WorldWideScience

Sample records for program ea aerospace

  1. International Space Programs. Aerospace Education III.

    Science.gov (United States)

    Bulmer, S. B.

    This book, one in the series on Aerospace Education III, is a collection of the diverse information available regarding the international space programs. The five goals listed for the book are: to examine the Soviet space program, to understand the future of Soviet space activity, to examine other national and international space programs, to…

  2. International Space Programs. Aerospace Education III.

    Science.gov (United States)

    Air Univ., Maxwell AFB, AL. Junior Reserve Office Training Corps.

    This curriculum guide is prepared for the Aerospace Education III series publication entitled "International Space Programs." The guide is organized according to specific chapters in the textbook. It provides guidelines for teachers in terms of objectives, behavioral objectives, suggested outlines, orientation, suggested key points,…

  3. The ARM unpiloted aerospace vehicle (UAV) program

    Energy Technology Data Exchange (ETDEWEB)

    Sowle, D. [Mission Research Corporation, Santa Barbara, CA (United States)

    1995-09-01

    Unmanned aerospace vehicles (UAVs) are an important complement to the DOE`s Atmospheric Radiation Measurement (ARM) Program. ARM is primarily a ground-based program designed to extensively quantify the radiometric and meteorological properties of an atmospheric column. There is a need for airborne measurements of radiative profiles, especially flux at the tropopause, cloud properties, and upper troposphere water vapor. There is also a need for multi-day measurements at the tropopause; for example, in the tropics, at 20 km for over 24 hours. UAVs offer the greatest potential for long endurance at high altitudes and may be less expensive than piloted flights. 2 figs.

  4. 48 CFR 1852.244-70 - Geographic participation in the aerospace program.

    Science.gov (United States)

    2010-10-01

    ... the aerospace program. 1852.244-70 Section 1852.244-70 Federal Acquisition Regulations System NATIONAL... Provisions and Clauses 1852.244-70 Geographic participation in the aerospace program. As prescribed in 1844.204-70, insert the following clause: Geographic Participation in the Aerospace Program (APR 1985) (a...

  5. A Qualitative Program Evaluation of a Structured Leadership Mentoring Program at a Large Aerospace Corporation

    Science.gov (United States)

    Teller, Romney P.

    2011-01-01

    The researcher utilized a qualitative approach to conduct a program evaluation of the organization where he is employed. The study intended to serve as a program evaluation for the structured in-house mentoring program at a large aerospace corporation (A-Corp). This program evaluation clarified areas in which the current mentoring program is…

  6. Atmospheric radiation measurement unmanned aerospace vehicle (ARM-UAV) program

    Energy Technology Data Exchange (ETDEWEB)

    Bolton, W.R. [Sandia National Laboratories, Livermore, CA (United States)

    1996-11-01

    ARM-UAV is part of the multi-agency U.S. Global Change Research Program and is addressing the largest source of uncertainty in predicting climatic response: the interaction of clouds and the sun`s energy in the Earth`s atmosphere. An important aspect of the program is the use of unmanned aerospace vehicles (UAVs) as the primary airborne platform. The ARM-UAV Program has completed two major flight series: The first series conducted in April, 1994, using an existing UAV (the General Atomics Gnat 750) consisted of eight highly successful flights at the DOE climate site in Oklahoma. The second series conducted in September/October, 1995, using two piloted aircraft (Egrett and Twin Otter), featured simultaneous measurements above and below clouds and in clear sky. Additional flight series are planned to continue study of the cloudy and clear sky energy budget in the Spring and Fall of 1996 over the DOE climate site in Oklahoma. 3 refs., 4 figs., 1 tab.

  7. Development of integrated programs for Aerospace-vehicle Design (IPAD): Product program management systems

    Science.gov (United States)

    Isenberg, J. M.; Southall, J. W.

    1979-01-01

    The Integrated Programs for Aerospace Vehicle Design (IPAD) is a computing system to support company-wide design information processing. This document presents a brief description of the management system used to direct and control a product-oriented program. This document, together with the reference design process (CR 2981) and the manufacture interactions with the design process (CR 2982), comprises the reference information that forms the basis for specifying IPAD system requirements.

  8. Aviation/Aerospace Teacher Education Workshops: Program Development and Implementation

    Science.gov (United States)

    1998-01-01

    The Aviation/Aerospace Teacher Education Workshops have been recommended by the Illinois Task force for Aviation/Space Education (1988) as a way of encouraging aeronautical education. The workshop will be offered to elementary school teachers. During...

  9. The NASA Electronic Parts and Packaging (NEPP) Program - Presentation to Korean Aerospace Research Institute

    Science.gov (United States)

    LaBel, Kenneth A.; Sampson, Michael J.

    2016-01-01

    This presentation will provide basic information about NASA's Electronic Parts and Packaging Program (NEPP), for sharing with representatives of the South Korean Aerospace Research Institute (KARI) as part of a larger presentation by Headquarters Office of Safety and Mission Assurance. The NEPP information includes mission and goals, history of the program, basic focus areas, strategies, deliverables and some examples of current tasks.

  10. Evaluation of verifiability in HAL/S. [programming language for aerospace computers

    Science.gov (United States)

    Young, W. D.; Tripathi, A. R.; Good, D. I.; Browne, J. C.

    1979-01-01

    The ability of HAL/S to write verifiable programs, a characteristic which is highly desirable in aerospace applications, is lacking since many of the features of HAL/S do not lend themselves to existing verification techniques. The methods of language evaluation are described along with the means in which language features are evaluated for verifiability. These methods are applied in this study to various features of HAL/S to identify specific areas in which the language fails with respect to verifiability. Some conclusions are drawn for the design of programming languages for aerospace applications and ongoing work to identify a verifiable subset of HAL/S is described.

  11. Program of Research and Education in Aerospace Structures

    Science.gov (United States)

    Whitesides, John L.; Johansen, Laurie W.

    2005-01-01

    Since its inception in January 2003, the program has provided support for 1 research professor and a total of 10 Graduate Research Scholar Assistants of these all 10 have completed their MS degree program. The program has generated 10 MS thesis. Final report lists papers presented in seminars for the period January 1, 2003 through June 30, 2005.

  12. Evaluation of the Program: Randall Aerospace and Marine Science Program. A Title III Evaluation Project, Final Report.

    Science.gov (United States)

    Goldberg, Isadore

    An interdisciplinary program related to aerospace and marine topics was created for students in the ninth and tenth grades in Washington, D.C. The curriculum and staff development focused upon the development of experiences incorporated within science, mathematics, communication skills, career education, and physical education. Objectives of the…

  13. 47 CFR 11.46 - EAS public service announcements.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false EAS public service announcements. 11.46 Section...) Organization § 11.46 EAS public service announcements. EAS Participants may use Public Service Announcements or obtain commercial sponsors for announcements, infomercials, or programs explaining the EAS to the public...

  14. A Program of Research and Education in Aerospace Structures at the Joint Institute for Advancement of Flight Sciences

    Science.gov (United States)

    Tolson, Robert H.

    2000-01-01

    The objectives of the cooperative effort with NASA was to conduct research related to aerospace structures and to increase the quality and quantity of highly trained engineers knowledgeable about aerospace structures. The program has successfully met the objectives and has been of significant benefit to NASA LARC, the GWU and the nation. The program was initiated with 3 students in 1994 under the direction of Dr. Robert Tolson as the Principal Investigator. Since initiation, 14 students have been involved in the program, resulting in 11 MS degrees with 2 more expected in 2000. The 11 MS theses and projects are listed. For technology transfer purposes some research is not reported in thesis form. Graduates from the program have been hired at aerospace and other companies across the nation, providing GWU and LARC with important industry and government contacts.

  15. Feasibility study of an Integrated Program for Aerospace vehicle Design (IPAD). Volume 4: IPAD system design

    Science.gov (United States)

    Goldfarb, W.; Carpenter, L. C.; Redhed, D. D.; Hansen, S. D.; Anderson, L. O.; Kawaguchi, A. S.

    1973-01-01

    The computing system design of IPAD is described and the requirements which form the basis for the system design are discussed. The system is presented in terms of a functional design description and technical design specifications. The functional design specifications give the detailed description of the system design using top-down structured programming methodology. Human behavioral characteristics, which specify the system design at the user interface, security considerations, and standards for system design, implementation, and maintenance are also part of the technical design specifications. Detailed specifications of the two most common computing system types in use by the major aerospace companies which could support the IPAD system design are presented. The report of a study to investigate migration of IPAD software between the two candidate 3rd generation host computing systems and from these systems to a 4th generation system is included.

  16. A bibliography of space books and articles from non-aerospace journals, 1957-1977. [NASA programs and spaceflight

    Science.gov (United States)

    Looney, J. J.

    1979-01-01

    This bibliography cites over 3,600 articles and books from the nonspecialized secondary literature relating to NASA and to aerospace-related themes. Entries are arranged alphabetically by author in the following categories: (1) space activity; (2) spaceflight: earliest times to the creation of NASA; (3) organization, administration, and management of NASA; (4) aeronautics; (5) boosters and rockets; (6) technology of spaceflight; (7) manned spaceflight; (8) space science; (9) applications; (10) space law; (11) international implications; (12) foreign space programs; (13) domestic public policy and opinion; and (14) economics: impact of NASA, analyses of aerospace industry, and patent policy.

  17. Detecting Silent Data Corruptions in Aerospace-Based Computing Using Program Invariants

    Directory of Open Access Journals (Sweden)

    Junchi Ma

    2016-01-01

    Full Text Available Soft error caused by single event upset has been a severe challenge to aerospace-based computing. Silent data corruption (SDC is one of the results incurred by soft error. SDC occurs when a program generates erroneous output with no indications. SDC is the most insidious type of results and very difficult to detect. To address this problem, we design and implement an invariant-based system called Radish. Invariants describe certain properties of a program; for example, the value of a variable equals a constant. Radish first extracts invariants at key program points and converts invariants into assertions. It then hardens the program by inserting the assertions into the source code. When a soft error occurs, assertions will be found to be false at run time and warn the users of soft error. To increase the coverage of SDC, we further propose an extension of Radish, named Radish_D, which applies software-based instruction duplication mechanism to protect the uncovered code sections. Experiments using architectural fault injections show that Radish achieves high SDC coverage with very low overhead. Furthermore, Radish_D provides higher SDC coverage than that of either Radish or pure instruction duplication.

  18. Thermographic Testing Using on the X-33 Space Launch Vehicle Program by BFGoodrich Aerospace

    Science.gov (United States)

    Burleigh, Douglas

    1999-01-01

    The X-33 program is a team effort sponsored by NASA, under Cooperative Agreement NCC8-115, and led by the Lockheed Martin Corporation. Team member BFGoodrich Aerospace Aerostructures Group (formerly Rohr) is responsible for design, manufacture, and integration of the Thermal Protection System (TPS) of the X-33 launch vehicle. The X-33 is a half-scale, experimental prototype of a vehicle called RLV (Reusable Launch Vehicle) or VentureStar(Trademark), an SSTO (single stage to orbit) vehicle, which is a proposed successor to the aging Space Shuttle. Thermographic testing has been employed by BFGoodrich Aerospace Aerostructures Group for a wide variety of uses in the testing of components of the X-33. Thermographic NDT (TNDT) has been used for inspecting large graphite-epoxy/aluminum honeycomb sandwich panels used on the Leeward Aeroshell structure of the X-33. And TNDT is being evaluated for use in inspecting carbon-carbon composite parts such as the nosecap and wing leading edge components. Pulsed Infrared Testing (PIRT), a special form of TNDT, is used for the routine inspection of sandwich panels made of brazed inconel honeycomb and facesheets. In the developmental and qualification testing of sub-elements of the X-33, thermography has been used to monitor 1) Arc Jet tests at NASA Ames Research Center in Mountainview, CA and NASA Johnson Space Center in Houston, TX, 2) High Temperature (wind) Tunnel Tests (HTT) at NASA Langley Research Center in Langley, VA, and 3) Hot Gas Tests at NASA Marshall Space Flight Center in Huntsville, AL.

  19. NASA Aerospace Flight Battery Program: Generic Safety, Handling and Qualification Guidelines for Lithium-Ion (Li-Ion) Batteries; Availability of Source Materials for Lithium-Ion (Li-Ion) Batteries; Maintaining Technical Communications Related to Aerospace Batteries (NASA Aerospace Battery Workshop). Volume 1, Part 1

    Science.gov (United States)

    Manzo, Michelle A.; Brewer, Jeffrey C.; Bugga, Ratnakumar V.; Darcy, Eric C.; Jeevarajan, Judith A.; McKissock, Barbara I.; Schmitz, Paul C.

    2010-01-01

    This NASA Aerospace Flight Battery Systems Working Group was chartered within the NASA Engineering and Safety Center (NESC). The Battery Working Group was tasked to complete tasks and to propose proactive work to address battery related, agency-wide issues on an annual basis. In its first year of operation, this proactive program addressed various aspects of the validation and verification of aerospace battery systems for NASA missions. Studies were performed, issues were discussed and in many cases, test programs were executed to generate recommendations and guidelines to reduce risk associated with various aspects of implementing battery technology in the aerospace industry. This document contains Part 1 - Volume I: Generic Safety, Handling and Qualification Guidelines for Lithium-Ion (Li-Ion) Batteries, Availability of Source Materials for Lithium-Ion (Li-Ion) Batteries, and Maintaining Technical Communications Related to Aerospace Batteries (NASA Aerospace Battery Workshop).

  20. 78 FR 49908 - Airworthiness Directives; Eclipse Aerospace, Inc. Airplanes

    Science.gov (United States)

    2013-08-16

    ...-007-AD; Amendment 39-17542; AD 2013-16-04] RIN 2120-AA64 Airworthiness Directives; Eclipse Aerospace... adopting a new airworthiness directive (AD) for all Eclipse Aerospace, Inc. Model EA500 airplanes equipped... service information identified in this AD, contact Eclipse Aerospace, Inc., 26 East Palatine Road...

  1. 78 FR 30243 - Airworthiness Directives; Eclipse Aerospace, Inc. Airplanes

    Science.gov (United States)

    2013-05-22

    ... Directives; Eclipse Aerospace, Inc. Airplanes AGENCY: Federal Aviation Administration (FAA), DOT. ACTION... all Eclipse Aerospace, Inc. Model EA500 airplanes equipped with Avio, Avio with ETT, or Avio NG 1.0... identified in this proposed AD, contact Eclipse Aerospace, Inc. 26 East Palatine Road, Wheeling, Illinois...

  2. Aerospace Community. Aerospace Education I.

    Science.gov (United States)

    Mickey, V. V.

    This book, one in the series on Aerospace Education I, emphasizes the two sides of aerospace--military aerospace and civilian aerospace. Chapter 1 includes a brief discussion on the organization of Air Force bases and missile sites in relation to their missions. Chapter 2 examines the community services provided by Air Force bases. The topics…

  3. Aerospace Medicine

    Science.gov (United States)

    Michaud, Vince

    2015-01-01

    NASA Aerospace Medicine overview - Aerospace Medicine is that specialty area of medicine concerned with the determination and maintenance of the health, safety, and performance of those who fly in the air or in space.

  4. Evaluation of Advanced Adhesives for Aerospace Structures

    Science.gov (United States)

    Stoyanov, P.; Rodriguez, N.; Dickinson, T.; Huy Nguyen, D.; Park, E.; Foyos, J.; Hernandez, V.; Ogren, J.; Berg, M.; Es-Said, O. S.

    2008-08-01

    Polymer adhesives are finding increased use in panel joining applications in aircraft and aerospace structures where the applied stresses permit their use and where a uniform stress distribution is needed. One such adhesive, Hysol EA-9394™, was compared to three other formulations in this study. The new formulations were Hysol EA-9396, Hysol EA-9396 filled with nickel nanofibers and mixed by machine (Jamesbury Blender), and Hysol EA-9396 filled with nickel nanofibers and hand mixed in the laboratory. The comparison consisted of measuring shear lap strengths of aluminum test pieces bonded together with the candidate adhesives. The mechanical tests were supplemented by a Weibull analysis of the strength data and by a visual inspection of the failure mode (adhesive/cohesive). The lap shear strengths (fracture stress values) of all three Hysol EA-9396 adhesives were greater than that of the baseline Hysol EA-9394 polymer.

  5. The National Evaluation of NASA's Science, Engineering, Mathematics and Aerospace Academy (SEMAA) Program

    Science.gov (United States)

    Martinez, Alina; Cosentino de Cohen, Clemencia

    2010-01-01

    This report presents findings from a NASA requested evaluation in 2008, which contains both implementation and impact modules. The implementation study investigated how sites implement Science, Engineering, Mathematics, and Aerospace Academy (SEMAA) and the contextual factors important in this implementation. The implementation study used data…

  6. NASA Aerospace Flight Battery Program: Generic Safety, Handling and Qualification Guidelines for Lithium-Ion (Li-Ion) Batteries; Availability of Source Materials for Lithium-Ion (Li-Ion) Batteries; Maintaining Technical Communications Related to Aerospace Batteries (NASA Aerospace Battery Workshop). Volume 2, Part 1

    Science.gov (United States)

    Manzo, Michelle A.; Brewer, Jeffrey C.; Bugga, Ratnakumar V.; Darcy, Eric C.; Jeevarajan, Judith A.; McKissock, Barbara I.; Schmitz, Paul C.

    2010-01-01

    This NASA Aerospace Flight Battery Systems Working Group was chartered within the NASA Engineering and Safety Center (NESC). The Battery Working Group was tasked to complete tasks and to propose proactive work to address battery related, agency-wide issues on an annual basis. In its first year of operation, this proactive program addressed various aspects of the validation and verification of aerospace battery systems for NASA missions. Studies were performed, issues were discussed and in many cases, test programs were executed to generate recommendations and guidelines to reduce risk associated with various aspects of implementing battery technology in the aerospace industry. This report contains the Appendices to the findings from the first year of the program's operations.

  7. EAS Telecommunications Certification Bodies (TCB)

    Data.gov (United States)

    Federal Communications Commission — EAS (Equipment Authorization System). A Telecommunication Certification Body (TCB) is an accredited product certification body with the authority to issue Grants of...

  8. Modeling Flight: The Role of Dynamically Scaled Free-Flight Models in Support of NASA's Aerospace Programs

    Science.gov (United States)

    Chambers, Joseph

    2010-01-01

    community, Leonardo da Vinci, George Cayley, and the Wright brothers are examples of early aviation pioneers who frequently used models during their scientific efforts to understand and develop flying machines. Progress in the technology associated with model testing in worldwide applications has firmly established model aircraft as a key element in new aerospace research and development programs. Models are now routinely used in many applications and roles, including aerodynamic data gathering in wind tunnel investigations for the analysis of full-scale aircraft designs, proof-of-concept demonstrators for radical aeronautical concepts, and problem-solving exercises for vehicles already in production. The most critical contributions of aerospace models are to provide confidence and risk reduction for new designs and to enhance the safety and efficiency of existing configurations.

  9. Military Aerospace. Aerospace Education II.

    Science.gov (United States)

    Smith, J. C.

    This book is a revised publication in the series on Aerospace Education II. It describes the employment of aerospace forces, their methods of operation, and some of the weapons and equipment used in combat and combat support activities. The first chapter describes some of the national objectives and policies served by the Air Force in peace and…

  10. Aerospace Environment. Aerospace Education I.

    Science.gov (United States)

    Savler, D. S.; Smith, J. C.

    This book is one in the series on Aerospace Education I. It briefly reviews current knowledge of the universe, the earth and its life-supporting atmosphere, and the arrangement of celestial bodies in outer space and their physical characteristics. Chapter 1 includes a brief survey of the aerospace environment. Chapters 2 and 3 examine the…

  11. Enterprise Architecture (EA) Roadmap

    Data.gov (United States)

    Office of Personnel Management — The Enterprise Roadmap reflects the information technology (IT) investment priorities established in agency PortfolioStat reviews, as well as IT program decisions...

  12. EAS Equipment Authorization Grantee Registrations

    Data.gov (United States)

    Federal Communications Commission — EAS (Equipment Authorization System). Radio Frequency (RF) devices are required to be properly authorized under 47 CFR Part 2 prior to being marketed or imported...

  13. 7 CFR 650.8 - When to prepare an environmental assessment (EA).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false When to prepare an environmental assessment (EA). 650... for NRCS-Assisted Programs § 650.8 When to prepare an environmental assessment (EA). An environmental assessment (EA) is to be prepared for: (a) Land and water resource projects that are not included in § 650.7...

  14. NASA-UVa light aerospace alloy and structure technology program supplement: Aluminum-based materials for high speed aircraft

    Science.gov (United States)

    Starke, E. A., Jr.

    1993-01-01

    This report on the NASA-UVa Light Aerospace Alloy and Structure Technology Program Supplement: Aluminum-Based Materials for High Speed Aircraft covers the period from January 1, 1992 to June 30, 1992. The objective of the research is to develop aluminum alloys and aluminum matrix composites for the airframe which can efficiently perform in the HSCT environment for periods as long as 60,000 hours (certification for 120,000 hours) and, at the same time, meet the cost and weight requirements for an economically viable aircraft. Current industry baselines focus on flight at Mach 2.4. The research covers four major materials systems: (1) ingot metallurgy 2XXX, 6XXX, and 8XXX alloys, (2) powder metallurgy 2XXX alloys, (3) rapidly solidified, dispersion strengthened Al-Fe-X alloys, and (4) discontinuously reinforced metal matrix composites. There are ten major tasks in the program which also include evaluation and trade-off studies by Boeing and Douglas aircraft companies.

  15. System engineering of aerospace and advanced technology programs at an astronautics company (record of study)

    Science.gov (United States)

    Kennedy, Mike O.

    An internship with the Martin Marietta Astronautics Group that was performed in partial fulfillment of the requirements for the Doctor of Engineering degree is documented. The internship included assignments with two Martin Marietta companies, on three different programs and in four areas of engineering. A first-hand look is taken at system engineering, SDI and advanced program management, and the way Martin Marietta conducts business. The five internship objectives were related to assignments in system modeling, system integration, engineering analysis and technical management: (1) The effects of thermally and mechanically induced mirror surface distortions upon the wavefront intensity field of a high energy laser beam passing through the optical train of a space-based laser system were modeled. (2) The restrictive as opposed to the broad interpretation of the 1972 ABM Treaty, and the capability of the Strategic Defense Initiative Zenith Star Program to comply with the Treaty were evaluated. (3) The capability of Martin Marietta to develop an automated analysis system to integrate and analyze Superconducting Super Collider detector designs was investigated. (4) The thermal models that were developed in support of the Small Intercontinental Ballistic Missile flight tests were described. (5) The technical management role of the Product Integrity Engineer assigned to the Zenith Star spacecraft's Beam Control and Transfer Subsystem was discussed. The relationships between the engineering, business, security and social concerns associated with the practice of engineering and the management of programs by a major defense contractor are explored.

  16. System Engineering of Aerospace and Advanced Technology Programs at AN Astronautics Company

    Science.gov (United States)

    Kennedy, Mike O.

    The purpose of this Record of Study is to document an internship with the Martin Marietta Astronautics Group in Denver, Colorado that was performed in partial fulfillment of the requirements for the Doctor of Engineering degree at Texas A&M University, and to demonstrate that the internship objectives have been met. The internship included assignments with two Martin Marietta companies, on three different programs and in four areas of engineering. The Record of Study takes a first-hand look at system engineering, SDI and advanced program management, and the way Martin Marietta conducts business. The five internship objectives were related to assignments in system modeling, system integration, engineering analysis and technical management. In support of the first objective, the effects of thermally and mechanically induced mirror surface distortions upon the wavefront intensity field of a high energy laser beam passing through the optical train of a space-based laser system were modeled. To satisfy the second objective, the restrictive as opposed to the broad interpretation of the 1972 ABM Treaty, and the capability of the Strategic Defense Initiative Zenith Star Program to comply with the Treaty were evaluated. For the third objective, the capability of Martin Marietta to develop an automated analysis system to integrate and analyze Superconducting Super Collider detector designs was investigated. For the fourth objective, the thermal models that were developed in support of the Small Intercontinental Ballistic Missile flight tests were described. And in response to the fifth objective, the technical management role of the Product Integrity Engineer assigned to the Zenith Star spacecraft's Beam Control and Transfer Subsystem was discussed. This Record of Study explores the relationships between the engineering, business, security and social concerns associated with the practice of engineering and the management of programs by a major defense contractor.

  17. Aerospace dermatology

    Directory of Open Access Journals (Sweden)

    Sandeep Arora

    2017-01-01

    Full Text Available Evolutionarily, man is a terrestrial mammal, adapted to land. Aviation and now space/microgravity environment, hence, pose new challenges to our physiology. Exposure to these changes affects the human body in acute and chronic settings. Since skin reflects our mental and physical well-being, any change/side effects of this environment shall be detected on the skin. Aerospace industry offers a unique environment with a blend of all possible occupational disorders, encompassing all systems of the body, particularly the skin. Aerospace dermatologists in the near future shall be called upon for their expertise as we continue to push human physiological boundaries with faster and more powerful military aircraft and look to colonize space stations and other planets. Microgravity living shall push dermatology into its next big leap-space, the final frontier. This article discusses the physiological effects of this environment on skin, effect of common dermatoses in aerospace environment, effect of microgravity on skin, and occupational hazards of this industry.

  18. Aerospace Dermatology.

    Science.gov (United States)

    Arora, Sandeep

    2017-01-01

    Evolutionarily, man is a terrestrial mammal, adapted to land. Aviation and now space/microgravity environment, hence, pose new challenges to our physiology. Exposure to these changes affects the human body in acute and chronic settings. Since skin reflects our mental and physical well-being, any change/side effects of this environment shall be detected on the skin. Aerospace industry offers a unique environment with a blend of all possible occupational disorders, encompassing all systems of the body, particularly the skin. Aerospace dermatologists in the near future shall be called upon for their expertise as we continue to push human physiological boundaries with faster and more powerful military aircraft and look to colonize space stations and other planets. Microgravity living shall push dermatology into its next big leap-space, the final frontier. This article discusses the physiological effects of this environment on skin, effect of common dermatoses in aerospace environment, effect of microgravity on skin, and occupational hazards of this industry.

  19. Aerospace engineering training: universities experience

    Directory of Open Access Journals (Sweden)

    Mertins Kseniya

    2016-01-01

    Full Text Available Contemporary professional working in aerospace engineering must have a set of soft and hard skills. The experience gained in universities shows that training of a competent professional is impossible without an employer involved in this process. The paper provides an analysis of missions, tasks and experience of aerospace professionals and identifies the present and future roles, missions and required skills of a highly qualified specialist in aerospace engineering. This analysis can be used to design a master’s program aiming at providing students with the required knowledge, know-how and attitudes needed to succeed as professionals in industrial companies.

  20. A Compendium of Wind Statistics and Models for the NASA Space Shuttle and Other Aerospace Vehicle Programs

    Science.gov (United States)

    Smith, O. E.; Adelfang, S. I.

    1998-01-01

    The wind profile with all of its variations with respect to altitude has been, is now, and will continue to be important for aerospace vehicle design and operations. Wind profile databases and models are used for the vehicle ascent flight design for structural wind loading, flight control systems, performance analysis, and launch operations. This report presents the evolution of wind statistics and wind models from the empirical scalar wind profile model established for the Saturn Program through the development of the vector wind profile model used for the Space Shuttle design to the variations of this wind modeling concept for the X-33 program. Because wind is a vector quantity, the vector wind models use the rigorous mathematical probability properties of the multivariate normal probability distribution. When the vehicle ascent steering commands (ascent guidance) are wind biased to the wind profile measured on the day-of-launch, ascent structural wind loads are reduced and launch probability is increased. This wind load alleviation technique is recommended in the initial phase of vehicle development. The vehicle must fly through the largest load allowable versus altitude to achieve its mission. The Gumbel extreme value probability distribution is used to obtain the probability of exceeding (or not exceeding) the load allowable. The time conditional probability function is derived from the Gumbel bivariate extreme value distribution. This time conditional function is used for calculation of wind loads persistence increments using 3.5-hour Jimsphere wind pairs. These increments are used to protect the commit-to-launch decision. Other topics presented include the Shuttle Shuttle load-response to smoothed wind profiles, a new gust model, and advancements in wind profile measuring systems. From the lessons learned and knowledge gained from past vehicle programs, the development of future launch vehicles can be accelerated. However, new vehicle programs by their very

  1. Aerospace Systems Monitor Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Proposal Title: Aerospace Systems Monitor PHASE 1 Technical Abstract: This Phase II STTR project will continue development and commercialization of the Aerospace...

  2. EA follow-up in the Ghanaian mining sector: Challenges and opportunities

    Energy Technology Data Exchange (ETDEWEB)

    Appiah-Opoku, Seth, E-mail: sappiah@bama.ua.edu [Geography Department, University of Alabama, 230 Farrah Hall, Tuscaloosa, AL 35487 (United States); Bryan, Hobson C. [Geography Department, University of Alabama, 330 Farrah Hall, Tuscaloosa, AL 35487 (United States)

    2013-07-15

    Environmental assessment (EA) follow-up provides a means for monitoring and evaluating the implementation of environmental impact studies. It is integral to the success or failure of a project or program. In spite of its importance, very little attention is given to the need for follow-up programs in most jurisdictions in Africa. Using a case study in the Ghanaian mining sector, this paper explores the challenges and opportunities within the country's EA process for an effective follow-up program. The paper is based on informal interviews, content analysis of relevant publications, official EA documents, and internet searches. The authors suggest a standard EA follow-up program to be formalized as an integral part of Ghana's environmental assessment policy. They also propose a follow-up process that harnesses existing opportunities within the country's EA system. This approach can be replicated in other African countries.

  3. U.S. aerospace industry opinion of the effect of computer-aided prediction-design technology on future wind-tunnel test requirements for aircraft development programs

    Science.gov (United States)

    Treon, S. L.

    1979-01-01

    A survey of the U.S. aerospace industry in late 1977 suggests that there will be an increasing use of computer-aided prediction-design technology (CPD Tech) in the aircraft development process but that, overall, only a modest reduction in wind-tunnel test requirements from the current level is expected in the period through 1995. Opinions were received from key spokesmen in 23 of the 26 solicited major companies or corporate divisions involved in the design and manufacture of nonrotary wing aircraft. Development programs for nine types of aircraft related to test phases and wind-tunnel size and speed range were considered.

  4. OneVA EA Vision and Strategy

    Data.gov (United States)

    Department of Veterans Affairs — The outcomes/goals supported by effective use of an EA are: Improved Service Delivery, Functional Integration, Resource Optimization and Authoritative Reference. VA...

  5. EAS Test Firm Accrediting Bodies (TFAB)

    Data.gov (United States)

    Federal Communications Commission — EAS (Equipment Authorization System). The accreditation bodies for testing laboratories are referred to as Test Firm Accrediting Bodies (TFABs). They are responsible...

  6. 24 CFR 50.31 - The EA.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false The EA. 50.31 Section 50.31 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development PROTECTION AND ENHANCEMENT OF ENVIRONMENTAL QUALITY Environmental Assessments and Related Reviews § 50.31 The EA. (a) Form HUD-4128—Environmental Assessment...

  7. Expert Advisor (EA) Evaluation System Using Web-based ELECTRE Method in Foreign Exchange (Forex) Market

    Science.gov (United States)

    Satibi; Widodo, Catur Edi; Farikhin

    2018-02-01

    This research aims to optimize forex trading profit automatically using EA but its still keep considering accuracy and drawdown levels. The evaluation system will classify EA performance based on trading market sessions (Sydney, Tokyo, London and New York) to determine the right EA to be used in certain market sessions. This evaluation system is a web-based ELECTRE methods that interact in real-time with EA through web service and are able to present real-time charts performance dashboard using web socket protocol communications. Web applications are programmed using NodeJs. In the testing period, all EAs had been simulated 24 hours in all market sessions for three months, the best EA is valued by its profit, accuracy and drawdown criteria that calculated using web-based ELECTRE method. The ideas of this research are to compare the best EA on testing period with collaboration performances of each best classified EA by market sessions. This research uses three months historical data of EUR/USD as testing period and other 3 months as validation period. As a result, performance of collaboration four best EA classified by market sessions can increase profits percentage consistently in testing and validation periods and keep securing accuracy and drawdown levels.

  8. Feasibility study of an Integrated Program for Aerospace vehicle Design (IPAD) Volume 7: IPAD benefits and impact

    Science.gov (United States)

    Hansen, S. D.; Southall, J. W.

    1973-01-01

    The potential benefits, impact and spinoff of IPAD technology are described. The benefits are projected from a flowtime and labor cost analysis of the design process and a study of the flowtime and labor cost savings being experienced with existing integrated systems. Benefits in terms of designer productivity, company effectiveness, and IPAD as a national resource are developed. A description is given of the potential impact of information handling as an IPAD technology, upon task and organization structure and people who use IPAD. Spinoff of IPAD technology to nonaerospace industries is discussed. The results of a personal survey made of aerospace, nonaerospace, government and university sources are given.

  9. 7 CFR 1794.71 - Adoption of an EA.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 12 2010-01-01 2010-01-01 false Adoption of an EA. 1794.71 Section 1794.71... AGRICULTURE (CONTINUED) ENVIRONMENTAL POLICIES AND PROCEDURES Adoption of Environmental Documents § 1794.71 Adoption of an EA. RUS may adopt a Federal EA or EIS or a portion thereof as its EA. RUS shall make the EA...

  10. Aerospace applications of magnetic bearings

    Science.gov (United States)

    Downer, James; Goldie, James; Gondhalekar, Vijay; Hockney, Richard

    1994-05-01

    Magnetic bearings have traditionally been considered for use in aerospace applications only where performance advantages have been the primary, if not only, consideration. Conventional wisdom has been that magnetic bearings have certain performance advantages which must be traded off against increased weight, volume, electric power consumption, and system complexity. These perceptions have hampered the use of magnetic bearings in many aerospace applications because weight, volume, and power are almost always primary considerations. This paper will review progress on several active aerospace magnetic bearings programs at SatCon Technology Corporation. The magnetic bearing programs at SatCon cover a broad spectrum of applications including: a magnetically-suspended spacecraft integrated power and attitude control system (IPACS), a magnetically-suspended momentum wheel, magnetic bearings for the gas generator rotor of a turboshaft engine, a vibration-attenuating magnetic bearing system for an airborne telescope, and magnetic bearings for the compressor of a space-rated heat pump system. The emphasis of these programs is to develop magnetic bearing technologies to the point where magnetic bearings can be truly useful, reliable, and well tested components for the aerospace community.

  11. Shot-Peening Sensitivity of Aerospace Materials

    National Research Council Canada - National Science Library

    Grendahl, Scott; Snoha, Daniel; Hardisky, Benjamin

    2007-01-01

    ... that the U.S. Army Research Laboratory, Weapons and Materials Research Directorate at Aberdeen Proving Ground, MD develop and execute a program aimed at evaluating the shot-peening sensitivity of several aerospace materials...

  12. EAS 2.948 Listed Test Firms

    Data.gov (United States)

    Federal Communications Commission — EAS (Equipment Authorization System). The following firms have submitted the information required by Section 2.948 of the FCC Rules for measuring devices subject to...

  13. A Program of Research and Education to Advance the Design, Synthesis, and Optimization of Aero-Space System Concepts

    Science.gov (United States)

    Sandusky, Robert

    2002-01-01

    Since its inception in December 1999, the program has provided support for a total of 11 Graduate Research Scholar Assistants, of these, 6 have completed their MS degree program. The program has generated 3 MS theses and a total of 4 publications/presentations.

