manthey, M.J.

    1985-07-01

    The ''measurement problem'' of contemporary physics is met by recognizing that the physicist participates when constructing and when applying the theory consisting of the formulated formal and measurement criteria (the expressions and rules) providing the necessary conditions which allow him to compute and measure facts, yet retains objectivity by requiring that these criteria, rules and facts be in corroborative equilibrium. We construct the particulate states of quantum physics by a recursive program which incorporates the non-determinism born of communication between asynchronous processes over a shared memory. Their quantum numbers and coupling constants arise from the construction via the unique 4-level combinatorial hierarchy. The construction defines indivisible quantum events with the requisite supraluminal correlations, yet does not allow supraluminal communication. Measurement criteria incorporate c, h-bar, and m/sub p/ or (not ''and'') G. The resulting theory is discrete throughout, contains no infinities, and, as far as we have developed it, is in agreement with quantum mechanical and cosmological fact

  1. Verification of Imperative Programs by Constraint Logic Program Transformation

    Directory of Open Access Journals (Sweden)

    Emanuele De Angelis

    2013-09-01

    Full Text Available We present a method for verifying partial correctness properties of imperative programs that manipulate integers and arrays by using techniques based on the transformation of constraint logic programs (CLP. We use CLP as a metalanguage for representing imperative programs, their executions, and their properties. First, we encode the correctness of an imperative program, say prog, as the negation of a predicate 'incorrect' defined by a CLP program T. By construction, 'incorrect' holds in the least model of T if and only if the execution of prog from an initial configuration eventually halts in an error configuration. Then, we apply to program T a sequence of transformations that preserve its least model semantics. These transformations are based on well-known transformation rules, such as unfolding and folding, guided by suitable transformation strategies, such as specialization and generalization. The objective of the transformations is to derive a new CLP program TransfT where the predicate 'incorrect' is defined either by (i the fact 'incorrect.' (and in this case prog is not correct, or by (ii the empty set of clauses (and in this case prog is correct. In the case where we derive a CLP program such that neither (i nor (ii holds, we iterate the transformation. Since the problem is undecidable, this process may not terminate. We show through examples that our method can be applied in a rather systematic way, and is amenable to automation by transferring to the field of program verification many techniques developed in the field of program transformation.

  2. New Data on Autism: Five Facts to Know

    Science.gov (United States)

    ... this? Submit Button Past Emails New Data on Autism: Five Facts to Know Language: English (US) Español ( ... Tweet Share Compartir Many children are living with autism spectrum disorder (ASD), and they need services and ...

  3. Key Facts about Influenza (Flu) and Flu Vaccine

    Science.gov (United States)

    ... Swine Variant Pandemic Other Key Facts About Influenza (Flu) Language: English (US) Español Recommend on Facebook Tweet ... Flu Treating Flu What is Influenza (also called Flu)? The flu is a contagious respiratory illness caused ...

  4. Emotional Disturbance. NICHCY Disability Fact Sheet #5

    Science.gov (United States)

    National Dissemination Center for Children with Disabilities, 2010

    2010-01-01

    The mental health of our children is a natural and important concern for us all. The fact is, many mental disorders have their beginnings in childhood or adolescence, yet may go undiagnosed and untreated for years. "Umbrella" terms such as emotional disturbance, behavioral disorders, or mental illness are used to refer to mental…

  5. Houston Community College 2011-2012 Fact Book

    Science.gov (United States)

    Houston Community College System, Office of Institutional Research, 2012

    2012-01-01

    The Houston Community College (HCC) 2011-2012 Fact Book provides statistical information about the college district. It is important for the reader to be aware that data presented in this publication may differ slightly from statistics found in other district reports. Such variances may result from differences methodology including the source of…

  6. Houston Community College 2010-2011 Fact Book

    Science.gov (United States)

    Houston Community College System, Office of Institutional Research, 2011

    2011-01-01

    The Houston Community College (HCC) 2010-2011 Fact Book provides statistical information about the college district. It is important for the reader to be aware that data presented in this publication may differ slightly from statistics found in other district reports. Such variances may result from differences methodology including the source of…

  7. Facts about food irradiation: Status and trends

    International Nuclear Information System (INIS)

    1991-01-01

    This fact sheet introduces the concept of irradiating food to reduce post-harvest losses from infestation, contamination and spoilage, to lower the incidence of foodborne diseases and to assist international trade in food products by offering an alternative to fumigation or some other treatments that may not be acceptable to the importing countries

  8. Non-destructive testing: significant facts

    International Nuclear Information System (INIS)

    Espejo, Hector; Ruch, Marta C.

    2006-01-01

    In the last fifty years different organisations, both public and private, have been assigned to the mission of introducing into the country the most relevant aspects of the modern technological discipline 'Non Destructive Testing' (NDT) through a manifold of activities, such as training and education, research, development, technical assistance and services, personnel qualification/certification and standardisation. A review is given of the significant facts in this process, in which the Argentine Atomic Energy Commission, CNEA, played a leading part, a balance of the accomplishments is made and a forecast of the future of the activity is sketched. (author) [es

  9. Large truck and bus crash facts, 2008. 

    Science.gov (United States)

    2010-03-01

    This annual edition of Large Truck and Bus Crash Facts contains descriptive statistics about fatal, injury, and : property damage only crashes involving large trucks and buses in 2008. Selected crash statistics on passenger : vehicles are also presen...

  10. CPR Facts and Stats

    Science.gov (United States)

    ... In Schools Training Kits RQI AHA Blended Learning & eLearning Guide AHA Instructors ECC Educational Conferences Programs CPR ... In Schools Training Kits RQI AHA Blended Learning & eLearning Guide AHA Instructors ECC Educational Conferences Programs CPR ...

  11. Synthesis of a hybrid model of the VSC FACTS devices and HVDC technologies

    Science.gov (United States)

    Borovikov, Yu S.; Gusev, A. S.; Sulaymanov, A. O.; Ufa, R. A.

    2014-10-01

    The motivation of the presented research is based on the need for development of new methods and tools for adequate simulation of FACTS devices and HVDC systems as part of real electric power systems (EPS). The Research object: An alternative hybrid approach for synthesizing VSC-FACTS and -HVDC hybrid model is proposed. The results: the VSC- FACTS and -HVDC hybrid model is designed in accordance with the presented concepts of hybrid simulation. The developed model allows us to carry out adequate simulation in real time of all the processes in HVDC, FACTS devices and EPS as a whole without any decomposition and limitation on their duration, and also use the developed tool for effective solution of a design, operational and research tasks of EPS containing such devices.

  12. Synthesis of a hybrid model of the VSC FACTS devices and HVDC technologies

    International Nuclear Information System (INIS)

    Borovikov, Yu S; Gusev, A S; Sulaymanov, A O; Ufa, R A

    2014-01-01

    The motivation of the presented research is based on the need for development of new methods and tools for adequate simulation of FACTS devices and HVDC systems as part of real electric power systems (EPS). The Research object: An alternative hybrid approach for synthesizing VSC-FACTS and -HVDC hybrid model is proposed. The results: the VSC- FACTS and -HVDC hybrid model is designed in accordance with the presented concepts of hybrid simulation. The developed model allows us to carry out adequate simulation in real time of all the processes in HVDC, FACTS devices and EPS as a whole without any decomposition and limitation on their duration, and also use the developed tool for effective solution of a design, operational and research tasks of EPS containing such devices

  13. Facts about Type 2

    Medline Plus

    Full Text Available ... Enroll in the Living WIth Type 2 Diabetes Program Gestational What is Gestational Diabetes? How to Treat ... Enroll in the Living WIth Type 2 Diabetes Program In It Together We Can Help Center for ...

  14. Facts about Type 2

    Medline Plus

    Full Text Available ... Hispanic Heritage Month African American Programs Latino Programs Asian Americans, Native Hawaiians and Pacific Islanders American Indian/ ... common in African Americans, Latinos, Native Americans, and Asian Americans/Pacific Islanders, as well as the aged ...

  15. TSCA Chemical Data Reporting Fact Sheet: Articles

    Science.gov (United States)

    This fact sheet provides guidance on classifying articles under the Toxic Substances Control Act (TSCA) and determining the applicability of EPA’s articles exclusion policy for purposes of the Chemical Data Reporting (CDR) rule. The primary goal of this document is to help the regulated community comply with the requirements of the CDR rule.

  16. Non-linear frequency scale mapping for voice conversion in text-to-speech system with cepstral description

    Czech Academy of Sciences Publication Activity Database

    Přibilová, Anna; Přibil, Jiří

    2006-01-01

    Roč. 48, č. 12 (2006), s. 1691-1703 ISSN 0167-6393 R&D Projects: GA MŠk(CZ) OC 277.001; GA AV ČR(CZ) 1QS108040569 Grant - others:MŠk(SK) 102/VTP/2000; MŠk(SK) 1/3107/06 Institutional research plan: CEZ:AV0Z20670512 Keywords : signal processing * speech processing * speech synthesis Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.678, year: 2006

  17. Functional cooperation between FACT and MCM is coordinated with cell cycle and differential complex formation

    Directory of Open Access Journals (Sweden)

    Lin Chih-Li

    2010-02-01

    Full Text Available Abstract Background Functional cooperation between FACT and the MCM helicase complex constitutes an integral step during DNA replication initiation. However, mode of regulation that underlies the proper functional interaction of FACT and MCM is poorly understood. Methods & Results Here we present evidence indicating that such interaction is coordinated with cell cycle progression and differential complex formation. We first demonstrate the existence of two distinct FACT-MCM subassemblies, FACT-MCM2/4/6/7 and FACT-MCM2/3/4/5. Both complexes possess DNA unwinding activity and are subject to cell cycle-dependent enzymatic regulation. Interestingly, analysis of functional attributes further suggests that they act at distinct, and possibly sequential, steps during origin establishment and replication initiation. Moreover, we show that the phosphorylation profile of the FACT-associated MCM4 undergoes a cell cycle-dependent change, which is directly correlated with the catalytic activity of the FACT-MCM helicase complexes. Finally, at the quaternary structure level, physical interaction between FACT and MCM complexes is generally dependent on persistent cell cycle and further stabilized upon S phase entry. Cessation of mitotic cycle destabilizes the complex formation and likely leads to compromised coordination and activities. Conclusions Together, our results correlate FACT-MCM functionally and temporally with S phase and DNA replication. They further demonstrate that enzymatic activities intrinsically important for DNA replication are tightly controlled at various levels, thereby ensuring proper progression of, as well as exit from, the cell cycle and ultimately euploid gene balance.

  18. Facts about Type 2

    Medline Plus

    Full Text Available ... Hispanic Heritage Month African American Programs Latino Programs Asian Americans, Native Hawaiians and Pacific Islanders American Indian/Alaska ... common in African Americans, Latinos, Native Americans, and Asian Americans/Pacific Islanders, as well as the aged population. ...

  19. Is Natural Language a Perigraphic Process? The Theorem about Facts and Words Revisited

    Directory of Open Access Journals (Sweden)

    Łukasz Dębowski

    2018-01-01

    Full Text Available As we discuss, a stationary stochastic process is nonergodic when a random persistent topic can be detected in the infinite random text sampled from the process, whereas we call the process strongly nonergodic when an infinite sequence of independent random bits, called probabilistic facts, is needed to describe this topic completely. Replacing probabilistic facts with an algorithmically random sequence of bits, called algorithmic facts, we adapt this property back to ergodic processes. Subsequently, we call a process perigraphic if the number of algorithmic facts which can be inferred from a finite text sampled from the process grows like a power of the text length. We present a simple example of such a process. Moreover, we demonstrate an assertion which we call the theorem about facts and words. This proposition states that the number of probabilistic or algorithmic facts which can be inferred from a text drawn from a process must be roughly smaller than the number of distinct word-like strings detected in this text by means of the Prediction by Partial Matching (PPM compression algorithm. We also observe that the number of the word-like strings for a sample of plays by Shakespeare follows an empirical stepwise power law, in a stark contrast to Markov processes. Hence, we suppose that natural language considered as a process is not only non-Markov but also perigraphic.

  20. Omnichannel Marketing. Facts & Figures. Denmark 2017

    DEFF Research Database (Denmark)

    Futtrup Kjær, Jan; Kjær Jacobsen, Christine; Bjerre Herdel, Stine

    This NBI Omnichannel Facts and Figures report highlights the central findings from the NBI Omnichannel capability benchmarking tool, based on data collected in 2015 and 2016. The insights shared here provide an understanding of the way companies and marketing departments are working to deliver...... on - and adapt to - the challenges and opportunities related to the customer-centric, omnichannel experience. View this report as a data-freeze and analysis on the status of omnichannel in Denmark as of 2017....

  1. CONSIDERATIONS ON OBJECT-ORIENTED PROGRAMMING ENVIRONMENT AUTOCAD DRAWINGS

    Directory of Open Access Journals (Sweden)

    PINTILIE Alexandru

    2015-06-01

    Full Text Available In recent years, Low Cost CAD systems are widespread in the technical world. Currently, the highest-rated CAD system is AutoCAD due to the fact that in association with AutoLISP programming language covered a broad range of production needs. As a high-level programming language, AutoLISP provides an easy and efficient programming technique that leads to automation and parameterization of AutoCAD commands and reduces the time spending for designing the drawings. This paper aims to highlight the advantages of using AutoLISP programming environment in the 2D drafting and 3D modeling using AutoCAD tools.

  2. The Solid* toolset for software visual analytics of program structure and metrics comprehension : From research prototype to product

    NARCIS (Netherlands)

    Reniers, Dennie; Voinea, Lucian; Ersoy, Ozan; Telea, Alexandru

    2014-01-01

    Software visual analytics (SVA) tools combine static program analysis and fact extraction with information visualization to support program comprehension. However, building efficient and effective SVA tools is highly challenging, as it involves extensive software development in program analysis,

  3. FACT light collection - solid light concentrators in Cherenkov Astronomy

    Energy Technology Data Exchange (ETDEWEB)

    Braun, Isabel [ETH Zurich, Institute for Particle Physics, CH-8093 Zurich (Switzerland); Collaboration: FACT-Collaboration

    2011-07-01

    Pixelized cameras of Imaging Atmospheric Cherenkov Telescopes use hollow light guides with reflective surfaces based on the Winston cone design. These cones minimize insensitive spaces between the photo sensors and shield the camera from stray background light by limiting the angular acceptance to the primary reflector area. FACT (First G-APD Cherenkov Telescope) will be the first IACT with Geiger-mode avalanche photodiodes as light sensors. Solid light concentrators complementing these sensors will be used instead of hollow Winston cones. We will present simulations and measurements of our light collector design, which was optimized for the requirements of the FACT telescope and detector, and discuss the specific differences to more traditional solutions.

  4. Fast reactor cycle technology development. 'FaCT seminar - R and D for key technology of national importance'. Seminar report and collection of documents

    International Nuclear Information System (INIS)

    2008-03-01

    An R and D program on the fast breeder reactor cycle commercialization, the FaCT Project, which was selected as one of the Key Technologies of National Importance, has been conducted at the Japan Atomic Energy Agency for the purposes of resolving the issues of long-term sustainable energy supply and the global warming. The first Seminar of the FaCT Project was held at the Osaka Science and Technology Center on November 30, 2007, to present the progress and status of the Project and exchange opinions among the participants from various sectors. In the Seminar, MEXT, METI and JAEA reported the national nuclear policy, the current status and future plan of the FaCT Project. A special panel session was also held on the approach to international collaboration relevant to the project, and the importance was stressed on further promoting the international collaboration and keeping the framework of international partnership in this area, while distinguishing the relationship between 'cooperation' and 'competition'. Over 260 audiences from various sectors including government, universities, research organizations, utilities, nuclear industries participated. This report provides a seminar summary and the presented papers. (author)

  5. Careers "Fact Sheets" for clinical engineering & biomedical technology.

    Science.gov (United States)

    Pacela, A F

    1991-01-01

    Three Careers "Fact Sheets" include information on CE and BMET job titles, job descriptions, and certification. These materials are intended to aid in furthering professional recognition for Clinical Engineers and BMETs, and may be useful in communicating with Administration or Human Resources departments.