  14. The development of aerospace polyimide adhesives

    Science.gov (United States)

    St.clair, A. K.; St.clair, T. L.

    1983-01-01

    Few materials are available which can be used as aerospace adhesives at temperatures in the range of 300 C. The Materials Division at NASA-Langley Research Center developed several high temperature polyimide adhesives to fulfill the stringent needs of current aerospace programs. These adhesives are the result of a decade of basic research studies on the structure property relationships of both linear and addition aromatic polyimides. The development of both in house and commercially available polyimides is reviewed with regards to their potential for use as aerospace adhesives.

  15. KIBO Industry, innovates in aerospace

    Science.gov (United States)

    Paillard, Jean-Philippe

    2016-07-01

    The conquest of space is a true inspiration. Imagine a long-duration mission to a distant destination. What shall we take to produce our food? A cow, fish, chicken, or just eggs. In the current state of the animal production technologies are complicated and expensive to implement, except perhaps one: the breeding of edible insects. Based on this postulate KIBO in partnership with Space Agriculture Task Force and the university's department of Nutrition Nagoya most innovative research program is created in modern nutrition. This program is called Pegasus. Pegasus research program aims to develop food productions and modules applicable to the aerospace conquest. Kibo industry is the first entomocole production company creat in Europe to human food; it aims to become the world leader by 2020. Kibo industry is particularly specialized in producing entomosource (products with insects). The first phase of the program is to achieve an outcome cereal bar edible insect to aerospace. So we will present the issues and objectives of the project, for aerospace and us. Jean-Philippe Paillard is the KIBO industry CEO and Vice President of the FFPIDI insects farms federation. He is also the co computer alone authorization dossier on the market in Europe and therefore the privileged interlocutor of the General Directorate for Health and Customer Review on this topic. He intervened at the last conference on the insect organized by FAO in Wageningen and various universities in France.

  16. The array for EAS neutron component detection

    Science.gov (United States)

    Gromushkin, D.; Alekseenko, V.; Petrukhin, A.; Shchegolev, O.; Stenkin, Yu; Stepanov, V.; Yashin, I.; Zadeba, E.

    2014-08-01

    The idea of a novel type detector array is the following: delayed thermal neutrons generated by hadronic component of Extensive Air Showers (EAS) can be detected over the whole array area using special electron-neutron detectors (en-detectors). The array PRISMA-32 consists of 32 en-detectors, deployed over the area of 450 m2. En-detectors are able to detect two main EAS components: electromagnetic one in a case of a synchronous passage of several charged particles, and hadronic component through thermal neutron captures. Detectors are based on a specialized inorganic scintillator, being a granulated alloy of ZnS(Ag) with LiF, enriched up to 90% with 6Li isotope. The array is triggered by the electromagnetic component of EAS, and provides information about the energy deposit (mostly electrons) and delayed neutrons accompanying the EAS within 20 ms after the trigger. During 2 years of operation more than 105 events were recorded. Examples of EAS detection are presented.

  17. EA Training 2.0 Newsletter #3 - EA Active, Problem Based Learning Methodology

    DEFF Research Database (Denmark)

    Buus, Lillian; Ryberg, Thomas; Sroga, Magdalena

    2010-01-01

    The main products of the project are innovative, active problem-based learning methodology for EA education and training, EA courses for university students and private and public sector employees, and an Enterprise Architecture competence ontology including a complete specification of skills...

  18. Study of EAS neutron component temporal structure

    Science.gov (United States)

    Gromushkin, D. M.; Petrukhin, A. A.; Stenkin, Yu. V.; Yashin, I. I.

    2011-04-01

    The neutron component of Extensive Air Showers (EAS) carries information about the primary cosmic ray flux as well as about parameters of hadronic interactions at ultra-high energies. We present here the data obtained with the "Neutron" array which is a prototype of a novel type EAS array PRISMA (Stenkin, 2009). The prototype consists of 5 large area scintillator detectors (0.75 m2 each) placed in the corners and in the center of 5 m side square. The scintillator consisting of an alloy of ZnS(Ag) and 6LiF is shaped as a thin layer of grains covered with thin transparent plastic film.

  19. Issues in NASA Program and Project Management:: A Collection of Papers on Aerospace Management Issues (Supplement 11)

    Science.gov (United States)

    Hoffman, Edward J. (Editor); Lawbaugh, William M. (Editor)

    1996-01-01

    Papers address the following topics: NASA's project management development process; Better decisions through structural analysis; NASA's commercial technology management system; Today's management techniques and tools; Program control in NASA - needs and opportunities; and Resources for NASA managers.

  20. 47 CFR 11.31 - EAS protocol.

    Science.gov (United States)

    2010-10-01

    ... Institute of Standards and Technology publication FIPS PUB 6-4. Each state is assigned an SS number as... applications. The use of county subdivisions will probably be rare and generally for oddly shaped or unusually... television broadcast stations, analog cable systems and wireless cable systems may upgrade their existing EAS...

  1. Comparing Generic Parameter Controllers for EAs

    NARCIS (Netherlands)

    Karafotias, G.; Hoogendoorn, M.

    2014-01-01

    Parameter controllers for Evolutionary Algorithms (EAs) deal with adjusting parameter values during an evolutionary run. Many ad hoc approaches have been presented for parameter control, but few generic parameter controllers exist and, additionally, no comparisons or in depth analyses of these

  2. EAS selection in the EMMA underground array

    DEFF Research Database (Denmark)

    Sarkamo, J.; Bezrukov, L.; Enqvist, T.

    2013-01-01

    The first measurements of the Experiment with MultiMuon Array (EMMA) have been analyzed for the selection of the Extensive Air Showers (EAS). Test data were recorded with an underground muon tracking station and a satellite station separated laterally by 10 metres. Events with tracks distributed...

  3. Environmental effects on composite airframes: A study conducted for the ARM UAV Program (Atmospheric Radiation Measurement Unmanned Aerospace Vehicle)

    Energy Technology Data Exchange (ETDEWEB)

    Noguchi, R.A.

    1994-06-01

    Composite materials are affected by environments differently than conventional airframe structural materials are. This study identifies the environmental conditions which the composite-airframe ARM UAV may encounter, and discusses the potential degradation processes composite materials may undergo when subjected to those environments. This information is intended to be useful in a follow-on program to develop equipment and procedures to prevent, detect, or otherwise mitigate significant degradation with the ultimate goal of preventing catastrophic aircraft failure.

  4. Aerospace Management, Volume 5 Number 1.

    Science.gov (United States)

    Kaprielyan, S. Peter

    Presented are articles and reports dealing with aspects of the aerospace programs of the National Aeronautics and Space Administration (NASA). Of major concern are the technological and managerial challenges within the space station and space shuttle programs. Other reports are given on: (1) medical experiments, (2) satellites, (3) international…

  5. Aerospace Systems Monitor Project

    Data.gov (United States)

    National Aeronautics and Space Administration — This Phase I STTR project will demonstrate the Aerospace System Monitor (ASM). This technology transforms the power distribution network in a spacecraft or aircraft...

  6. Increased cardiogenesis in P19-GFP teratocarcinoma cells expressing the propeptide IGF-1Ea

    Energy Technology Data Exchange (ETDEWEB)

    Poudel, Bhawana [Heart Science Centre, National Heart and Lung Institute, Imperial College, London (United Kingdom); Bilbao, Daniel [EMBL, Mouse Biology Unit, Monterotondo (Italy); Sarathchandra, Padmini; Germack, Renee [Heart Science Centre, National Heart and Lung Institute, Imperial College, London (United Kingdom); Rosenthal, Nadia [Heart Science Centre, National Heart and Lung Institute, Imperial College, London (United Kingdom); Australian Regenerative Medicine Institute, Monash University, Melbourne (Australia); Santini, Maria Paola, E-mail: m.santini@imperial.ac.uk [Heart Science Centre, National Heart and Lung Institute, Imperial College, London (United Kingdom)

    2011-12-16

    Highlights: Black-Right-Pointing-Pointer In this study, we explored the function of IGF-1Ea propeptide in inducing cardiogenesis of stem cells. Black-Right-Pointing-Pointer IGF-1Ea promoted cardiac mesodermal induction in uncommitted cells. Black-Right-Pointing-Pointer Under differentiation condition, IGF-1Ea increased expression of cardiac differentiation markers. Black-Right-Pointing-Pointer Furthermore, it promoted formation of finely organized sarcomeric structure. Black-Right-Pointing-Pointer IGF-1Ea propeptide may be a good candidate to improve production of cardiomyocytes from pluripotent cells. -- Abstract: The mechanism implicated in differentiation of endogenous cardiac stem cells into cardiomyocytes to regenerate the heart tissue upon an insult remains elusive, limiting the therapeutical goals to exogenous cell injection and/or gene therapy. We have shown previously that cardiac specific overexpression of the insulin-like growth factor 1 propeptide IGF-1Ea induces beneficial myocardial repair after infarct. Although the mechanism is still under investigation, the possibility that this propeptide may be involved in promoting stem cell differentiation into the cardiac lineage has yet to be explored. To investigate whether IGF-1Ea promote cardiogenesis, we initially modified P19 embryonal carcinoma cells to express IGF-1Ea. Taking advantage of their cardiomyogenic nature, we analyzed whether overexpression of this propeptide affected cardiac differentiation program. The data herein presented showed for the first time that constitutively overexpressed IGF-1Ea increased cardiogenic differentiation program in both undifferentiated and DMSO-differentiated cells. In details, IGF-1Ea overexpression promoted localization of alpha-actinin in finely organized sarcomeric structure compared to control cells and upregulated the cardiac mesodermal marker NKX-2.5 and the ventricular structural protein MLC2v. Furthermore, activated IGF-1 signaling promoted cardiac

  7. 47 CFR 11.61 - Tests of EAS procedures.

    Science.gov (United States)

    2010-10-01

    ... EOM Codes: (A) Analog and digital AM, FM, and TV broadcast stations must conduct tests of the EAS... transmitted within 60 minutes of receipt by EAS Participants in an EAS Local Area or State. Analog and digital class D non-commercial educational FM and analog and digital LPTV stations are required to transmit only...

  8. D1.1 Stakeholders Needs Regarding EA

    DEFF Research Database (Denmark)

    Ryberg, Thomas; Eleftheriou, Paraskevi; Maglavera, Stavroula

    2009-01-01

    in a university course about EA. This deliverable commences with a detailed description of the methodology followed for the identification of stakeholders needs regarding Enterprise Architecture (EA) training and education. It then presents the results of the methodology application in terms of EA related...

  9. Aerospace Technology Curriculum Guide. Invest in Success. Vo. Ed. #260.

    Science.gov (United States)

    Idaho State Dept. of Education, Boise. Div. of Vocational Education.

    This document contains standards for an articulated secondary and postsecondary curriculum in aerospace technology. The curriculum standards can be used to ensure that vocational programs meet the needs of local business and industry. The first part of the document contains a task list and student performance standards for the aerospace technology…

  10. The Relationship of Skilled Aerospace Manufacturing Workforce Performance to Training

    Science.gov (United States)

    Malsberry, Suzanne

    2014-01-01

    A major economic driver, the aerospace industry contributes to exports and higher wage jobs, which the United States requires to maintain robust economic health. Despite the investment in vocational educational training programs, insufficient workers have been available to aerospace companies. The purpose of this study was to investigate the…

  11. 75 FR 61345 - Airworthiness Directives; Eclipse Aerospace, Inc. Model EA500 Airplanes

    Science.gov (United States)

    2010-10-05

    ... an older version of AVIO to upgrade to AVIO NG since it is more than the value of the airplane. We... AMOC applies, notify your appropriate principal inspector (PI) in the FAA Flight Standards District Office (FSDO), or lacking a PI, your local FSDO. Related Information (h) For more information about this...

  12. Aerospace Accident - Injury Autopsy Data System -

    Data.gov (United States)

    Department of Transportation — The Aerospace Accident Injury Autopsy Database System will provide the Civil Aerospace Medical Institute (CAMI) Aerospace Medical Research Team (AMRT) the ability to...

  13. Frontier Aerospace Opportunities

    Science.gov (United States)

    Bushnell, Dennis M.

    2014-01-01

    Discussion and suggested applications of the many ongoing technology opportunities for aerospace products and missions, resulting in often revolutionary capabilities. The, at this point largely unexamined, plethora of possibilities going forward, a subset of which is discussed, could literally reinvent aerospace but requires triage of many possibilities. Such initial upfront homework would lengthen the Research and Development (R&D) time frame but could greatly enhance the affordability and performance of the evolved products and capabilities. Structural nanotubes and exotic energetics along with some unique systems approaches are particularly compelling.

  14. Index of international publications in aerospace medicine.

    Science.gov (United States)

    2014-05-01

    The 5th edition of the Index of International Publications in Aerospace Medicine is a comprehensive : listing of international publications in clinical aerospace medicine, operational aerospace medicine, : aerospace physiology, environmental medicine...

  15. Managing complexity of aerospace systems

    Science.gov (United States)

    Tamaskar, Shashank

    Growing complexity of modern aerospace systems has exposed the limits of conventional systems engineering tools and challenged our ability to design them in a timely and cost effective manner. According to the US Government Accountability Office (GAO), in 2009 nearly half of the defense acquisition programs are expecting 25% or more increase in unit acquisition cost. Increase in technical complexity has been identified as one of the primary drivers behind cost-schedule overruns. Thus to assure the affordability of future aerospace systems, it is increasingly important to develop tools and capabilities for managing their complexity. We propose an approach for managing the complexity of aerospace systems to address this pertinent problem. To this end, we develop a measure that improves upon the state-of-the-art metrics and incorporates key aspects of system complexity. We address the problem of system decomposition by presenting an algorithm for module identification that generates modules to minimize integration complexity. We demonstrate the framework on diverse spacecraft and show the impact of design decisions on integration cost. The measure and the algorithm together help the designer track and manage complexity in different phases of system design. We next investigate how complexity can be used as a decision metric in the model-based design (MBD) paradigm. We propose a framework for complexity enabled design space exploration that introduces the idea of using complexity as a non-traditional design objective. We also incorporate complexity with the component based design paradigm (a sub-field of MBD) and demonstrate it on several case studies. The approach for managing complexity is a small but significant contribution to the vast field of complexity management. We envision our approach being used in concert with a suite of complexity metrics to provide an ability to measure and track complexity through different stages of design and development. This will not

  16. Bio-based structural composite materials for aerospace applications

    CSIR Research Space (South Africa)

    Jacob John, Maya

    2008-09-01

    Full Text Available between fibre and matrix, moisture and thermal durability besides compliance to meet with airworthiness standards. The latter part of the program will deal with biopolymer matrices which would lead to development of green composites for aerospace...

  17. 75 FR 39911 - Aerospace Supplier Development Mission to China

    Science.gov (United States)

    2010-07-13

    ... programs. The evolution of China's aerospace industry is part of a broader industry trend toward supply... calendar ( http://www.ita.doc.gov/doctm/tmcal.html ) and other Internet Web sites, press releases to...

  18. An Aerospace Nation

    Science.gov (United States)

    2016-05-25

    of materials by drone or other robotic devices from any place to anywhere. The country will reinvent its domestic aerospace infrastructure such...sized-projects -aerotropolitan-ambitions. 20. Scott Thompson, Chuck Marx , James B. Grow, Robert W. McCutcheon, et al., Avia- tion’s Second Golden Age

  19. EAS-BUAP: Lateral Distribution and Performance

    Science.gov (United States)

    Salazar, H.; Martinez, O.; Cotzomi, J.; Moreno, E.; Aguilar, S.; Villaseñor, L.

    2003-07-01

    We describe the operation and performance of the first stage of the EAS-UAP extensive air shower array, as a detector of very high energy cosmic rays (Eo > 1014eV) after one year of operation. The array is located at the Campus of Puebla University, 2200 m above sea level. It consists of 10 liquid scintillator detectors, each with an active surface of 1 m2 and a detector spacing of 20 m in a square grid. One Auger Water Cherenkov detector is also included as part of the array. In this report we discuss the stability, the calibration and lateral distribution function reconstruction capabilities of the detector array. We also present the analysis of the shower size spectrum. In addition, the main characteristics of this array allow us to use it as an educational and training facility.

  20. Environmental Agents Service (EAS) Registry System of Records

    Data.gov (United States)

    Department of Veterans Affairs — The Environmental Agent Service (EAS) Registries is the information system encompassing the Ionizing Radiation Registry (IRR), the Agent Orange Registry (AOR), and...

  1. AI aerospace components

    Science.gov (United States)

    Heindel, Troy A.; Murphy, Terri B.; Rasmussen, Arthur N.; Mcfarland, Robert Z.; Montgomery, Ronnie E.; Pohle, George E.; Heard, Astrid E.; Atkinson, David J.; Wedlake, William E.; Anderson, John M.

    1991-01-01

    An evaluation is made of the application of novel, AI-capabilities-related technologies to aerospace systems. Attention is given to expert-system shells for Space Shuttle Orbiter mission control, manpower and processing cost reductions at the NASA Kennedy Space Center's 'firing rooms' for liftoff monitoring, the automation of planetary exploration systems such as semiautonomous mobile robots, and AI for battlefield staff-related functions.

  2. Aerospace Engineering Systems

    Science.gov (United States)

    VanDalsem, William R.; Livingston, Mary E.; Melton, John E.; Torres, Francisco J.; Stremel, Paul M.

    1999-01-01

    Continuous improvement of aerospace product development processes is a driving requirement across much of the aerospace community. As up to 90% of the cost of an aerospace product is committed during the first 10% of the development cycle, there is a strong emphasis on capturing, creating, and communicating better information (both requirements and performance) early in the product development process. The community has responded by pursuing the development of computer-based systems designed to enhance the decision-making capabilities of product development individuals and teams. Recently, the historical foci on sharing the geometrical representation and on configuration management are being augmented: Physics-based analysis tools for filling the design space database; Distributed computational resources to reduce response time and cost; Web-based technologies to relieve machine-dependence; and Artificial intelligence technologies to accelerate processes and reduce process variability. Activities such as the Advanced Design Technologies Testbed (ADTT) project at NASA Ames Research Center study the strengths and weaknesses of the technologies supporting each of these trends, as well as the overall impact of the combination of these trends on a product development event. Lessons learned and recommendations for future activities will be reported.

  3. Thermophysical Properties and Spectral Characterization of EA 6043

    Science.gov (United States)

    2014-10-01

    correlation for EA 6043. The 1999 density data, shown as triangles in Figure 2, clearly demonstrate that the measured density of EA 6043 depends on...systems: temperature in kelvin with pressure in pascal and temperature in Celsius with pressure in torr. The percent differences between the

  4. 33 CFR 230.10 - Environmental Assessments (EA).

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Environmental Assessments (EA..., DEPARTMENT OF DEFENSE PROCEDURES FOR IMPLEMENTING NEPA § 230.10 Environmental Assessments (EA). (a) Purpose... potential environmental effects of the proposed action and, if appropriate, its alternatives, for...

  5. Access to Japanese aerospace-related scientific and technical information: The NASA Aerospace Database

    Science.gov (United States)

    Hoetker, Glenn P.; Lahr, Thomas F.

    1993-01-01

    With Japan's growing R&D strength in aerospace-related fields, it is increasingly important for U.S. researchers to be aware of Japanese advances. However, several factors make it difficult to do so. After reviewing the diffusion of aerospace STI in Japan, four factors which make it difficult for U.S. researchers to gather this information are discussed: language, the human network, information scatter, and document acquisition. NASA activities to alleviate these difficulties are described, beginning with a general overview of the NASA STI Program. The effects of the new National Level Agreement between NASA and NASDA are discussed.

  6. Final Environmental Assessment and Finding of No Significant Impact (EA/FONSI) for 2012-14 Capital Improvements Program (CIP) at Davis-Monthan Air Force Base, Tucson, Arizona

    Science.gov (United States)

    2012-03-01

    solid waste; record - keeping and reporting; and pollution prevention. AFI 32-7080, Pollution Prevention Program, addresses source reduction, resource...wildlife community with more than 120 avian species; numerous mammalian, reptilian, and amphibian species; and hundreds of invertebrate species (Davis...turn heats the surface of the Earth. Human activities that involve combustion of fossil fuels (i.e., fuels containing carbon, such as wood, coal

  7. 75 FR 7949 - Airworthiness Directives; Extra Flugzeugproduktions- und Vertriebs- GmbH Models EA-300/200 and EA...

    Science.gov (United States)

    2010-02-23

    ... Flugzeugproduktions- und Vertriebs- GmbH Models EA-300/200 and EA-300/L Airplanes AGENCY: Federal Aviation... reported on aeroplanes already compliant with Part II of Extra Service Bulletin No. SB-300-2-97 issue A, as... Extra Service Bulletin No. SB-300-2-97 issue A, as mandated by the LBA AD D-1998-001, dated 15 January...

  8. Cluster type EAS array of the NEVOD experimental complex

    Science.gov (United States)

    Amelchakov, M. B.; Ampilogov, N. V.; Astapov, I. I.; Barbashina, N. S.; Bogdanov, A. G.; Chiavassa, A.; Gromushkin, D. M.; Khokhlov, S. S.; Kokoulin, R. P.; Kompaniets, K. G.; Likiy, O. I.; Ovchinnikov, V. V.; Petrukhin, A. A.; Saavedra, O.; Shulzhenko, I. A.; Yashin, I. I.

    2017-06-01

    A new NEVOD-EAS array for detection of extensive air showers (EAS) in the energy range 1015-1017 eV is being created in MEPhI (Moscow, Russia) on the basis of the Experimental complex NEVOD. It will be operated in conjunction with the Cherenkov water detector NEVOD and coordinate detector DECOR, as well as with detectors URAN and TREK which are now being constructed. The array will allow determining of the size, axis position and arrival direction of EAS registered by aforementioned installations. The NEVOD-EAS registering system is organized in a cluster principle. Each cluster of the shower array is an independent system which includes 16 scintillation counters of EAS electron-photon component combined in 4 detector stations and registering electronics. Cluster electronics performs digitizing of analog signals, selection of events according to intra-cluster triggering conditions, time-stamping of events and monitoring of cluster operational parameters. Information on events and operational parameters is transferred to the central DAQ post of control and synchronization. In 2015-2016, the central part of the NEVOD-EAS array was created and launched into operation. It includes 4 clusters located at different altitudes at area of 104 m2 around the complex. The paper discribes the features of the distributed cluster type registering system of the NEVOD-EAS shower array, as well as the main characteristics of clusters and their elements.

  9. ScienceScope: Aerospace

    CSIR Research Space (South Africa)

    CSIR

    2006-12-01

    Full Text Available that were produced by local industry based on tracking radar technology developed at the CSIR. They are capable of tracking small targets at long ranges in all weather conditions and form part of the ship's main weapon and air defence systems. 7..., outcomes of advances in the manufacture and operation of aerospace systems impact on society at large. This could be in the improvement of the carry- ing capacity of commercial transport air- craft, the avionics capabilities of military fighter aircraft...

  10. 43rd Aerospace Mechanisms Symposium

    Science.gov (United States)

    Boesiger, Edward A.

    2016-01-01

    The Aerospace Mechanisms Symposium (AMS) provides a unique forum for those active in the design, production and use of aerospace mechanisms. A major focus is the reporting of problems and solutions associated with the development and flight certification of new mechanisms. Sponsored and organized by the Mechanisms Education Association, responsibility for hosting the AMS is shared by the National Aeronautics and Space Administration and Lockheed Martin Space Systems Company (LMSSC). Now in its 43rd symposium, the AMS continues to be well attended, attracting participants from both the U.S. and abroad. The 43rd AMS was held in Santa Clara, California on May 4, 5 and 6, 2016. During these three days, 42 papers were presented. Topics included payload and positioning mechanisms, components such as hinges and motors, CubeSats, tribology, and mechanism testing. Hardware displays during the supplier exhibit gave attendees an opportunity to meet with developers of current and future mechanism components. The high quality of this symposium is a result of the work of many people, and their efforts are gratefully acknowledged. This extends to the voluntary members of the symposium organizing committee representing the eight NASA field centers, LMSSC, and the European Space Agency. Appreciation is also extended to the session chairs, the authors, and particularly the personnel at ARC responsible for the symposium arrangements and the publication of these proceedings. A sincere thank you also goes to the symposium executive committee who is responsible for the year-to-year management of the AMS, including paper processing and preparation of the program. The use of trade names of manufacturers in this publication does not constitute an official endorsement of such products or manufacturers, either expressed or implied, by the National Aeronautics and Space Administration.

  11. The Aerospace Environment. Aerospace Education I. Instructor Handbook.

    Science.gov (United States)

    Air Univ., Maxwell AFB, AL. Junior Reserve Office Training Corps.

    This publication provides guidelines for teachers using the textbook entitled "Aerospace Environment," published in the Aerospace Education I series. Major categories included in each chapter are objectives, behavioral objectives, suggested outline, orientation, suggested key points, instructional aids, projects, and further reading.…

  12. Aerospace Community. Aerospace Education I. Instructional Unit V.

    Science.gov (United States)

    Moynihan, Eileen P.

    This curriculum guide is prepared for the textbook entitled "Aerospace Community," published in the Aerospace Education I series. Specific guidelines are suggested for teachers using the textbook. Major categories included in the guidebook for each chapter are objectives (traditional and behavioral), suggested outline, orientation,…

  13. Military Aerospace. Aerospace Education II. Instructional Unit VI.

    Science.gov (United States)

    Hall, Arthur D.

    This curriculum guide is prepared for the Aerospace Education II series publication entitled "Military Aerospace." Sections in the guide include objectives (traditional and behavioral), suggested outline, orientation, suggested key points, suggestions for teaching, instructional aids, projects, and further reading. A separate sheet is…

  14. The Aerospace Age. Aerospace Education I. Instructional Unit II.

    Science.gov (United States)

    Air Univ., Maxwell AFB, AL. Junior Reserve Office Training Corps.

    This curriculum guide is prepared for the textbook entitled "The Aerospace Age," published in the Aerospace Education I series. The guide is organized by objectives, behavioral objectives, textbook outline, orientation, suggested key points, suggestions for teaching, instructional aids, projects, and further reading. Major points…

  15. (1+1) EA on Generalized Dynamic OneMax

    DEFF Research Database (Denmark)

    Kötzing, Timo; Lissovoi, Andrei; Witt, Carsten

    2015-01-01

    Evolutionary algorithms (EAs) perform well in settings involving uncertainty, including settings with stochastic or dynamic fitness functions. In this paper, we analyze the (1+1) EA on dynamically changing OneMax, as introduced by Droste (2003). We re-prove the known results on first hitting times...... using the modern tool of drift analysis. We extend these results to search spaces which allow for more than two values per dimension. Furthermore, we make an anytime analysis as suggested by Jansen and Zarges (2014), analyzing how closely the (1+1) EA can track the dynamically moving optimum over time...

  16. Limitless Horizons: Careers in Aerospace.

    Science.gov (United States)

    Lewis, Mary H.

    This is a manual for acquainting students with pertinent information relating to career choices in aerospace science, engineering, and technology. The first chapter presents information about the aerospace industry by describing disciplines typical of this industry. The National Aeronautics and Space Administration's (NASA) classification system…

  17. Smart antennas in aerospace applications

    NARCIS (Netherlands)

    Verpoorte, Jaco; Schippers, Harmen; Roeloffzen, C.G.H.; Marpaung, D.A.I.

    2010-01-01

    The interest in Smart Antennas for aerospace applications is growing. This paper describes smart antennas which can be used on aircraft. Two aerospace applications are discussed in more detail: a phased array antenna with optical beam forming and a large vibrating phased array antenna with

  18. 47 CFR 11.32 - EAS Encoder.

    Science.gov (United States)

    2010-10-01

    ... must additionally provide the following minimum specifications: (1) Encoder programming. Access to encoder programming shall be protected by a lock or other security measures and be configured so that... fundamental frequencies of 853 and 960 Hz and not vary over ±0.5 Hz. (ii) Harmonic Distortion. The total...

  19. Severo-Vostoku ot EAS perepadajet malo / Jekaterina Guzhvina

    Index Scriptorium Estoniae

    Guzhvina, Jekaterina

    2007-01-01

    Mitmel turismiga tegeleval Ida-Viru ettevõtjal polnud piisavalt infot Ettevõtluse Arendamise Sihtasutuse interneti-projeti "Puhka Eestis" võimaluste kohta. EAS leiab, et ettevõtjad peaksid ise aktiivsemad olema

  20. EAS kulutab 150 miljonit telesaadetele ja messidele / Martin Hanson

    Index Scriptorium Estoniae

    Hanson, Martin, 1984-

    2008-01-01

    EAS kulutab välisturistide Eestisse meelitamiseks 150 miljonit krooni, millega finantseeritakse telesaateid, messidel osalemist ja ajakirjanike pressireise. Vt. samas: Kampaania maksumus; Eesti tutvustuse üritusi. Kommenteerib Mari Loorens-Timmo

  1. EAS vahendas mullu Harjumaale 47 miljonit krooni toetusi / Allar Korjas

    Index Scriptorium Estoniae

    Korjas, Allar

    2005-01-01

    Möödunud aastal jõudis EAS- i vahendusel alustavate ja tegutsevate ettevõtete ning regionaalse arengu toetamiseks Harjumaale 47,1 miljonit krooni. Tabel. Vt. samas: Aare Ets. Regionaalne koostöö Harjumaal on oluline

  2. Noise properties and cascadability of SOA-EA regenerators

    DEFF Research Database (Denmark)

    Öhman, Filip; Bischoff, Svend; Tromborg, Bjarne

    2002-01-01

    We suggest and analyse a new device containing concatenated pairs of semiconductor optical amplifiers (SOAs) and electroabsorption modulators (EAs). The device has regenerative properties and improves the cascadability of optical fibre links.......We suggest and analyse a new device containing concatenated pairs of semiconductor optical amplifiers (SOAs) and electroabsorption modulators (EAs). The device has regenerative properties and improves the cascadability of optical fibre links....

  3. Analysis of the hadron component in E.A.S.

    Science.gov (United States)

    Procureur, J.; Stamenov, J. N.; Stavrev, P. V.; Ushev, S. Z.

    1985-01-01

    Hadrons in extensive air showers (E.A.S.) provide direct information about high energy interactions. As a rule the biases pertaining to different shower array arrangements have a relative large influence for the basic phenomenological characteristics of the E.A.S. hadron component. In this situation, the problem of the correct comparison between model calculated and experimental characteristics is of great importance for the reliability of the derived conclusions about the high energy interaction characteristics.

  4. Development and integration of modern laboratories in aerospace education

    Science.gov (United States)

    Desautel, D.; Hunter, N.; Mourtos, N.; Pernicka, H.

    1992-01-01

    This paper describes the development and integration of a suite of laboratories in an aerospace engineering program. The program's approach to undergraduate education is described as the source for the development of the supporting laboratories. Nine laboratories supporting instruction were developed and installed. The nine laboratories include most major flight-vehicle disciplines. The purpose and major equipments/experiments of each laboratory are briefly described, as is the integration of the laboratory with coursework. The laboratory education provided by this program successfully achieves its purpose of producing competitive aerospace engineering graduates and advancing the level of undergraduate education.

  5. EA anamnesis An Approach for Decision Making Analysis in Enterprise Architecture

    OpenAIRE

    Plataniotis, Georgios; De Kinderen, Sybren; Proper, Hendrik A.

    2014-01-01

    Enterprise Architecture (EA) modeling languages can express the business-to-IT-stack for an organization, showing how changes in the IT landscape impact business aspects and vice versa. Yet EA languages provide only the final architectural design, not the rationale behind this design. In earlier work, we presented the EA Anamnesis approach for EA rationalization. We discussed how EA Anamnesis forms a complement to current EA modeling languages, showing for example desig...

  6. Aerospace Human Factors

    Science.gov (United States)

    Jordan, Kevin

    1999-01-01

    The following contains the final report on the activities related to the Cooperative Agreement between the human factors research group at NASA Ames Research Center and the Psychology Department at San Jose State University. The participating NASA Ames division has been, as the organization has changed, the Aerospace Human Factors Research Division (ASHFRD and Code FL), the Flight Management and Human Factors Research Division (Code AF), and the Human Factors Research and Technology Division (Code IH). The inclusive dates for the report are November 1, 1984 to January 31, 1999. Throughout the years, approximately 170 persons worked on the cooperative agreements in one capacity or another. The Cooperative Agreement provided for research personnel to collaborate with senior scientists in ongoing NASA ARC research. Finally, many post-MA/MS and post-doctoral personnel contributed to the projects. It is worth noting that 10 former cooperative agreement personnel were hired into civil service positions directly from the agreements.

  7. Dynamics of aerospace vehicles

    Science.gov (United States)

    Schmidt, David K.

    1991-01-01

    The focus of this research was to address the modeling, including model reduction, of flexible aerospace vehicles, with special emphasis on models used in dynamic analysis and/or guidance and control system design. In the modeling, it is critical that the key aspects of the system being modeled be captured in the model. In this work, therefore, aspects of the vehicle dynamics critical to control design were important. In this regard, fundamental contributions were made in the areas of stability robustness analysis techniques, model reduction techniques, and literal approximations for key dynamic characteristics of flexible vehicles. All these areas are related. In the development of a model, approximations are always involved, so control systems designed using these models must be robust against uncertainties in these models.

  8. Anechoic Chambers: Aerospace Applications. (Latest Citations from the Aerospace Database)

    Science.gov (United States)

    1996-01-01

    The bibliography contains citations concerning the design, development, performance, and applications of anechoic chambers in the aerospace industry. Anechoic chamber testing equipment, techniques for evaluation of aerodynamic noise, microwave and radio antennas, and other acoustic measurement devices are considered. Shock wave studies on aircraft models and components, electromagnetic measurements, jet flow studies, and antenna radiation pattern measurements for industrial and military aerospace equipment are discussed. (Contains 50-250 citations and includes a subject term index and title list.)

  9. Optimal control with aerospace applications

    CERN Document Server

    Longuski, James M; Prussing, John E

    2014-01-01

    Want to know not just what makes rockets go up but how to do it optimally? Optimal control theory has become such an important field in aerospace engineering that no graduate student or practicing engineer can afford to be without a working knowledge of it. This is the first book that begins from scratch to teach the reader the basic principles of the calculus of variations, develop the necessary conditions step-by-step, and introduce the elementary computational techniques of optimal control. This book, with problems and an online solution manual, provides the graduate-level reader with enough introductory knowledge so that he or she can not only read the literature and study the next level textbook but can also apply the theory to find optimal solutions in practice. No more is needed than the usual background of an undergraduate engineering, science, or mathematics program: namely calculus, differential equations, and numerical integration. Although finding optimal solutions for these problems is a...

  10. Aerospace materials and material technologies

    CERN Document Server

    Wanhill, R

    2017-01-01

    This book is a comprehensive compilation of chapters on materials (both established and evolving) and material technologies that are important for aerospace systems. It considers aerospace materials in three Parts. Part I covers Metallic Materials (Mg, Al, Al-Li, Ti, aero steels, Ni, intermetallics, bronzes and Nb alloys); Part II deals with Composites (GLARE, PMCs, CMCs and Carbon based CMCs); and Part III considers Special Materials. This compilation has ensured that no important aerospace material system is ignored. Emphasis is laid in each chapter on the underlying scientific principles as well as basic and fundamental mechanisms leading to processing, characterization, property evaluation and applications. A considerable amount of materials data is compiled and presented in appendices at the end of the book. This book will be useful to students, researchers and professionals working in the domain of aerospace materials.