  6. General Information about Learning Disabilities (Fact Sheet Number 7) = Informacion General sobre Impedimentos en el Aprendizaje (Fact Sheet Number 19).

    Science.gov (United States)

    Interstate Research Associates, Inc., Washington, DC.

    This fact sheet providing general information about learning disabilities is presented in both English and Spanish versions. It begins with the federal definition of learning disabilities and a discussion of its implications followed by estimates of incidence. Typical characteristics of students with learning disabilities are then summarized as…

  7. Facts and Fiction on Ultraviolet Protection by Clothing

    International Nuclear Information System (INIS)

    Osterwalder, U.; Schlenker, W.; Rohwer, H.; Martin, E.; Schuh, S.

    2000-01-01

    With the increase of skin cancer the fact that not all apparel is sufficiently protective against UV Radiation is becoming better know to the public. There is an emerging market for UV protective clothing. Its need is not commonly accepted. Understanding of the influencing factors is low. To the consumer it is not always clear what is fact and what is fiction. This paper answers six frequently asked questions. (1) The need for improving UV protection by clothing is demonstrated by UV transmittance measurements in public. (2) A pitfall in the generally recommended 'see through' assessment test is shown. (3) When a garment gets wet its UV protection is not necessarily poor. (4) The reduced UV protection of stretched knitwear can be accounted for. (5) A real life study confirms that UV protection is not washed out. (6) UV protection can be washed in with special additives to laundry products. (author)

  8. Groups of Fact in Computer Society

    Directory of Open Access Journals (Sweden)

    Maria Cristina Cereser Pezzella

    2015-12-01

    groups and the fact groups, presenting these as subjects, although without constituting a society. Technological changes led to the formation of so-called cyberspace, which enabled a change in the own way of understanding the reality through faster diffusion of the most varied content information, thus allowing not only a quicker movement of goods and messages, as well as the modification of habits and even the conversion of practically any cultural product in assets to be profitable exploitation, aimed at consumption.

  9. Teaching Facts of Addition to Brazilian Children with Attention-Deficit/Hyperactivity Disorder

    Science.gov (United States)

    Costa, Adriana Corrêa; Rohde, Luis Augusto; Dorneles, Beatriz Vargas

    2015-01-01

    Storage and/or automatic retrieval of the basic facts of addition from the long-term memory seems to be impaired in children with ADHD presenting arithmetical difficulties. The present study was carried out to evaluate the effectiveness of an educational intervention model designed to teach basic facts of addition as a means of advancing from…

  10. Quasi-Experimental Evaluation of a Student Mentoring Program

    OpenAIRE

    Sandner, Malte

    2013-01-01

    This paper presents evidence from a natural-experiment which evaluates the effectiveness of a student mentoring program. The mentoring includes several compulsory, scheduled, faceto- face appointments between a mentor and a student in the first study year. All mentors are graduated and employed by the institution. For the evaluation, I use the fact that the mentoring is only offered to students in an economics and management program, whereas it is not offered to students in an industrial engi...

  11. Facts about food irradiation: Food irradiation costs

    International Nuclear Information System (INIS)

    1991-01-01

    This fact sheet gives the cost of a typical food irradiation facility (US $1 million to US $3 million) and of the food irradiation process (US $10-15 per tonne for low-dose applications; US $100-250 per tonne for high-dose applications). These treatments also bring consumer benefits in terms of availability, storage life and improved hygiene. 2 refs

  12. Function assertive community treatment (FACT) and psychiatric service use in patients diagnosed with severe mental illness.

    Science.gov (United States)

    Drukker, M; van Os, J; Sytema, S; Driessen, G; Visser, E; Delespaul, P

    2011-09-01

    Previous work suggests that the Dutch variant of assertive community treatment (ACT), known as Function ACT (FACT), may be effective in increasing symptomatic remission rates when replacing a system of hospital-based care and separate community-based facilities. FACT guidelines propose a different pattern of psychiatric service consumption compared to traditional services, which should result in different costing parameters than care as usual (CAU). South-Limburg FACT patients, identified through the local psychiatric case register, were matched with patients from a non-FACT control region in the North of the Netherlands (NN). Matching was accomplished using propensity scoring including, among others, total and outpatient care consumption. Assessment, as an important ingredient of FACT, was the point of departure of the present analysis. FACT patients, compared to CAU, had five more outpatient contacts after the index date. Cost-effectiveness was difficult to assess. Implementation of FACT results in measurable changes in mental health care use.

  13. Facts about food irradiation: Packaging of irradiated foods

    International Nuclear Information System (INIS)

    1991-01-01

    This fact sheet considers the effects on packaging materials of food irradiation. Extensive research has shown that almost all commonly used food packaging materials toted are suitable for use. Furthermore, many packaging materials are themselves routinely sterilized by irradiation before being used. 2 refs

  14. Are we reaching the target audience? Evaluation of a fish fact sheet.

    Science.gov (United States)

    Burger, J; Waishwell, L

    2001-09-28

    According to the US Environmental Protection Agency, over 16% of freshwater lakes and 7% of the rivers are under some sort of fish consumption advisory because of the presence of toxic chemicals. There is considerable interest in the issuing of information, advisories, and fact sheets concerning the consumption of wild-caught fish from contaminated waters, and in the actual consumption patterns of subsistence and recreational anglers. Despite the large number of consumption advisories issued by state agencies, there is little information on how these advisories, or other forms of risk communication, are perceived by target audiences, notably fishermen and women of child-bearing age. The states of South Carolina and Georgia issue consumption advisories for fish from the Savannah River, among other sites. To gain a greater insight into the perception of anglers about a supplemental fish fact sheet jointly developed by South Carolina, Georgia, federal agencies, and the Consortium for Risk Evaluation with Stakeholder Participation, we interviewed fisherman along the Savannah River. The objectives were to determine: (1) whether they had previously read the Fish Fact Sheet or had heard about the consumption advisories; (2) what major message they obtained from the sheet; (3) who they felt the fact sheet was aimed at, and who should get the Fish Fact Sheet; (4) who should be concerned about health risks from consuming the fish; and (5) the best method of disseminating such information. We interviewed 92 fishermen (37% black, 62% white) during the fishing season of 1999. Half had heard some information about consumption advisories, mainly from the media (64%). The study concluded that there were no ethnic differences in whether they had heard about the advisories, understood the major message of the fact sheet, felt they could reduce their risk from consuming the fish, or felt that it made a difference which agency issued the fact sheet. There were significant ethnic

  15. FACT: taking a spiritual history in a clinical setting.

    Science.gov (United States)

    Larocca-Pitts, Mark A

    2008-01-01

    Healthcare clinicians need a good tool for taking spiritual histories in a clinical setting. A spiritual history provides important clinical information and any properly trained clinician can take one. Professionally trained chaplains follow-up with more in-depth spiritual assessments if indicated. A spiritual history tool's effectiveness depends on five criteria: brevity, memorability, appropriateness, patient-centeredness, and credibility (Koenig, 2007). The chaplain-developed FACT stands for: F-Faith (and/or Belief); A-Active (and/or Available, Accessible, Applicable); C-Coping (and/or Comfort)/Conflict (and/or Concern); and T-Treatment. FACT compares favorably, if not better in some categories, with three physician-developed spiritual history tools: Koenig's (2007) CSI-MEMO, American College of Physicians' tool (Lo, Quill, & Tulsky, 1999), and Puchalski's and Romer's (2000) FICA.

  16. Using the Frailty Assessment for Care Planning Tool (FACT to screen elderly chronic kidney disease patients for frailty: the nurse experience

    Directory of Open Access Journals (Sweden)

    Moffatt H

    2018-05-01

    frailty” were enhanced. Future nurse-led FACT screening initiatives should incorporate those factors identified as being integral to program success: realistic goals, clear guidelines, and ongoing training. Adopting the evaluation of frailty as a priority within clinical departments will encourage sustainability.Keywords: frailty, screening, feasibility, qualitative, end stage renal disease, decision making

  17. Herpes Can Happen to Anyone: Share Facts, Not Fears

    Science.gov (United States)

    ... promiscuous. Links Oral Herpes Sexually Transmitted Diseases Genital Herpes (CDC) Genital Herpes Fact Sheet (CDC) What You Need to Know About Genital Herpes Video (CDC) References Vaccination to Reduce Reactivation of ...

  18. 77 FR 40626 - RP9580.210, Personal Assistance Services in Shelters Fact Sheet

    Science.gov (United States)

    2012-07-10

    ... DEPARTMENT OF HOMELAND SECURITY Federal Emergency Management Agency [Docket ID FEMA-2012-0014] RP9580.210, Personal Assistance Services in Shelters Fact Sheet AGENCY: Federal Emergency Management... Management Agency (FEMA) is accepting comments on Recovery Fact Sheet RP9580.210, Personal Assistance...

  19. 2009 H1N1 Flu Vaccine Facts

    Science.gov (United States)

    ... of this page please turn Javascript on. Feature: Flu 2009 H1N1 Flu Vaccine Facts Past Issues / Fall 2009 Table of ... the H1N1 flu vaccine. 1 The 2009 H1N1 flu vaccine is safe and well tested. Clinical trials ...

  20. Facts about food irradiation: Genetic studies

    International Nuclear Information System (INIS)

    1991-01-01

    Results published in the mid-1970s from the National Institute of Nutrition (NIN) in India showed increased numbers of polyploid cells in rats, mice, monkeys and malnourished children fed irradiated wheat products. This fact sheet considers the validity of these results. A large number of independent studies have been subsequently performed, and in none of these have results been obtained that support the NIN findings. The conclusion is that there is no evidence to link the consumption of irradiated food with any mutagenic effect. 3 refs

  1. Final Rule for Industrial Process Cooling Towers: Fact Sheet

    Science.gov (United States)

    Fact sheet concerning a final rule to reduce air toxics emissions from industrial process cooling towers. Air toxics are those pollutants known or suspected of causing cancer or other serious health effects.

  2. Psychoacoustics Facts and Models

    CERN Document Server

    Fastl, Hugo

    2007-01-01

    Psychoacoustics – Facts and Models offers a unique, comprehensive summary of information describing the processing of sound by the human hearing system. It includes quantitative relations between sound stimuli and auditory perception in terms of hearing sensations, for which quantitative models are given, as well as an unequalled collection of data on the human hearing system as a receiver of acoustic information. In addition, many examples of the practical application of the results of basic research in fields such as noise control, audiology, or sound quality engineering are detailed. The third edition includes an additional chapter on audio-visual interactions and applications, plus more on applications throughout. Reviews of previous editions have characterized it as "an essential source of psychoacoustic knowledge," "a major landmark ," and a book that "without doubt will have a long-lasting effect on the standing and future evolution of this scientific domain."

  3. Katyn Massacre – Basic Facts

    Directory of Open Access Journals (Sweden)

    Monika Komaniecka

    2013-09-01

    Full Text Available Katyn is a symbol of the criminal policy of the Soviet system against the Polish nation. The present study aims to demonstrate the basic facts of Katyn massacre – the execution of almost 22,000 people: Polish prisoners of war in Katyn, Kharkov, Kalinin (Tver and also other Polish prisoners (soldiers and civilians, which took place in the spring of 1940 in different places of the Soviet Ukraine and Belarus republics based on the decision of the Soviet authorities, that is the Political Bureau of All-Union Communist Party (Bolsheviks of March 5, 1940. This article refers not only to the massacre itself, but also its origin, historical processes and the lies accompanying Katyn massacre.

  4. Implant removal after fracture healing : facts and fiction

    NARCIS (Netherlands)

    Vos, D.I.

    2013-01-01

    A frequently asked question to trauma and orthopaedic surgeons is whether and if yes, when an implant will be removed? Although implant removal after fracture healing is daily practice, a scientific basis doesn’t exist. All studies in this thesis were performed to unravel the facts and fiction of

  5. Epilepsy. Fact Sheet = Epilepsia. Hojas Informativas Sobre Discapacidades.

    Science.gov (United States)

    National Information Center for Children and Youth with Disabilities, Washington, DC.

    This fact sheet, written in both English and Spanish, provides a definition, information on incidence, typical characteristics, and educational implications of epilepsy. It notes that epilepsy is classified as "other health impaired" under the Individuals with Disabilities Education Act (IDEA) and that children with epilepsy or seizure disorders…

  6. African Americans: College Majors and Earnings. Fact Sheet

    Science.gov (United States)

    Carnevale, Anthony P.; Fasules, Megan L.; Porter, Andrea; Landis-Santos Jennifer

    2016-01-01

    Access to college for African Americans has increased, but African Americans are highly concentrated in lower-paying majors. The college major, which has critical economic consequences throughout life, reflects personal choices but also reflects the fact that African-American students are concentrated in open-access four-year institutions that…

  7. Fact sheet on thyroid test in Fukushima prefecture

    International Nuclear Information System (INIS)

    Hiranuma, Yuri

    2017-01-01

    Fukushima Prefecture chose about 360,000 people who were 18 years old or younger at the time of the accident at Fukushima Daiichi NPS on March 11, 2011, and started thyroid test as part of the prefectural health survey on October 9, 2011. The survey is entrusted to Fukushima Medical University of Medicine from Fukushima Prefecture. This fact sheet summarizes the current state of thyroid test in Fukushima Prefecture. A considerable amount of data and related information have been accumulated in the seventh year from the beginning. However, especially the information disclosed in English by people concerned combined the results of the second round, which was not analyzed properly, with those of the first round. This fact gives a suspicion of intention to deny the possibility of radiation influence in such a way as to make it invisible even if there was the influence. This study firstly prepared an English fact sheet to convey the actual situation in English. However, since some official information/views were contained in papers only available in English, this study also prepared the Japanese version for enabling to grasp the current situation. The Japanese version is supplemented with explanation rather than the Japanese translation of the English version, in order to make it easier to understand. The future of thyroid test is a topic that is causing controversy. Now that the transparency, scientific fairness, and the data integrity of Fukushima Medical University are suspected, it is extremely important that an independent analysis in the true sense is to be performed by qualified experts based on the latest evidence. (A.O.)

  8. Ethical Practices For Effective Leadership: Fact Or Fallacy-The ...

    African Journals Online (AJOL)

    Ethical Practices For Effective Leadership: Fact Or Fallacy-The Kenyan Experience. ... KCA Journal of Business Management ... argue that laws alone cannot 'convert' the society that has developed and perfected the art of unethical practices.

  9. Facts about food irradiation: Nutritional quality of irradiated foods

    International Nuclear Information System (INIS)

    1991-01-01

    This fact sheet briefly considers the nutritional value of irradiated foods. Micronutrients, especially vitamins, are sensitive to any food processing method, but irradiation does not cause any special nutritional problems in food. 4 refs

  10. Structure of the human histone chaperone FACT Spt16 N-terminal domain

    Energy Technology Data Exchange (ETDEWEB)

    Marcianò, G.; Huang, D. T., E-mail: d.huang@beatson.gla.ac.uk [Cancer Research UK Beatson Institute, Garscube Estate, Switchback Road, Glasgow G61 1BD, Scotland (United Kingdom)

    2016-01-22

    The Spt16–SSRP1 heterodimer is a histone chaperone that plays an important role in regulating chromatin assembly. Here, a crystal structure of the N-terminal domain of human Spt16 is presented and it is shown that this domain may contribute to histone binding. The histone chaperone FACT plays an important role in facilitating nucleosome assembly and disassembly during transcription. FACT is a heterodimeric complex consisting of Spt16 and SSRP1. The N-terminal domain of Spt16 resembles an inactive aminopeptidase. How this domain contributes to the histone chaperone activity of FACT remains elusive. Here, the crystal structure of the N-terminal domain (NTD) of human Spt16 is reported at a resolution of 1.84 Å. The structure adopts an aminopeptidase-like fold similar to those of the Saccharomyces cerevisiae and Schizosaccharomyces pombe Spt16 NTDs. Isothermal titration calorimetry analyses show that human Spt16 NTD binds histones H3/H4 with low-micromolar affinity, suggesting that Spt16 NTD may contribute to histone binding in the FACT complex. Surface-residue conservation and electrostatic analysis reveal a conserved acidic patch that may be involved in histone binding.