  11. Heat transfer in aerospace propulsion

    Science.gov (United States)

    Simoneau, Robert J.; Hendricks, Robert C.; Gladden, Herbert J.

    1988-01-01

    Presented is an overview of heat transfer related research in support of aerospace propulsion, particularly as seen from the perspective of the NASA Lewis Research Center. Aerospace propulsion is defined to cover the full spectrum from conventional aircraft power plants through the Aerospace Plane to space propulsion. The conventional subsonic/supersonic aircraft arena, whether commercial or military, relies on the turbine engine. A key characteristic of turbine engines is that they involve fundamentally unsteady flows which must be properly treated. Space propulsion is characterized by very demanding performance requirements which frequently push systems to their limits and demand tailored designs. The hypersonic flight propulsion systems are subject to severe heat loads and the engine and airframe are truly one entity. The impact of the special demands of each of these aerospace propulsion systems on heat transfer is explored.

  12. Aerospace technology and hospital systems

    Science.gov (United States)

    1972-01-01

    The use of aerospace medical techniques to improve the quality of earth health care systems is discussed. Data are focused on physiological measurements and monitoring, medical information management, clean room technology, and reliability and quality assurance for hospital equipment.

  13. Titanium alloys for aerospace applications

    Energy Technology Data Exchange (ETDEWEB)

    Peters, M.; Leyens, C. [DLR-German Aerospace Center, D-51170 Koeln (Germany); Kumpfert, J. [Airbus Industrie, F-31707 Blagnac (France); Ward, C.H. [US Air Force Research Laboratory, London NW1 5TH (United Kingdom)

    2003-06-01

    There is probably no other material more closely related to aerospace than titanium and its alloys. With a density of 4.5 g/cm{sup 3}, titanium alloys are only about half as heavy as steel or Ni-based superalloys, yielding an excellent strength-to-weight ratio. Furthermore, they have exceptional corrosion resistance. The use of titanium alloys in the aerospace sector will be highlighted including airframe, engine, helicopter, and space applications. (Abstract Copyright [2003], Wiley Periodicals, Inc.)

  14. Polyimides: Thermally stable aerospace polymers

    Science.gov (United States)

    St.clair, A. K.

    1980-01-01

    An up to date review of available commercial and experimental high temperature polyimide resins which show potential for aerospace applications is presented. Current government research trends involving the use of polyimides as matrix resins for structural composites are discussed. Both the development of polyimides as adhesives for bonding metals and composites, and as films and coatings for use in an aerospace environment are reviewed. In addition, future trends for polyimides are proposed.

  15. Emerging Needs for Pervasive Passive Wireless Sensor Networks on Aerospace Vehicles

    Science.gov (United States)

    Wilson, William C.; Juarez, Peter D.

    2014-01-01

    NASA is investigating passive wireless sensor technology to reduce instrumentation mass and volume in ground testing, air flight, and space exploration applications. Vehicle health monitoring systems (VHMS) are desired on all aerospace programs to ensure the safety of the crew and the vehicles. Pervasive passive wireless sensor networks facilitate VHMS on aerospace vehicles. Future wireless sensor networks on board aerospace vehicles will be heterogeneous and will require active and passive network systems. Since much has been published on active wireless sensor networks, this work will focus on the need for passive wireless sensor networks on aerospace vehicles. Several passive wireless technologies such as microelectromechanical systems MEMS, SAW, backscatter, and chipless RFID techniques, have all shown potential to meet the pervasive sensing needs for aerospace VHMS applications. A SAW VHMS application will be presented. In addition, application areas including ground testing, hypersonic aircraft and spacecraft will be explored along with some of the harsh environments found in aerospace applications.

  16. NASA/DOD Aerospace Knowledge Diffusion Research Project. Paper 6: Aerospace knowledge diffusion in the academic community: A report of phase 3 activities of the NASA/DOD Aerospace Knowledge Diffusion Research Project

    Science.gov (United States)

    Pinelli, Thomas E.; Kennedy, John M.

    1990-01-01

    Descriptive and analytical data regarding the flow of aerospace-based scientific and technical information (STI) in the academic community are presented. An overview is provided of the Federal Aerospace Knowledge Diffusion Research Project, illustrating a five-year program on aerospace knowledge diffusion. Preliminary results are presented of the project's research concerning the information-seeking habits, practices, and attitudes of U.S. aerospace engineering and science students and faculty. The type and amount of education and training in the use of information sources are examined. The use and importance ascribed to various information products by U.S. aerospace faculty and students including computer and other information technology is assessed. An evaluation of NASA technical reports is presented and it is concluded that NASA technical reports are rated high in terms of quality and comprehensiveness, citing Engineering Index and IAA as the most frequently used materials by faculty and students.

  17. Report to the NASA Administrator by the Aerospace Safety Advisory Panel on the Space Shuttle Program. Part 1: Observations and Conclusions

    Science.gov (United States)

    1976-01-01

    Each system was chosen on the basis of its importance with respect to crew safety and mission success. An overview of the systems management is presented. The space shuttle main engine, orbiter thermal protection system, avionics, external tanks and solid rocket boosters were examined. The ground test and ground support equipment programs were studied. Program management was found to have an adequate understanding of the significant ground and flight risks involved.

  18. Annual report to the NASA Administrator by the Aerospace Safety Advisory Panel on the space shuttle program. Part 1: Observations and conclusions

    Science.gov (United States)

    1977-01-01

    The panel reviewed the following areas of major significance for the Approach and Landing Test program: mission planning and crew training, flight-readiness of the Carrier Aircraft and the Orbiter, including its flight control and avionics system, facilities, and communications and ground support equipment. The management system for risk assessment was investigated. The Orbital Flight Test Program was also reviewed. Observations and recommendations are presented.

  19. The website-based eaTracker® 'My Goals' feature: a qualitative evaluation.

    Science.gov (United States)

    Lieffers, Jessica Rl; Haresign, Helen; Mehling, Christine; Arocha, Jose F; Hanning, Rhona M

    2017-04-01

    In 2011, Dietitians of Canada added 'My Goals' to its website-based nutrition/activity tracking program (eaTracker®, http://www.eaTracker.ca/); this feature allows users to choose 'ready-made' or 'write-your-own' goals and to self-report progress. The purpose of the present study was to document experiences and perceptions of goal setting and My Goals, and report users' feedback on what is needed in future website-based goal setting/tracking tools. One-on-one semi-structured interviews were conducted with (i) My Goals users and (ii) dietitians providing a public information support service, EatRight Ontario (ERO). My Goals users from Ontario and Alberta, Canada were recruited via an eaTracker website pop-up box; ERO dietitians working in Ontario, Canada were recruited via ERO. My Goals users (n 23; age 19-70 years; 91 % female; n 5 from Alberta/n 18 from Ontario) and ERO dietitians (n 5). Dietitians and users felt goal setting for nutrition (and activity) behaviour change was both a beneficial and a challenging process. Dietitians were concerned about users setting poor-quality goals and users felt it was difficult to stick to their goals. Both users and dietitians were enthusiastic about the My Goals concept, but felt the current feature had limitations that affected use. Dietitians and users provided suggestions to improve My Goals (e.g. more prominent presence of My Goals in eaTracker; assistance with goal setting; automated personalized feedback). Dietitians and users shared similar perspectives on the My Goals feature and both felt goal use was challenging. Several suggestions were provided to enhance My Goals that are relevant to website-based goal setting/tracking tool design in general.

  20. 32 CFR 651.33 - Actions normally requiring an EA.

    Science.gov (United States)

    2010-07-01

    ... normally requiring an EA during the life cycle include, but are not limited to, testing, production... decisions, in principle) for future actions with potential environmental effects. Such actions should be... affects a federally listed threatened or endangered plant or animal species, a federal candidate species...

  1. Aeromedical solutions for aerospace safety.

    Science.gov (United States)

    Kapoor, Pawan; Gaur, Deepak

    2017-10-01

    All facets of activity in the speciality of Aviation Medicine are essentially aimed at enhancing aerospace safety. This paper highlights some innovative changes brought about by Aerospace Medicine in the three major fields of the speciality namely, medical evaluation, aeromedical training and research. Based on lab and field studies, military aircrew are now permitted flying with Modifinil as 'Go' Pill and Zolpidem as 'No-Go' Pill during sustained operations. Several other drugs for disabilities like Hypertension and CAD are now permitted for aviators. Comprehensive revision of policy permitting early return to flying is an on-going process. OPRAM courses for all three streams of aircrew in IAF have contributed to reduce aircraft accident rates. Human Engineering Consultancy and expert advice is provided by specialists at IAM as well as those in the field. In future, the country needs to provide better post-service opportunities to aerospace medicine specialists. This, in turn, will attract bright young minds to the specialty. The ISRO Humanin-Space programme will be an exciting challenge for all in this unique field. Aerospace Medicine continues to provide aerospace safety solutions to the IAF and the aviation industry. The nation needs to continue to utilize and support this specialty.

  2. ChEA: transcription factor regulation inferred from integrating genome-wide ChIP-X experiments.

    Science.gov (United States)

    Lachmann, Alexander; Xu, Huilei; Krishnan, Jayanth; Berger, Seth I; Mazloom, Amin R; Ma'ayan, Avi

    2010-10-01

    Experiments such as ChIP-chip, ChIP-seq, ChIP-PET and DamID (the four methods referred herein as ChIP-X) are used to profile the binding of transcription factors to DNA at a genome-wide scale. Such experiments provide hundreds to thousands of potential binding sites for a given transcription factor in proximity to gene coding regions. In order to integrate data from such studies and utilize it for further biological discovery, we collected interactions from such experiments to construct a mammalian ChIP-X database. The database contains 189,933 interactions, manually extracted from 87 publications, describing the binding of 92 transcription factors to 31,932 target genes. We used the database to analyze mRNA expression data where we perform gene-list enrichment analysis using the ChIP-X database as the prior biological knowledge gene-list library. The system is delivered as a web-based interactive application called ChIP Enrichment Analysis (ChEA). With ChEA, users can input lists of mammalian gene symbols for which the program computes over-representation of transcription factor targets from the ChIP-X database. The ChEA database allowed us to reconstruct an initial network of transcription factors connected based on shared overlapping targets and binding site proximity. To demonstrate the utility of ChEA we present three case studies. We show how by combining the Connectivity Map (CMAP) with ChEA, we can rank pairs of compounds to be used to target specific transcription factor activity in cancer cells. The ChEA software and ChIP-X database is freely available online at: http://amp.pharm.mssm.edu/lib/chea.jsp.

  3. Propulsion technology for National Aero-Space Plane

    Science.gov (United States)

    Anderson, C. W.; Mcclinton, Charles R.; Guy, R. W.

    1990-01-01

    The National Aerospace Plane (NASP) program is briefly reviewed, including its growth, objectives, team organization, and schedule. The NASP propulsion technology is discussed, and the results of engine module tests are described. Future large-scale and higher-speed testing needs are examined.

  4. Space Station Freedom - A resource for aerospace education

    Science.gov (United States)

    Brown, Robert W.

    1988-01-01

    The role of the International Space Station in future U.S. aerospace education efforts is discussed from a NASA perspective. The overall design concept and scientific and technological goals of the Space Station are reviewed, and particular attention is given to education projects such as the Davis Planetarium Student Space Station, the Starship McCullough, the Space Habitat, the working Space Station model in Austin, TX, the Challenger Center for Space Life Education, Space M+A+X, and the Space Science Student Involvement Program. Also examined are learning-theory aspects of aerospace education: child vs adult learners, educational objectives, teaching methods, and instructional materials.

  5. Annual report to the NASA Administrator by the Aerospace Safety Advisory Panel. Part 2: Space shuttle program. Section 1: Observations and conclusions

    Science.gov (United States)

    1975-01-01

    The NASA and contractor management systems, including policies, practices, and procedures for the development of critical systems, subsystems and integration of the program elements, were investigated. The technical development status of critical systems, subsystems, and interfaces is presented. Space shuttle elements were qualified as to potential risks and hazards. The elements included the orbiter, external tanks, main engine, solid rocket boosters, and the ground support facilities.

  6. Challenges in aerospace medicine education.

    Science.gov (United States)

    Grenon, S Marlene; Saary, Joan

    2011-11-01

    Aerospace medicine training and research represents a dream for many and a challenge for most. In Canada, although some opportunities exist for the pursuit of education and research in the aerospace medicine field, they are limited despite the importance of this field for enabling safe human space exploration. In this commentary, we aim to identify some of the challenges facing individuals wishing to get involved in the field as well as the causal factors for these challenges. We also explore strategies to mitigate against these.

  7. Supporting the industrialisation of aerospace technologies

    CSIR Research Space (South Africa)

    Botha, M

    2015-10-01

    Full Text Available Globally, the aerospace industry is recognised as one of the most significant multipliers for economic development. Aerospace requires a technology injection to enhance industrialisation. An example is the Rooivalk development programme, which...

  8. National Aerospace Leadership Initiative - Phase 2

    Science.gov (United States)

    2010-03-01

    Trumpf, Volvo Aerospace. 2.2.6. Virtual Machining for NC Verification Team • CCAT – Brian Kindilien, Matt Lloyd, Nasir Mannan Software...Pegasus Manufacturing, Sterling Engineering, Volvo Aerospace. National Aerospace Leadership Initiative – Phase II Final Report 39 of 128... Volvo Aerospace The CCAT-NCAL team worked closely with Volvo Aero to understand their machine tools to be modeled: • Phoenix VTL mill/turn system

  9. Aerospace Training. Washington's Community and Technical Colleges

    Science.gov (United States)

    Washington State Board for Community and Technical Colleges, 2014

    2014-01-01

    Aerospace is an economic powerhouse that generates jobs and fuels our economy. Washington's community and technical colleges produce the world-class employees needed to keep it that way. With about 1,250 aerospace-related firms employing more than 94,000 workers, Washington has the largest concentration of aerospace expertise in the nation. To…

  10. The array for investigations of EAS neutron component

    Directory of Open Access Journals (Sweden)

    Gromushkin D.M.

    2017-01-01

    Full Text Available The neutron component of EAS has not been practically studied for many years. Creation of the neutron detector arrays PRISMA-32 and PRISMA-YBJ demonstrated the effectiveness of such investigations. It is important to underline that recording the EAS neutron component is carried out over the whole array area. Development of a new larger scale neutron detector array (URAN in MEPhI will continue these studies. During the construction of the URAN array, a new design of en-detectors based on the scintillator with natural boron and new electronics was developed. The use of new electronics with a switchable sampling rate allows one to reach EAS fast timing accuracy up to 10 ns. The en-detectors of the URAN are located on the roofs of the buildings. The sensitive area of each detector is 0.36 m2, while the array's starting area is ∼ 103 m2. Total number of the initial array detectors is 72. They are subdivided into 6 independent clusters each of 12 en-detectors, connected with the central data acquisition station.

  11. The array for investigations of EAS neutron component

    Science.gov (United States)

    Gromushkin, D. M.; Ampilogov, N. V.; Barbashina, N. S.; Bogdanov, F. A.; Kokoulin, R. P.; Ovchinnikov, V. V.; Petrukhin, A. A.; Shulzhenko, I. A.; Stenkin, Yu. V.; Yashin, I. I.; Yurin, K. O.

    2017-06-01

    The neutron component of EAS has not been practically studied for many years. Creation of the neutron detector arrays PRISMA-32 and PRISMA-YBJ demonstrated the effectiveness of such investigations. It is important to underline that recording the EAS neutron component is carried out over the whole array area. Development of a new larger scale neutron detector array (URAN) in MEPhI will continue these studies. During the construction of the URAN array, a new design of en-detectors based on the scintillator with natural boron and new electronics was developed. The use of new electronics with a switchable sampling rate allows one to reach EAS fast timing accuracy up to 10 ns. The en-detectors of the URAN are located on the roofs of the buildings. The sensitive area of each detector is 0.36 m2, while the array's starting area is ˜ 103 m2. Total number of the initial array detectors is 72. They are subdivided into 6 independent clusters each of 12 en-detectors, connected with the central data acquisition station.

  12. Hybrid techniques for complex aerospace electromagnetics problems

    Science.gov (United States)

    Aberle, Jim

    1993-01-01

    Important aerospace electromagnetics problems include the evaluation of antenna performance on aircraft and the prediction and control of the aircraft's electromagnetic signature. Due to the ever increasing complexity and expense of aircraft design, aerospace engineers have become increasingly dependent on computer solutions. Traditionally, computational electromagnetics (CEM) has relied primarily on four disparate techniques: the method of moments (MoM), the finite-difference time-domain (FDTD) technique, the finite element method (FEM), and high frequency asymptotic techniques (HFAT) such as ray tracing. Each of these techniques has distinct advantages and disadvantages, and no single technique is capable of accurately solving all problems of interest on computers that are available now or will be available in the foreseeable future. As a result, new approaches that overcome the deficiencies of traditional techniques are beginning to attract a great deal of interest in the CEM community. Among these new approaches are hybrid methods which combine two or more of these techniques into a coherent model. During the ASEE Summer Faculty Fellowship Program a hybrid FEM/MoM computer code was developed and applied to a geometry containing features found on many modern aircraft.

  13. Summary of aerospace and nuclear engineering activities

    Science.gov (United States)

    1988-01-01

    The Texas A&M Nuclear and Aerospace engineering departments have worked on five different projects for the NASA/USRA Advanced Design Program during the 1987/88 year. The aerospace department worked on two types of lunar tunnelers that would create habitable space. The first design used a heated cone to melt the lunar regolith, and the second used a conventional drill to bore its way through the crust. Both used a dump truck to get rid of waste heat from the reactor as well as excess regolith from the tunneling operation. The nuclear engineering department worked on three separate projects. The NEPTUNE system is a manned, outer-planetary explorer designed with Jupiter exploration as the baseline mission. The lifetime requirement for both reactor and power-conversion systems was twenty years. The second project undertaken for the power supply was a Mars Sample Return Mission power supply. This was designed to produce 2 kW of electrical power for seven years. The design consisted of a General Purpose Heat Source (GPHS) utilizing a Stirling engine as the power conversion unit. A mass optimization was performed to aid in overall design. The last design was a reactor to provide power for propulsion to Mars and power on the surface. The requirements of 300 kW of electrical power output and a mass of less than 10,000 Rg were set. This allowed the reactor and power conversion unit to fit within the Space Shuttle cargo bay.

  14. 76 FR 24874 - Initiation of Scoping for an Environmental Assessment (EA)

    Science.gov (United States)

    2011-05-03

    ... From the Federal Register Online via the Government Publishing Office ENVIRONMENTAL PROTECTION AGENCY Initiation of Scoping for an Environmental Assessment (EA) AGENCY: Environmental Protection Agency... Assessment (EA) to analyze the potential environmental impacts related to the reissuance of the National...

  15. 78 FR 68835 - Initiation of Scoping for an Environmental Assessment (EA)

    Science.gov (United States)

    2013-11-15

    ... From the Federal Register Online via the Government Publishing Office ENVIRONMENTAL PROTECTION AGENCY Initiation of Scoping for an Environmental Assessment (EA) AGENCY: Environmental Protection Agency... Assessment (EA) to analyze the potential environmental impacts related to the reissuance of the National...

  16. Emergency Communications: The Emergency Alert System (EAS) and All-Hazard Warnings

    Science.gov (United States)

    2005-09-02

    Communications: The Emergency Alert System (EAS) and All- Hazard Warnings Updated September 2, 2005 Linda K. Moore Analyst in Telecommunications Policy...3. DATES COVERED - 4. TITLE AND SUBTITLE Emergency Communications: The Emergency Alert System (EAS) and All- Hazard Warnings 5a. CONTRACT... Emergency Alert System (EAS) and All- Hazard Warnings Summary The Emergency Alert System (EAS) is one of several federally managed warning systems. The

  17. CORBASec Used to Secure Distributed Aerospace Propulsion Simulations

    Science.gov (United States)

    Blaser, Tammy M.

    2003-01-01

    The NASA Glenn Research Center and its industry partners are developing a Common Object Request Broker (CORBA) Security (CORBASec) test bed to secure their distributed aerospace propulsion simulations. Glenn has been working with its aerospace propulsion industry partners to deploy the Numerical Propulsion System Simulation (NPSS) object-based technology. NPSS is a program focused on reducing the cost and time in developing aerospace propulsion engines. It was developed by Glenn and is being managed by the NASA Ames Research Center as the lead center reporting directly to NASA Headquarters' Aerospace Technology Enterprise. Glenn is an active domain member of the Object Management Group: an open membership, not-for-profit consortium that produces and manages computer industry specifications (i.e., CORBA) for interoperable enterprise applications. When NPSS is deployed, it will assemble a distributed aerospace propulsion simulation scenario from proprietary analytical CORBA servers and execute them with security afforded by the CORBASec implementation. The NPSS CORBASec test bed was initially developed with the TPBroker Security Service product (Hitachi Computer Products (America), Inc., Waltham, MA) using the Object Request Broker (ORB), which is based on the TPBroker Basic Object Adaptor, and using NPSS software across different firewall products. The test bed has been migrated to the Portable Object Adaptor architecture using the Hitachi Security Service product based on the VisiBroker 4.x ORB (Borland, Scotts Valley, CA) and on the Orbix 2000 ORB (Dublin, Ireland, with U.S. headquarters in Waltham, MA). Glenn, GE Aircraft Engines, and Pratt & Whitney Aircraft are the initial industry partners contributing to the NPSS CORBASec test bed. The test bed uses Security SecurID (RSA Security Inc., Bedford, MA) two-factor token-based authentication together with Hitachi Security Service digital-certificate-based authentication to validate the various NPSS users. The test

  18. 47 CFR 11.54 - EAS operation during a National Level emergency.

    Science.gov (United States)

    2010-10-01

    ... Script is in the EAS Operating Handbook's section for Participating sources. (5) Analog and digital TV... systems, digital cable systems, and wireless cable systems shall transmit all EAS announcements visually... primary language of the EAS participant. (9) Analog and digital broadcast stations may transmit their call...

  19. 47 CFR 11.51 - EAS code and Attention Signal Transmission requirements.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false EAS code and Attention Signal Transmission... SYSTEM (EAS) Emergency Operations § 11.51 EAS code and Attention Signal Transmission requirements. (a... without the Attention Signal and emergency message for State and local emergencies. Pauses in video...

  20. 7 CFR 520.6 - Preparation of an Environmental Assessment (EA).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Preparation of an Environmental Assessment (EA). 520.6... SERVICE, DEPARTMENT OF AGRICULTURE PROCEDURES FOR IMPLEMENTING NATIONAL ENVIRONMENTAL POLICY ACT § 520.6 Preparation of an Environmental Assessment (EA). (a) Actions requiring EA. The following actions would...

  1. Study of the shower maximum depth by the method of detection of the EAS Cerenkov light pulse shape

    Science.gov (United States)

    Aliev, N.; Alimov, T.; Kakhkharov, M.; Khakimov, N.; Makhmudov, B. M.; Rakhimova, N.; Tashpulatov, R.; Khristiansen, G. B.; Prosin, V. V.; Zhukov, V. Y.

    1985-01-01

    The results of processing the data on the shape of the EAS Cerenkov light pulses recorded by the extensive air showers (EAS) array are presented. The pulse FWHM is used to find the mean depth of EAS maximum.

  2. Aerospace Medicine Talk

    Science.gov (United States)

    Williams, Richard S.

    2015-01-01

    The presentation is next Sunday, May 10th. It will be to the Civil Aviation Medical Association, for 2 hours at Disney World in Orlando. It is a high level talk on space medicine, including history, the role of my office, human health risks of space flight, general aspects of space medicine practice, human health risk management (including integrated activities of medical operations and the Human Research Program, and thoughts concerning health risks for long duration exploration class space missions. No proprietary data or material will be used, all is readily available in the public sector. There is also a short (30 min) talk on Monday at the CAMA lunch. There we will describe the Visual Impairment and Intracranial Pressure syndrome, with possible etiologies and plans for research (already selected studies). Again, nothing proprietary will be discussed.

  3. Aerospace Safety Advisory Panel

    Science.gov (United States)

    1984-01-01

    An assessment of NASA's safety performance for 1983 affirms that NASA Headquarters and Center management teams continue to hold the safety of manned flight to be their prime concern, and that essential effort and resources are allocated for maintaining safety in all of the development and operational programs. Those conclusions most worthy of NASA management concentration are given along with recommendations for action concerning; product quality and utility; space shuttle main engine; landing gear; logistics and management; orbiter structural loads, landing speed, and pitch control; the shuttle processing contractor; and the safety of flight operations. It appears that much needs to be done before the Space Transportation System can achieve the reliability necessary for safe, high rate, low cost operations.

  4. Damage growth in aerospace composites

    CERN Document Server

    2015-01-01

    This book presents novel methods for the simulation of damage evolution in aerospace composites that will assist in predicting damage onset and growth and thus foster less conservative designs which realize the promised economic benefits of composite materials. The presented integrated numerical/experimental methodologies are capable of taking into account the presence of damage and its evolution in composite structures from the early phases of the design (conceptual design) through to the detailed finite element method analysis and verification phase. The book is based on the GARTEUR Research Project AG-32, which ran from 2007 to 2012, and documents the main results of that project. In addition, the state of the art in European projects on damage evolution in composites is reviewed. While the high specific strength and stiffness of composite materials make them suitable for aerospace structures, their sensitivity to damage means that designing with composites is a challenging task. The new approaches describ...

  5. CSIR ScienceScope: Aerospace

    CSIR Research Space (South Africa)

    CSIR

    2006-12-01

    Full Text Available weather conditions and form part of the ship's main weapon and air defence systems. 7 operational conditions. Derivatives of Fynmeet have been procured by a number of international research institutes. Sensing the future The knowledge and years...-encompassing technologies, outcomes of advances in the manufacture and operation of aerospace systems impact on society at large. This could be in the improvement of the carry- ing capacity of commercial transport air- craft, the avionics capabilities of military...

  6. Magnetic Gearboxes for Aerospace Applications

    Science.gov (United States)

    Perez-Diaz, Jose Luis; Diez-Jimenez, Efren; Alvarez-Valenzuela, Marco A.; Sanchez-Garcia-Casarrubios, Juan; Cristache, Christian; Valiente-Blanco, Ignacio

    2014-01-01

    Magnetic gearboxes are contactless mechanisms for torque-speed conversion. They present no wear, no friction and no fatigue. They need no lubricant and can be customized for other mechanical properties as stiffness or damping. Additionally, they can protect structures and mechanisms against overloads, limitting the transmitted torque. In this work, spur, planetary and "magdrive" or "harmonic drive" configurations are compared considering their use in aerospace applications. The most recent test data are summarized to provide some useful help for the design engineer.

  7. Cytochalasins from cultures of endophytic fungus Phoma multirostrata EA-12.

    Science.gov (United States)

    Chen, Zi-ming; Chen, He-Ping; Li, Yan; Feng, Tao; Liu, Ji-Kai

    2015-01-01

    Two new cytochalsians, multirostratin A (1) and 20-oxo-deoxaphomin (2), together with five known analogues (3-7), were obtained from the endophytic fungus Phoma multirostrata EA-12. The structures of 1 and 2 were elucidated by MS and 1D- and 2D-NMR spectroscopic data analyses, as well as by comparison of data with those of analogues reported in the literature. Compounds 1 and 2 showed moderate cytotoxicity against five tumor cell lines (HL-60, A-549, SMMC-7721, MCF-7 and SW-480).

  8. Advanced Ceramic Materials for Future Aerospace Applications

    Science.gov (United States)

    Misra, Ajay

    2015-01-01

    With growing trend toward higher temperature capabilities, lightweight, and multifunctionality, significant advances in ceramic matrix composites (CMCs) will be required for future aerospace applications. The presentation will provide an overview of material requirements for future aerospace missions, and the role of ceramics and CMCs in meeting those requirements. Aerospace applications will include gas turbine engines, aircraft structure, hypersonic and access to space vehicles, space power and propulsion, and space communication.

  9. The time interval between the onset of tricuspid E wave and annular Ea wave (TE-Ea) can predict right atrial pressure in patients with heart failure.

    Science.gov (United States)

    Naderi, Nasim; Amin, Ahmad; Haghighi, Zahra Ojaghi; Esmaeilzadeh, Maryam; Bakhshandeh, Hooman; Taghavi, Sepideh; Maleki, Majid

    2014-11-01

    There is conflicting data regarding the tricuspid annular velocities and their relation to right ventricular filling pressures. We aimed to assess if the time interval between the onset of tricuspid E wave and annular Ea wave has any correlation with right sided filling pressure in patients with heart failure. Thirty heart failure patients (left ventricular ejection fraction≤35%) were enrolled. Echocardiography was performed to obtain tricuspid inflow and tissue Doppler annular velocities just before a standard right heart catheterization. The right atrial pressure was obtained from right heart catheterization. The E/Ea [the ratio of peak velocity of early tricuspid inflow wave (E) to peak velocity of early diastolic wave of the lateral tricuspid annulus (Ea)] and the time intervals between the beginning of R wave of electrocardiogram and onset of E (TE) as well as between the beginning of R wave and onset of Et (TEa) were measured, TE-Ea was calculated as TE-TEa. The mean right atrial pressure (RAP) was 8.8 (SD=4.7) mm Hg. The mean TE-Ea was + 8.61 milliseconds. There was no significant correlation between RAP and E/Ea (r=0.08, p>0.05) but the correlation between TE-Ea and RAP was significant (r=0.5, p=0.01). According to our results and in contrary to some prior studies, we showed for the first time that right side TE-Ea stands as a better surrogate of right atrial pressure than E/Ea in heart failure patients. This finding needs more accurate studies and could present TE-Ea as a feasible tool to look into hemodynamics of heart failure patients.

  10. Local and national impact of aerospace research and technology

    Science.gov (United States)

    Mccarthy, J. F., Jr.

    1981-01-01

    An overview of work at the NASA Lewis Research Center in the areas of aeronautics space, and energy is presented. Local and national impact of the work is discussed. Some aspects of the U.S. research and technology base, the aerospace industry, and foreign competition are discussed. In conclusion, U.S. research and technology programs are cited as vital to U.S. economic health.

  11. Aerospace Medical Support in Russia

    Science.gov (United States)

    Castleberry, Tara; Chamberlin, Blake; Cole, Richard; Dowell, Gene; Savage, Scott

    2011-01-01

    This slide presentation reviews the role of the flight surgeon in support of aerospace medical support operations at the Gagarin Cosmonaut Training Center (GCTC), also known as Star City, in Russia. The flight surgeon in this role is the medical advocate for non-russian astronauts, and also provides medical care for illness and injury for astronauts, family members, and guests as well as civil servants and contractors. The flight surgeon also provides support for hazardous training. There are various photos of the area, and the office, and some of the equipment that is used.

  12. Cybersecurity for aerospace autonomous systems

    Science.gov (United States)

    Straub, Jeremy

    2015-05-01

    High profile breaches have occurred across numerous information systems. One area where attacks are particularly problematic is autonomous control systems. This paper considers the aerospace information system, focusing on elements that interact with autonomous control systems (e.g., onboard UAVs). It discusses the trust placed in the autonomous systems and supporting systems (e.g., navigational aids) and how this trust can be validated. Approaches to remotely detect the UAV compromise, without relying on the onboard software (on a potentially compromised system) as part of the process are discussed. How different levels of autonomy (task-based, goal-based, mission-based) impact this remote characterization is considered.

  13. Cognitive engineering in aerospace applications

    Science.gov (United States)

    Woods, David D.

    1993-01-01

    The progress that was made with respect to the objectives and goals of the research that is being carried out in the Cognitive Systems Engineering Laboratory (CSEL) under a Cooperative Agreement with NASA Ames Research Center is described. The major objective of this project is to expand the research base in Cognitive Engineering to be able to support the development and human-centered design of automated systems for aerospace applications. This research project is in support of the Aviation Safety/Automation Research plan and related NASA research goals in space applications.

  14. Management of Diversificataion System in Aerospace Industry

    Directory of Open Access Journals (Sweden)

    Yuriy Veniaminovich Vlasov

    2016-12-01

    Full Text Available The article is devoted to the development of approaches to improve the efficiency of Russian aerospace industry enterprises in terms of industry reforming given the influence of economic risks and financial instability. The article discusses the policy of the diversification of production as one of the key factors of increasing the competitiveness of domestic aerospace industry enterprises. The authors analyze the experience of domestic and foreign corporations in the sphere of diversification and conclude that Russian space enterprises and corporations lag behind the development of international companies in carrying out diversification. The interconnection between enterprise economic stability and the diversification of its production is established. The authors have developed a mathematical model for calculating the optimal structure of primary and diversified products and its impact on enterprise financial stability in the conditions of limited financial resources. The advantage of this approach is that it can be integrated in a common methodology of the diversification of industrial enterprises production. The authors have also developed the algorithm of multi-criteria evaluation and optimal distribution of the volume of resources to manufacture diversified products. The algorithm is based on dynamic programming models. The scientific results of the article can be applied to create a system to manage the diversification of production. The main functions of this system are to identify current and emerging technologies that can provide significant competitive advantage for enterprises in the potential markets of high-tech products, as well as to identify and eliminate unproductive or constraining regulations, methods and management practices that are inappropriate to diversification policy. Thus, it becomes possible to implement the monitoring of the process of the diversification of production at all its stages

  15. 75 FR 19662 - Aerospace Safety Advisory Panel; Meeting

    Science.gov (United States)

    2010-04-15

    ... No: 2010-8569] NATIONAL AERONAUTICS AND SPACE ADMINISTRATION [Notice (10-043)] Aerospace Safety..., the National Aeronautics and Space Administration announce a forthcoming meeting of the Aerospace... Dakon, Aerospace Safety Advisory Panel Executive Director, National Aeronautics and Space Administration...

  16. Ultrasonic Characterization of Aerospace Composites

    Science.gov (United States)

    Leckey, Cara; Johnston, Patrick; Haldren, Harold; Perey, Daniel

    2015-01-01

    Composite materials have seen an increased use in aerospace in recent years and it is expected that this trend will continue due to the benefits of reduced weight, increased strength, and other factors. Ongoing work at NASA involves the investigation of the large-scale use of composites for spacecraft structures (SLS components, Orion Composite Crew Module, etc). NASA is also involved in work to enable the use of composites in advanced aircraft structures through the Advanced Composites Project (ACP). In both areas (space and aeronautics) there is a need for new nondestructive evaluation and materials characterization techniques that are appropriate for characterizing composite materials. This paper will present an overview of NASA's needs for characterizing aerospace composites, including a description of planned and ongoing work under ACP for the detection of composite defects such as fiber waviness, reduced bond strength, delamination damage, and microcracking. The research approaches include investigation of angle array, guided wave, and phase sensitive ultrasonic methods. The use of ultrasonic simulation tools for optimizing and developing methods will also be discussed.

  17. iSTEM: The Aerospace Engineering Challenge

    Science.gov (United States)

    English, Lyn D.; King, Donna T.; Hudson, Peter; Dawes, Les

    2014-01-01

    The authors developed The Paper Plane Challenge as one of a three-part response to The Aerospace Engineering Challenge. The Aerospace Engineering Challenge was the second of three multi-part activities that they had developed with the teachers during the year. Their aim was to introduce students to the exciting world of engineering, where they…

  18. The 42nd Aerospace Mechanism Symposium

    Science.gov (United States)

    Boesiger, Edward A. (Editor); Hakun, Claef (Editor)

    2014-01-01

    The Aerospace Mechanisms Symposium (AMS) provides a unique forum for those active in the design, production, and use of aerospace mechanisms. A major focus is the reporting of problems and solutions associated with the development, and flight certification of new mechanisms.

  19. Wind Turbine Aerodynamics from an Aerospace Perspective

    NARCIS (Netherlands)

    van Garrel, Arne; ten Pas, Sebastiaan; Venner, Cornelis H.; van Muijden, Jaap

    2018-01-01

    The current challenges in wind turbine aerodynamics simulations share a number of similarities with the challenges that the aerospace industry has faced in the past. Some of the current challenges in the aerospace aerodynamics community are also relevant for today’s wind turbine aerodynamics

  20. Powered Flight The Engineering of Aerospace Propulsion

    CERN Document Server

    Greatrix, David R

    2012-01-01

    Whilst most contemporary books in the aerospace propulsion field are dedicated primarily to gas turbine engines, there is often little or no coverage of other propulsion systems and devices such as propeller and helicopter rotors or detailed attention to rocket engines. By taking a wider viewpoint, Powered Flight - The Engineering of Aerospace Propulsion aims to provide a broader context, allowing observations and comparisons to be made across systems that are overlooked by focusing on a single aspect alone. The physics and history of aerospace propulsion are built on step-by-step, coupled with the development of an appreciation for the mathematics involved in the science and engineering of propulsion. Combining the author’s experience as a researcher, an industry professional and a lecturer in graduate and undergraduate aerospace engineering, Powered Flight - The Engineering of Aerospace Propulsion covers its subject matter both theoretically and with an awareness of the practicalities of the industry. To ...

  1. Reliability and validity of the Euthanasia Attitude Scale (EAS) for Hong Kong medical doctors.

    Science.gov (United States)

    Tang, Wai-Kiu; Mak, Kwok-Kei; Kam, Philip Ming-Ho; Ho, Joanna Wing-Kiu; Chan, Denise Che-Ying; Suen, To-Lam; Lau, Michael Chak-Kwan; Cheng, Adrian Ka-Chun; Wan, Yuen-Ting; Wan, Ho-Yan; Hussain, Assad

    2010-08-01

    This study aimed to examine the reliability and validity of the Euthanasia Attitude Scale (EAS) in Hong Kong medical doctors. A total of 107 medical doctors (61.7% men) participated in a survey at clinical settings in 2008. The 21-item EAS was used to assess their attitudes toward euthanasia. The mean (standard deviation) and median of the EAS were 63.60 (60.31) and 63.00. Total EAS scores correlated well with ''Ethical Considerations,'' ''Practical Considerations,'' and ''Treasuring Life'' (Spearman rho =.37-.96, P Attitude Scale may be a reliable and valid measure for assessing the attitudes toward euthanasia in medical professionals.

  2. Nondestructive Evaluation for Aerospace Composites

    Science.gov (United States)

    Leckey, Cara; Cramer, Elliott; Perey, Daniel

    2015-01-01

    Nondestructive evaluation (NDE) techniques are important for enabling NASA's missions in space exploration and aeronautics. The expanded and continued use of composite materials for aerospace components and vehicles leads to a need for advanced NDE techniques capable of quantitatively characterizing damage in composites. Quantitative damage detection techniques help to ensure safety, reliability and durability of space and aeronautic vehicles. This presentation will give a broad outline of NASA's range of technical work and an overview of the NDE research performed in the Nondestructive Evaluation Sciences Branch at NASA Langley Research Center. The presentation will focus on ongoing research in the development of NDE techniques for composite materials and structures, including development of automated data processing tools to turn NDE data into quantitative location and sizing results. Composites focused NDE research in the areas of ultrasonics, thermography, X-ray computed tomography, and NDE modeling will be discussed.

  3. Automated procedures for sizing aerospace vehicle structures /SAVES/

    Science.gov (United States)

    Giles, G. L.; Blackburn, C. L.; Dixon, S. C.

    1972-01-01

    Results from a continuing effort to develop automated methods for structural design are described. A system of computer programs presently under development called SAVES is intended to automate the preliminary structural design of a complete aerospace vehicle. Each step in the automated design process of the SAVES system of programs is discussed, with emphasis placed on use of automated routines for generation of finite-element models. The versatility of these routines is demonstrated by structural models generated for a space shuttle orbiter, an advanced technology transport,n hydrogen fueled Mach 3 transport. Illustrative numerical results are presented for the Mach 3 transport wing.

  4. Impact of the integrated maintenance concept on EA-6B readiness and maintenance support at NAS Whidbey Island, WA and NADEP Jacksonville, FL

    OpenAIRE

    Schulz, Kimberly J.

    2002-01-01

    Approved for public release; distribution is unlimited. Faced with an aging Navy air force, the EA -6B, a piece of the aging aircraft inventory puzzle, is included in a mandated program called Integrated Maintenance Concept (IMC.) IMC incorporates a maintenance process called Reliability Centered Maintenance (RCM) to establish and adjust preventative maintenance requirements. The premise of the program is to justify each preventative maintenance action to maintain obsolescent airframes whi...

  5. Titanium alloys Russian aircraft and aerospace applications

    CERN Document Server

    Moiseyev, Valentin N

    2005-01-01

    This text offers previously elusive information on state-of-the-art Russian metallurgic technology of titanium alloys. It details their physical, mechanical, and technological properties, as well as treatments and applications in various branches of modern industry, particularly aircraft and aerospace construction. Titanium Alloys: Russian Aircraft and Aerospace Applications addresses all facets of titanium alloys in aerospace and aviation technology, including specific applications, fundamentals, composition, and properties of commercial alloys. It is useful for all students and researchers interested in the investigation and applications of titanium.

  6. Photoacoustic microscopy of electronic acupuncture (EA) effect in small animals.

    Science.gov (United States)

    Yang, Jinge; Wu, Dan; Tang, Yong; Jiang, Huabei

    2017-02-01

    Acupuncture has been an effective treatment for various pain in China for several thousand years. However, the mechanisms underlying this mysterious ancient healing are still largely unknown. Here we applied photoacoustic microscopy (PAM) to investigate brain hemodynamic changes in response to electronic acupuncture (EA) at ST36 (Zusanli). Due to the high optical absorption of blood at 532 nm, PAM could sensitively probe changes in hemoglobin concentration (HbT, i.e., cerebral blood volume [CBV]) of cortical regions in high resolution. Six healthy mice were stimulated at the acupoint and three healthy mice were stimulated at sham points. Remarkable CBV changes in sensorimotor and retrosplenial agranular cortex were observed. Results showed the potential of PAM as a visualization tool to study the acupuncture effect on brain hemodynamics in animal models. (a) Schematic showing the stimulation points. (b) B-scan images overlaid with mouse atlas. (c) & (d) Statistical results of CBV changes from cortical regions. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  7. REDES TECNOLÓGICAS APLICADAS EM EaD

    Directory of Open Access Journals (Sweden)

    Suélly Lima dos Santos

    2011-08-01

    Full Text Available Com o advento da internet e o aparecimento das novas tecnologias educacionais, conjunto de informações e comunicações (telefone, internet, rádio, vídeo, computador e televisão, ultrapassaram as fronteiras das quatro paredes da sala de aula, surgindo ambientes virtuais direcionadas à ampliação da participação dos serviços públicos relacionados ao ensino. À educação e à formação técnica e profissional permitiu-se o aumento da interatividade através da tecnologia, promovendo maneiras de acesso ao aluno utilizando computadores e/ou dispositivos móveis que viabiliza a Educação à Distância (EaD. Devido o grande crescimento do ensino à distância, as instituições já utilizam redes de dados para ampliar o acesso de aprendizagem. Com este espantoso aumento das redes, e da acelerada transmissão de informações aprender como elas funcionam é muito importante, além do mais usando a própria tecnologia para este fim. Como conclusão deste trabalho as mudanças relâmpadas da grande disponibilidade de dados no ambiente virtual é de enorme valia para o processo ensino-aprendizado.

  8. MODELING AND DESIGN STUDY USING HFC-236EA AS AN ALTERNATIVE REFRIGERANT IN A CENTRIFUGAL COMPRESSOR

    Science.gov (United States)

    The report gives results of an investigation of the operation of a centrifugal compressor--part of a chlorofluorocarbon (CFC)-114 chiller installation--with the new refrigerant hydrofluorocarbon (HFC)-236ea, a proposed alternative to CFC-114. A large set of CFC-236ea operating da...

  9. Medico-Social Problems Of Victims On The Ground Of The E.A.S. ...

    African Journals Online (AJOL)

    OBJECTIVE: The aim of this study was to describe the medico-social problems faced by victims at the EAS plane crash in kano city. METHODS: Structured survey questionnaire was administered on the 56 households affected by the EAS plane crash in kano city. FINDINGS: There were thirty- five deaths out of the 601 ...

  10. 7 CFR 1955.136 - Environmental Assessment (EA) and Environmental Impact Statement (EIS).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 14 2010-01-01 2009-01-01 true Environmental Assessment (EA) and Environmental Impact... Disposal of Inventory Property General § 1955.136 Environmental Assessment (EA) and Environmental Impact Statement (EIS). (a) Prior to a final decision on some disposal actions, an environmental assessment must be...

  11. 36 CFR 1010.6 - Determination of requirement for EA or EIS.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Determination of requirement for EA or EIS. 1010.6 Section 1010.6 Parks, Forests, and Public Property PRESIDIO TRUST ENVIRONMENTAL QUALITY § 1010.6 Determination of requirement for EA or EIS. In deciding whether to require the...

  12. Runtime analysis of the (1+1) EA on computing unique input output sequences

    DEFF Research Database (Denmark)

    Lehre, Per Kristian; Yao, Xin

    2010-01-01

    Computing unique input output (UIO) sequences is a fundamental and hard problem in conformance testing of finite state machines (FSM). Previous experimental research has shown that evolutionary algorithms (EAs) can be applied successfully to find UIOs for some FSMs. However, before EAs can...

  13. 47 CFR 101.1317 - Competitive bidding procedures for mutually exclusive MAS EA applications.

    Science.gov (United States)

    2010-10-01

    ... exclusive MAS EA applications. 101.1317 Section 101.1317 Telecommunication FEDERAL COMMUNICATIONS COMMISSION... License Requirements § 101.1317 Competitive bidding procedures for mutually exclusive MAS EA applications. Mutually exclusive initial applications for licenses in the portions of the MAS bands licensed on a...

  14. 76 FR 1600 - U.S. Aerospace Supplier & Investment Mission

    Science.gov (United States)

    2011-01-11

    ... International Trade Administration U.S. Aerospace Supplier & Investment Mission AGENCY: International Trade.... Aerospace Supplier & Investment Mission to Montreal, Canada on May 2-4, 2011. This aerospace mission is an....S. Aerospace Trade and Investment Mission must complete and submit an application package for...

  15. Technology Applications Team: Applications of aerospace technology

    Science.gov (United States)

    1993-01-01

    Highlights of the Research Triangle Institute (RTI) Applications Team activities over the past quarter are presented in Section 1.0. The Team's progress in fulfilling the requirements of the contract is summarized in Section 2.0. In addition to our market-driven approach to applications project development, RTI has placed increased effort on activities to commercialize technologies developed at NASA Centers. These Technology Commercialization efforts are summarized in Section 3.0. New problem statements prepared by the Team in the reporting period are presented in Section 4.0. The Team's transfer activities for ongoing projects with the NASA Centers are presented in Section 5.0. Section 6.0 summarizes the status of four add-on tasks. Travel for the reporting period is described in Section 7.0. The RTI Team staff and consultants and their project responsibilities are listed in Appendix A. The authors gratefully acknowledge the contributions of many individuals to the RTI Technology Applications Team program. The time and effort contributed by managers, engineers, and scientists throughout NASA were essential to program success. Most important to the program has been a productive working relationship with the NASA Field Center Technology Utilization (TU) Offices. The RTI Team continues to strive for improved effectiveness as a resource to these offices. Industry managers, technical staff, medical researchers, and clinicians have been cooperative and open in their participation. The RTI Team looks forward to continuing expansion of its interaction with U.S. industry to facilitate the transfer of aerospace technology to the private sector.

  16. Inspection tools for aerospace critical surfaces

    Science.gov (United States)

    Workman, Gary L.; Thompson, G. W.; Nerren, Billy H.; Burns, H. Dewitt, Jr.

    1998-03-01

    The measurement and control of cleanliness for critical surfaces during manufacturing and in service operations provides unique challenges in aerospace. For re-usable propulsion systems, such as the solid rocket motors, the current thrust for environmentally benign processes has had a major impact on programs designed for maintaining quality in the production of bondline surfaces. The major goal is to improve upon our ability to detect and identify possible contaminants which are detrimental to the integrity of the bondline. This effort requires an in-depth study of the possible sources of contamination, methodologies to detect and identify contaminants, discriminate between contaminants and chemical species caused by environmental conditions, and the effect of particular contaminants on the bondline integrity of the critical surfaces. This presentation will provide an overview of several optical methods used to detect and identify contamination on critical surfaces, currently being performed by the Surface Contamination and Analysis Team at Marshall Space Flight Center. The methods under development for contamination monitoring include FTIR and Near-IR SPectrometry, UV Fluorescence, and Variable Angle Spectroscopic Ellipsometry. Comparisons between these methods and the current primary tool, optical stimulation of electron emission for on-line inspection will be presented. Experiments include quantitative measurement of silicone and Conoco HD2 greases, metal hydroxides, tape residues, etc. on solid rocket motor surfaces.

  17. Nanomaterials: Opportunities and Challenges for Aerospace

    National Research Council Canada - National Science Library

    Obieta, Isabel; Marcos, J

    2005-01-01

    Nanomaterials are regarded world-wide as key materials of the 21st Century. Also, in aerospace a high potential for nanomaterials applications is postulated and technological breakthroughs are expected in this area...

  18. Additive Manufacturing of Aerospace Propulsion Components

    Science.gov (United States)

    Misra, Ajay K.; Grady, Joseph E.; Carter, Robert

    2015-01-01

    The presentation will provide an overview of ongoing activities on additive manufacturing of aerospace propulsion components, which included rocket propulsion and gas turbine engines. Future opportunities on additive manufacturing of hybrid electric propulsion components will be discussed.

  19. 2012 aerospace medical certification statistical handbook.

    Science.gov (United States)

    2013-12-01

    The annual Aerospace Medical Certification Statistical Handbook reports descriptive : characteristics of all active U.S. civil aviation airmen and the aviation medical examiners (AMEs) that : perform the required medical examinations. The 2012 annual...

  20. 2011 aerospace medical certification statistical handbook.

    Science.gov (United States)

    2013-01-01

    The annual Aerospace Medical Certification Statistical Handbook reports descriptive characteristics of all active U.S. civil aviation airmen and the aviation medical examiners (AMEs) that perform the required medical examinations. The 2011 annual han...

  1. Aerospace Grade Carbon Felt Preform Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Fiber Materials, Inc. (FMI) will develop an aerospace-grade carbon felt preform by employing application specific materials with effective processes and fabrication...

  2. Introduction to NASA's Academy of Aerospace Quality

    OpenAIRE

    Smith, Alice; Smith, Jeffrey

    2016-01-01

    The NASA Academy of Aerospace Quality (AAQ) is an internet-based public domain forum of quality assurance-related educational modules for students and faculty at academic institutions targeting those involved in aerospace research, technology development, and payload design and development including Cube Sats, Small Sats, Nano Sats, Rockets and High Altitude Balloons. The target users are university project and research teams but the academy has also been used by K-12 teams, independent space...

  3. Protons, Aerospace, and Electronics: A National Interest

    Science.gov (United States)

    Label, Kenneth A.; Turflinger, Thomas L.

    2017-01-01

    The aerospace and semiconductor industries lost 2000 hours annually of research access when IUCF closed. An ad hoc team between the U.S. government and industry was formed to evaluate other facility options. In this presentation, we will discuss: 1) Why aerospace, semiconductor manufacturers, and others are interested in proton facility access, as well as, 2) Some of the basics of a typical test for electronics, and 3) We'll conclude with the brief current status on progress.

  4. Index of International Publications in Aerospace Medicine

    Science.gov (United States)

    2010-10-01

    Aerospace Medicine technical reports are available in full-text from the Civil Aerospace Medical Institute’s publications Web site: www.faa.gov/library...Peterburg, Russia: Akademiia Grazhdanskoi Aviatsii, 2004. Aviation and Environmental Physiology Acosta J. Historia Natural y Moral de las Indias... Historia y Cultura Aeronáutica, 1987. Gowdey DW, Pearce JW. A Selected Bibliography of the Open Literature on Aviation Medicine, 1945-1955. Ottawa

  5. Intelligent Systems Applied to the Aerospace Industry

    OpenAIRE

    Sary, Charisse; Werking, Roger

    1997-01-01

    For years, the aerospace industry has relied on people and their knowledge to make critical decisions. This method of decision-making has become very expensive and unreliable, particularly when used to monitor increasingly complex systems. Intelligent systems and tools are now available that can be used to reduce costs and improve operations. Much work has been done in the area of intelligent systems to support aerospace-related activities. Computer Sciences Corporation (CSC) has conducted st...

  6. Novel Wiring Technologies for Aerospace Applications

    Science.gov (United States)

    Gibson, Tracy L.; Parrish, Lewis M.

    2014-01-01

    Because wire failure in aerospace vehicles could be catastrophic, smart wiring capabilities have been critical for NASA. Through the years, researchers at Kennedy Space Center (KSC) have developed technologies, expertise, and research facilities to meet this need. In addition to aerospace applications, NASA has applied its knowledge of smart wiring, including self-healing materials, to serve the aviation industry. This webinar will discuss the development efforts of several wiring technologies at KSC and provide insight into both current and future research objectives.

  7. Towards a new titanium sector: Aerospace

    CSIR Research Space (South Africa)

    Du Preez, W

    2012-10-01

    Full Text Available Sector: Aerospace 4th Biennial Conference Presented by: Dr Willie du Preez Director: Titanium Centre of Competence Date: 9 October 2012 Outline ? Why Titanium? ? The Opportunity for South Africa ? The SA Titanium Industry Strategy ? Primary... 3 USD/kg Ti Ti Powder 40 USD/kg Ti SA Opportunity ? Technology-led Industry Development ? CSIR 2012 Slide 9 Raw material Market 2nd largest Ti producer 3rd largest V producer Aerospace Automotive Medical Recreational Industrial Power...

  8. Probability and Statistics in Aerospace Engineering

    Science.gov (United States)

    Rheinfurth, M. H.; Howell, L. W.

    1998-01-01

    This monograph was prepared to give the practicing engineer a clear understanding of probability and statistics with special consideration to problems frequently encountered in aerospace engineering. It is conceived to be both a desktop reference and a refresher for aerospace engineers in government and industry. It could also be used as a supplement to standard texts for in-house training courses on the subject.

  9. Total quality management - It works for aerospace information services

    Science.gov (United States)

    Erwin, James; Eberline, Carl; Colquitt, Wanda

    1993-01-01

    Today we are in the midst of information and 'total quality' revolutions. At the NASA STI Program's Center for AeroSpace Information (CASI), we are focused on using continuous improvements techniques to enrich today's services and products and to ensure that tomorrow's technology supports the TQM-based improvement of future STI program products and services. The Continuous Improvements Program at CASI is the foundation for Total Quality Management in products and services. The focus is customer-driven; its goal, to identify processes and procedures that can be improved and new technologies that can be integrated with the processes to gain efficiencies, provide effectiveness, and promote customer satisfaction. This Program seeks to establish quality through an iterative defect prevention approach that is based on the incorporation of standards and measurements into the processing cycle.

  10. PRODUCTION AND CHARACTERIZATION OF CRUDE INTRACELLULER PHYTASE FROM RECOMBINANT BACTERIA pEAS1AMP

    Directory of Open Access Journals (Sweden)

    A.M.P. Nuhriawangsa

    2014-10-01

    Full Text Available This research was aimed at producing a crude intracellular phytase characterized from recombinantbacteria. The recombinant bacteria (pEAS1AMP was produced by way of transforming pET-22b(++pEAS1 into competent E. coli BL21 and E. coli BL21(DE3 cells. Crude intracellular phytaseproduction was induced using 1,5 mM Isopropyl-β-D-thiogalactopyranosid (IPTG. Recombinantbacteria product and enzyme activity test followed the Sajidan method. E. coli BL21(+pEAS1 and E.coli BL21 (DE3(+pEAS1 recombinant bacteria showed growth after 20 hours and 10 hours oftransformation. Phytase activity of E. coli BL21 (DE3(++pEAS1 showed higher than those of E. coliBL21(++pEAS1. Crude intracellular phytase of pEAS1AMP recombinant bacteria has an optimumactivity at pH 5, 40oC, incubation period of 60 minutes, substrate concentration of 2%, molecular weight(MW of 47.3 kDa, Km = 15.91 υM and Vm = 2.41 υM/second. Mg2+ acts as a cofactor but Fe3+ (10-4M acts as an inhibitor.

  11. Analysis and test of low profile aluminum aerospace tank dome

    Science.gov (United States)

    Ahmed, R.; Wilhelm, J. M.

    1993-01-01

    In order to increase the structural performance of cryogenic tanks, the aerospace industry is beginning to employ low-profile bulkheads in new generation launch vehicle designs. This report details the analysis and test of one such dome made from 2219 aluminum. Such domes have two potential failure modes under internal pressure, general tensile failure and hoop compression buckling (in regions near the equator). The test determined the buckling load and ultimate tensile load of the hardware and showed that both compared well with the analysis predictions. This effort was conducted under the auspices of NASA and the General Dynamics Cryogenic Tank Technology Program (CTTP).

  12. Mobile Computing for Aerospace Applications

    Science.gov (United States)

    Alena, Richard; Swietek, Gregory E. (Technical Monitor)

    1994-01-01

    The use of commercial computer technology in specific aerospace mission applications can reduce the cost and project cycle time required for the development of special-purpose computer systems. Additionally, the pace of technological innovation in the commercial market has made new computer capabilities available for demonstrations and flight tests. Three areas of research and development being explored by the Portable Computer Technology Project at NASA Ames Research Center are the application of commercial client/server network computing solutions to crew support and payload operations, the analysis of requirements for portable computing devices, and testing of wireless data communication links as extensions to the wired network. This paper will present computer architectural solutions to portable workstation design including the use of standard interfaces, advanced flat-panel displays and network configurations incorporating both wired and wireless transmission media. It will describe the design tradeoffs used in selecting high-performance processors and memories, interfaces for communication and peripheral control, and high resolution displays. The packaging issues for safe and reliable operation aboard spacecraft and aircraft are presented. The current status of wireless data links for portable computers is discussed from a system design perspective. An end-to-end data flow model for payload science operations from the experiment flight rack to the principal investigator is analyzed using capabilities provided by the new generation of computer products. A future flight experiment on-board the Russian MIR space station will be described in detail including system configuration and function, the characteristics of the spacecraft operating environment, the flight qualification measures needed for safety review, and the specifications of the computing devices to be used in the experiment. The software architecture chosen shall be presented. An analysis of the

  13. Posterior Tracheopexy for Severe Tracheomalacia Associated with Esophageal Atresia (EA: Primary Treatment at the Time of Initial EA Repair versus Secondary Treatment

    Directory of Open Access Journals (Sweden)

    Hester F. Shieh

    2018-01-01

    Full Text Available PurposeWe review outcomes of posterior tracheopexy for tracheomalacia in esophageal atresia (EA patients, comparing primary treatment at the time of initial EA repair versus secondary treatment.MethodsAll EA patients who underwent posterior tracheopexy from October 2012 to September 2016 were retrospectively reviewed. Clinical symptoms, tracheomalacia scores, and persistent airway intrusion were collected. Indication for posterior tracheopexy was the presence of clinical symptoms, in combination with severe tracheomalacia as identified on bronchoscopic evaluation, typically defined as coaptation in one or more regions of the trachea. Secondary cases were usually those with chronic respiratory symptoms who underwent bronchoscopic evaluation, whereas primary cases were those found to have severe tracheomalacia on routine preoperative dynamic tracheobronchoscopy at the time of initial EA repair.ResultsA total of 118 patients underwent posterior tracheopexy: 18 (15% primary versus 100 (85% secondary cases. Median (interquartile range age was 2 months (1–4 months for primary (22% type C and 18 months (8–40 months for secondary (87% type C cases (p < 0.001. There were statistically significant improvements in most clinical symptoms postoperatively for primary and secondary cases, with no significant differences in any postoperative symptoms between the two groups (p > 0.1. Total tracheomalacia scores improved significantly in primary (p = 0.013 and secondary (p < 0.001 cases. Multivariable Cox regression analysis indicated no differences in persistent airway intrusion requiring reoperation between primary and secondary tracheopexy adjusting for imbalances in age and EA type (p = 0.67.ConclusionPosterior tracheopexy is effective in treating severe tracheomalacia with significant improvements in clinical symptoms and degree of airway collapse on bronchoscopy. With no significant differences in outcomes between primary and

  14. Aerospace medicine at Brooks AFB, TX: hail and farewell.

    Science.gov (United States)

    Nunneley, Sarah A; Webb, James T

    2011-05-01

    With the impending termination of USAF operations at Brooks Air Force Base (AFB) in San Antonio, TX, it is time to consider its historic role in Aerospace Medicine. The base was established in 1917 as a flight training center for the U.S. Army Air Service and in 1926 became home to its School of Aviation Medicine. The school moved to San Antonio's Randolph Field in 1931, but in 1959 it returned to Brooks where it occupied new facilities to support its role as a national center for U.S. Air Force aerospace medicine, including teaching, clinical medicine, and research. The mission was then expanded to encompass support of U.S. military and civilian space programs. With the abrupt termination of the military space program in 1969, research at Brooks focused on clinical aviation medicine and support of advanced military aircraft while continuing close cooperation with NASA in support of orbital spaceflight and the journey to the Moon. Reorganization in the 1990s assigned all research functions at Brooks to the Human Systems Division and its successors, leaving to USAFSAM the missions related to clinical work and teaching. In 2002 the USAF and the city of San Antonio implemented shared operation of Brooks as a "City-Base" in the hope of deflecting threatened closure. Nevertheless, under continuing pressure to consolidate military facilities in the United States, the 2005 Base Closure and Realignment Commission ordered Brooks closed by 2011, with its aerospace medicine functions relocated to new facilities at Wright-Patterson AFB in Dayton, OH.

  15. Assessment of avionics technology in European aerospace organizations

    Science.gov (United States)

    Martinec, D. A.; Baumbick, Robert; Hitt, Ellis; Leondes, Cornelius; Mayton, Monica; Schwind, Joseph; Traybar, Joseph

    1992-01-01

    This report provides a summary of the observations and recommendations made by a technical panel formed by the National Aeronautics and Space Administration (NASA). The panel, comprising prominent experts in the avionics field, was tasked to visit various organizations in Europe to assess the level of technology planned for use in manufactured civil avionics in the future. The primary purpose of the study was to assess avionics systems planned for implementation or already employed on civil aircraft and to evaluate future research, development, and engineering (RD&E) programs, address avionic systems and aircraft programs. The ultimate goal is to ensure that the technology addressed by NASa programs is commensurate with the needs of the aerospace industry at an international level. The panel focused on specific technologies, including guidance and control systems, advanced cockpit displays, sensors and data networks, and fly-by-wire/fly-by-light systems. However, discussions the panel had with the European organizations were not limited to these topics.

  16. Business Architecture Development at Public Administration - Insights from Government EA Method Engineering Project in Finland

    Science.gov (United States)

    Valtonen, Katariina; Leppänen, Mauri

    Governments worldwide are concerned for efficient production of services to customers. To improve quality of services and to make service production more efficient, information and communication technology (ICT) is largely exploited in public administration (PA). Succeeding in this exploitation calls for large-scale planning which embraces issues from strategic to technological level. In this planning the notion of enterprise architecture (EA) is commonly applied. One of the sub-architectures of EA is business architecture (BA). BA planning is challenging in PA due to a large number of stakeholders, a wide set of customers, and solid and hierarchical structures of organizations. To support EA planning in Finland, a project to engineer a government EA (GEA) method was launched. In this chapter, we analyze the discussions and outputs of the project workshops and reflect emerged issues on current e-government literature. We bring forth insights into and suggestions for government BA and its development.

  17. EAS thermal neutron detection with the PRISMA-LHAASO-16 experiment

    Science.gov (United States)

    Li, B.-B.; Alekseenko, V. V.; Cui, S.-w.; Chen, T.-L.; Dangzengluobu; Feng, S.-H.; Gao, Q.; Liu, Y.; Huang, Q.-C.; He, Y.-Y.; Liu, M.-Y.; Ma, X.-H.; Pozdnyakov, E. I.; Shchegolev, O. B.; Shen, F.-Z.; Stenkin, Yu. V.; Stepanov, V. I.; Yanin, Ya. V.; Yao, J.-D.; Zhou, R.

    2017-12-01

    EAS (extensive air shower) thermal neutron measurement gives advantages to study energy and mass composition of primary cosmic rays especially in the knee region. After the success of the PRISMA-YBJ experiment, we build a new EAS thermal neutron detection array at Tibet University, Lhasa, China (3700 m a.s.l.) in March, 2017. This prototype array so called "PRISMA-LHAASO-16" consists of 16 EAS EN-detectors ("EN" is abbreviation for electron and neutron) measuring two main EAS components: hadronic and electromagnetic ones. Different from PRISMA-YBJ, these detectors use a thin layer of a novel type of ZnS(Ag) scintillator alloyed with natural boron compound for thermal neutron capture. PRISMA-LHAASO-16 will be moved to the LHAASO site in the near future. In this paper, we introduce principle of the detection technique, deployment of the array, and the test results of the array.

  18. MISCIBILITY, SOLUBILITY, AND VISCOSITY MEASUREMENTS FOR R-236EA WITH POTENTIAL LUBRICANTS

    Science.gov (United States)

    The report gives results of miscibility, solubility, and viscosity measurements of refrigerant R-236ea with three potential lubricants. (NOTE: The data were needed to determine the suitability of refrigerant/lubricant combinations for use in refrigeration systems.) The lubricants...

  19. Data of evolutionary structure change: 1I5EA-1XTVB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I5EA-1XTVB 1I5E 1XTV A B GKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIET...PMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG-- EE HHHHHHHHHHH... 1XTV B 1XTVB 1XTV B 1XTVB 1XTV B 1XTVB

  20. Data of evolutionary structure change: 1I5EA-1XTVE [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I5EA-1XTVE 1I5E 1XTV A E GKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIET...PMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG-- EE HHHHHHHHHHH... 1XTV E 1XTVE 1XTV E 1XTVE 1XTV E 1XTVE

  1. Data of evolutionary structure change: 1I5EA-1XTVF [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I5EA-1XTVF 1I5E 1XTV A F GKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIET...PMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG-- EE HHHHHHHHHHH... 1XTV F 1XTVF 1XTV F 1XTVF 1XTV F 1XTVF

  2. Data of evolutionary structure change: 1I5EA-1XTVA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I5EA-1XTVA 1I5E 1XTV A A GKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIET...PMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG-- EE HHHHHHHHHHH... 1XTV A 1XTVA 1XTV A 1XTVA 1XTV A 1XTVA

  3. Data of evolutionary structure change: 1I5EA-1XTVH [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I5EA-1XTVH 1I5E 1XTV A H GKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIET...PMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG-- EE HHHHHHHHHHH... 1XTV H 1XTVH 1XTV H 1XTVH 1XTV H 1XTVH

  4. Data of evolutionary structure change: 1I5EA-1XTVC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I5EA-1XTVC 1I5E 1XTV A C GKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIET...PMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG-- EE HHHHHHHHHHH... 1XTV C 1XTVC 1XTV C 1XTVC 1XTV C 1XTVC

  5. Data of evolutionary structure change: 1I5EA-1XTVD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I5EA-1XTVD 1I5E 1XTV A D GKVYVFDHPLIQHKLTYIRDKNTGTKEFRELVDEVATLMAFEITRDLPLEEVEIET...PMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG-- EE HHHHHHHHHHH... 1XTV D 1XTVD 1XTV D 1XTVD 1XTV D 1XTVD

  6. Data of evolutionary structure change: 1E1EA-2RGMB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1E1EA-2RGMB 1E1E 2RGM A B MLSPSEIPQRDWFPSDFTFGAATSAYQIEGAWNEDGKGESNWDHFCHNHPERILDG...SNSDIGANSYHMYKTDVRLLKEMGMDAYRFSISWPRILPKGTKEGGINPDGIKYYRNLINLLLENGIEPYVTIFHWDVPQALEEKYGGFLDKSHKSIVED...KEFNTA ---WLGGLSRAAFPKRFVFGTVTSAYQVEGMAASGGRGPSIWDAFAHT-PGNVAGNQNGDVATDQYHRYKEDVNLMKSLN...TPTSYSADWQVTYVFAK-NGKPIGPQANSNWLYIVPWGMYGCVNYIKQKYGNPTVVITENGMDQPAN----LSRDQYLRDTTRVHFYRSYLTQLKKAIDE... 2RGM B 2RGMB

  7. Differentiation of partial acylglycerols derived from different animal fats by EA-IRMS and GCMS techniques

    National Research Council Canada - National Science Library

    Nina Naquiah, A. N; Marikkar, J. M.N; Shuhaimi, M

    2016-01-01

    ...) and Elemental Analysis–Isotope Ratio Mass Spectrometry (EA-IRMS). Mono- (MAG) and di-(DAG) acylglycerols of animal fats were prepared according to a chemical glycerolysis method and isolated using column chromatography...

  8. Aerospace and Flight. Technology Learning Activity. Teacher Edition. Technology Education Series.

    Science.gov (United States)

    Oklahoma State Dept. of Vocational and Technical Education, Stillwater. Curriculum and Instructional Materials Center.

    This packet of technology learning activity (TLA) materials on aerospace and flight for students in grades 6-10 consists of a technology education overview, information on use, and instructor's and student's sections. The overview discusses the technology education program and materials. Components of the instructor's and student's sections are…

  9. Learning To Compete: Post-graduate Training in an Aerospace Company.

    Science.gov (United States)

    Hyland, Paul; Sloan, Terry; Beckett, Ron

    2002-01-01

    A master of technology management degree program was offered to aerospace employees on site; many completed modules and 20 completed degrees. Responses from 38.5% of 65 participants indicated both personal and company benefits (improved capacity for change, movement toward a learning culture), but some experienced problems in applying learning on…

  10. Slow and fast light in SOA-EA structures for phased-array antennas

    DEFF Research Database (Denmark)

    Sales, S.; Öhman, Filip; Bermejo, A.

    We present an SOA-EA structure for controlling the phase and amplitude of optically fed phased-array antennas. Phase shifts of 40 degrees are obtained through slow and fast light effects by changing only the reverse voltage.......We present an SOA-EA structure for controlling the phase and amplitude of optically fed phased-array antennas. Phase shifts of 40 degrees are obtained through slow and fast light effects by changing only the reverse voltage....

  11. Wireless Sensing Opportunities for Aerospace Applications

    Directory of Open Access Journals (Sweden)

    William Wilson

    2008-07-01

    Full Text Available Wireless sensors and sensor networks is an emerging technology area with many applications within the aerospace industry. Integrated vehicle health monitoring (IVHM of aerospace vehicles is needed to ensure the safety of the crew and the vehicle, yet often high costs, weight, size and other constraints prevent the incorporation of instrumentation onto spacecraft. This paper presents a few of the areas such as IVHM, where new wireless sensing technology is needed on both existing vehicles as well as future spacecraft. From ground tests to inflatable structures to the International Space Station, many applications could receive benefits from small, low power, wireless sensors. This paper also highlights some of the challenges that need to overcome when implementing wireless sensor networks for aerospace vehicles.