  11. Structure of the human histone chaperone FACT Spt16 N-terminal domain

    International Nuclear Information System (INIS)

    Marcianò, G.; Huang, D. T.

    2016-01-01

    The Spt16–SSRP1 heterodimer is a histone chaperone that plays an important role in regulating chromatin assembly. Here, a crystal structure of the N-terminal domain of human Spt16 is presented and it is shown that this domain may contribute to histone binding. The histone chaperone FACT plays an important role in facilitating nucleosome assembly and disassembly during transcription. FACT is a heterodimeric complex consisting of Spt16 and SSRP1. The N-terminal domain of Spt16 resembles an inactive aminopeptidase. How this domain contributes to the histone chaperone activity of FACT remains elusive. Here, the crystal structure of the N-terminal domain (NTD) of human Spt16 is reported at a resolution of 1.84 Å. The structure adopts an aminopeptidase-like fold similar to those of the Saccharomyces cerevisiae and Schizosaccharomyces pombe Spt16 NTDs. Isothermal titration calorimetry analyses show that human Spt16 NTD binds histones H3/H4 with low-micromolar affinity, suggesting that Spt16 NTD may contribute to histone binding in the FACT complex. Surface-residue conservation and electrostatic analysis reveal a conserved acidic patch that may be involved in histone binding

  12. Energy in Sweden. Facts and figures 2007; Energilaeget 2007

    Energy Technology Data Exchange (ETDEWEB)

    2007-12-15

    Energy in Sweden 2007: Facts and Figures contains the tabular for most of the diagrams in the main publication. These data consist primarily of the results of the Agency's processing of basic data from Statistics Sweden. 2001 statistics for the period 1983-1999 where revised compared to data for previous editions. With effect from the 2001 edition, statistics are of preliminary character for the two last published years (2005 and 2006). Breakdowns into certain types of fuels vary somewhat depending on whether preliminary or final data is used. Further information about the statistics can be found in Energy in Sweden, chapter 8 Energy Facts. Please note that the figures have been rounded up or down, therefore totals do not always comply with the sum of individual figures

  13. Amazing & extraordinary facts the steam age

    CERN Document Server

    Holland, Julian

    2012-01-01

    Respected transport author Julian Holland delves into the intriguing world of steam in his latest book, which is full of absorbing facts and figures on subjects ranging from Cornish beam engines, steam railway locomotives, road vehicles and ships through to traction engines, steam rollers and electricity generating stations and the people who designed and built them. Helped along the way by the inventive minds of James Watt, Richard Trevithick and George Stephenson, steam became the powerhouse that drove the Industrial Revolution in Britain in the late 18th and 19th centuries.

  14. Teenage Pregnancy. Highlights: An ERIC/CAPS Fact Sheet.

    Science.gov (United States)

    Lachance, Laurie L.

    This fact sheet addresses the issue of teenage pregnancy. Six factors contributing to the current attention focused on teenage pregnancy and parenthood are listed and teenage pregnancy and birth rates are discussed. Other areas covered include teenage nonuse of contraception, sex education by schools and parents, family planning services, and the…

  15. Facts about food irradiation: Chemical changes in irradiated foods

    International Nuclear Information System (INIS)

    1991-01-01

    This fact sheet addresses the safety of irradiated food. The irradiation process produces very little chemical change in food, and laboratory experiments have shown no harmful effects in animals fed with irradiated milk powder. 3 refs

  16. Higher Education in Facts & Figures: Research and Innovation

    Science.gov (United States)

    Universities UK, 2007

    2007-01-01

    This edition of Higher education in facts and figures focusses on Research and innovation. Research and innovation are crucial to the future of the UK's competitiveness. Universities are the prime drivers for this, both through producing, and acting as a magnet for, the best knowledge and talent. The UK's research performance is exceptionally…

  17. Public Relations for Brazilian Libraries: Process, Principles, Program Planning, Planning Techniques and Suggestions.

    Science.gov (United States)

    Kies, Cosette N.

    A brief overview of the functions of public relations in libraries introduces this manual, which provides an explanation of the public relations (PR) process, including fact-finding, planning, communicating, evaluating, and marketing; some PR principles; a 10-step program that could serve as a model for planning a PR program; a discussion of PR…

  18. What Is Quality Preschool? Fact Sheet

    Science.gov (United States)

    Advocates for Children of New Jersey, 2010

    2010-01-01

    Children need quality early learning programs. This can be a child care center, a preschool or a Head Start program. Not all early learning programs provide the high quality children need. This paper presents questions that should be considered when looking for an early learning program.

  19. Modulation of chromatin structure by the FACT histone chaperone complex regulates HIV-1 integration.

    Science.gov (United States)

    Matysiak, Julien; Lesbats, Paul; Mauro, Eric; Lapaillerie, Delphine; Dupuy, Jean-William; Lopez, Angelica P; Benleulmi, Mohamed Salah; Calmels, Christina; Andreola, Marie-Line; Ruff, Marc; Llano, Manuel; Delelis, Olivier; Lavigne, Marc; Parissi, Vincent

    2017-07-28

    Insertion of retroviral genome DNA occurs in the chromatin of the host cell. This step is modulated by chromatin structure as nucleosomes compaction was shown to prevent HIV-1 integration and chromatin remodeling has been reported to affect integration efficiency. LEDGF/p75-mediated targeting of the integration complex toward RNA polymerase II (polII) transcribed regions ensures optimal access to dynamic regions that are suitable for integration. Consequently, we have investigated the involvement of polII-associated factors in the regulation of HIV-1 integration. Using a pull down approach coupled with mass spectrometry, we have selected the FACT (FAcilitates Chromatin Transcription) complex as a new potential cofactor of HIV-1 integration. FACT is a histone chaperone complex associated with the polII transcription machinery and recently shown to bind LEDGF/p75. We report here that a tripartite complex can be formed between HIV-1 integrase, LEDGF/p75 and FACT in vitro and in cells. Biochemical analyzes show that FACT-dependent nucleosome disassembly promotes HIV-1 integration into chromatinized templates, and generates highly favored nucleosomal structures in vitro. This effect was found to be amplified by LEDGF/p75. Promotion of this FACT-mediated chromatin remodeling in cells both increases chromatin accessibility and stimulates HIV-1 infectivity and integration. Altogether, our data indicate that FACT regulates HIV-1 integration by inducing local nucleosomes dissociation that modulates the functional association between the incoming intasome and the targeted nucleosome.

  20. Logic programming and metadata specifications

    Science.gov (United States)

    Lopez, Antonio M., Jr.; Saacks, Marguerite E.

    1992-01-01

    Artificial intelligence (AI) ideas and techniques are critical to the development of intelligent information systems that will be used to collect, manipulate, and retrieve the vast amounts of space data produced by 'Missions to Planet Earth.' Natural language processing, inference, and expert systems are at the core of this space application of AI. This paper presents logic programming as an AI tool that can support inference (the ability to draw conclusions from a set of complicated and interrelated facts). It reports on the use of logic programming in the study of metadata specifications for a small problem domain of airborne sensors, and the dataset characteristics and pointers that are needed for data access.

  1. Permitted decompilation of a computer program in order to protect the general interest

    Directory of Open Access Journals (Sweden)

    Radovanović Sanja M.

    2015-01-01

    Full Text Available Computer program is an intellectual creation protected by copyright. However, unlike other items with equivalent legal protection, a computer program has a strong technical functionality, which is, in nowadays' society, an indispensable factor in everyday business activities, exchange of information, entertainment or achieving other similar purposes. Precisely because of this feature, computer program can rarely be seen in isolation from the hardware and software environment. In other words, the functionality of a computer program reaches its full scope only in interaction with other computer program or device. Bearing in mind the fact that this intellectual creation is in the focus of technological, and thus social, development, legislators are trying to provide a legal framework in which these interactions take place unhindered. In fact, considering that each aspect of the use of a computer program presents the exclusive right of the author, relying on his or her consent to undertake certain perpetration which would provide the necessary connectivity of the various components, could put in risk further technological development. Therefore, the lawmakers provide that, in certain cases and under certain conditions, the author's exclusive right could be restricted or excluded. This paper aims to analyze a normative contribution in achieving, technical and technological needed, and therefore, in terms of general interest justified, interactions.