  12. Adopting exergy analysis for use in aerospace

    Science.gov (United States)

    Hayes, David; Lone, Mudassir; Whidborne, James F.; Camberos, José; Coetzee, Etienne

    2017-08-01

    Thermodynamic analysis methods, based on an exergy metric, have been developed to improve system efficiency of traditional heat driven systems such as ground based power plants and aircraft propulsion systems. However, in more recent years interest in the topic has broadened to include applying these second law methods to the field of aerodynamics and complete aerospace vehicles. Work to date is based on highly simplified structures, but such a method could be shown to have benefit to the highly conservative and risk averse commercial aerospace sector. This review justifies how thermodynamic exergy analysis has the potential to facilitate a breakthrough in the optimization of aerospace vehicles based on a system of energy systems, through studying the exergy-based multidisciplinary design of future flight vehicles.

  13. Polymer and ceramic nanocomposites for aerospace applications

    Science.gov (United States)

    Rathod, Vivek T.; Kumar, Jayanth S.; Jain, Anjana

    2017-09-01

    This paper reviews the potential of polymer and ceramic matrix composites for aerospace/space vehicle applications. Special, unique and multifunctional properties arising due to the dispersion of nanoparticles in ceramic and metal matrix are briefly discussed followed by a classification of resulting aerospace applications. The paper presents polymer matrix composites comprising majority of aerospace applications in structures, coating, tribology, structural health monitoring, electromagnetic shielding and shape memory applications. The capabilities of the ceramic matrix nanocomposites to providing the electromagnetic shielding for aircrafts and better tribological properties to suit space environments are discussed. Structural health monitoring capability of ceramic matrix nanocomposite is also discussed. The properties of resulting nanocomposite material with its disadvantages like cost and processing difficulties are discussed. The paper concludes after the discussion of the possible future perspectives and challenges in implementation and further development of polymer and ceramic nanocomposite materials.

  14. Polymer and ceramic nanocomposites for aerospace applications

    Science.gov (United States)

    Rathod, Vivek T.; Kumar, Jayanth S.; Jain, Anjana

    2017-11-01

    This paper reviews the potential of polymer and ceramic matrix composites for aerospace/space vehicle applications. Special, unique and multifunctional properties arising due to the dispersion of nanoparticles in ceramic and metal matrix are briefly discussed followed by a classification of resulting aerospace applications. The paper presents polymer matrix composites comprising majority of aerospace applications in structures, coating, tribology, structural health monitoring, electromagnetic shielding and shape memory applications. The capabilities of the ceramic matrix nanocomposites to providing the electromagnetic shielding for aircrafts and better tribological properties to suit space environments are discussed. Structural health monitoring capability of ceramic matrix nanocomposite is also discussed. The properties of resulting nanocomposite material with its disadvantages like cost and processing difficulties are discussed. The paper concludes after the discussion of the possible future perspectives and challenges in implementation and further development of polymer and ceramic nanocomposite materials.

  15. NSWC Crane Aerospace Cell Test History Database

    Science.gov (United States)

    Brown, Harry; Moore, Bruce

    1994-01-01

    The Aerospace Cell Test History Database was developed to provide project engineers and scientists ready access to the data obtained from testing of aerospace cell designs at Naval Surface Warfare Center, Crane Division. The database is intended for use by all aerospace engineers and scientists involved in the design of power systems for satellites. Specifically, the database will provide a tool for project engineers to review the progress of their test at Crane and to have ready access to data for evaluation. Additionally, the database will provide a history of test results that designers can draw upon to answer questions about cell performance under certain test conditions and aid in selection of a cell for a satellite battery. Viewgraphs are included.

  16. Cost Reduction Key Drivers Within a Small Batch Aerospace Manufacturing Line

    OpenAIRE

    Delamare, Adrien

    2016-01-01

    This report details my work at the endpoint of the internship I spent within the Composite Manufacturing Unit of Airbus Defence & Space in Les Mureaux, France. It is as well the conclusion of the master’s program in aerospace engineering that I attended at KTH Royal Institute of Technology, Sweden.This document gives an overview of the cost reduction key drivers within a small batch aerospace manufacturing line. Some of the suggested leads developed in the paper have been set up in the pa...

  17. Analysis and Perspective from the Complex Aerospace Systems Exchange (CASE) 2013

    Science.gov (United States)

    Jones, Kennie H.; Parker, Peter A.; Detweiler, Kurt N.; McGowan, Anna-Maria R.; Dress, David A.; Kimmel, William M.

    2014-01-01

    NASA Langley Research Center embedded four rapporteurs at the Complex Aerospace Systems Exchange (CASE) held in August 2013 with the objective to capture the essence of the conference presentations and discussions. CASE was established to provide a discussion forum among chief engineers, program managers, and systems engineers on challenges in the engineering of complex aerospace systems. The meeting consists of invited presentations and panels from industry, academia, and government followed by discussions among attendees. This report presents the major and reoccurring themes captured throughout the meeting and provides analysis and insights to further the CASE mission.

  18. Imprint of the atmospheric attenuation process on electron distribution in EAS

    Science.gov (United States)

    Dey, R. K.; Dam, S.; Ray, S.

    2017-04-01

    The lateral density distribution (LDD) of shower particles in an extensive air shower (EAS) experiment is commonly approximated by a particular type of lateral density function (LDF). A standard perception is being used in air shower physics since long, according to which the LDD is assumed to be symmetric about the EAS axis, and the adopted LDF is adequate for the description of the LDD. However, the simulated electron density of a non-vertical EAS is asymmetric. In this work, such asymmetry in the LDD can be qualitatively explained as the atmospheric attenuation suffered by each shower particle. Quantitatively, the asymmetry can be roughly described in terms of a gap length (GL) between the EAS core and the center of the modified density pattern consisting of several equi-density ellipses. This study also validates the use of such a modeling of the atmospheric attenuation on the electromagnetic component in an EAS by investigating the so called GL in simulated density data. A modified LDF is proposed, based on these features of the simulated densities for the purpose of shower reconstruction in EAS experiments. The GL arises from attenuation effect is found to increase with the mass of the shower initiating particle. A different radial dependence of the local age parameter (LAP) is seen, if the modified LDF is applied to simulated electron densities. Primary cosmic-ray mass sensitivity of the LAP is also re-examined.

  19. The comprehensive aerospace index (CASI): Tracking the economic performance of the aerospace industry

    Science.gov (United States)

    Mattedi, Adriana Prest; Mantegna, Rosario Nunzio; Ramos, Fernando Manuel; Rosa, Reinaldo Roberto

    2008-12-01

    In this paper, we described the Comprehensive AeroSpace Index (CASI), a financial index aimed at representing the economic performance of the aerospace industry. CASI is build upon a data set of approximately 20 years of daily close prices set, from January 1987 to June 2007, from a comprehensive sample of leading aerospace-related companies with stocks negotiated on the New York Exchange (NYSE) and on the over-the-counter (OTC) markets. We also introduced the sub-indices CASI-AERO, for aeronautical segment, and CASI-SAT, for satellite segment, and considered the relation between them. These three indices are compared to others aerospace indices and to more traditional general financial indices like DJIA, S&P500 and Nasdaq. Our results have shown that the CASI is an index that describes very well the aerospace sector behavior, since it is able to reflect the aeronautical segment comportment as well as the satellite one. Therefore, in this sense, it can be considered as a representative index of the aerospace sector. Moreover, the creation of two sub-indices, the CASI-AERO and the CASI-SAT, allows to elucidate capital movements within the aerospace sector, particularly those of speculative nature, like the dot.com bubble and crash of 1998-2001.

  20. Integrated Vehicle Health Management (IVHM) for Aerospace Systems

    Science.gov (United States)

    Baroth, Edmund C.; Pallix, Joan

    2006-01-01

    To achieve NASA's ambitious Integrated Space Transportation Program objectives, aerospace systems will implement a variety of new concept in health management. System level integration of IVHM technologies for real-time control and system maintenance will have significant impact on system safety and lifecycle costs. IVHM technologies will enhance the safety and success of complex missions despite component failures, degraded performance, operator errors, and environment uncertainty. IVHM also has the potential to reduce, or even eliminate many of the costly inspections and operations activities required by current and future aerospace systems. This presentation will describe the array of NASA programs participating in the development of IVHM technologies for NASA missions. Future vehicle systems will use models of the system, its environment, and other intelligent agents with which they may interact. IVHM will be incorporated into future mission planners, reasoning engines, and adaptive control systems that can recommend or execute commands enabling the system to respond intelligently in real time. In the past, software errors and/or faulty sensors have been identified as significant contributors to mission failures. This presentation will also address the development and utilization of highly dependable sohare and sensor technologies, which are key components to ensure the reliability of IVHM systems.

  1. NASA's educational programs

    Science.gov (United States)

    Brown, Robert W.

    1990-01-01

    The educational programs of NASA's Educational Affairs Division are examined. The problem of declining numbers of science and engineering students is reviewed. The various NASA educational programs are described, including programs at the elementary and secondary school levels, teacher education programs, and undergraduate, graduate, and university faculty programs. The coordination of aerospace education activities and future plans for increasing NASA educational programs are considered.

  2. MEMS for automotive and aerospace applications

    CERN Document Server

    Kraft, Michael

    2013-01-01

    MEMS for automotive and aerospace applications reviews the use of Micro-Electro-Mechanical-Systems (MEMS) in developing solutions to the unique challenges presented by the automotive and aerospace industries.Part one explores MEMS for a variety of automotive applications. The role of MEMS in passenger safety and comfort, sensors for automotive vehicle stability control applications and automotive tire pressure monitoring systems are considered, along with pressure and flow sensors for engine management, and RF MEMS for automotive radar sensors. Part two then goes on to explore MEMS for

  3. Review: laser ignition for aerospace propulsion

    Directory of Open Access Journals (Sweden)

    Steven A. O’Briant

    2016-03-01

    This paper aims to provide the reader an overview of advanced ignition methods, with an emphasis on laser ignition and its applications to aerospace propulsion. A comprehensive review of advanced ignition systems in aerospace applications is performed. This includes studies on gas turbine applications, ramjet and scramjet systems, and space and rocket applications. A brief overview of ignition and laser ignition phenomena is also provided in earlier sections of the report. Throughout the reading, research papers, which were presented at the 2nd Laser Ignition Conference in April 2014, are mentioned to indicate the vast array of projects that are currently being pursued.

  4. Metal Matrix Composite Materials for Aerospace Applications

    Science.gov (United States)

    Bhat, Biliyar N.; Jones, C. S. (Technical Monitor)

    2001-01-01

    Metal matrix composites (MMC) are attractive materials for aerospace applications because of their high specific strength, high specific stiffness, and lower thermal expansion coefficient. They are affordable since complex parts can be produced by low cost casting process. As a result there are many commercial and Department of Defense applications of MMCs today. This seminar will give an overview of MMCs and their state-of-the-art technology assessment. Topics to be covered are types of MMCs, fabrication methods, product forms, applications, and material selection issues for design and manufacture. Some examples of current and future aerospace applications will also be presented and discussed.

  5. Variational analysis and aerospace engineering mathematical challenges for the aerospace of the future

    CERN Document Server

    Mohammadi, Bijan; Pironneau, Olivier; Cipolla, Vittorio

    2016-01-01

    This book presents papers surrounding the extensive discussions that took place from the ‘Variational Analysis and Aerospace Engineering’ workshop held at the Ettore Majorana Foundation and Centre for Scientific Culture in 2015. Contributions to this volume focus on advanced mathematical methods in aerospace engineering and industrial engineering such as computational fluid dynamics methods, optimization methods in aerodynamics, optimum controls, dynamic systems, the theory of structures, space missions, flight mechanics, control theory, algebraic geometry for CAD applications, and variational methods and applications. Advanced graduate students, researchers, and professionals in mathematics and engineering will find this volume useful as it illustrates current collaborative research projects in applied mathematics and aerospace engineering.

  6. Quality and productivity drive innovation and improvement at United Technologies Aerospace Operations, Inc.

    Science.gov (United States)

    Jamar, L. G.

    1986-01-01

    Quality and innovation are the hallmarks of the national space program. In programs that preceded the Shuttle Program the emphasis was on meeting the risks and technical challenges of space with safety, quality, reliability, and success. At United Technologies Aerospace Operations, Inc. (UTAO), the battle has developed along four primary fronts. These fronts include programs to motivate and reward people, development and construction of optimized processes and facilities, implementation of specifically tailored management systems, and the application of appropriate measurement and control systems. Each of these initiatives is described. However, to put this quality and productivity program in perspective, UTAO and its role in the Shuttle Program are described first.

  7. CSIR in aerospace: An engine for future industrial growth

    CSIR Research Space (South Africa)

    Naidoo, Kavendra

    2017-10-01

    Full Text Available in aerospace: An engine for future industrial growth Dr Kavendra Naidoo CSIR aeronautic systems manager 2 Overview • A brief summary of past and current activities in South African aerospace • Overview of CSIR capabilities in aerospace • Opportunities... for industry impact 3 A brief summary of previous and current activities in SA aerospace Argos-II Airborne Observation System SumbandilaSat Satellite 4 RAVIN Light Aircraft JS1 Championship Glider Sling Light Sport Aircraft AIRBUS SUPPLIER...

  8. 76 FR 58776 - U.S. Aerospace Supplier & Investment Mission

    Science.gov (United States)

    2011-09-22

    ... International Trade Administration U.S. Aerospace Supplier & Investment Mission AGENCY: International Trade... & Investment Mission to Montreal, Canada, May 6-9, 2012. This aerospace mission is an ideal opportunity for U.S.... Participation Requirements All parties interested in participating in the U.S. aerospace trade and investment...

  9. 78 FR 72598 - Airworthiness Directives; British Aerospace Regional Aircraft Airplanes

    Science.gov (United States)

    2013-12-03

    ... directive (AD) for British Aerospace Regional Aircraft Jetstream Series 3101 and Jetstream Model 3201... ADs None. (c) Applicability This AD applies to British Aerospace Regional Aircraft Jetstream Series... instructions of British Aerospace Jetstream Series 3100 & 3200 Service Bulletin 32-JM7862, Revision 1, dated...

  10. Aerospace Technology Careers: The Opportunity To Soar. Information Summaries.

    Science.gov (United States)

    National Aeronautics and Space Administration, Washington, DC.

    This document provides guidelines for the preparation of careers in aerospace, whether with the National Aeronautics and Space Administration (NASA) or private industry. The document discusses the following topics: (1) Preparing for an Aerospace Career; (2) Careers in Aerospace; (3) Employment Requirements; and (4) How To Apply. (ZWH)

  11. 76 FR 62455 - Aerospace Safety Advisory Panel; Meeting

    Science.gov (United States)

    2011-10-07

    ... SPACE ADMINISTRATION Aerospace Safety Advisory Panel; Meeting AGENCY: National Aeronautics and Space... meeting of the Aerospace Safety Advisory Panel. DATES: Friday, October 21, 2011, 12:30 to 2 p.m. Central.... FOR FURTHER INFORMATION CONTACT: Ms. Susan Burch, Aerospace Safety Advisory Panel Administrative...

  12. 77 FR 1955 - Aerospace Safety Advisory Panel; Meeting

    Science.gov (United States)

    2012-01-12

    ... SPACE ADMINISTRATION Aerospace Safety Advisory Panel; Meeting AGENCY: National Aeronautics and Space... meeting of the Aerospace Safety Advisory Panel. DATES: Friday, January 27, 2012, Time 11 a.m.-12:30 p.m... CONTACT: Ms. Susan Burch, Aerospace Safety Advisory Panel Administrative Officer, National Aeronautics and...

  13. 75 FR 36697 - Aerospace Safety Advisory Panel; Meeting

    Science.gov (United States)

    2010-06-28

    ... SPACE ADMINISTRATION Aerospace Safety Advisory Panel; Meeting AGENCY: National Aeronautics and Space... meeting of the Aerospace Safety Advisory Panel. DATES: Friday, July 16, 2010, 1 p.m. to 3 p.m. ADDRESSES... CONTACT: Ms. Kathy Dakon, Aerospace Safety Advisory Panel Executive Director, National Aeronautics and...

  14. 78 FR 1265 - Aerospace Safety Advisory Panel; Meeting

    Science.gov (United States)

    2013-01-08

    ... SPACE ADMINISTRATION Aerospace Safety Advisory Panel; Meeting AGENCY: National Aeronautics and Space... meeting of the Aerospace Safety Advisory Panel. ] DATES: Friday, January 25, 2013, 10:00 a.m. to 11:00 a.m... CONTACT: Ms. Harmony Myers, Aerospace Safety Advisory Panel Executive Director, National Aeronautics and...

  15. 77 FR 58413 - Aerospace Safety Advisory Panel; Meeting

    Science.gov (United States)

    2012-09-20

    ... SPACE ADMINISTRATION Aerospace Safety Advisory Panel; Meeting AGENCY: National Aeronautics and Space... meeting of the Aerospace Safety Advisory Panel. DATES: Friday, October 12, 2012, 12:00 p.m. to 1:00 p.m.... FOR FURTHER INFORMATION CONTACT: Ms. Harmony Myers, Aerospace Safety Advisory Panel Executive Director...

  16. 76 FR 65750 - Aerospace Safety Advisory Panel; Charter Renewal

    Science.gov (United States)

    2011-10-24

    ... SPACE ADMINISTRATION Aerospace Safety Advisory Panel; Charter Renewal AGENCY: National Aeronautics and... Aerospace Safety Advisory Panel. SUMMARY: Pursuant to sections 14(b)(1) and 9(c) of the Federal Advisory... of the NASA Aerospace Safety Advisory Panel is in the public interest in connection with the...

  17. 75 FR 28547 - Aerospace Supplier Mission to Russia

    Science.gov (United States)

    2010-05-21

    ... International Trade Administration Aerospace Supplier Mission to Russia AGENCY: International Trade..., International Trade Administration, U.S. and Foreign Commercial Service, is organizing an Aerospace Supplier... departure to the United States). This aerospace mission, to be led by a senior U.S. Department of Commerce...

  18. 77 FR 54787 - Airworthiness Directives; M7 Aerospace LLC Airplanes

    Science.gov (United States)

    2012-09-06

    ...-17177; AD 2012-18-01] RIN 2120-AA64 Airworthiness Directives; M7 Aerospace LLC Airplanes AGENCY: Federal... new airworthiness directive (AD) for all M7 Aerospace LLC Models SA226-AT, SA226-T, SA226-T(B), SA226... information identified in this AD, contact M7 Aerospace LP, 10823 NE Entrance Road, San Antonio, Texas 78216...

  19. 76 FR 36937 - Aerospace Safety Advisory Panel; Meeting

    Science.gov (United States)

    2011-06-23

    ... SPACE ADMINISTRATION Aerospace Safety Advisory Panel; Meeting AGENCY: National Aeronautics and Space... meeting of the Aerospace Safety Advisory Panel. DATES: Friday, July 15, 2011, 10 a.m. to 12 p.m. ADDRESSES... INFORMATION CONTACT: Ms. Kathy Dakon, Aerospace Safety Advisory Panel Executive Director, National Aeronautics...

  20. 78 FR 15976 - Aerospace Safety Advisory Panel; Meeting.

    Science.gov (United States)

    2013-03-13

    ... SPACE ADMINISTRATION Aerospace Safety Advisory Panel; Meeting. AGENCY: National Aeronautics and Space... meeting of the Aerospace Safety Advisory Panel. DATES: Wednesday April 3, 2013, 11:00 a.m. to 12:00 p.m..., Greenbelt, MD 20771-0001. FOR FURTHER INFORMATION CONTACT: Ms. Harmony Myers, Aerospace Safety Advisory...

  1. 76 FR 19147 - Aerospace Safety Advisory Panel; Meeting.

    Science.gov (United States)

    2011-04-06

    ... SPACE ADMINISTRATION Aerospace Safety Advisory Panel; Meeting. AGENCY: National Aeronautics and Space... meeting of the Aerospace Safety Advisory Panel. DATES: Friday, April 29, 2011, from 11 p.m. to 1 p.m..., FL 32899. FOR FURTHER INFORMATION CONTACT: Ms. Kathy Dakon, Aerospace Safety Advisory Panel Executive...

  2. 78 FR 57903 - Aerospace Safety Advisory Panel; Charter Renewal

    Science.gov (United States)

    2013-09-20

    ... SPACE ADMINISTRATION Aerospace Safety Advisory Panel; Charter Renewal AGENCY: National Aeronautics and Space Administration (NASA). ACTION: Notice of renewal and amendment of the charter of the Aerospace... the Aerospace Safety Advisory Panel is in the public interest in connection with the performance of...

  3. 76 FR 70042 - Airworthiness Directives; Pacific Aerospace Limited Airplanes

    Science.gov (United States)

    2011-11-10

    ...-030-AD; Amendment 39-16862; AD 2011-23-11] RIN 2120-AA64 Airworthiness Directives; Pacific Aerospace...). ACTION: Final rule. SUMMARY: We are adopting a new airworthiness directive (AD) for Pacific Aerospace...., Washington, DC 20590. FOR FURTHER INFORMATION CONTACT: Karl Schletzbaum, Aerospace Engineer, FAA, Small...

  4. 78 FR 77618 - Airworthiness Directives; M7 Aerospace LLC Airplanes

    Science.gov (United States)

    2013-12-24

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; M7 Aerospace LLC...). SUMMARY: We propose to adopt a new airworthiness directive (AD) for all M7 Aerospace LLC Models SA226-AT... bulkhead. This proposed AD also requires reporting certain inspection results to M7 Aerospace LLC. We are...

  5. 77 FR 71357 - Airworthiness Directives; Pacific Aerospace Limited Airplanes

    Science.gov (United States)

    2012-11-30

    ... Directives; Pacific Aerospace Limited Airplanes AGENCY: Federal Aviation Administration (FAA), Department of... airworthiness directive (AD) for all Pacific Aerospace Limited Models FU24-954 and FU24A-954 airplanes that... INFORMATION CONTACT: Karl Schletzbaum, Aerospace Engineer, FAA, Small Airplane Directorate, 901 Locust, Room...

  6. 78 FR 9781 - Airworthiness Directives; Pacific Aerospace Limited Airplanes

    Science.gov (United States)

    2013-02-12

    ...-044-AD; Amendment 39-17335; AD 2013-03-01] RIN 2120-AA64 Airworthiness Directives; Pacific Aerospace... Aerospace Limited Models FU24-954 and FU24A-954 airplanes. This AD results from mandatory continuing.... For service information identified in this AD, contact Pacific Aerospace Limited, Hamilton Airport...

  7. 76 FR 26316 - Aerospace Safety Advisory Panel; Meeting

    Science.gov (United States)

    2011-05-06

    ... SPACE ADMINISTRATION Aerospace Safety Advisory Panel; Meeting AGENCY: National Aeronautics and Space... Federal Register of April 26, 2011, announcing a meeting of the Aerospace Safety Advisory Panel (ASAP) to... Administration, Washington, DC 20546, (202) 358-0732. SUPPLEMENTARY INFORMATION: The Aerospace Safety Advisory...

  8. Utilization of Additive Manufacturing for Aerospace Heat Exchangers

    Science.gov (United States)

    2016-02-29

    viability of additive manufacturing for producin9 aerospace heat exchangers for naval air platforms . This report considers various heat exc...demonstration , aerospace heat exchangers 16. SECURITY CLASSIFICATION OF: 17. LIMITATION OF ABSTRACT a. REPORT b. ABSTRACT c. THIS PAGE UNCLASSIFIED... Aerospace Heat Exchangers Research Conducted for the Office of Naval Research Under the Enabling Additive Manufacturing Technologies for Industry

  9. 77 FR 25502 - Aerospace Safety Advisory Panel; Meeting

    Science.gov (United States)

    2012-04-30

    ... SPACE ADMINISTRATION Aerospace Safety Advisory Panel; Meeting AGENCY: National Aeronautics and Space... meeting of the Aerospace Safety Advisory Panel. DATES: Friday, May 25, 2012, 10:00-11:00 a.m. CST... Visitor Control Center to gain access.) FOR FURTHER INFORMATION CONTACT: Ms. Harmony Myers, Aerospace...

  10. 78 FR 77501 - NASA Aerospace Safety Advisory Panel; Meeting

    Science.gov (United States)

    2013-12-23

    ... SPACE ADMINISTRATION NASA Aerospace Safety Advisory Panel; Meeting AGENCY: National Aeronautics and... forthcoming meeting of the Aerospace Safety Advisory Panel. DATES: Thursday, January 23, 2014, 1:00 p.m. to 2..., Houston, TX 77058. FOR FURTHER INFORMATION CONTACT: Ms. Marian Norris, Aerospace Safety Advisory Panel...

  11. 32 CFR 705.30 - Aerospace Education Workshop.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Aerospace Education Workshop. 705.30 Section 705... REGULATIONS AND OFFICIAL RECORDS PUBLIC AFFAIRS REGULATIONS § 705.30 Aerospace Education Workshop. (a) This... of Naval Operations has cognizance of all assistance provided by the Navy to all Aerospace Education...

  12. 77 FR 75908 - Airworthiness Directives; Gulfstream Aerospace Corporation

    Science.gov (United States)

    2012-12-26

    ... Aerospace Corporation AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of proposed... Aerospace Corporation Model GV and GV-SP airplanes. This proposed AD was prompted by reports of two failures... in this proposed AD, contact Gulfstream Aerospace Corporation, Technical Publications Dept., P.O. Box...

  13. 76 FR 55614 - Airworthiness Directives; Pacific Aerospace Limited Airplanes

    Science.gov (United States)

    2011-09-08

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Pacific Aerospace... (AD) for Pacific Aerospace Limited Models FU24-954 and FU24A-954 airplanes modified with an unapproved... INFORMATION CONTACT: Karl Schletzbaum, Aerospace Engineer, FAA, Small Airplane Directorate, 901 Locust, Room...

  14. 78 FR 56941 - Aerospace Safety Advisory Panel; Meeting

    Science.gov (United States)

    2013-09-16

    ... SPACE ADMINISTRATION Aerospace Safety Advisory Panel; Meeting AGENCY: National Aeronautics and Space... meeting of the Aerospace Safety Advisory Panel. DATES: Friday, October 11, 2013, 10:00 a.m. to 11:00 a.m.... FOR FURTHER INFORMATION CONTACT: Ms. Harmony Myers, Aerospace Safety Advisory Panel Executive Director...

  15. 78 FR 36793 - Aerospace Safety Advisory Panel; Meeting

    Science.gov (United States)

    2013-06-19

    ... SPACE ADMINISTRATION Aerospace Safety Advisory Panel; Meeting AGENCY: National Aeronautics and Space... meeting of the Aerospace Safety Advisory Panel (ASAP). DATES: Friday, July 12, 2013, 09:00-10:00 a.m.... Harmony Myers, Aerospace Safety Advisory Panel Executive Director, National Aeronautics and Space...

  16. 76 FR 50881 - Airworthiness Directives; M7 Aerospace LP Airplanes

    Science.gov (United States)

    2011-08-17

    ...-025-AD; Amendment 39-16771; AD 2011-17-07] RIN 2120-AA64 Airworthiness Directives; M7 Aerospace LP.... SUMMARY: We are adopting a new airworthiness directive (AD) for certain M7 Aerospace LP Models SA226-T... AD, contact M7 Aerospace, LC, 10823 NE. Entrance Road, San Antonio, Texas 78216; telephone (210) 824...

  17. 76 FR 2923 - Aerospace Safety Advisory Panel; Meeting

    Science.gov (United States)

    2011-01-18

    ... SPACE ADMINISTRATION Aerospace Safety Advisory Panel; Meeting AGENCY: National Aeronautics and Space... meeting of the Aerospace Safety Advisory Panel. DATES: Friday, February 4, 2011, 11:30 a.m. to 1:30 p.m... CONTACT: Ms. Kathy Dakon, Aerospace Safety Advisory Panel Executive Director, National Aeronautics and...

  18. 75 FR 61219 - Aerospace Safety Advisory Panel; Meeting

    Science.gov (United States)

    2010-10-04

    ... SPACE ADMINISTRATION Aerospace Safety Advisory Panel; Meeting AGENCY: National Aeronautics and Space... meeting of the Aerospace Safety Advisory Panel. DATES: Friday, October 22, 2010, 12:30 p.m. to 2 p.m... 77058. FOR FURTHER INFORMATION CONTACT: Ms. Kathy Dakon, Aerospace Safety Advisory Panel Executive...

  19. 75 FR 6407 - Aerospace Safety Advisory Panel; Meeting

    Science.gov (United States)

    2010-02-09

    ... SPACE ADMINISTRATION Aerospace Safety Advisory Panel; Meeting AGENCY: National Aeronautics and Space... meeting of the Aerospace Safety Advisory Panel. DATES: Wednesday, February 24, 2010, 12:30 p.m. to 2:30 p... Center Visitor's Center to gain access.) ] FOR FURTHER INFORMATION CONTACT: Ms. Kathy Dakon, Aerospace...

  20. 77 FR 38090 - Aerospace Safety Advisory Panel; Meeting.

    Science.gov (United States)

    2012-06-26

    ... SPACE ADMINISTRATION Aerospace Safety Advisory Panel; Meeting. AGENCY: National Aeronautics and Space... meeting of the Aerospace Safety Advisory Panel. DATES: Friday, July 20, 2012, 11:30 a.m. to 12:30 p.m. EDT... FURTHER INFORMATION CONTACT: Ms. Harmony Myers, Aerospace Safety Advisory Panel Executive Director...

  1. 47 CFR 11.11 - The Emergency Alert System (EAS).

    Science.gov (United States)

    2010-10-01

    ... Fixed-Satellite Service Direct to Home providers); SDARS, as defined in 47 CFR 25.201; participating... as satellites or repeaters of a hub station (or common studio or control point if there is no hub station) and rebroadcast 100 percent of the programming of the hub station (or common studio or control...

  2. 7 CFR 1794.23 - Proposals normally requiring an EA.

    Science.gov (United States)

    2010-01-01

    ... boundaries. (12) Installing a heat recovery steam generator and steam turbine with a rating of more than 200... Administrator on a case-by-case basis. (c) Electric program. Applications for financial assistance for certain... classification are: (1) Construction of fuel cell, combustion turbine, combined cycle, or diesel generating...

  3. Aircraft of Today. Aerospace Education I.

    Science.gov (United States)

    Savler, D. S.

    This textbook gives a brief idea about the modern aircraft used in defense and for commercial purposes. Aerospace technology in its present form has developed along certain basic principles of aerodynamic forces. Different parts in an airplane have different functions to balance the aircraft in air, provide a thrust, and control the general…

  4. Theory of Aircraft Flight. Aerospace Education II.

    Science.gov (United States)

    Elmer, James D.

    This revised textbook, one in the Aerospace Education II series, provides answers to many questions related to airplanes and properties of air flight. The first chapter provides a description of aerodynamic forces and deals with concepts such as acceleration, velocity, and forces of flight. The second chapter is devoted to the discussion of…

  5. Spacecraft and their Boosters. Aerospace Education I.

    Science.gov (United States)

    Coard, E. A.

    This book, one in the series on Aerospace Education I, provides a description of some of the discoveries that spacecraft have made possible and of the experience that American astronauts have had in piloting spacecraft. The basic principles behind the operation of spacecraft and their boosters are explained. Descriptions are also included on…

  6. Aerospace Technologies and Applications for Dual Use

    DEFF Research Database (Denmark)

     the Planet safety and security. In this frame, the concept of dual use - the set of technologies and applications that can be exploied for both civil and military purposes - becomes a key-topic. In addition, the aerospace is a strategic building block in the deployment of a network centric environment...

  7. Annual Report to the NASA Administrator by the Aerospace Safety Advisory Panel on the Space Shuttle Program. Part 2: Summary of Information Developed in the Panel's Fact-Finding Activities

    Science.gov (United States)

    1977-01-01

    The panel focused its attention on those areas that are considered most significant for flight success and safety. Elements required for the Approach and Landing Test Program, the Orbital Flight Test Program, and those management systems and their implementation which directly affect safety, reliability, and quality control, were investigated. Ground facilities and the training programs for the ground and flight crews were studied. Of special interest was the orbiter thermal protection subsystems.

  8. Aerospace Meteorology Lessons Learned Relative to Aerospace Vehicle Design and Operations

    Science.gov (United States)

    Vaughan, William W.; Anderson, B. Jeffrey

    2004-01-01

    Aerospace Meteorology came into being in the 1950s as the development of rockets for military and civilian usage grew in the United States. The term was coined to identify those involved in the development of natural environment models, design/operational requirements, and environment measurement systems to support the needs of aerospace vehicles, both launch vehicles and spacecraft. It encompassed the atmospheric environment of the Earth, including Earth orbit environments. Several groups within the United States were active in this area, including the Department of Defense, National Aeronautics and Space Administration, and a few of the aerospace industry groups. Some aerospace meteorology efforts were similar to those being undertaken relative to aviation interests. As part of the aerospace meteorology activities a number of lessons learned resulted that produced follow on efforts which benefited from these experiences, thus leading to the rather efficient and technologically current descriptions of terrestrial environment design requirements, prelaunch monitoring systems, and forecast capabilities available to support the development and operations of aerospace vehicles.

  9. Prevalence of E/A wave fusion and A wave truncation in DDD pacemaker patients with complete AV block under nominal AV intervals.

    Science.gov (United States)

    Poller, Wolfram C; Dreger, Henryk; Schwerg, Marius; Melzer, Christoph

    2015-01-01

    Optimization of the AV-interval (AVI) in DDD pacemakers improves cardiac hemodynamics and reduces pacemaker syndromes. Manual optimization is typically not performed in clinical routine. In the present study we analyze the prevalence of E/A wave fusion and A wave truncation under resting conditions in 160 patients with complete AV block (AVB) under the pre-programmed AVI. We manually optimized sub-optimal AVI. We analyzed 160 pacemaker patients with complete AVB, both in sinus rhythm (AV-sense; n = 129) and under atrial pacing (AV-pace; n = 31). Using Doppler analyses of the transmitral inflow we classified the nominal AVI as: a) normal, b) too long (E/A wave fusion) or c) too short (A wave truncation). In patients with a sub-optimal AVI, we performed manual optimization according to the recommendations of the American Society of Echocardiography. All AVB patients with atrial pacing exhibited a normal transmitral inflow under the nominal AV-pace intervals (100%). In contrast, 25 AVB patients in sinus rhythm showed E/A wave fusion under the pre-programmed AV-sense intervals (19.4%; 95% confidence interval (CI): 12.6-26.2%). A wave truncations were not observed in any patient. All patients with a complete E/A wave fusion achieved a normal transmitral inflow after AV-sense interval reduction (mean optimized AVI: 79.4 ± 13.6 ms). Given the rate of 19.4% (CI 12.6-26.2%) of patients with a too long nominal AV-sense interval, automatic algorithms may prove useful in improving cardiac hemodynamics, especially in the subgroup of atrially triggered pacemaker patients with AV node diseases.

  10. Prevalence of E/A wave fusion and A wave truncation in DDD pacemaker patients with complete AV block under nominal AV intervals.

    Directory of Open Access Journals (Sweden)

    Wolfram C Poller

    Full Text Available Optimization of the AV-interval (AVI in DDD pacemakers improves cardiac hemodynamics and reduces pacemaker syndromes. Manual optimization is typically not performed in clinical routine. In the present study we analyze the prevalence of E/A wave fusion and A wave truncation under resting conditions in 160 patients with complete AV block (AVB under the pre-programmed AVI. We manually optimized sub-optimal AVI.We analyzed 160 pacemaker patients with complete AVB, both in sinus rhythm (AV-sense; n = 129 and under atrial pacing (AV-pace; n = 31. Using Doppler analyses of the transmitral inflow we classified the nominal AVI as: a normal, b too long (E/A wave fusion or c too short (A wave truncation. In patients with a sub-optimal AVI, we performed manual optimization according to the recommendations of the American Society of Echocardiography.All AVB patients with atrial pacing exhibited a normal transmitral inflow under the nominal AV-pace intervals (100%. In contrast, 25 AVB patients in sinus rhythm showed E/A wave fusion under the pre-programmed AV-sense intervals (19.4%; 95% confidence interval (CI: 12.6-26.2%. A wave truncations were not observed in any patient. All patients with a complete E/A wave fusion achieved a normal transmitral inflow after AV-sense interval reduction (mean optimized AVI: 79.4 ± 13.6 ms.Given the rate of 19.4% (CI 12.6-26.2% of patients with a too long nominal AV-sense interval, automatic algorithms may prove useful in improving cardiac hemodynamics, especially in the subgroup of atrially triggered pacemaker patients with AV node diseases.

  11. Probing the evolution of the EAS muon content in the atmosphere with KASCADE-Grande

    Science.gov (United States)

    Apel, W. D.; Arteaga-Velázquez, J. C.; Bekk, K.; Bertaina, M.; Blümer, J.; Bozdog, H.; Brancus, I. M.; Cantoni, E.; Chiavassa, A.; Cossavella, F.; Daumiller, K.; de Souza, V.; Di Pierro, F.; Doll, P.; Engel, R.; Fuhrmann, D.; Gherghel-Lascu, A.; Gils, H. J.; Glasstetter, R.; Grupen, C.; Haungs, A.; Heck, D.; Hörandel, J. R.; Huege, T.; Kampert, K.-H.; Kang, D.; Klages, H. O.; Link, K.; Łuczak, P.; Mathes, H. J.; Mayer, H. J.; Milke, J.; Mitrica, B.; Morello, C.; Oehlschläger, J.; Ostapchenko, S.; Pierog, T.; Rebel, H.; Roth, M.; Schieler, H.; Schoo, S.; Schröder, F. G.; Sima, O.; Toma, G.; Trinchero, G. C.; Ulrich, H.; Weindl, A.; Wochele, J.; Zabierowski, J.

    2017-10-01

    The evolution of the muon content of very high energy air showers (EAS) in the atmosphere is investigated with data of the KASCADE-Grande observatory. For this purpose, the muon attenuation length in the atmosphere is obtained to Λμ = 1256 ± 85-232+229 (syst) g/cm2 from the experimental data for shower energies between 1016.3 and 1017.0 eV. Comparison of this quantity with predictions of the high-energy hadronic interaction models QGSJET-II-02, SIBYLL 2.1, QGSJET-II-04 and EPOS-LHC reveals that the attenuation of the muon content of measured EAS in the atmosphere is lower than predicted. Deviations are, however, less significant with the post-LHC models. The presence of such deviations seems to be related to a difference between the simulated and the measured zenith angle evolutions of the lateral muon density distributions of EAS, which also causes a discrepancy between the measured absorption lengths of the density of shower muons and the predicted ones at large distances from the EAS core. The studied deficiencies show that all four considered hadronic interaction models fail to describe consistently the zenith angle evolution of the muon content of EAS in the aforesaid energy regime.

  12. Equus asinus papillomavirus (EaPV1) provides new insights into equine papillomavirus diversity.

    Science.gov (United States)

    Lecis, R; Tore, G; Scagliarini, A; Antuofermo, E; Dedola, C; Cacciotto, C; Dore, G M; Coradduzza, E; Gallina, L; Battilani, M; Anfossi, A G; Muzzeddu, M; Chessa, B; Pittau, M; Alberti, A

    2014-06-04

    We detected a novel papillomavirus (EaPV1) from healthy skin and from sun associated cutaneous lesions of an Asinara (Sardinia, Italy) white donkey reared in captivity in a wildlife recovery centre. The entire genome of EaPV1 was cloned, sequenced, and characterised. Genome is 7467 bp long, and shows some characteristic elements of horse papillomaviruses, including a small untranslated region between the early and late regions and the lack of the retinoblastoma tumour suppressor binding domain LXCXE in E7. Additionally, a typical E6 ORF is missing. EaPV1 DNA was detected in low copies in normal skin of white and grey donkeys of the Asinara Island, and does not transform rodent fibroblasts in standard transformation assays. Pairwise nucleotide alignments and phylogenetic analyses based on concatenated E1-E2-L1 amino acid sequences revealed the highest similarity with the Equine papillomavirus type 1. The discovery of EaPV1, the prototype of a novel genus and the first papillomavirus isolated in donkeys, confirms a broad diversity in Equidae papillomaviruses. Taken together, data suggest that EaPV1 is a non-malignant papillomavirus adapted to healthy skin of donkeys. Copyright © 2014 Elsevier B.V. All rights reserved.

  13. Advances in control system technology for aerospace applications

    CERN Document Server

    2016-01-01

    This book is devoted to Control System Technology applied to aerospace and covers the four disciplines Cognitive Engineering, Computer Science, Operations Research, and Servo-Mechanisms. This edited book follows a workshop held at the Georgia Institute of Technology in June 2012, where the today's most important aerospace challenges, including aerospace autonomy, safety-critical embedded software engineering, and modern air transportation were discussed over the course of two days of intense interactions among leading aerospace engineers and scientists. Its content provide a snapshot of today's aerospace control research and its future, including Autonomy in space applications, Control in space applications, Autonomy in aeronautical applications, Air transportation, and Safety-critical software engineering.

  14. Environmental Projects for Aerospace Applications

    Science.gov (United States)

    2012-05-23

    identified and evaluated potential replacements for methylene chloride based chemical paint strippers used on Army aviation and missile equipment...Sustainment of aviation and missile weapon system maintenance activities require the use of HAP-free chemical paint strippers .  This program...Evaluated immersion and manual paint strippers that are NESHAP compliant. 2024-T3 MIL-C-5541 Type I, Class 1a Stripping Efficiency Panel

  15. Aerospace Technology Innovation. Volume 9

    Science.gov (United States)

    Turner, Janelle (Editor); Cousins, Liz (Editor)

    2001-01-01

    Commercializing technology is a daunting task. Of every 11 new product ideas, only one will successfully make it to the marketplace. Fully 46% of new product investment becomes sunk in cost. Yet, a few good companies consistently attain an 80% technology commercialization success rate and have lead the way in establishing best practices. The NASA Incubator program consists of nine incubators, each residing near a NASA research center. The purpose of the incubators is to use the best practices is to use the best practices of technology commercialization to help early stage businesses successfully launch new products that incorporate NASA technology.

  16. Optimal mutation rates for the (1+λ) EA on OneMax

    DEFF Research Database (Denmark)

    Gießen, Christian; Witt, Carsten

    2016-01-01

    We study the (1 + λ) EA with mutation probability c/n, where c > 0 is a constant, on the ONEMAX problem. Using an improved variable drift theorem, we show that upper and lower bounds on the expected runtime of the (1+λ) EA obtained from variable drift theorems are at most apart by a small lower...... mutation rates for the (1+λ) EA for various parameter settings of c and λ and also for moderate sizes of n. This makes the need for potentially lengthy and costly experiments in order to optimize the parameters unnecessary. Interestingly, even for moderate n and not too small λ it turns out that mutation...... rates up to 10% larger than the asymptotically optimal rate 1/n minimize the expected runtime. However, in absolute terms the expected runtime does not change by much when replacing 1/n with the optimal mutation rate....

  17. Self-Adaptive Operator Scheduling using the Religion-Based EA

    DEFF Research Database (Denmark)

    Thomsen, Rene; Krink, Thiemo

    2002-01-01

    The optimal choice of the variation operators mutation and crossover and their parameters can be decisive for the performance of evolutionary algorithms (EAs). Usually the type of the operators (such as Gaussian mutation) remains the same during the entire run and the probabilistic frequency...... of their application is determined by a constant parameter, such as a fixed mutation rate. However, recent studies have shown that the optimal usage of a variation operator changes during the EA run. In this study, we combined the idea of self-adaptive mutation operator scheduling with the Religion-Based EA (RBEA......), which is an agent model with spatially structured and variable sized subpopulations (religions). In our new model (OSRBEA), we used a selection of different operators, such that each operator type was applied within one specific subpopulation only. Our results indicate that the optimal choice...

  18. Materials for Electroactive Ion-Exchange (EaIX) Separations of Pertechnetate Ion

    Energy Technology Data Exchange (ETDEWEB)

    Stender, Matthias; Hubler, Timothy L.; Alhoshan, Mansour; Smyrl, William H.

    2004-03-29

    Many contaminants of interest to the U.S. Department of Energy (DOE) exist as anions (e.g. chromate, pertechnetate and nitrate). The objective of this study is to develop Electroactive Ion-Exchange (EaIX) materials. Such materials can be used to separate pertechnetate ion from radioactive wastes located at DOE sites while limiting the amount of secondary wastes generated. We have developed a synthetic strategy to prepare vinyl-bipyridyl and -terpyridyl ligands which allow incorporation of ion-selective architectures with a polymerizable handle. Fe complexes formed with these ligands provide the working core of the electroactive polymers. The polymers can be directly used as materials for EaIX or they can be incorporated into porous composite materials that are then used for EaIX.

  19. Linsley's EAS time structure method for the primary cosmic ray spectrum at LAAS

    Science.gov (United States)

    Iyono, A.; Matsumoto, H.; Okei, K.; Tsuji, S.; Ohara, S.; Ochi, N.; Konishi, T.; Takahashi, N.; Yamamoto, I.; Nakatsuka, T.; Nakamura, T.; Ohmori, N.; Saito, K.

    2011-09-01

    We have installed a shift register system of extensive air show (EAS) particles in a compact EAS array built on the rooftop of the Faculty of Engineering building in the campus of Okayama University of Science and being operated since April 2006 as part of Large Area Air Shower (LAAS) experiments , in order to register each arrival time of EAS particles within 5 μs. Detector simulations based on the database obtained from one of the standard cosmic ray propagation simulator in the atmosphere (AIRES) have also been carried out and the procedures to estimate the primary cosmic ray energy from the Linsley's method have been developed and examined. Applying Linsley's method to the EAS data obtained by our EAS arrays and the simulation results, we derived the energy spectrum from 1016 eV to 1019.5 eV. Consequently, we obtained the power-law index of -3.2 (+0.46-0.8) in the primary energy range of 1016 eV to 1018.5 eV, and obtained that a change around 1018 eV appeared if not taking account of the zenith angle distribution of primary cosmic rays. We compared the obtained energy spectrum with other experimental data above 1016 eV energies, and showed the two components of power-law energy spectra well described our data. We also showed the improvement of energy resolution by applying the restriction of zenith angle of primary cosmic rays in our simulation results, as well as the potential of the Linsley's method with a compact EAS array.

  20. Education programme on aerospace and environmental medicine for medical faculty of lomonosov moscow state university

    Science.gov (United States)

    Grigoriev, A. I.; Buravkova, L. B.; Loginov, V. A.; Vinogradova, O. L.

    The problems and approaches to organisation of the education process in the field of aerospace and environmental medicine for medical students are discussed. Original education programs are developed on the basis of Russian experience in space biology and physiology, environmental medicine, aerospace medicine and medical support during spaceflight. The main goals of these programs are to acquaint students with: interaction of living organisms with natural and artificial surroundings, including space flight conditions; the physiological reactions on extreme environmental factors; basic mechanisms of human adaptation to space flight and particularly to microgravity; the current research in space medicine and new telecommunication technologies. All programs are formed in accordance with contemporary progress in life sciences and revealed a result of the interdisciplinary approach to education process.

  1. NAVAIR Office of Small Business Programs

    Science.gov (United States)

    2012-08-08

    00 * DUAL HATTED * * AIR-7.0 CORPORATE OPERATIONS & TOTAL FORCE ASST. COMMANDER AIR-2.0 CONTRACTS ASST. COMMANDER AIR-1.0 PROGRAM...INTERROGATOR SYSTEM AN / UPX-29(V) PMA231 C-2A GREYHOUND / E-2D AHE C-2A(R) SLEP PMA234 AIRBORNE ELECTRONIC ATTACK EA-6B PROWLER EA

  2. A Combined group EA-PROMETHEE method for a supplier selection problem

    Directory of Open Access Journals (Sweden)

    Hamid Reza Rezaee Kelidbari

    2016-07-01

    Full Text Available One of the important decisions which impacts all firms’ activities is the supplier selection problem. Since the 1950s, several works have addressed this problem by treating different aspects and instances. In this paper, a combined multiple criteria decision making (MCDM technique (EA-PROMETHEE has been applied to implement a proper decision making. To this aim, after reviewing the theoretical background regarding to supplier selection, the extension analysis (EA is used to determine the importance of criteria and PROMETHEE for appraisal of suppliers based on the criteria. An empirical example illustrated the proposed approach.

  3. Hadronic interactions and EAS muon pseudorapidities investigated with the Muon Tracking Detector in KASCADE-Grande

    Energy Technology Data Exchange (ETDEWEB)

    Zabierowski, J., E-mail: janzab@zpk.u.lodz.p [Soltan Institute for Nuclear Studies, P.O. Box 447, 90950 Lodz (Poland); Apel, W.D. [Institut fuer Kernphysik, Forschungszentrum Karlsruhe, 76021 Karlsruhe (Germany); Arteaga, J.C. [Institut fuer Experimentelle Kernphysik, Universitaet Karlsruhe D-76021 Karlsruhe (Germany); Badea, F.; Bekk, K. [Institut fuer Kernphysik, Forschungszentrum Karlsruhe, 76021 Karlsruhe (Germany); Bertaina, M. [Dipartimento di Fisica Generale dell' Universita, 10125 Torino (Italy); Bluemer, H. [Institut fuer Experimentelle Kernphysik, Universitaet Karlsruhe D-76021 Karlsruhe (Germany); Institut fuer Kernphysik, Forschungszentrum Karlsruhe, 76021 Karlsruhe (Germany); Bozdog, H. [Institut fuer Kernphysik, Forschungszentrum Karlsruhe, 76021 Karlsruhe (Germany); Brancus, I.M. [National Institute of Physics and Nuclear Engineering, 7690 Bucharest (Romania); Brueggemann, M.; Buchholz, P. [Fachbereich Physik, Universitaet Siegen, 57068 Siegen (Germany); Cantoni, E. [Dipartimento di Fisica Generale dell' Universita, 10125 Torino (Italy); Istituto di Fisica dello Spazio Interplanetario, INAF, 10133 Torino (Italy); Chiavassa, A. [Dipartimento di Fisica Generale dell' Universita, 10125 Torino (Italy); Cossavella, F. [Institut fuer Experimentelle Kernphysik, Universitaet Karlsruhe D-76021 Karlsruhe (Germany); Daumiller, K. [Institut fuer Kernphysik, Forschungszentrum Karlsruhe, 76021 Karlsruhe (Germany); Souza, V. de [Institut fuer Experimentelle Kernphysik, Universitaet Karlsruhe D-76021 Karlsruhe (Germany); Di Pierro, F. [Dipartimento di Fisica Generale dell' Universita, 10125 Torino (Italy); Doll, P.; Engel, R.; Engler, J. [Institut fuer Kernphysik, Forschungszentrum Karlsruhe, 76021 Karlsruhe (Germany)

    2009-12-15

    The Muon Tracking Detector in the KASCADE-Grande EAS experiment allows the precise measurement of shower muon directions up to 700 m distance from the shower center. This directional information is used to study the pseudorapidity of muons in EAS, closely related to the pseudorapidity of their parent mesons. Moreover, the mean value of muon pseudorapidity in a registered shower reflects the longitudinal development of its hadronic component. All of this makes it a good tool for testing hadronic interaction models. The possibilities of such tests given by the KASCADE-Grande experimental setup are discussed and an example of the obtained muon pseudorapidity spectrum is shown.

  4. Temporal and lateral distributions of EAS neutron component measured with PRISMA-32

    Science.gov (United States)

    Gromushkin, D. M.; Bogdanov, F. A.; Petrukhin, A. A.; Shchegolev, O. B.; Stenkin, Yu V.; Stepanov, V. I.; Yashin, I. I.; Yurin, K. O.

    2017-01-01

    Some results on the EAS neutron component measurements by means of the PRISMA-32 array are presented. The array consists of 32 electron-neutron detectors (en-detectors) capable to detect two main EAS components: electromagnetic one consisting of charged particles, and hadronic one by measuring delayed thermal neutrons accompanying the showers. For thermal neutrons detection, a compound of a well-known inorganic scintillator ZnS(Ag) and LiF, enriched to 90 % with 6Li isotope is used. The setup allows us to record neutron component over the whole array area.

  5. IT Data Mining Tool Uses in Aerospace

    Science.gov (United States)

    Monroe, Gilena A.; Freeman, Kenneth; Jones, Kevin L.

    2012-01-01

    Data mining has a broad spectrum of uses throughout the realms of aerospace and information technology. Each of these areas has useful methods for processing, distributing, and storing its corresponding data. This paper focuses on ways to leverage the data mining tools and resources used in NASA's information technology area to meet the similar data mining needs of aviation and aerospace domains. This paper details the searching, alerting, reporting, and application functionalities of the Splunk system, used by NASA's Security Operations Center (SOC), and their potential shared solutions to address aircraft and spacecraft flight and ground systems data mining requirements. This paper also touches on capacity and security requirements when addressing sizeable amounts of data across a large data infrastructure.

  6. Integration of pyrotechnics into aerospace systems

    Science.gov (United States)

    Bement, Laurence J.; Schimmel, Morry L.

    1993-01-01

    The application of pyrotechnics to aerospace systems has been resisted because normal engineering methods cannot be used in design and evaluation. Commonly used approaches for energy sources, such as electrical, hydraulic and pneumatic, do not apply to explosive and pyrotechnic devices. This paper introduces the unique characteristics of pyrotechnic devices, describes how functional evaluations can be conducted, and demonstrates an engineering approach for pyrotechnic integration. Logic is presented that allows evaluation of two basic types of pyrotechnic systems to demonstrate functional margin.

  7. Overexpression of an EaZIP gene devoid of transit peptide sequence induced leaf variegation in tobacco

    Science.gov (United States)

    Guan, Xiayu; Li, Zhijian; Zhang, Zhiliang; Wei, Xiangying; Xie, Jiahua; Chen, Qingxi

    2017-01-01

    Leaf variegation is an ornamental trait that is not only biologically but also economically important. In our previous study, a Mg-protoporphyrin IX monomethyl ester cyclase homologue, EaZIP (Epipremnum aureum leucine zipper) was found to be associated with leaf variegation in Epipremnum aureum (Linden & Andre) G.S. Bunting. The protein product of this nuclear-encoded gene is targeted back to chloroplast involving in chlorophyll biosynthesis. Based on a web-based homology analysis, the EaZIP was found to lack a chloroplast transit peptide (cTP) sequence. In the present study, we tested if overexpression of the EaZIP cDNA with or without the cTP sequence could affect leaf variegation. Transgenic tobacco plants overexpressing EaZIP genes with (EaZIPwcTP) and without (EaZIPwocTP) cTP sequence were generated. Many plant lines harboring EaZIPwocTP showed variegated leaves, while none of the plant lines with EaZIPwcTP produced such a phenotype. Molecular analysis of T0 plants and selfed T1 progeny, as well as observations of tagged marker GFP (green fluorescent protein) did not show any other difference in patterns of gene integrity and expression. Results from this study indicate that transgenic approach for expressing EaZIPwocTP could be a novel method of generating variegated plants even through the underlying mechanisms remain to be elucidated. PMID:28422996

  8. Internal fluid mechanics research on supercomputers for aerospace propulsion systems

    Science.gov (United States)

    Miller, Brent A.; Anderson, Bernhard H.; Szuch, John R.

    1988-01-01

    The Internal Fluid Mechanics Division of the NASA Lewis Research Center is combining the key elements of computational fluid dynamics, aerothermodynamic experiments, and advanced computational technology to bring internal computational fluid mechanics (ICFM) to a state of practical application for aerospace propulsion systems. The strategies used to achieve this goal are to: (1) pursue an understanding of flow physics, surface heat transfer, and combustion via analysis and fundamental experiments, (2) incorporate improved understanding of these phenomena into verified 3-D CFD codes, and (3) utilize state-of-the-art computational technology to enhance experimental and CFD research. Presented is an overview of the ICFM program in high-speed propulsion, including work in inlets, turbomachinery, and chemical reacting flows. Ongoing efforts to integrate new computer technologies, such as parallel computing and artificial intelligence, into high-speed aeropropulsion research are described.

  9. Making aerospace technology work for the automotive industry - Introduction

    Science.gov (United States)

    Olson, W. T.

    1978-01-01

    In many cases it has been found that advances made in one technical field can contribute to other fields. An investigation is in this connection conducted concerning subjects from contemporary NASA programs and projects which might have relevance and potential usefulness to the automotive industry. Examples regarding aerospace developments which have been utilized by the automotive industry are related to electronic design, computer systems, quality control experience, a NASA combustion scanner and television display, exhaust gas analyzers, and a device for suppressing noise propagated through ducts. Projects undertaken by NASA's center for propulsion and power research are examined with respect to their value for the automotive industry. As a result of some of these projects, a gas turbine engine and a Stirling engine might each become a possible alternative to the conventional spark ignition engine.

  10. Optical Fiber Strain Instrumentation for High Temperature Aerospace Structural Monitoring

    Science.gov (United States)

    Wang, A.

    2002-01-01

    The objective of the program is the development and laboratory demonstration of sensors based on silica optical fibers for measurement of high temperature strain for aerospace materials evaluations. A complete fiber strain sensor system based on white-light interferometry was designed and implemented. An experiment set-up was constructed to permit testing of strain measurement up to 850 C. The strain is created by bending an alumina cantilever beam to which is the fiber sensor is attached. The strain calibration is provided by the application of known beam deflections. To ensure the high temperature operation capability of the sensor, gold-coated single-mode fiber is used. Moreover, a new method of sensor surface attachment which permits accurate sensor gage length determination is also developed. Excellent results were obtained at temperatures up to 800-850 C.

  11. An overview of Ball Aerospace cryogen storage and delivery systems

    Science.gov (United States)

    Marquardt, J.; Keller, J.; Mills, G.; Schmidt, J.

    2015-12-01

    Starting on the Gemini program in the 1960s, Beech Aircraft (now Ball Aerospace) has been designing and manufacturing dewars for a variety of cryogens including liquid hydrogen and oxygen. These dewars flew on the Apollo, Skylab and Space Shuttle spacecraft providing fuel cell reactants resulting in over 150 manned spaceflights. Since Space Shuttle, Ball has also built the liquid hydrogen fuel tanks for the Boeing Phantom Eye unmanned aerial vehicle. Returning back to its fuel cell days, Ball has designed, built and tested a volume-constrained liquid hydrogen and oxygen tank system for reactant delivery to fuel cells on unmanned undersea vehicles (UUVs). Herein past history of Ball technology is described. Testing has been completed on the UUV specific design, which will be described.

  12. Annual report to the NASA Administrator by the Aerospace Safety Advisory Panel. Part 2: Space shuttle program. Section 2: Summary of information developed in the Panel's fact-finding activities

    Science.gov (United States)

    1975-01-01

    The management areas and the individual elements of the shuttle system were investigated. The basic management or design approach including the most obvious limits or hazards that are significant to crew safety was reviewed. Shuttle program elements that were studied included the orbiter, the space shuttle main engine, the external tank project, solid rocket boosters, and the launch and landing elements.

  13. HEAT TRANSFER EVALUATION OF HFC-236EA WITH HIGH PERFORMANCE ENHANCED TUBES IN CONDENSATION AND EVAPORATION

    Science.gov (United States)

    The report gives results of an evaluation of the heat transfer performance of pure hydrofluorocarbon (HFC)-236ea for high performance enhanced tubes which had not been previously used in Navy shipboard chillers. Shell-side heat transfer coefficient data are presented for condensa...

  14. HEAT TRANSFER EVALUATION OF HFC-236EA AND CFC-114 IN CONDENSATION AND EVAPORATION

    Science.gov (United States)

    The report gives results of a heat transfer evaluation of the refrigerants hexafluoropropane (HFC-236ea) and 1,1,2,2-dichloro-tetrafluoroethane (CFC-114). (NOTE: With the mandatory phase-out of chlorofluorocarbons (CFCs), as dictated by the Montreal Protocol and Clean Air Act Ame...

  15. Spectrophotometric Properties of E+A Galaxies in SDSS-IV MaNGA

    Science.gov (United States)

    Marinelli, Mariarosa; Dudley, Raymond; Edwards, Kay; Gonzalez, Andrea; Johnson, Amalya; Kerrison, Nicole; Melchert, Nancy; Ojanen, Winonah; Weaver, Olivia; Liu, Charles; SDSS-IV MaNGA

    2018-01-01

    Quenched post-starburst galaxies, or E+A galaxies, represent a unique and informative phase in the evolution of galaxies. We used a qualitative rubric-based methodology, informed by the literature, to manually select galaxies from the SDSS-IV IFU survey Mapping Nearby Galaxies at Apache Point Observatory (MaNGA) using the single-fiber spectra from the Sloan Digital Sky Survey Data Release 8. Of the 2,812 galaxies observed so far in MaNGA, we found 39 galaxies meeting our criteria for E+A classification. Spectral energy distributions of these 39 galaxies from the far-UV to the mid-infrared demonstrate a heterogeneity in our sample emerging in the infrared, indicating many distinct paths to visually similar optical spectra. We used SDSS-IV MaNGA Pipe3D data products to analyze stellar population ages, and found that 34 galaxies exhibited stellar populations that were older at 1 effective radius than at the center of the galaxy. Given that our sample was manually chosen based on E+A markers in the single-fiber spectra aimed at the center of each galaxy, our E+A galaxies may have only experienced their significant starbursts in the central region, with a disk of quenched or quenching material further outward. This work was supported by grants AST-1460860 from the National Science Foundation and SDSS FAST/SSP-483 from the Alfred P. Sloan Foundation to the CUNY College of Staten Island.

  16. ET Ayodelel. AA ohmic". EA. Oluyemi: and s:.o. Ajanal~tu

    African Journals Online (AJOL)

    48 ELT. Ayodele ea? oi. In the present investigation. the synthesis and fungicidal activity of substituted dibenzyl trisulfides (1) are reported. The synthesized compounds were characterized by '1-I NMIR, “C. NMR and mass spectrometric techniques. To our knowledge. no detailed study of the synthesis and fungicidal activity ...

  17. COMPARISON OF CFC-114 AND HFC-236EA PERFORMANCE IN SHIPBOARD VAPOR COMPRESSION SYSTEMS

    Science.gov (United States)

    The report gives results of a comparison of the performance of two refrigerants - 1,1,1,2,3,3-hexafluoropropane (HFC-236ea) and 1,2-dichloro-tetrafluoroethane (CFC-114) - in shipboard vapor compression refrigeration systems. (NOTE: In compliance with the Montreal Protocol and Dep...

  18. Simulation studies and implementation of Linsley's EAS time structure method for the primary cosmic ray spectrum

    Science.gov (United States)

    Matsumoto, Hiroki; Iyono, Atsushi; Yamamoto, Isao; Kohata, Masaki; Okei, Kazuhide; Tsuji, Shuhei; Nakatsuka, Takao; Ochi, Nobuaki

    2010-03-01

    A compact extensive air shower (EAS) array of eight plastic scintillators viewed by HAMAMATSU H7195 photomultiplier tubes covering a total area of 2 m2 is built in the rooftop of the Faculty of Technology building, Okayama University of Science, and operated since April 2006. We have installed a shift register system in our EAS array to record EAS particle arrival time within 5 μs. We have also performed detector simulations based on the database obtained from the AIRES simulator and developed the procedures to estimate the primary cosmic ray energy from Linsley's method. Applying this method to our EAS data and the simulation result, we derived the energy spectrum from 1016 to 1019.5 eV. Consequently, we obtained the power-law index of -3.2(+0.46 -0.8) in the primary energy range of 1016 to 1018.5 eV, and obtained that a change around 1018 eV appeared if not taking account of the zenith angle distribution of primary cosmic rays. We also showed the improvement of energy resolution by applying the restriction of zenith angle of primary cosmic rays in our simulation, as well as the potential of Linsley's method with a mini array.

  19. Analysis of EA-18G Growler Engine Maintenance at Naval Air Station Whidbey Island, WA

    Science.gov (United States)

    2013-05-30

    LCDR Will Gray , Ms. Kimberlee Haney, LCDR Josh Macmurdo, Mr. Steve Nickerson, Mr. John Senior, LT Will Shields, Mr. Rick Swankie, and Mr. Norm...AT3. His first duty assignment was with the Grey Wolves of VAQ- 35 at NAS Whidbey Island, WA. During this tour he qualified as an EA-6B Plane Captain

  20. A Conceptual Critique of the EA:es Comparison in the Comprehensive Rorschach System.

    Science.gov (United States)

    Kleiger, James H.; Exner, John E., Jr.

    1992-01-01

    The EA:es index (part of the Comprehensive Rorschach System) is discussed, demonstrating how conceptual difficulties and abstract jargon can result in misleading and contradictory inferences. The comments of J. E. Exner, Jr., and the response of J. H. Kleiger concern the importance of theory in Rorschach interpretation. (SLD)

  1. Utility of 64-row MDCT in assessment of neonates with congenital EA and distal TEF

    Directory of Open Access Journals (Sweden)

    Hosam El-Deen Galal Mohamed El-Malah

    2015-12-01

    Conclusion: Preoperative MDCT scan with MPVR, 3D TL-VR of 64-row MDCT which is a noninvasive technique could provide more accurate information about the assessment of the origin of the fistula, the distal esophageal pouches and inter-pouch distance in neonates with EA and distal TEF.

  2. Total quality management: It works for aerospace information services

    Science.gov (United States)

    Erwin, James; Eberline, Carl; Colquitt, Wanda

    1993-01-01

    Today we are in the midst of information and 'total quality' revolutions. At the NASA STI Program's Center for AeroSpace Information (CASI), we are focused on using continuous improvements techniques to enrich today's services and products and to ensure that tomorrow's technology supports the TQM-based improvement of future STI program products and services. The Continuous Improvements Program at CASI is the foundation for Total Quality Management in products and services. The focus is customer-driven; its goal, to identify processes and procedures that can be improved and new technologies that can be integrated with the processes to gain efficiencies, provide effectiveness, and promote customer satisfaction. This Program seeks to establish quality through an iterative defect prevention approach that is based on the incorporation of standards and measurements into the processing cycle. Four projects are described that utilize cross-functional, problem-solving teams for identifying requirements and defining tasks and task standards, management participation, attention to critical processes, and measurable long-term goals. The implementation of these projects provides the customer with measurably improved access to information that is provided through several channels: the NASA STI Database, document requests for microfiche and hardcopy, and the Centralized Help Desk.

  3. A Systems Engineering Approach to Quality Assurance for Aerospace Testing

    Science.gov (United States)

    Shepherd, Christena C.

    2015-01-01

    On the surface, it appears that AS91001 has little to say about how to apply a Quality Management System (QMS) to major aerospace test programs (or even smaller ones). It also appears that there is little in the quality engineering Body of Knowledge (BOK)2 that applies to testing, unless it is nondestructive examination (NDE), or some type of lab or bench testing associated with the manufacturing process. However, if one examines: a) how the systems engineering (SE) processes are implemented throughout a test program; and b) how these SE processes can be mapped to the requirements of AS9100, a number of areas for involvement of the quality professional are revealed. What often happens is that quality assurance during a test program is limited to inspections of the test article; what could be considered a manufacturing al fresco approach. This limits the quality professional and is a disservice to the programs and projects, since there are a number of ways that quality can enhance critical processes, and support efforts to improve risk reduction, efficiency and effectiveness.

  4. 75 FR 2107 - Notice of Availability of the Draft Environmental Assessment (Draft EA) for the Urban Stream...

    Science.gov (United States)

    2010-01-14

    ... opportunities for the public and other groups. The grant recipient, DuPage County Stormwater Management Division... Assessment (Draft EA) for the Urban Stream Research Center Proposed To Be Constructed in Unincorporated...), Commerce. ACTION: Notice of Availability of the Draft Environmental Assessment (Draft EA) for the Urban...

  5. 47 CFR 90.699 - Transition of the upper 200 channels in the 800 MHz band to EA licensing.

    Science.gov (United States)

    2010-10-01

    ... a sharing arrangement with the EA licensee that may result in an otherwise impermissible level of... mechanism consists of two phases that must be completed before an EA licensee may proceed to request the..., antennas, receivers, battery back-up power, etc.) and the availability of the frequency channel due to...

  6. 77 FR 14855 - Notice of Availability and Request for Comment on the Draft Environmental Assessment (EA) for the...

    Science.gov (United States)

    2012-03-13

    ... Assessment (EA) for the Launch and Reentry of SpaceShipTwo Reusable Suborbital Rockets at the Mojave Air and... comments on the Draft EA for the Launch and Reentry of SpaceShipTwo Reusable Suborbital Rockets at the... issuing experimental permits and/or launch licenses to operate SpaceShipTwo Reusable Suborbital Rockets...

  7. 77 FR 38210 - Channel Spacing and Bandwidth Limitations for Certain Economic Area (EA)-Based 800 MHz...

    Science.gov (United States)

    2012-06-27

    ... COMMISSION 47 CFR Part 90 Channel Spacing and Bandwidth Limitations for Certain Economic Area (EA)-Based 800... Specialized Mobile Radio (SMR) licensees to exceed a legacy channel spacing requirement and bandwidth... not impacted by EA-based 800 MHz SMR licensees exceeding the channel spacing and bandwidth requirement...

  8. Computational Modeling of Flow Control Systems for Aerospace Vehicles Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Clear Science Corp. proposes to develop computational methods for designing active flow control systems on aerospace vehicles with the primary objective of...

  9. High Performing, Low Temperature Operating, Long Lifetime, Aerospace Lubricants Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Physical Sciences Inc. (PSI) proposes to synthesize, characterize, and test new ionic liquids and formulations as lubricants for aerospace applications. The...

  10. Aerospace Structures Test Facility Environmental Test Chambers (ETC)

    Data.gov (United States)

    Federal Laboratory Consortium — Purpose: The ETCs test the structural integrity of aerospace structures in representative operating temperatures and aerodynamic load distributions. The test article...

  11. Applications of hybrid and digital computation methods in aerospace-related sciences and engineering. [problem solving methods at the University of Houston

    Science.gov (United States)

    Huang, C. J.; Motard, R. L.

    1978-01-01

    The computing equipment in the engineering systems simulation laboratory of the Houston University Cullen College of Engineering is described and its advantages are summarized. The application of computer techniques in aerospace-related research psychology and in chemical, civil, electrical, industrial, and mechanical engineering is described in abstracts of 84 individual projects and in reprints of published reports. Research supports programs in acoustics, energy technology, systems engineering, and environment management as well as aerospace engineering.