  2. Face the Facts

    Science.gov (United States)

    ... families might initiate conversations. Back to top Key Considerations Determine what benefits are provided by Social Security and any pensions. Then, determine whether your parents are eligible for other financial programs. Ensure that each family member has a ...

  3. Participation in Sports and Civic Engagement. Fact Sheet

    Science.gov (United States)

    Lopez, Mark Hugo; Moore, Kimberlee

    2006-01-01

    One reason to offer sports in school is to teach youth the values, skills, and habits that will make them more active, engaged, and responsible citizens. Past evidence on the civic effects of sports is mixed, but points to some potential positive civic effects. This fact sheet uses recent data from the 2002 National Youth Survey of Civic…

  4. Facts about food irradiation: Irradiation and food safety

    International Nuclear Information System (INIS)

    1991-01-01

    This fact sheet focusses on the question of whether irradiation can be used to make spoiled food good. No food processing procedures can substitute for good hygienic practices, and good manufacturing practices must be followed in the preparation of food whether or not the food is intended for further processing by irradiation or any other means. 3 refs

  5. Developmental changes in fact and source recall: Contributions from executive function and brain electrical activity

    Directory of Open Access Journals (Sweden)

    Vinaya Rajan

    2015-04-01

    Full Text Available Source memory involves recollecting the contextual details surrounding a memory episode. When source information is bound together, it makes a memory episodic in nature. Unfortunately, very little is known about the factors that contribute to its formation in early development. This study examined the development of source memory in middle childhood. Measures of executive function were examined as potential sources of variation in fact and source recall. Continuous electroencephalogram (EEG measures were collected during baseline and fact and source retrieval in order to examine memory-related changes in EEG power. Six and 8-year-old children were taught 10 novel facts from two different sources and recall for fact and source information was later tested. Older children were better on fact recall, but both ages were comparable on source recall. However, source recall performance was poor at both ages, suggesting that this ability continues to develop beyond middle childhood. Regression analyses revealed that executive function uniquely predicted variance in source recall performance. Task-related increases in theta power were observed at frontal, temporal and parietal electrode sites during fact and source retrieval. This investigation contributes to our understanding of age-related differences in source memory processing in middle childhood.

  6. 5 CFR 890.1040 - Conducting a fact-finding proceeding.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Conducting a fact-finding proceeding. 890.1040 Section 890.1040 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE... oral and written arguments and documentary evidence, present witnesses, question any witnesses...

  7. Facts and possibilities for the energy problem

    Energy Technology Data Exchange (ETDEWEB)

    Koch, E [Kernforschungszentrum Karlsruhe (Germany, F.R.). Abt. Bauwesen

    1977-01-01

    After the oil crisis, all countries have become more aware of the energy problem. The economic dictate of OPEC countries must be counteracted at least by a partial self-supply with energy. The article deals with a few selected, realistic developments on the energy sector. Among others, the following facts are discussed: pretroleum reserves in the FRG, coal liquefaction, efficiency of thermal power plants, alternative projects for nuclear energy, reprocessing of nuclear waste, and problems of nuclear waste storage.

  8. High Speed Simulation Framework for Reliable Logic Programs

    International Nuclear Information System (INIS)

    Lee, Wan-Bok; Kim, Seog-Ju

    2006-01-01

    This paper shows a case study of designing a PLC logic simulator that was developed to simulate and verify PLC control programs for nuclear plant systems. The nuclear control system requires strict restrictions rather than normal process control system does, since it works with nuclear power plants requiring high reliability under severe environment. One restriction is the safeness of the control programs which can be assured by exploiting severe testing. Another restriction is the simulation speed of the control programs, that should be fast enough to control multi devices concurrently in real-time. To cope with these restrictions, we devised a logic compiler which generates C-code programs from given PLC logic programs. Once the logic program was translated into C-code, the program could be analyzed by conventional software analysis tools and could be used to construct a fast logic simulator after cross-compiling, in fact, that is a kind of compiled-code simulation

  9. PYGMALION: A Creative Programming Environment

    Science.gov (United States)

    1975-06-01

    iiiiiimimmmimm wm^m^mmm’ wi-i ,»■»’■’.■- v* 26 Examples of Purely Iconic Reasoning 1-H Pythagoras ’ original proof of the Pythagorean Theorem ... Theorem Proving Machine񓟋. His program employed properties of the representation to guide the proof of theorems . His simple heruristic "Reject...one theorem the square of the hypotenuse. "Every proposition is presented as a self-contained fact relying on its own intrinsic evidence. Instead

  10. Looking for optimal number and placement of FACTS devices to manage the transmission congestion

    International Nuclear Information System (INIS)

    Rahimzadeh, Sajad; Tavakoli Bina, Mohammad

    2011-01-01

    Some applications of FACTS devices show that they are proper and effective tools to control the technical parameters of power systems. However determination of optimal number, location, size and type of these devices is a difficult problem. Moreover, applying a suitable objective function for optimal placement of FACTS devices plays a very important role in economic improvement of a power market. In this paper optimal placement of parallel and series FACTS devices is studied. The STATCOM is selected as a parallel FACTS device and SSSC as a series one. The optimization problem is formulated in regard to restructured environment and a new objective function is defined so that its minimization can alleviate the congestion and provide fairer conditions for power market participants. Moreover, an index based on objective function value is presented to determine the optimal number of each FACTS device in a specific designed algorithm. The power injection models for STATCOM and SSSC are adopted by applying neural models based on the averaging technique. This model takes the converter power losses into account and produces the required PQ-phasor that is suitable for power system steady state analysis. The proposed method is applied on modified IEEE 14-bus, 30-bus and 118-bus test systems and the results are analyzed.

  11. 5 CFR 890.1028 - Conducting a fact-finding proceeding.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Conducting a fact-finding proceeding. 890.1028 Section 890.1028 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE... counsel, submit oral and written arguments and documentary evidence, present witnesses on his own behalf...

  12. Child Care in Sweden. Fact Sheets on Sweden.

    Science.gov (United States)

    Swedish Inst., Stockholm.

    This fact sheet outlines Sweden's policies of government-supported child care and parental insurance provisions. Swedish families receive: (1) free maternity and child health care; (2) child allowances for each child of 9,000 krona per year through age 16; (3) up to 450 days of paid parental leave for the birth of a child, with 360 days paid at 90…

  13. The fact and fiction of the nuclear question

    International Nuclear Information System (INIS)

    Chartier, Isabelle.

    1982-01-01

    The nuclear theme is one that gives rise to much speculation and hearsay. To study the nuclear question is to delve into a social and tangible reality which as a product of flights of fancy, calls for a special approach and appropriate methods of investigation. The author sets out to try and draw a line between fact and fiction [fr

  14. OPA Q's and A's: Overview of the Oil Pollution Act of 1990. Fact sheet

    International Nuclear Information System (INIS)

    1991-12-01

    The OPA Q's and A's are part of a series of fact sheets that provide up-to-date information on EPA's implementation of the OPA. The first fact sheet provides an overview of the various provisions of the OPA and the Agency's responsibilities under the new law

  15. Improvements Needed in Administration of the Guaranteed Student Loan Program.

    Science.gov (United States)

    General Accounting Office, Washington, DC.

    This report identifies improvements needed in administration of the guaranteed student loan program. Improvements needed are based on the fact that that lenders are not informed when student borrowers drop out of school. Alternatives for providing lenders with timely information on enrollment terminations are indicated. Additional administrative…

  16. Retrieval Practice, with or without Mind Mapping, Boosts Fact Learning in Primary School Children

    Science.gov (United States)

    Ritchie, Stuart J.; Della Sala, Sergio; McIntosh, Robert D.