  12. NASA/DOD Aerospace Knowledge Diffusion Research Project. Paper 39: The role of computer networks in aerospace engineering

    Science.gov (United States)

    Bishop, Ann P.; Pinelli, Thomas E.

    1994-01-01

    This paper presents selected results from an empirical investigation into the use of computer networks in aerospace engineering. Such networks allow aerospace engineers to communicate with people and access remote resources through electronic mail, file transfer, and remote log-in. The study drew its subjects from private sector, government and academic organizations in the U.S. aerospace industry. Data presented here were gathered in a mail survey, conducted in Spring 1993, that was distributed to aerospace engineers performing a wide variety of jobs. Results from the mail survey provide a snapshot of the current use of computer networks in the aerospace industry, suggest factors associated with the use of networks, and identify perceived impacts of networks on aerospace engineering work and communication.

  13. Chemical Gas Sensors for Aerospace Applications

    Science.gov (United States)

    Hunter, Gary W.; Liu, C. C.

    1998-01-01

    Chemical sensors often need to be specifically designed (or tailored) to operate in a given environment. It is often the case that a chemical sensor that meets the needs of one application will not function adequately in another application. The more demanding the environment and specialized the requirement, the greater the need to adapt exiting sensor technologies to meet these requirements or, as necessary, develop new sensor technologies. Aerospace (aeronautic and space) applications are particularly challenging since often these applications have specifications which have not previously been the emphasis of commercial suppliers. Further, the chemical sensing needs of aerospace applications have changed over the years to reflect the changing emphasis of society. Three chemical sensing applications of particular interest to the National Aeronautics and Space Administration (NASA) which illustrate these trends are launch vehicle leak detection, emission monitoring, and fire detection. Each of these applications reflects efforts ongoing throughout NASA. As described in NASA's "Three Pillars for Success", a document which outlines NASA's long term response to achieve the nation's priorities in aerospace transportation, agency wide objectives include: improving safety and decreasing the cost of space travel, significantly decreasing the amount of emissions produced by aeronautic engines, and improving the safety of commercial airline travel. As will be discussed below, chemical sensing in leak detection, emission monitoring, and fire detection will help enable the agency to meet these objectives. Each application has vastly different problems associated with the measurement of chemical species. Nonetheless, the development of a common base technology can address the measurement needs of a number of applications.

  14. Oklahoma Aerospace Intellectual Capital/Educational Recommendations: An Inquiry of Oklahoma Aerospace Executives

    Science.gov (United States)

    Nelson, Erin M.

    2010-01-01

    Scope and Method of Study: The purpose of this qualitative study was to conduct detailed personal interviews with aerospace industry executives/managers from both the private and military sectors from across Oklahoma to determine their perceptions of intellectual capital needs of the industry. Interviews with industry executives regarding…

  15. Aerospace product/process design interface

    Science.gov (United States)

    The present volume discusses the electron beam welding of launch-vehicle structures, an integrated aluminum forging-stock producer for aerospace structures, the definition of design processes in decision-based concurrent engineering, and the theory and application of the development of a comprehensive/concurrent engineering method. Also discussed are managing constraints in integrated and cooperative product development, an automatic FEM mesh-generation for the automation of parametric conceptual design, and computer-aided life-cycle design. (For individual items see A93-21746 to A93-21750)

  16. Infrared signature studies of aerospace vehicles

    Science.gov (United States)

    Mahulikar, Shripad P.; Sonawane, Hemant R.; Arvind Rao, G.

    2007-10-01

    Infrared (IR) emissions from aircraft are used to detect, track, and lock-on to the target. MAN Portable Air Defence Systems (MANPADS) have emerged as a major cause of aircraft and helicopter loss. Therefore, IR signature studies are important to counter this threat for survivability enhancement, and are an important aspect of stealth technology. This paper reviews contemporary developments in this discipline, with particular emphasis on IR signature prediction from aerospace vehicles. The role of atmosphere in IR signature analysis, and relation between IR signature level and target susceptibility are illustrated. Also, IR signature suppression systems and countermeasure techniques are discussed, to highlight their effectiveness and implications in terms of penalties.

  17. Development and analysis of insulation constructions for aerospace wiring applications

    Science.gov (United States)

    Slenski, George A.; Woodford, Lynn M.

    1993-03-01

    The Wright Laboratory Materials Directorate at WPAFB, Ohio recently completed a research and development program under contract with the McDonnell Douglas Aerospace Company, St. Louis, Missouri. Program objectives were to develop wire insulation performance requirements, evaluate candidate insulations, and prepare preliminary specification sheets on the most promising candidates. Aircraft wiring continues to be a high maintenance item and a major contributor to electrically-related aircraft mishaps. Mishap data on aircraft show that chafing of insulation is the most common mode of wire failure. Improved wiring constructions are expected to increase aircraft performance and decrease costs by reducing maintenance actions. In the laboratory program, new insulation constructions were identified that had overall improved performance in evaluation tests when compared to currently available MIL-W-81381 and MIL-W-22759 wiring. These insulations are principally aromatic polyimide and crosslinked ethylene tetrafluoroethylene (ETFE), respectively. Candidate insulations identified in preliminary specification sheets were principally fluoropolymers with a polyimide inner layer. Examples of insulation properties evaluated included flammability, high temperature mechanical and electrical performance, fluid immersion, and susceptibility to arc propagation under applied power chafing conditions. Potential next generation wire insulation materials are also reviewed.

  18. The Stellar Kinematics of E+A Galaxies in SDSS IV-MaNGA

    Science.gov (United States)

    Johnson, Amalya; Dudley, Raymond; Edwards, Kay; Gonzalez, Andrea; Kerrison, Nicole; Marinelli, Mariarosa; Melchert, Nancy; Ojanen, Winonah; Liu, Charles; SDSS-IV MaNGA

    2018-01-01

    E+A galaxies, hypothesized to be “transition” galaxies between the blue cloud and the red sequence, are valuable sources for studying the evolution of galaxies. Using data from the Sloan Digital Sky Survey Mapping Nearby Galaxies at Apache Point Observatory (MaNGA) survey, a large scale integral field spectroscopic survey of nearby galaxies from 3600 to 10300 Å, we identifed galaxies that exhibitted E+A characteristics within their optical spectra. We analyzed the 2,812 galaxies thus far observed by MaNGA to identify those that showed evidence of a starburst about 1 billion years ago, followed by cessation of star formation and quenching of the galaxy. Through this process we identifed 39 E+A galaxies by directly looking at the optical spectra and ensuring they exhibited the necessary properties of an E+A spectra, including a strong break at the 4000 Å mark, little to no Hα emission and absorption through the Balmer series, and a blue slope of the continuum past ~5000 Å as the flux decreases. We analyzed the stellar kinematics of these galaxies to determine whether or not they were fast or slow rotators, a proposed indicator of a major merger in their recent past. Using Voronoi binned graphs from the MaNGA Marvin database, we measured their stellar rotation curves in order to more clearly show the range of velocities within the galaxies. Among our 39 E+A candidates, all but two exhibited significant, orderly rotation across the galaxy, and 29 out of 39 of our galaxies show rotation faster than 30 km/s. With the caveat that our selection process was biased toward galaxies with orderly rotation, this prevalence of rotation challenges the belief that all E+A galaxies are created from major mergers. This work was supported by grants AST-1460860 from the National Science Foundation and SDSS FAST/SSP-483 from the Alfred P. Sloan Foundation to the CUNY College of Staten Island.

  19. EA Paschos

    Indian Academy of Sciences (India)

    ... suggested that density fluctuations grow during the transition period and remnants of this effect should be sought in the universe. The relation between theories with Majorana neutrinos and low energy phenomena, including oscillations, advanced considerably during the past two years with a consistent picture developed ...

  20. NASA/DOD Aerospace Knowledge Diffusion Research Project. Report 28: The technical communication practices of aerospace engineering and science students: Results of the phase 4 cross-national surveys

    Science.gov (United States)

    Pinelli, Thomas E.; Hecht, Laura M.; Barclay, Rebecca O.; Kennedy, John M.

    1994-01-01

    This report describes similarities and differences between undergraduate and graduate aerospace engineering and science students in the context of two general aspects of the educational experience. First, we explore the extent to which students differ regarding the factors that lead to the choice of becoming an aerospace engineer or a scientist, current satisfaction with that choice, and career-related goals and objectives. Second, we look at the technical communication skills, practices, habits, and training of aerospace engineering and science students. The reported data were obtained from a survey of students enrolled in aerospace engineering and science programs at universities in India, Japan, Russia, and the United Kingdom. The surveys were undertaken as part of the NASA/DOD Aerospace Knowledge Diffusion Research Project. Data are reported for the following categories: student demographics; skill importance, skill training, and skill helpfulness; collaborative writing; computer and information technology use and importance, use of electronic networks; use and importance of libraries and library services; use and importance of information sources and products; use of foreign language technical reports; and foreign language (reading and speaking) skills.

  1. An Assessment of the Effectiveness of Selected Aerospace Education Workshops in Tennessee

    Science.gov (United States)

    Maupin, Pauline Hicks

    1976-01-01

    Data from questionnaires indicated that the Tennessee Aerospace Education Workshops were successful in reaching their stated goals, which included developing a greater awareness of aerospace education and helping teachers incorporate more aerospace education in classroom activities. (MLH)

  2. Activities of the NASA sponsored SRI technology applications team in transferring aerospace technology to the public sector

    Science.gov (United States)

    Berke, J. G.

    1971-01-01

    The organization and functions of an interdisciplinary team for the application of aerospace generated technology to the solution of discrete technological problems within the public sector are presented. The interdisciplinary group formed at Stanford Research Institute, California is discussed. The functions of the group are to develop and conduct a program not only optimizing the match between public sector technological problems in criminalistics, transportation, and the postal services and potential solutions found in the aerospace data base, but ensuring that appropriate solutions are acutally utilized. The work accomplished during the period from July 1, 1970 to June 30, 1971 is reported.

  3. Citizen Science: Broadening Access and Engagement Through Community Partnerships, Aerospace Education and Water Quality Research

    Science.gov (United States)

    Johnson, M. A.

    2016-12-01

    We applied a new approach to the design and development of citizen science learning opportunities to enhance outreach to diverse student populations, while advancing water quality research and aerospace education. This collaborative approach to informal science, technology, engineering, and math (STEM) and aerospace education required innovative partnerships between private general aviation pilots, researchers, teachers, and students. This research explored the development of active partnerships required to facilitate community engaged science, with an emphasis on increased participation of women and girls and people of color, while creating new exploratory pathways for broadening access to and engagement in STEM learning experiences. We developed an outreach program through collaborative planning with local schools to create new STEM learning experiences based upon basic aerospace education concepts and an existing water quality research project designed to track harmful algal blooms (HAB) that can produce toxins called cyanobacteria, also known as blue-green algae, which can impact drinking, fishing, and recreational waters. General aviation pilots functioning as citizen scientists obtained high-resolution aerial images while flying over potentially impacted waters. Aerial data was made available to teachers and students, as well as researchers participating in the existing water quality program lead by NASA Glenn Research Center. Teachers used the images and results to educate in climate change and the dangers of HAB. Students were able to compare aerial data with their own observations, and also gained experience in aeronautical science through field trips to local airports, hands-on experience with private research aircraft, specialized equipment used for data collection, and advanced ground instruction from research pilots. As a result of reaching out to local educators serving diverse student populations and facilitating collaborative planning, we

  4. Chemical Microsensor Development for Aerospace Applications

    Science.gov (United States)

    Xu, Jennifer C.; Hunter, Gary W.; Lukco, Dorothy; Chen, Liangyu; Biaggi-Labiosa, Azlin M.

    2013-01-01

    Numerous aerospace applications, including low-false-alarm fire detection, environmental monitoring, fuel leak detection, and engine emission monitoring, would benefit greatly from robust and low weight, cost, and power consumption chemical microsensors. NASA Glenn Research Center has been working to develop a variety of chemical microsensors with these attributes to address the aforementioned applications. Chemical microsensors using different material platforms and sensing mechanisms have been produced. Approaches using electrochemical cells, resistors, and Schottky diode platforms, combined with nano-based materials, high temperature solid electrolytes, and room temperature polymer electrolytes have been realized to enable different types of microsensors. By understanding the application needs and chemical gas species to be detected, sensing materials and unique microfabrication processes were selected and applied. The chemical microsensors were designed utilizing simple structures and the least number of microfabrication processes possible, while maintaining high yield and low cost. In this presentation, an overview of carbon dioxide (CO2), oxygen (O2), and hydrogen/hydrocarbons (H2/CxHy) microsensors and their fabrication, testing results, and applications will be described. Particular challenges associated with improving the H2/CxHy microsensor contact wire-bonding pad will be discussed. These microsensors represent our research approach and serve as major tools as we expand our sensor development toolbox. Our ultimate goal is to develop robust chemical microsensor systems for aerospace and commercial applications.

  5. Managing human fallibility in critical aerospace situations

    Science.gov (United States)

    Tew, Larry

    2014-11-01

    Human fallibility is pervasive in the aerospace industry with over 50% of errors attributed to human error. Consider the benefits to any organization if those errors were significantly reduced. Aerospace manufacturing involves high value, high profile systems with significant complexity and often repetitive build, assembly, and test operations. In spite of extensive analysis, planning, training, and detailed procedures, human factors can cause unexpected errors. Handling such errors involves extensive cause and corrective action analysis and invariably schedule slips and cost growth. We will discuss success stories, including those associated with electro-optical systems, where very significant reductions in human fallibility errors were achieved after receiving adapted and specialized training. In the eyes of company and customer leadership, the steps used to achieve these results lead to in a major culture change in both the workforce and the supporting management organization. This approach has proven effective in other industries like medicine, firefighting, law enforcement, and aviation. The roadmap to success and the steps to minimize human error are known. They can be used by any organization willing to accept human fallibility and take a proactive approach to incorporate the steps needed to manage and minimize error.

  6. Strength Pareto particle swarm optimization and hybrid EA-PSO for multi-objective optimization.

    Science.gov (United States)

    Elhossini, Ahmed; Areibi, Shawki; Dony, Robert

    2010-01-01

    This paper proposes an efficient particle swarm optimization (PSO) technique that can handle multi-objective optimization problems. It is based on the strength Pareto approach originally used in evolutionary algorithms (EA). The proposed modified particle swarm algorithm is used to build three hybrid EA-PSO algorithms to solve different multi-objective optimization problems. This algorithm and its hybrid forms are tested using seven benchmarks from the literature and the results are compared to the strength Pareto evolutionary algorithm (SPEA2) and a competitive multi-objective PSO using several metrics. The proposed algorithm shows a slower convergence, compared to the other algorithms, but requires less CPU time. Combining PSO and evolutionary algorithms leads to superior hybrid algorithms that outperform SPEA2, the competitive multi-objective PSO (MO-PSO), and the proposed strength Pareto PSO based on different metrics.

  7. EAS primary particle parameter estimation with the complex Pamir-XXI detector array

    Directory of Open Access Journals (Sweden)

    Galkin V.I.

    2017-01-01

    Full Text Available Some new developments in EAS methods made in the framework of the Pamir-XXI project are presented. First, primary energy and direction definition accuracies by a network of fast scintillators are considered, optimum network cell size is defined for 10 PeV showers. Second, the same accuracies for a network of fast optical (Cherenkov detectors are considered for 30 TeV–10 PeV showers. Third, the possibilities of separation of EAS initiated by protons, nitrogen and iron nuclei of 1 and 10 PeV energies using a wide-angle Cherenkov telescope are discussed. Finally, the results of the extraction of 30–50 TeV gamma showers from the proton shower background with the same telescope are presented. Presumably, our developments can help in the study of PCR mass composition and ultra high energy gamma ray astronomy in other projects.

  8. 5th Conference on Aerospace Materials, Processes, and Environmental Technology

    Science.gov (United States)

    Cook, M. B. (Editor); Stanley, D. Cross (Editor)

    2003-01-01

    Records are presented from the 5th Conference on Aerospace Materials, Processes, and Environmental Technology. Topics included pollution prevention, inspection methods, advanced materials, aerospace materials and technical standards,materials testing and evaluation, advanced manufacturing,development in metallic processes, synthesis of nanomaterials, composite cryotank processing, environmentally friendly cleaning, and poster sessions.

  9. The aerospace technology laboratory (a perspective, then and now)

    Science.gov (United States)

    Connors, J. F.; Hoffman, R. G.

    1982-01-01

    The physical changes that have taken place in aerospace facilities since the Wright brothers' accomplishment 78 years ago are highlighted. For illustrative purposes some of the technical facilities and operations of the NASA Lewis Research Center are described. These simulation facilities were designed to support research and technology studies in aerospace propulsion.

  10. Development and application of high-end aerospace MEMS

    Science.gov (United States)

    Yuan, Weizheng

    2017-12-01

    This paper introduces the design and manufacturing technology of aerospace microelectromechanical systems (MEMS) characterized by high performance, multi-variety, and small batch. Moreover, several kinds of special MEMS devices with high precision, high reliability, and environmental adaptability, as well as their typical applications in the fields of aeronautics and aerospace, are presented.

  11. 76 FR 23339 - Aerospace Safety Advisory Panel; Meeting

    Science.gov (United States)

    2011-04-26

    ... From the Federal Register Online via the Government Publishing Office NATIONAL AERONAUTICS AND SPACE ADMINISTRATION Aerospace Safety Advisory Panel; Meeting AGENCY: National Aeronautics and Space... Aerospace Safety Advisory Panel (ASAP) to take place on April 29, 2011, at the Kennedy Space Center, FL. Due...

  12. A novel C₂₅ sterol peroxide from the endophytic fungus Phoma sp. EA-122.

    Science.gov (United States)

    Chen, Zi-Ming; Fan, Qiong-Ying; Chen, He-Ping; Li, Zheng-Hui; Feng, Tao; Liu, Ji-Kai

    2015-01-01

    A novel C₂₅ sterol peroxide, phomasterol A (1), together with two known compounds (2-3), was isolated from the endophytic fungus Phoma sp. EA-122. The structure of phomasterol A (1) was elucidated by MS, 1D, and 2D NMR data analyses. Phomasterol A (1) was evaluated for its inhibitory activities against protein-tyrosine phosphatases MEG2 and PTP1Bc, showing moderate activities with identical IC₅₀ values of 25 μM.

  13. D2.1 - An EA Active, Problem Based Learning Methodology - EAtrain2

    DEFF Research Database (Denmark)

    Ryberg, Thomas; Georgsen, Marianne; Buus, Lillian

    This deliverable reports on the work undertaken in work package 2 with the key objective to develop a learning methodology for web 2.0 mediated Enterprise Architecture (EA) learning building on a problem based learning (PBL) approach. The deliverable reports not only on the methodology but also o...... on the activities leading to its development (literature review, workshops, etc.) and on further outcomes of this work relevant to the platform specification and pilot courses preparation....

  14. Bibliographic guide to publications in aerospace medicine and related topics.

    Science.gov (United States)

    Antuñano, M J

    1993-04-01

    This bibliographic guide is a comprehensive listing of international publications (books) in Clinical Aerospace Medicine, Operational Aerospace Medicine, Aerospace Physiology, Environmental Medicine/Physiology, Diving Medicine/Physiology, Aerospace Human Factors, as well as other important topics directly or indirectly-related to aerospace medicine. This guide will be useful as a primary source of consultation for bibliographic information; especially to those colleagues who are in their formative years, and to those who do not have easy access to computer-aided literature search systems. This bibliographic guide does not constitute a recommendation or an endorsement of any of the publications listed herein and the merits or limitations of each publication should be judged by the reader.

  15. Skill gap analysis and training needs in Indian aerospace industry

    Directory of Open Access Journals (Sweden)

    Premkumar Balaraman

    2016-12-01

    Full Text Available Purpose: The main objective of the paper is on assessing the global aerospace industry as well as Indian scenario, and attempts to assess the skill gaps and training needs of Indian aerospace industry.  Design/methodology/approach: The study is qualitative in nature, and employs wide array of qualitative tools which includes desktop study, focus group interviews and secondary sources of information. Around 10 focus groups were used in the study, with each focus group having a minimum of 6 members of experts in the aerospace and allied industries. The study evolved into a 2 staged one, with the first study elucidating the growing importance and potential of aerospace industry, justifying the significance to take forward the second part of the study. And the second study specifically focuses on skill gaps and training needs. Findings and Originality/value: The Study yields varied results on existing generic expectations of aerospace industry, specific needs of aerospace industry, identification of aerospace job categories unique to aerospace industry, key issues of training in Indian scenario and recommendations. The paper in summary reflects the current scenario of aerospace industry potentials for India and its likely impact on skills gap and training needs. Practical implications: Skills gap is a significant gap between an organization’s current capabilities and the skills it needs to achieve its goals. As a number of Global forecasts project, India as an emerging aviation market, the skill gaps in this sector is predicted to be huge and necessitates the study on assessing the skill gaps and its allied training needs. Originality/value: The Study is highly original and first one of its kind in reflecting the current situation of the skills gap and training needs in Indian Aerospace industry. The focus group interviews were conducted with the experts at various levels in the industyr without any bias yielding valid and realtime data for the

  16. 12th International School of Mathematics "G Stampacchia" : Applied Mathematics in the Aerospace Field "Ettore Majorana"

    CERN Document Server

    Salvetti, Attilio; Applied Mathematics in Aerospace Science and Engineering

    1994-01-01

    This book contains the proceedings ofthe meeting on "Applied Mathematics in the Aerospace Field," held in Erice, Sicily, Italy from September 3 to September 10, 1991. The occasion of the meeting was the 12th Course of the School of Mathematics "Guido Stampacchia," directed by Professor Franco Giannessi of the University of Pisa. The school is affiliated with the International Center for Scientific Culture "Ettore Majorana," which is directed by Professor Antonino Zichichi of the University of Bologna. The objective of the course was to give a perspective on the state-of­ the-art and research trends concerning the application of mathematics to aerospace science and engineering. The course was structured with invited lectures and seminars concerning fundamental aspects of differential equa­ tions, mathematical programming, optimal control, numerical methods, per­ turbation methods, and variational methods occurring in flight mechanics, astrodynamics, guidance, control, aircraft design, fluid mechanic...

  17. NASA/DOD Aerospace Knowledge Diffusion Research Project. Paper 19: Computer and information technology and aerospace knowledge diffusion

    Science.gov (United States)

    Pinelli, Thomas E.; Kennedy, John M.; Barclay, Rebecca O.; Bishop, Ann P.

    1992-01-01

    To remain a world leader in aerospace, the US must improve and maintain the professional competency of its engineers and scientists, increase the research and development (R&D) knowledge base, improve productivity, and maximize the integration of recent technological developments into the R&D process. How well these objectives are met, and at what cost, depends on a variety of factors, but largely on the ability of US aerospace engineers and scientists to acquire and process the results of federally funded R&D. The Federal Government's commitment to high speed computing and networking systems presupposes that computer and information technology will play a major role in the aerospace knowledge diffusion process. However, we know little about information technology needs, uses, and problems within the aerospace knowledge diffusion process. The use of computer and information technology by US aerospace engineers and scientists in academia, government, and industry is reported.

  18. Scoping Aerospace: Tracking Federal Procurement and R&D Spending in the Aerospace Sector

    Science.gov (United States)

    2005-01-01

    after the Cold War—these expenditures were cut in half during the period studied. Overall, external military spending (for air systems, missile systems...percentage of total military spending . During the period studied, aero- space expenditures represented 30 percent of all military acquisition spending. An...to the pur- chase of new airframes. Nonetheless, these data reveal a clear downward trend in the share of military spending being directed to aerospace

  19. Stepper motor instabilities in an aerospace application

    Science.gov (United States)

    Kackley, Russell; Mccully, Sean

    1992-01-01

    Stepper motors are frequently used in positioning mechanisms because they have several advantages over ordinary DC motors. However, there is frequently no feedback loop and the motor may exhibit instabilities under some conditions. A stepper motor in an aerospace positioning mechanism was investigated. During testing, the motor exhibited unstable behavior, such as backrunning and forward running. The instability was dependent on voltage pulse characteristics, temperature, positioning angle, step rate, and interaction between the two motors in the system. Both testing and analysis results verified the instability. A special purpose FORTRAN code was written to simulate the system. This code was combined with another simpler code to show the performance of the system in the phase plane so that instability boundaries could be displayed along with the motor performance. The analysis was performed to verify that proposed modifications would produce stable performance before implementation in the hardware. Subsequent testing verified the analytic stability predictions.

  20. Hypersonic characteristics of an advanced aerospace plane

    Science.gov (United States)

    Mccandless, R. S.; Cruz, C. I.

    1985-01-01

    A series of hypersonic wind-tunnel tests have been conducted in the NASA Langley Hypersonic Facilities Complex to obtain the static longitudinal and lateral-directional aerodynamic characteristics of an advanced aerospace plane. Data were obtained at 0 to 20 deg angles of attack and -3 to 3 deg angles of sideslip at Mach numbers of 6 and 10 in air and 20 in helium. Results show that stable trim capability exists at angles of attack near maximum lift-drag ratio (L/D). Both performance and stability exhibited some Mach number dependency. The vehicle was longitudinally unstable at low angles of attack but stable at angles of attack near and above maximum L/D. It was directionally unstable with positive dihedral effect. The rudder showed an inability to provide lateral-directional control, and removing the vertical tail resulted in increased directional instability. Analytical predictions of the static longitudinal aerodynamic coefficients gave relatively good comparisons with the experimental data.

  1. Novel Pressure Sensor for Aerospace Purposes

    Directory of Open Access Journals (Sweden)

    T. BEUTEL

    2010-04-01

    Full Text Available In this work, a novel silicon-based sensor for pressure and flow measurements is presented. To meet the special requirements of the aerospace industry a new piezoresistive pressure sensor with a flat surface has been developed, so that the flow is not affected by the sensor. To avoid bonding-wires on top of the sensor a special through-wafer connection is presented. By making other significant changes in the layout as well as in the micro fabrication process, a novel sensor has been created. It is robust enough to be laminated in fibre material, which opens new possibilities for measurements. With this sensor it is possible to characterize the condition of the flow near the separation point. This article describes the complete process from the development to the laminated sensor.

  2. Predicting Production Costs for Advanced Aerospace Vehicles

    Science.gov (United States)

    Bao, Han P.; Samareh, J. A.; Weston, R. P.

    2002-01-01

    For early design concepts, the conventional approach to cost is normally some kind of parametric weight-based cost model. There is now ample evidence that this approach can be misleading and inaccurate. By the nature of its development, a parametric cost model requires historical data and is valid only if the new design is analogous to those for which the model was derived. Advanced aerospace vehicles have no historical production data and are nowhere near the vehicles of the past. Using an existing weight-based cost model would only lead to errors and distortions of the true production cost. This paper outlines the development of a process-based cost model in which the physical elements of the vehicle are soared according to a first-order dynamics model. This theoretical cost model, first advocated by early work at MIT, has been expanded to cover the basic structures of an advanced aerospace vehicle. Elemental costs based on the geometry of the design can be summed up to provide an overall estimation of the total production cost for a design configuration. This capability to directly link any design configuration to realistic cost estimation is a key requirement for high payoff MDO problems. Another important consideration in this paper is the handling of part or product complexity. Here the concept of cost modulus is introduced to take into account variability due to different materials, sizes, shapes, precision of fabrication, and equipment requirements. The most important implication of the development of the proposed process-based cost model is that different design configurations can now be quickly related to their cost estimates in a seamless calculation process easily implemented on any spreadsheet tool.

  3. ACC/AHA guidelines superior to ESC/EAS guidelines for primary prevention with statins in non-diabetic Europeans

    DEFF Research Database (Denmark)

    Mortensen, Martin Bødtker; Nordestgaard, Børge G; Afzal, Shoaib

    2017-01-01

    Aim: We compared the 2013 American College of Cardiology/American Heart Association (ACC/AHA) and the 2016 European Society of Cardiology/European Atherosclerosis Society (ESC/EAS) guidelines on prevention of atherosclerotic cardiovascular disease (ASCVD) using different risk prediction models [US......-SCORE, was well-calibrated around decision thresholds for statin therapy. For a Class I recommendation, 42% of individuals qualified for statins using the ACC/AHA guidelines vs. 6% with the ESC/EAS guidelines. Using ACC/AHA- vs. ESC/EAS-defined statin eligibility led to a substantial gain in sensitivity (+62......% for any ASCVD and +76% for fatal ASCVD) with a smaller loss in specificity (-35% for any ASCVD and -36% for fatal ASCVD). Similar differences between the ACC/AHA and ESC/EAS guidelines were found for men and women separately, and for Class IIa recommendations. The sensitivity and specificity of a US...

  4. Service-Oriented Enterprise Architecture (SoEA) Adoption and Maturity Measurement Model: A Systematic Literature Review

    OpenAIRE

    Nur Azaliah Abu Bakar; Harihodin Selamat; Mohd Nazri Kama

    2013-01-01

    This article provides a systematic review of existing research related to the Service-oriented Enterprise Architecture (SoEA) adoption and maturity measurement model. The review’s main goals are to support research; to facilitate other researchers’ search for relevant studies; and to propose areas for future studies within this area. In addition, this article provides useful information on SoEA adoption issues and its related maturity model, based on research-based knowledge. The review resul...

  5. 85 km Long Reach PON System Using a Reflective SOA-EA Modulator and Distributed Raman Fiber Amplification

    DEFF Research Database (Denmark)

    Tafur Monroy, Idelfonso; Öhman, Filip; Yvind, Kresten

    2006-01-01

    We report on a bidirectional 85 km long reach PON system supported by distributed fiber Raman amplification with a record 7.5 Gb/s remote carrier modulated upstream signal by employing a reflective SOA-EA monolithically integrated circuit......We report on a bidirectional 85 km long reach PON system supported by distributed fiber Raman amplification with a record 7.5 Gb/s remote carrier modulated upstream signal by employing a reflective SOA-EA monolithically integrated circuit...

  6. NASA/DOD Aerospace Knowledge Diffusion Research Project. Paper 12: The diffusion of federally funded aerospace research and development (R/D) and the information seeking behavior of US aerospace engineers and scientists

    Science.gov (United States)

    Pinelli, Thomas E.; Kennedy, John M.; Barclay, Rebecca O.

    1991-01-01

    In this paper, the diffusion of federally funded aerospace R&D is explored from the perspective of the information-seeking behavior of U.S. aerospace engineers and scientists. The following three assumptions frame this exploration: (1) knowledge production, transfer, and utilization are equally important components of the aerospace R&D process; (2) the diffusion of knowledge resulting from federally funded aerospace R&D is indispensable for the U.S. to remain a world leader in aerospace; and (3) U.S. government technical reports, produced by NASA and DOD, play an important, but as yet undefined, role in the diffusion of federally funded aerospace R&D. A conceptual model for federally funded aerospace knowledge diffusion, one that emphasizes U.S. goverment technical reports, is presented. Data regarding three research questions concerning the information-seeking behavior of U.S. aerospace engineers and scientists are also presented.

  7. 75 FR 59170 - Airworthiness Directives; British Aerospace Regional Aircraft Models Jetstream Series 3101 and...

    Science.gov (United States)

    2010-09-27

    ... British Aerospace Jetstream Series 3100 & 3200 Service Bulletin 05-JA090143, dated April 30, 2009; and British Aerospace Regional Aircraft has issued British Aerospace Jetstream Series 3100 & 3200 Service... Aerospace Jetstream Series 3100 & 3200 Service Bulletin 05-JA090143, dated April 30, 2009. (2) Replace the...

  8. The 1994 Fiber Optic Sensors for Aerospace Technology (FOSAT) Workshop

    Science.gov (United States)

    Baumbick, Robert (Compiler); Adamovsky, Grigory (Compiler); Tuma, Meg (Compiler); Beheim, Glenn (Compiler); Sotomayor, Jorge (Compiler)

    1995-01-01

    The NASA Lewis Research Center conducted a workshop on fiber optic technology on October 18-20, 1994. The workshop objective was to discuss the future direction of fiber optics and optical sensor research, especially in the aerospace arena. The workshop was separated into four sections: (1) a Systems Section which dealt specifically with top level overall architectures for the aircraft and engine; (2) a Subsystems Section considered the parts and pieces that made up the subsystems of the overall systems; (3) a Sensor/Actuators section considered the status of research on passive optical sensors and optical powered actuators; and (4) Components Section which addressed the interconnects for the optical systems (e.g., optical connectors, optical fibers, etc.). This report contains the minutes of the discussion on the workshop, both in each section and in the plenary sessions. The slides used by a limited number of presenters are also included as presented. No attempt was made to homogenize this report. The view of most of the attendees was: (1) the government must do a better job of disseminating technical information in a more timely fashion; (2) enough work has been done on the components, and system level architecture definition must dictate what work should be done on components; (3) a Photonics Steering Committee should be formed to coordinate the efforts of government and industry in the photonics area, to make sure that programs complimented each other and that technology transferred from one program was used in other programs to the best advantage of the government and industry.

  9. Simulations and Experiments on Vibration Control of Aerospace Thin-Walled Parts via Preload

    Directory of Open Access Journals (Sweden)

    Qiong Wu

    2017-01-01

    Full Text Available Thin-walled parts primarily comprise the entire piece of rough machining, and the material removal rate can surpass 95%. Numerous components with thin-walled structures are preferred in the aerospace industry for their light weight, high strength, and other advantages. In aerospace thin-walled workpiece machining processes and practical applications, they are excited by the vibration. The preload changing the modal stiffness of the part is found and this change causes continuous changes in the natural frequency. Researching on the influence of pretightening force on dynamic characteristics of thin-walled components is highly significant for controlling vibration. In this study, the typical aviation thin-walled part is the research object. Finite element numerical simulation and experimental verification are employed to analyze the dynamic characteristics of 7075 aluminum alloy thin-walled plates under different preloads for exploring the relationship between natural frequency and preload. The relationship is validated by comparative results. Both the simulation and experimental results show that the natural frequencies of plates increase following the augmentation of the preload. Thus, this research introduces the method where vibration of aerospace thin-walled parts is reduced by preload. For practical engineering application, a program showing the relationship between natural frequency and preload is written using Visual Basic language.

  10. MMAS Versus Population-Based EA on a Family of Dynamic Fitness Functions

    DEFF Research Database (Denmark)

    Lissovoi, Andrei; Witt, Carsten

    2015-01-01

    We study the behavior of a population-based EA and the Max–Min Ant System (MMAS) on a family of deterministically-changing fitness functions, where, in order to find the global optimum, the algorithms have to find specific local optima within each of a series of phases. In particular, we prove...... function extended over a finite alphabet of μ symbols, whereas population size μ−1 is not sufficient. Furthermore, we show that MMAS does not require additional modifications to track the optimum of the finite-alphabet Maze functions, and, using a novel drift statement to simplify the analysis, reduce...

  11. MMAS vs. Population-based EA on a family of dynamic fitness functions

    DEFF Research Database (Denmark)

    Lissovoi, Andrei; Witt, Carsten

    2014-01-01

    We study the behavior of a population-based EA and the Max-Min Ant System (MMAS) on a family of deterministically-changing fitness functions, where, in order to find the global optimum, the algorithms have to find specific local optima within each of a series of phases. In particular, we prove...... a Maze function extended over a finite alphabet of μ symbols, whereas population size μ-1 is not sufficient. Furthermore, we show that MMAS does not require additional modifications to track the optimum of the finite-alphabet Maze functions, and, using a novel drift statement to simplify the analysis...