    2013-01-01

    Retrieval practice is a method of study in which testing is incorporated into the learning process. This method is known to facilitate recall for facts in adults and in secondary-school-age children, but existing studies in younger children are somewhat limited in their practical applicability. In two studies of primary school-age children of 8–12 years, we tested retrieval practice along with another study technique, mind mapping, which is more widely-used, but less well-evidenced. Children studied novel geographical facts, with or without retrieval practice and with or without mind mapping, in a crossed-factorial between-subjects design. In Experiment 1, children in the retrieval practice condition recalled significantly more facts four days later. In Experiment 2, this benefit was replicated at one and five weeks in a different, larger sample of schoolchildren. No consistent effects of mind mapping were observed. These results underline the effectiveness of retrieval practice for fact learning in young children. PMID:24265738

  17. Facts, values, and journalism.

    Science.gov (United States)

    Gilbert, Susan

    2017-03-01

    At a time of fake news, hacks, leaks, and unverified reports, many people are unsure whom to believe. How can we communicate in ways that make individuals question their assumptions and learn? My colleagues at The Hastings Center and many journalists and scientists are grappling with this question and have, independently, reached the same first step: recognize that facts can't be fully understood without probing their connection to values. "Explaining the basics is important, of course, but we also need to diversify our approach to the coverage of science-particularly as it intersects with the matrix of cultural, religious, social, and political values of our readers," said an article in Undark, an online magazine of science journalism. An editorial in Nature called for scientists to engage directly with citizens in debates over climate change and genome editing, noting that "the ethical issues can be critically dependent on the science, for example, in understanding where the boundaries between non-heritable and heritable genome modifications might be." We're here to help. © 2017 The Hastings Center.

  18. Assessment of ATC with Shunt FACTS Devices

    OpenAIRE

    Ashwani Kumar; Jitender Kumar

    2013-01-01

    In this paper, an optimal power flow based approach has been applied for multi-transactions deregulated environment for ATC determination with SVC and STATCOM. The main contribution of the paper is (i) OPF based approach for evaluation of ATC with multi-transactions, (ii) ATC enhancement with FACTS devices viz. SVC and STATCOM for intact and line contingency cases, (iii) Impact of ZIP load on ATC determination and comparison of ATC obtained with SVC and STATCOM. The results have been determin...

  19. Facts controllers in power transmission and distribution

    CERN Document Server

    Padiyar, KR

    2007-01-01

    About the Book: The emerging technology of Flexible AC Transmission System (FACTS) enables planning and operation of power systems at minimum costs, without compromising security. This is based on modern high power electronic systems that provide fast controllability to ensure ''flexible'' operation under changing system conditions. This book presents a comprehensive treatment of the subject by discussing the operating principles, mathematical models, control design and issues that affect the applications. The concepts are explained often with illustrative examples and case studies. In partic

  20. A Rasch and factor analysis of the Functional Assessment of Cancer Therapy-General (FACT-G

    Directory of Open Access Journals (Sweden)

    Selby Peter J

    2007-04-01

    Full Text Available Abstract Background Although the Functional Assessment of Cancer Therapy – General questionnaire (FACT-G has been validated few studies have explored the factor structure of the instrument, in particular using non-sample dependent measurement techniques, such as Rasch Models. Furthermore, few studies have explored the relationship between item fit to the Rasch Model and clinical utility. The aim of this study was to investigate the dimensionality and measurement properties of the FACT-G with Rasch Models and Factor analysis. Methods A factor analysis and Rasch analysis (Partial Credit Model was carried out on the FACT-G completed by a heterogeneous sample of cancer patients (n = 465. For the Rasch analysis item fit (infit mean squares ≥ 1.30, dimensionality and item invariance were assessed. The impact of removing misfitting items on the clinical utility of the subscales and FACT-G total scale was also assessed. Results The factor analysis demonstrated a four factor structure of the FACT-G which broadly corresponded to the four subscales of the instrument. Internal consistency for these four scales was very good (Cronbach's alpha 0.72 – 0.85. The Rasch analysis demonstrated that each of the subscales and the FACT-G total scale had misfitting items (infit means square ≥ 1.30. All these scales with the exception of the Social & Family Well-being Scale (SFWB were unidimensional. When misfitting items were removed, the effect sizes and the clinical utility of the instrument were maintained for the subscales and the total FACT-G scores. Conclusion The results of the traditional factor analysis and Rasch analysis of the FACT-G broadly agreed. Caution should be exercised when utilising the Social & Family Well-being scale and further work is required to determine whether this scale is best represented by two factors. Additionally, removing misfitting items from scales should be performed alongside an assessment of the impact on clinical utility.

  1. Evaluating bioremediation: distinguishing fact from fiction.

    Science.gov (United States)

    Shannon, M J; Unterman, R

    1993-01-01

    Bioremediation options encompass diverse types of biochemical mechanisms that may lead to a target's mineralization, partial transformation, humification, or altered redox state (e.g. for metallic elements). Because these various mechanisms produce alternative fates of the targeted pollutants, it is often necessary to use diverse evaluation criteria to qualify a successful bioremediation. Too often target depletion from a treated matrix can be mistakenly ascribed to biological activity when in fact the depletion is caused by abiotic losses (e.g. volatilization, leaching, and stripping). Thus, effective, and therefore convincing, evaluation requires that experimental and engineering designs anticipate all possible routes of target depletion and that these routes be carefully monitored.

  2. Facts and values in risk assessment

    International Nuclear Information System (INIS)

    Cross, Frank B.

    1998-01-01

    Risk, as commonly understood, is a complex melange of facts, values, and fears. While this complexity of public risk perception is now broadly recognized, its implications are insufficiently explored. Public risk perceptions offer p poor guide for public policymaking. Popular assessments of risk are tainted by misinformation and unreliable heuristics. While subjective considerations, often called values, play a role in public perception of risk, those 'values' are often inappropriate for government decisionmaking. Reliance on public perceptions of risk means more premature deaths. Public risk perception also is systematically skewed contrary to the interests of the disadvantaged. Strict probabilistic risk measures generally provide a superior guide for government regulatory policy

  3. Disaster mythology and fact: Hurricane Katrina and social attachment.

    Science.gov (United States)

    Jacob, Binu; Mawson, Anthony R; Payton, Marinelle; Guignard, John C

    2008-01-01

    Misconceptions about disasters and their social and health consequences remain prevalent despite considerable research evidence to the contrary. Eight such myths and their factual counterparts were reviewed in a classic report on the public health impact of disasters by Claude de Ville de Goyet entitled, The Role of WHO in Disaster Management: Relief, Rehabilitation, and Reconstruction (Geneva, World Health Organization, 1991), and two additional myths and facts were added by Pan American Health Organization. In this article, we reconsider these myths and facts in relation to Hurricane Katrina, with particular emphasis on psychosocial needs and behaviors, based on data gleaned from scientific sources as well as printed and electronic media reports. The review suggests that preparedness plans for disasters involving forced mass evacuation and resettlement should place a high priority on keeping families together--and even entire neighborhoods, where possible--so as to preserve the familiar and thereby minimize the adverse effects of separation and major dislocation on mental and physical health.

  4. Method to render second order beam optics programs symplectic

    International Nuclear Information System (INIS)

    Douglas, D.; Servranckx, R.V.

    1984-10-01

    We present evidence that second order matrix-based beam optics programs violate the symplectic condition. A simple method to avoid this difficulty, based on a generating function approach to evaluating transfer maps, is described. A simple example illustrating the non-symplectricity of second order matrix methods, and the effectiveness of our solution to the problem, is provided. We conclude that it is in fact possible to bring second order matrix optics methods to a canonical form. The procedure for doing so has been implemented in the program DIMAT, and could be implemented in programs such as TRANSPORT and TURTLE, making them useful in multiturn applications. 15 refs

  5. Analysis of Students' Errors on Linear Programming at Secondary ...

    African Journals Online (AJOL)

    The purpose of this study was to identify secondary school students' errors on linear programming at 'O' level. It is based on the fact that students' errors inform teaching hence an essential tool for any serious mathematics teacher who intends to improve mathematics teaching. The study was guided by a descriptive survey ...

  6. Overview of FACTS devices for wind power plants directly connected to the transmission network

    DEFF Research Database (Denmark)

    Adamczyk, Andrzej Grzegorz; Teodorescu, Remus; Rodriguez, Pedro

    2010-01-01

    Growing number of wind turbines is changing electricity generation profile all over the world. This brings challenges for power system operation, which was designed and developed around conventional power plants with directly coupled synchronous generators. In result, safety and stability...... of the electrical network with high wind energy penetration might be compromised. For this reason transmission system operators (TSO) impose more stringent connection requirements on the wind power plant (WPP) owners. On the other hand flexible AC transmission systems (FACTS) devices offer enhancement of grid...... research in FACTS applicability for WPPs is summarized. Examples of few existing FACTS applications for wind farms are given....

  7. How energy can be more rationally used. Technical possibilities and facts of business management. Under the pressure of rising energy costs

    Energy Technology Data Exchange (ETDEWEB)

    Klein, H; Ziegler, A [Bundesministerium fuer Forschung und Technologie, Bonn (Germany, F.R.)

    1976-03-01

    The article deals with the technical possibilities and economical operating facts of rational energy consumption. Beginning with a short discussion of the available energy reserves it is shown that a rational way of dealing with energy can already be pre-programmed in the choice of the energy form for each particular consumption purpose. Economic growth, indeed, promotes the rational use of energy. The following main points are individually discussed: related subjects in economic pre-planning operation, energy economy in the heating of houses, questions of environmental protection. The article ends with a look at future aspects of rational energy utilization.

  8. Facts and figures in 2004

    International Nuclear Information System (INIS)

    Lavergne, R.; Meuric, L.; Scherrer, S.; Paquel, V.; Louati, S.; Thienard, H.

    2005-01-01

    This document gathers a series of articles dedicated to the situation of the energy sector in France at the end of 2004: -) the energy balance sheet, -) the trend concerning energy consumption since 1973, -) the energy bill, -) figures about electrical power, -) figures about natural gas, -) figures about solid fossil fuels, -) figures about oil, and -) figures about renewable energies. The important fact to note is that the energy bill has soared by 24.1% to reach 28.35 milliard euros which represents 1.75% of the gross national product (PIB). The evolution over the year 2004 of the factors that contribute to the level of the energy bill is: - the import-export energy quantity differential: +7.5%, - the import-export energy cost differential (in Usa dollar): +27.1%, and - the fall of the dollar: -9.1%. (A.C.)

  9. When lightning strikes: bolting down the facts & fiction.

    Science.gov (United States)

    Usatch, Ben

    2009-04-01

    MYTH: There's no danger from lightning until the rain starts. FACT: Lightning often precedes the storm by up to 10 miles. A reasonable guideline is the "30-30 rule," by which you count the seconds between the flash and the thunder. If the time span is less than 30 seconds, seek shelter. Additionally, wait a full 30 minutes from last lightning flash to resume outdoor activities.

  10. Facts about food irradiation: Safety of irradiation facilities

    International Nuclear Information System (INIS)

    1991-01-01

    This fact sheet considers the safety of industrial irradiation facilities. Although there have been accidents, none of them has endangered public health or environmental safety, and the radiation processing industry is considered to have a very good safety record. Gamma irradiators do not produce radioactive waste, and the radiation sources at the facilities cannot explode nor in any other way release radioactivity into the environment. 3 refs

  11. Facts about food irradiation: Irradiated foods and the consumer

    International Nuclear Information System (INIS)

    1991-01-01

    This fact sheet discusses market testing of irradiate food, consumer response to irradiated products has always been positive, and in some countries commercial quantities of some irradiated food items have been sold on a regular basis. Consumers have shown no reluctance to buy irradiated food products. 4 refs

  12. Scientific Facts and Methods in Public Reason

    DEFF Research Database (Denmark)

    Jønch-Clausen, Karin; Kappel, Klemens

    2016-01-01

    Should scientific facts and methods have an epistemically privileged status in public reason? In Rawls’s public reason account he asserts what we will label the Scientific Standard Stricture: citizens engaged in public reason must be guided by non-controversial scientific methods, and public reason...... must be in line with non-controversial scientific conclusions. The Scientific Standard Stricture is meant to fulfill important tasks such as enabling the determinateness and publicity of the public reason framework. However, Rawls leaves us without elucidation with regard to when science...

  13. Evaluation of a structured smoking cessation program for primary care medicine

    NARCIS (Netherlands)

    Jaehne, A.; Ruether, T.; Deest, H.; Gehrig, H.; de Zeeuw, J.; Alberti, A.; Mulzer, K.

    Background: Despite the fact that 9 of 10 general practitioners in Germany believe that smoking cessation is an important topic structured programs are only rarely offered to patients. Beside a lack of time and missing reimbursement, physician's limited treatment skills are frequent reasons for this

  14. State Arts Agency Fact Sheet: Support for Arts Education

    Science.gov (United States)

    Online Submission, 2015

    2015-01-01

    This national overview of state arts agency grants and services for arts education includes summary statistics and geographic distribution. The fact sheet uses data from Final Descriptive Reports of state arts agency grant-making activities submitted annually to the National Assembly of State Arts Agencies (NASAA) and the National Endowment for…

  15. Linear Programming, the Simplex Algorithm and Simple Polytopes

    Directory of Open Access Journals (Sweden)

    Das Bhusan

    2010-09-01

    Full Text Available In the first part of the paper we survey some far reaching applications of the basis facts of linear programming to the combinatorial theory of simple polytopes. In the second part we discuss some recent developments concurring the simplex algorithm. We describe sub-exponential randomized pivot roles and upper bounds on the diameter of graphs of polytopes.

  16. Statements journalism: W hen the press renounces being the scene of facts

    OpenAIRE

    Munive, Mario

    2017-01-01

    It is not a journalism genre, but a discourse that seems to be in the DNA of Latin America’s press. On the newsroom it is known as “He said, she said” journalism. This term refers to a kind of contagious disease. Journalists and media that have been affected assume that news can give us statements instead of facts. In other words, that the inverted pyramid is licensed to replace verified facts with others opinions. It is time to ask us some questions from an academic perspective. Why is “He s...

  17. Supporting documentation for the 1997 revision to the DOE Insulation Fact Sheet

    Energy Technology Data Exchange (ETDEWEB)

    Stovall, T.K.

    1997-08-22

    The Department of Energy (DOE) Insulation Fact Sheet has been revised to reflect developments in energy conservation technology and the insulation market. A nationwide insulation cost survey was made by polling insulation contractors and builders, and the results are reported here. These costs, along with regional weather data, regional fuel costs, and fuel-specific system efficiencies were used to produce recommended insulation levels for new and existing houses. This report contains all of the methodology, algorithms, assumptions, references, and data resources that were used to produce the 1997 DOE Insulation Fact Sheet.

  18. The angles of the fact rotor tipvanes on the rods and on the blades

    NARCIS (Netherlands)

    Bruining, A.

    1988-01-01

    This report contains the data of the angles of the tipvanes of the FACT rotor. These tipvanes were used on the FACT rotor blades and rods. Two sets uf tipvanes were measured: a set having a Liebeck air-foil section and a set with a NACA airfoil section. The tipvanes with the Liebeck airfoil section

  19. Facts about food irradiation: Irradiation and food additives and residues

    International Nuclear Information System (INIS)

    1991-01-01

    This fact sheet considers the issue of the irradiation of food containing food additives or pesticide residues. The conclusion is that there is no health hazard posed by radiolytic products of pesticides or food additives. 1 ref

  20. The Economic and Workforce Development Program (ED>Net) Annual Report, 2001-02 [and] Addendum to FY 01-02 Annual Report.

    Science.gov (United States)

    California Community Colleges, Sacramento. Economic Development Coordination Network (EDNet).

    This document contains an annual report and its addendum from the Economic and Workforce Development Program of California Community Colleges. The annual report provides an overview of the Program's evaluation processes, regional centers, short-term projects, legislation, strategic plan, etc. It also provides vital facts about the program such as…

Some links on this page may take you to non-federal websites. Their policies may differ from this site.