  12. Exotic geophysical phenomena observed in an environmental neutron flux study using EAS PRISMA detectors

    Directory of Open Access Journals (Sweden)

    Alekseenko Victor

    2017-01-01

    Full Text Available Some exotic geophysical events are observed by a global net of electron-neutron detectors (en-detectors developed in the framework of the PRISMA EAS project. Our en-detectors running both on the Earth's surface and underground are continuously measuring the environmental thermal neutron flux. Thermal neutrons are in equilibrium with media and are therefore sensitive to many geophysical phenomena, which are exotic for people studying ultra high-energy cosmic rays or carrying out low background experiments deep underground.

  13. Engineering derivatives from biological systems for advanced aerospace applications

    Science.gov (United States)

    Winfield, Daniel L.; Hering, Dean H.; Cole, David

    1991-01-01

    The present study consisted of a literature survey, a survey of researchers, and a workshop on bionics. These tasks produced an extensive annotated bibliography of bionics research (282 citations), a directory of bionics researchers, and a workshop report on specific bionics research topics applicable to space technology. These deliverables are included as Appendix A, Appendix B, and Section 5.0, respectively. To provide organization to this highly interdisciplinary field and to serve as a guide for interested researchers, we have also prepared a taxonomy or classification of the various subelements of natural engineering systems. Finally, we have synthesized the results of the various components of this study into a discussion of the most promising opportunities for accelerated research, seeking solutions which apply engineering principles from natural systems to advanced aerospace problems. A discussion of opportunities within the areas of materials, structures, sensors, information processing, robotics, autonomous systems, life support systems, and aeronautics is given. Following the conclusions are six discipline summaries that highlight the potential benefits of research in these areas for NASA's space technology programs.

  14. A Methodology for Engineering Competencies Definition in the Aerospace Industry

    Directory of Open Access Journals (Sweden)

    Laura Fortunato

    2011-10-01

    Full Text Available The need to cut off lead times, to increase the products innovation, to respond to changing customer requirements and to integrate new technologies into business process pushes companies to increase the collaboration. In particular, collaboration, knowledge sharing and information exchange in the Aerospace Value Network, need to a clear definition and identification of competencies of several actors. Main contractors, stakeholders, customers, suppliers, partners, have different expertise and backgrounds and in this collaborative working environment are called to work together in projects, programs and process. To improve collaboration and support the knowledge sharing, a competencies definition methodology and the related dictionary result useful tools among actors within an extended supply chain. They can use the same terminology and be informed on the competencies available. It becomes easy to specify who knows to do required activities stimulating collaboration and improving communication. Based on an action research developed in the context of the iDesign Foundation project, the paper outlines a competency definition methodology and it presents examples from the implementation in Alenia Aeronautica company. A new definition of competency is suggested supporting by a new method to specify the structural relationship between competencies and activities of aeronautical processes.

  15. Loft: An Automated Mesh Generator for Stiffened Shell Aerospace Vehicles

    Science.gov (United States)

    Eldred, Lloyd B.

    2011-01-01

    Loft is an automated mesh generation code that is designed for aerospace vehicle structures. From user input, Loft generates meshes for wings, noses, tanks, fuselage sections, thrust structures, and so on. As a mesh is generated, each element is assigned properties to mark the part of the vehicle with which it is associated. This property assignment is an extremely powerful feature that enables detailed analysis tasks, such as load application and structural sizing. This report is presented in two parts. The first part is an overview of the code and its applications. The modeling approach that was used to create the finite element meshes is described. Several applications of the code are demonstrated, including a Next Generation Launch Technology (NGLT) wing-sizing study, a lunar lander stage study, a launch vehicle shroud shape study, and a two-stage-to-orbit (TSTO) orbiter. Part two of the report is the program user manual. The manual includes in-depth tutorials and a complete command reference.

  16. NASA/DOD Aerospace Knowledge Diffusion Research Project. Paper 47: The value of computer networks in aerospace

    Science.gov (United States)

    Bishop, Ann Peterson; Pinelli, Thomas E.

    1995-01-01

    This paper presents data on the value of computer networks that were obtained from a national survey of 2000 aerospace engineers that was conducted in 1993. Survey respondents reported the extent to which they used computer networks in their work and communication and offered their assessments of the value of various network types and applications. They also provided information about the positive impacts of networks on their work, which presents another perspective on value. Finally, aerospace engineers' recommendations on network implementation present suggestions for increasing the value of computer networks within aerospace organizations.

  17. Spectroscopic Measurement Techniques for Aerospace Flows

    Science.gov (United States)

    Danehy, Paul M.; Bathel, Brett F.; Johansen, Craig T.; Cutler, Andrew D.; Hurley, Samantha

    2014-01-01

    The conditions that characterize aerospace flows are so varied, that a single diagnostic technique is not sufficient for its measurement. Fluid dynamists use knowledge of similarity to help categorize and focus on different flow conditions. For example, the Reynolds number represents the ratio of inertial to viscous forces in a flow. When the velocity scales, length scales, and gas density are large and the magnitude of the molecular viscosity is low, the Reynolds number becomes large. This corresponds to large scale vehicles (e.g Airbus A380), fast moving objects (e.g. artillery projectiles), vehicles in dense fluids (e.g. submarine in water), or flows with low dynamic viscosity (e.g. skydiver in air). In each of these cases, the inertial forces dominate viscous forces, and unsteady turbulent fluctuations in the flow variables are observed. In contrast, flows with small length scales (e.g. dispersion of micro-particles in a solid rocket nozzle), slow moving objects (e.g. micro aerial vehicles), flows with low density gases (e.g. atmospheric re-entry), or fluids with a large magnitude of viscosity (e.g. engine coolant flow), all have low Reynolds numbers. In these cases, viscous forces become very important and often the flows can be steady and laminar. The Mach number, which is the ratio of the velocity to the speed of sound in the medium, also helps to differentiate types of flows. At very low Mach numbers, acoustic waves travel much faster than the object, and the flow can be assumed to be incompressible (e.g. Cessna 172 aircraft). As the object speed approaches the speed of sound, the gas density can become variable (e.g. flow over wing of Learjet 85). When the object speed is higher than the speed of sound (Ma > 1), the presences of shock waves and other gas dynamic features can become important to the vehicle performance (e.g. SR-71 Blackbird). In the hypersonic flow regime (Ma > 5), large changes in temperature begin to affect flow properties, causing real

  18. Challenges for Insertion of Structural Nanomaterials in Aerospace Applications

    Science.gov (United States)

    Sochi, Emilie J.

    2012-01-01

    In the two decades since Iijima's report on carbon nanotubes (CNT), there has been great interest in realizing the benefits of mechanical properties observed at the nanoscale in large-scale structures. The weight savings possible due to dramatic improvements in mechanical properties relative to state-of-the-art material systems can be game changing for applications like aerospace vehicles. While there has been significant progress in commercial production of CNTs, major aerospace applications that take advantage of properties offered by this material have yet to be realized. This paper provides a perspective on the technical challenges and barriers for insertion of CNTs as an emerging material technology in aerospace applications and proposes approaches that may reduce the typical timeframe for technology maturation and insertion into aerospace structures.

  19. Liquid crystalline thermosetting polymers as protective coatings for aerospace

    NARCIS (Netherlands)

    Guerriero, G.L.

    2012-01-01

    Environmental regulations are driving the development of new aerospace coating systems, mainly to eliminate chromates and reduce volatile organic compound (VOC) emissions. Among the various potential options for new coating materials, liquid crystalline polymers (LCPs) are attractive due to their

  20. High Spatial Resolution shape Sensing for Adaptive Aerospace Vehicles Project

    Data.gov (United States)

    National Aeronautics and Space Administration — It is accepted that adaptive aerospace vehicles whose flight avionic systems are reconfigurable are needed to respond to changing flight parameters, vehicle system...

  1. Global Optimization using Interval Analysis : Interval Optimization for Aerospace Applications

    NARCIS (Netherlands)

    Van Kampen, E.

    2010-01-01

    Optimization is an important element in aerospace related research. It is encountered for example in trajectory optimization problems, such as: satellite formation flying, spacecraft re-entry optimization and airport approach and departure optimization; in control optimization, for example in

  2. Applications of aerospace technology to petroleum extraction and reservoir engineering

    Science.gov (United States)

    Jaffe, L. D.; Back, L. H.; Berdahl, C. M.; Collins, E. E., Jr.; Gordon, P. G.; Houseman, J.; Humphrey, M. F.; Hsu, G. C.; Ham, J. D.; Marte, J. E.; hide

    1977-01-01

    Through contacts with the petroleum industry, the petroleum service industry, universities and government agencies, important petroleum extraction problems were identified. For each problem, areas of aerospace technology that might aid in its solution were also identified, where possible. Some of the problems were selected for further consideration. Work on these problems led to the formulation of specific concepts as candidate for development. Each concept is addressed to the solution of specific extraction problems and makes use of specific areas of aerospace technology.

  3. Maintenance applications of augmented reality for the Chinese aerospace industry

    OpenAIRE

    Ou, Peng

    2011-01-01

    Since augmented reality has not reached full maturity in use, it is not widely adopted within the aerospace industry. According to the literature review, minimal research efforts have been conducted to assess the cost-benefit or cost- effectiveness of augmented reality so far. Moreover, to the best of researcher’s knowledge, no research has been carried out to develop a systematic process for selecting and implementing augmented reality within the Chinese aerospace industry....

  4. The link between aerospace industry and NASA during the Apollo years

    Science.gov (United States)

    Turcat, Nicolas

    2008-01-01

    Made in the frame of a French master on political history of USA in Paris IV La Sorbonne University, this subject is the third part of " The Economy of Apollo during the 60s". Nicolas Turcat is actually preparing his PhD in History of Innovation (DEA—Paris IV La Sorbonne). Our actual subject is " the link between aerospace industry and NASA during the Apollo years". This speech will highlight on some aspects of the link between NASA and aerospace industry. NASA could achieve the Apollo mission safely and under heavy financial pressure during the sixties due to a new type of organization for a civil agency; the contractor system. In fact, Military used it since the 1950s. And we will see how the development of this type of contract permitted a better interaction between the two parts. NASA would make another type of link with universities and technical institutes; a real brain trust was created, and between 1961 and 1967, 10,000 students worked and more than 200 universities on Apollo program. We will try to study briefly the procurement plan and process during the Apollo years. Without entering the " spin-offs debate", we will try to watch different aspects of the impacts and realities of the contractor and subcontractor system. We will see that would create a political debate inside USA when presidents Johnson and Nixon would decide to reduce Apollo program. Which states will benefit Apollo program? Or questions like how the debate at the end of the 1960s will become more and more political? Actually, almost 60% of the country's R&D was focused on Apollo, economical and moreover, political impacts would be great. We will try to study this under the light of different example: and particularly in California. The industrial and military complex was a part of the Apollo program. Apollo reoriented the aim of this complex for making it the first aerospace industry. Since this time, USA had not only acquired space ambition but real space capabilities. But more than

  5. Differentiation of partial acylglycerols derived from different animal fats by EA-IRMS and GCMS techniques

    Energy Technology Data Exchange (ETDEWEB)

    Nina Naquiah, A.N.; Marikkar, J.M.N.; Shuhaimi, M.

    2016-07-01

    A study was carried out to compare partial acylglycerols of lard with those of chicken fat, beef fat and mutton fat using Gas Chromatography Mass Spectrometry (GC-MS) and Elemental Analysis–Isotope Ratio Mass Spectrometry (EA-IRMS). Mono- (MAG) and di-(DAG) acylglycerols of animal fats were prepared according to a chemical glycerolysis method and isolated using column chromatography. The fatty acid composition and δ13C carbon isotope ratio of MAG and DAG derived from individual animal fat were determined separately to establish their identity characteristics. The results showed that the δ13C values of MAG and DAG of lard were significantly different from those of MAG and DAG derived from chicken fat, beef fat and mutton fat. According to the loading plots based on a principle component analysis (PCA), fatty acids namely stearic, oleic and linoleic were the most discriminating parameters to distinctly identify MAG and DAG derived from different animal fats. This demonstrated that the EA-IRMS and the PCA of fatty acid data have considerable potential for discriminating MAG and DAG derived from lard from other animal fats for Halal authentication purposes. (Author)

  6. Potential energy curves of Li+2 from all-electron EA-EOM-CCSD calculations

    Science.gov (United States)

    Musiał, Monika; Medrek, Magdalena; Kucharski, Stanisław A.

    2015-10-01

    The electron attachment (EA) equation-of-motion coupled-cluster theory provides description of the states obtained by the attachment of an electron to the reference system. If the reference is assumed to be a doubly ionised cation, then the EA results relate to the singly ionised ion. In the current work, the above scheme is applied to the calculations of the potential energy curves (PECs) of the Li+2 cation adopting the doubly ionised Li2 +2 structure as the reference system. The advantage of such computational strategy relies on the fact that the closed-shell Li2 +2 reference dissociates into closed-shell fragments (Li2 +2 ⇒ Li+ + Li+), hence the RHF (restricted Hartree-Fock) function can be used as the reference in the whole range of interatomic distances. This scheme offers the first principle method without any model or effective potential parameters for the description of the bond-breaking processes. In this study, the PECs and selected spectroscopic constants for 18 electronic states of the Li+2 ion were computed and compared with experimental and other theoretical results. †In honour of Professor Sourav Pal on the occasion of an anniversary in his private and scientific life.

  7. NASA/DOD Aerospace Knowledge Diffusion Research Project. Paper 26: The relationship between technology policy and scientific and technical information within the US and Japanese aerospace industries

    Science.gov (United States)

    Pinelli, Thomas E.; Barclay, Rebecca O.; Kennedy, John M.

    1993-01-01

    Government technology policy has nurtured the growth of the aerospace industry which is vital to both the U.S. and Japanese economies. Japanese technology policy differs significantly from U.S. technology policy, however, particularly with respect to the production, transfer, and use of scientific and technical information (STI). In this paper, we discuss the unique position of the aerospace industry in the U.S. and Japan, U.S. and Japanese aerospace policy, and the role of STI in the process of aerospace innovation. The information-seeking behaviors of U.S. and Japanese aerospace engineers and scientists are compared. The authors advocate the development of innovation-adoption technology and STI policy goals for U.S. aerospace and the inclusion of an aerospace knowledge diffusion transfer system with an 'active' component for scanning and acquiring foreign aerospace technology and STI.

  8. Robust and Adaptive Control With Aerospace Applications

    CERN Document Server

    Lavretsky, Eugene

    2013-01-01

    Robust and Adaptive Control shows the reader how to produce consistent and accurate controllers that operate in the presence of uncertainties and unforeseen events. Driven by aerospace applications the focus of the book is primarily on continuous-dynamical systems.  The text is a three-part treatment, beginning with robust and optimal linear control methods and moving on to a self-contained presentation of the design and analysis of model reference adaptive control (MRAC) for nonlinear uncertain dynamical systems. Recent extensions and modifications to MRAC design are included, as are guidelines for combining robust optimal and MRAC controllers. Features of the text include: ·         case studies that demonstrate the benefits of robust and adaptive control for piloted, autonomous and experimental aerial platforms; ·         detailed background material for each chapter to motivate theoretical developments; ·         realistic examples and simulation data illustrating key features ...

  9. Information processing for aerospace structural health monitoring

    Science.gov (United States)

    Lichtenwalner, Peter F.; White, Edward V.; Baumann, Erwin W.

    1998-06-01

    Structural health monitoring (SHM) technology provides a means to significantly reduce life cycle of aerospace vehicles by eliminating unnecessary inspections, minimizing inspection complexity, and providing accurate diagnostics and prognostics to support vehicle life extension. In order to accomplish this, a comprehensive SHM system will need to acquire data from a wide variety of diverse sensors including strain gages, accelerometers, acoustic emission sensors, crack growth gages, corrosion sensors, and piezoelectric transducers. Significant amounts of computer processing will then be required to convert this raw sensor data into meaningful information which indicates both the diagnostics of the current structural integrity as well as the prognostics necessary for planning and managing the future health of the structure in a cost effective manner. This paper provides a description of the key types of information processing technologies required in an effective SHM system. These include artificial intelligence techniques such as neural networks, expert systems, and fuzzy logic for nonlinear modeling, pattern recognition, and complex decision making; signal processing techniques such as Fourier and wavelet transforms for spectral analysis and feature extraction; statistical algorithms for optimal detection, estimation, prediction, and fusion; and a wide variety of other algorithms for data analysis and visualization. The intent of this paper is to provide an overview of the role of information processing for SHM, discuss various technologies which can contribute to accomplishing this role, and present some example applications of information processing for SHM implemented at the Boeing Company.

  10. Multifunctional Carbon Foams for Aerospace Applications

    Science.gov (United States)

    Rogers, D. K.; Plucinski, J.

    2001-01-01

    Carbon foams produced by the controlled thermal decomposition of inexpensive coal extracts exhibit a combination of structural and thermal properties that make them attractive for aerospace applications. Their thermal conductivity can be tailored between 0.5 and 100 W/mK through precursor selection/modification and heat treatment conditions; thus, they can serve in either thermal protection or heat transfer systems such as heat exchangers. Because their structure is essentially a 3D random network of graphite-like members, they also can be considered low-cost, easily fabricated replacements for multi-directional structural carbon fiber preforms. Strengths of over 4000 psi in compression are common. Their density can be designed between 0.1 and 0.8 g/cc, and they can be impregnated with a variety of matrices or used, unfilled, in sandwich structures. These foams also exhibit intriguing electrochemical properties that offer potential in high-efficiency fuel cell and battery applications, mandrels and tooling for composite manufacture, ablative performance, and fire resistance. This paper presents the results of research conducted under NASA SBIR Topic 99.04.01, General Aviation Technology, supported from Langley Research Center. The potential of foam design through precursor selection, cell size and density control, density grading, and heat treatment is demonstrated.

  11. Aerospace Applications of Non-Equilibrium Plasma

    Science.gov (United States)

    Blankson, Isaiah M.

    2016-01-01

    Nonequilibrium plasma/non-thermal plasma/cold plasmas are being used in a wide range of new applications in aeronautics, active flow control, heat transfer reduction, plasma-assisted ignition and combustion, noise suppression, and power generation. Industrial applications may be found in pollution control, materials surface treatment, and water purification. In order for these plasma processes to become practical, efficient means of ionization are necessary. A primary challenge for these applications is to create a desired non-equilibrium plasma in air by preventing the discharge from transitioning into an arc. Of particular interest is the impact on simulations and experimental data with and without detailed consideration of non-equilibrium effects, and the consequences of neglecting non-equilibrium. This presentation will provide an assessment of the presence and influence of non-equilibrium phenomena for various aerospace needs and applications. Specific examples to be considered will include the forward energy deposition of laser-induced non-equilibrium plasmoids for sonic boom mitigation, weakly ionized flows obtained from pulsed nanosecond discharges for an annular Hall type MHD generator duct for turbojet energy bypass, and fundamental mechanisms affecting the design and operation of novel plasma-assisted reactive systems in dielectric liquids (water purification, in-pipe modification of fuels, etc.).

  12. Impact source localisation in aerospace composite structures

    Science.gov (United States)

    De Simone, Mario Emanuele; Ciampa, Francesco; Boccardi, Salvatore; Meo, Michele

    2017-12-01

    The most commonly encountered type of damage in aircraft composite structures is caused by low-velocity impacts due to foreign objects such as hail stones, tool drops and bird strikes. Often these events can cause severe internal material damage that is difficult to detect and may lead to a significant reduction of the structure’s strength and fatigue life. For this reason there is an urgent need to develop structural health monitoring systems able to localise low-velocity impacts in both metallic and composite components as they occur. This article proposes a novel monitoring system for impact localisation in aluminium and composite structures, which is able to determine the impact location in real-time without a-priori knowledge of the mechanical properties of the material. This method relies on an optimal configuration of receiving sensors, which allows linearization of well-known nonlinear systems of equations for the estimation of the impact location. The proposed algorithm is based on the time of arrival identification of the elastic waves generated by the impact source using the Akaike Information Criterion. The proposed approach was demonstrated successfully on both isotropic and orthotropic materials by using a network of closely spaced surface-bonded piezoelectric transducers. The results obtained show the validity of the proposed algorithm, since the impact sources were detected with a high level of accuracy. The proposed impact detection system overcomes current limitations of other methods and can be retrofitted easily on existing aerospace structures allowing timely detection of an impact event.

  13. Nanocomposites as Advanced Materials for Aerospace Industry

    Directory of Open Access Journals (Sweden)

    George PELIN

    2012-12-01

    Full Text Available Polymer nanocomposites, consisting of nanoparticles dispersed in polymer matrix, have gained interest due to the attractive properties of nanostructured fillers, as carbon nanotubes and layered silicates. Low volume additions (1- 5% of nanoparticles provide properties enhancements comparable to those achieved by conventional loadings (15- 40% of traditional fillers.Structural nanocomposites represent reinforcement structures based on carbon or glass fibers embedded into polymeric matrix modified with nanofillers.Structural composites are the most important application of nanaocomposites, in aerospace field, as, laminates and sandwich structures. Also, they can by used as anti-lightning, anti-radar protectors and paints. The paper presents the effects of sonic dispersion of carbon nanotubes and montmorrilonite on the mechanical, electrical, rheological and trybological properties of epoxy polymers and laminated composites, with carbon or glass fiber reinforcement, with nanoadditivated epoxy matrix. One significant observation is that nanoclay contents higher than 2% wt generate an increase of the resin viscosity, from 1500 to 50000- 100000 cP, making the matrix impossible to use in high performance composites.Also, carbon nanotubes provide the resin important electrical properties, passing from dielectric to semi- conductive class. These effects have also been observed for fiber reinforced composites.Contrarily to some opinions in literature, the results of carbon nanotubes or nanoclays addition on the mechanical characteristics of glass or carbon fiber composites seem to be rather low.

  14. Membrane topology and identification of key residues of EaDAcT, a plant MBOAT with unusual substrate specificity.

    Science.gov (United States)

    Tran, Tam N T; Shelton, Jennifer; Brown, Susan; Durrett, Timothy P

    2017-10-01

    Euonymus alatus diacylglycerol acetyltransferase (EaDAcT) catalyzes the transfer of an acetyl group from acetyl-CoA to the sn-3 position of diacylglycerol to form 3-acetyl-1,2-diacyl-sn-glycerol (acetyl-TAG). EaDAcT belongs to a small, plant-specific subfamily of the membrane bound O-acyltransferases (MBOAT) that acylate different lipid substrates. Sucrose gradient density centrifugation revealed that EaDAcT colocalizes to the same fractions as an endoplasmic reticulum (ER)-specific marker. By mapping the membrane topology of EaDAcT, we obtained an experimentally determined topology model for a plant MBOAT. The EaDAcT model contains four transmembrane domains (TMDs), with both the N- and C-termini orientated toward the lumen of the ER. In addition, there is a large cytoplasmic loop between the first and second TMDs, with the MBOAT signature region of the protein embedded in the third TMD close to the interface between the membrane and the cytoplasm. During topology mapping, we discovered two cysteine residues (C187 and C293) located on opposite sides of the membrane that are important for enzyme activity. In order to identify additional amino acid residues important for acetyltransferase activity, we isolated and characterized acetyltransferases from other acetyl-TAG-producing plants. Among them, the acetyltransferase from Euonymus fortunei possessed the highest activity in vivo and in vitro. Mutagenesis of conserved amino acids revealed that S253, H257, D258 and V263 are essential for EaDAcT activity. Alteration of residues unique to the acetyltransferases did not alter the unique acyl donor specificity of EaDAcT, suggesting that multiple amino acids are important for substrate recognition. © 2017 The Authors The Plant Journal © 2017 John Wiley & Sons Ltd.

  15. NASA/DoD Aerospace Knowledge Diffusion Research Project. Paper 30: The electronic transfer of information and aerospace knowledge diffusion

    Science.gov (United States)

    Pinelli, Thomas E.; Bishop, Ann P.; Barclay, Rebecca O.; Kennedy, John M.

    1992-01-01

    Increasing reliance on and investment in information technology and electronic networking systems presupposes that computing and information technology will play a major role in the diffusion of aerospace knowledge. Little is known, however, about actual information technology needs, uses, and problems within the aerospace knowledge diffusion process. The authors state that the potential contributions of information technology to increased productivity and competitiveness will be diminished unless empirically derived knowledge regarding the information-seeking behavior of the members of the social system - those who are producing, transferring, and using scientific and technical information - is incorporated into a new technology policy framework. Research into the use of information technology and electronic networks by U.S. aerospace engineers and scientists, collected as part of a research project designed to study aerospace knowledge diffusion, is presented in support of this assertion.

  16. Korea space program

    Science.gov (United States)

    Hong, Jai-Hak

    Though Korea's space activities are just in the infant stage, we are looking forward to joining the advanced countries in the space field. We have three on-going space programs: the KOREASAT Program, a sounding rocket program, and the KITSAT Program. And, we have three more programs that we are in the process of formulating: a small remote sensing satellite program, a data receiving station construction program, and the second generation KOREASAT program. We have several organizations which are involved with space-related activities: KARI, ETRI, SERI, and KAIST. KARI was founded in 1989 in accordance with the Aerospace Industry Development & Promotion Act for the purpose of conducting research on aicraft, satellites and scientific rockets, and supporting national aerospace development projects.

  17. NASA/DOD Aerospace Knowledge Diffusion Research Project. Paper 69: Writing for the Aerospace Industry. Chapter 3; The Practice of Technical and Scientific Communication: Writing in Professional Contexts

    Science.gov (United States)

    Barclay, Rebecca O.; Pinelli, Thomas E.

    1997-01-01

    The large and complex aerospace industry, which employed approximately 850,000 people in 1994 (Aerospace Facts, 1994-95, p. 11), plays a vital role in the nation's economy. Although only a small percentage of those employed in aerospace are technical communicators, they perform a wide variety of communication duties in government and the private sector.

  18. Space Benefits: The secondary application of aerospace technology in other sectors of the economy

    Science.gov (United States)

    1981-01-01

    Some 585 examples of the beneficial use of NASA aerospace technology by public and private organizations are described to demonstrate the effects of mission-oriented programs on technological progress in the United States. General observations regarding technology transfer activity are presented. Benefit cases are listed in 20 categories along with pertinent information such as communication link with NASA; the DRI transfer example file number; and individual case numbers associated with the technology and examples used; and the date of the latest contract with user organizations. Subject, organization, geographic, and field center indexes are included.

  19. NASA's experience in the international exchange of scientific and technical information in the aerospace field

    Science.gov (United States)

    Thibideau, Philip A.

    1990-01-01

    The early NASA international scientific and technical information exchange arrangements were usually detailed in correspondence with the librarians of the institutions involved. While this type of exchange grew to include some 200 organizations in 43 countries, NASA's main focus shifted to the relationship with the European Space Agency (ESA), which began in 1964. The NASA/ESA Tripartite Exchange Program provides more than 4000 technical reports from the NASA-produced Aerospace Database. The experience in the evolving cooperation between NASA and ESA has established the model for more recent exchange agreements with Israel, Australia, and Canada. The results of these agreements are made available to participating European organizations through the NASA File.

  20. AGARD (Advisory Group for Aerospace Research & Development) Index of Publications, 1980-1982.

    Science.gov (United States)

    1984-01-01

    DYNAMIC D. BRAUN and J. STOPPEL In AGARD Dyn. Environ. Qualification QUALIFICATION PROGRAM IN AEROSPACE Tech. 8 p (SEE N82-22154 13-01) Dec. 1981...h.p 01 t t N8t t 4’ STAK..ia IHi AGo" .. o ’.’a 0.t’ ~ i ARD AG. 2170(E) Ip 212 N82.27972 SWITHERBANK. A.mdl"’ fq 1 1,, , ra NM on p r tMutpe STOPPEL

  1. Massively parallel DNA sequencing successfully identifies new causative mutations in deafness genes in patients with cochlear implantation and EAS.

    Directory of Open Access Journals (Sweden)

    Maiko Miyagawa

    Full Text Available Genetic factors, the most common etiology in severe to profound hearing loss, are one of the key determinants of Cochlear Implantation (CI and Electric Acoustic Stimulation (EAS outcomes. Satisfactory auditory performance after receiving a CI/EAS in patients with certain deafness gene mutations indicates that genetic testing would be helpful in predicting CI/EAS outcomes and deciding treatment choices. However, because of the extreme genetic heterogeneity of deafness, clinical application of genetic information still entails difficulties. Target exon sequencing using massively parallel DNA sequencing is a new powerful strategy to discover rare causative genes in Mendelian disorders such as deafness. We used massive sequencing of the exons of 58 target candidate genes to analyze 8 (4 early-onset, 4 late-onset Japanese CI/EAS patients, who did not have mutations in commonly found genes including GJB2, SLC26A4, or mitochondrial 1555A>G or 3243A>G mutations. We successfully identified four rare causative mutations in the MYO15A, TECTA, TMPRSS3, and ACTG1 genes in four patients who showed relatively good auditory performance with CI including EAS, suggesting that genetic testing may be able to predict the performance after implantation.

  2. Ethernet for Aerospace Applications - Ethernet Heads for the Skies

    Science.gov (United States)

    Grams, Paul R.

    2015-01-01

    One of the goals of aerospace applications is to reduce the cost and complexity of avionic systems. Ethernet is a highly scalable, flexible, and popular protocol. The aerospace market is large, with a forecasted production of over 50,000 turbine-powered aircraft valued at $1.7 trillion between 2012 and 2022. Boeing estimates demand for commercial aircraft by 2033 to total over 36,000 with a value of over $5 trillion. In 2014 US airlines served over 750 million passengers and this is growing over 2% yearly. Electronic fly-by-wire is now used for all airliners and high performance aircraft. Although Ethernet has been widely used for four decades, its use in aerospace applications is just beginning to become common. Ethernet is the universal solution in commercial networks because of its high bandwidths, lower cost, openness, reliability, maintainability, flexibility, and interoperability. However, when Ethernet was designed applications with time-critical, safety relevant and deterministic requirements were not given much consideration. Many aerospace applications use a variety of communication architectures that add cost and complexity. Some of them are SpaceWire, MIL-STD-1553, Avionics Full Duplex Switched Ethernet (AFDX), and Time-Triggered Ethernet (TTE). Aerospace network designers desire to decrease the number of networks to reduce cost and effort while improving scalability, flexibility, openness, maintainability, and reliability. AFDX and TTE are being considered more for critical aerospace systems because they provide redundancy, failover protection, guaranteed timing, and frame priority and are based on Ethernet IEEE 802.3. This paper explores the use of AFDX and TTE for aerospace applications.

  3. Environmental Assessment for Muskrat & Raccoon Trapping Program : Muscatatuck National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This EA for the Muscatatuck NWR muskrat and raccoon trapping program summarizes the purpose of the program, the four proposed alternatives, and the consequences of...

  4. Estudo de chuveiros atmosfericos extensos como o calorimetro hadronico MHD-EAS-TOP

    OpenAIRE

    Helio Nogima

    1997-01-01

    Resumo: Esta tese foi desenvolvida no âmbito do experimento EAS-TOP , tendo um calorímetro hadrônico para raios cósmicos como objeto e instrumento de estudo. O trabalho consiste de uma parte instrumental e outra de análise de dados. Na parte instrumental destaca-se a medida da flutuação de resposta dos detectores proporcionais, obtida através da seleção de eventos de chuveiros. Na outra parte o calorímetro é usado para o estudo de chuveiros atmosféricos extensos. A análise é feita comparando ...

  5. A Study of E+A Galaxies Through SDSS-MaNGA Integral Field Spectroscopy

    Science.gov (United States)

    Wally, Muhammad; Weaver, Olivia A.; Anderson, Miguel Ricardo; Liu, Allen; Falcone, Julia; Wallack, Nicole Lisa; James, Olivia; Liu, Charles

    2017-01-01

    We outline the selection process and analysis of sixteen E+A galaxies observed by the Mapping Nearby Galaxies at the Apache Point Observatory (MaNGA) survey as a part of the fourth generation of the Sloan Digital Sky Survey (SDSS-IV). We present their Integral field spectroscopy and analyze their spatial distribution of stellar ages, metallicities and other stellar population properties. We can potentially study the variation in these properties as a function of redshift. This work was supported by the Alfred P. Sloan Foundation via the SDSS-IV Faculty and Student Team (FAST) initiative, ARC Agreement #SSP483 to the CUNY College of Staten Island. This work was also supported by grants to The American Museum of Natural History, and the CUNY College of Staten Island through The National Science Foundation.

  6. WH-EA: An Evolutionary Algorithm for Wiener-Hammerstein System Identification

    Directory of Open Access Journals (Sweden)

    J. Zambrano

    2018-01-01

    Full Text Available Current methods to identify Wiener-Hammerstein systems using Best Linear Approximation (BLA involve at least two steps. First, BLA is divided into obtaining front and back linear dynamics of the Wiener-Hammerstein model. Second, a refitting procedure of all parameters is carried out to reduce modelling errors. In this paper, a novel approach to identify Wiener-Hammerstein systems in a single step is proposed. This approach is based on a customized evolutionary algorithm (WH-EA able to look for the best BLA split, capturing at the same time the process static nonlinearity with high precision. Furthermore, to correct possible errors in BLA estimation, the locations of poles and zeros are subtly modified within an adequate search space to allow a fine-tuning of the model. The performance of the proposed approach is analysed by using a demonstration example and a nonlinear system identification benchmark.

  7. Multigap resistive plate chambers for EAS study in the EEE Project

    CERN Document Server

    An, S; Badalà, A; Zichichi, A

    2007-01-01

    The EEE (Extreme Energy Events) Project, conceived by its leader Antonino Zichichi, is an experiment to study very high-energetic air showers (EAS) through the detection of the shower's muon component using a network of tracking detectors, installed in Italian high schools. The single tracking telescope is composed of three large area () Multi-gap Resistive Plate Chambers (MRPCs). The data collected by the telescopes will be used for studies of air showers and also for the search of time correlations between sites which are far apart. The first telescope, recently installed in the Liceo B. Touschek in Grottaferrata (Rome), is successfully running, and other telescopes are going to be installed in a short time in other towns, opening up the way for the first search of long-distance coincidences over a total area of .

  8. Population Size vs. Mutation Strength for the (1+λ) EA on OneMax

    DEFF Research Database (Denmark)

    Gießen, Christian; Witt, Carsten

    2015-01-01

    The (1+1) EA with mutation probability c/n, where c>0 is an arbitrary constant, is studied for the classical OneMax function. Its expected optimization time is analyzed exactly (up to lower order terms) as a function of c and λ. It turns out that 1/n is the only optimal mutation probability if λ......=o(ln n ln ln n/ln ln ln n), which is the cut-off point for linear mnspeed-up. However, if λ is above this cut-off point then the standard mutation probability 1/n is no longer the only optimal choice. Instead, the expected number of generations is (up to lower order terms) independent of c......, irrespectively of it being less than 1 or greater. The results are obtained by a careful study of order statistics of the binomial distribution and variable drift theorems for upper and lower bounds....

  9. Differentiation of partial acylglycerols derived from different animal fats by EA-IRMS and GCMS techniques

    Directory of Open Access Journals (Sweden)

    Nina Naquiah, A. N.

    2016-06-01

    Full Text Available A study was carried out to compare partial acylglycerols of lard with those of chicken fat, beef fat and mutton fat using Gas Chromatography Mass Spectrometry (GC-MS and Elemental Analysis–Isotope Ratio Mass Spectrometry (EA-IRMS. Mono- (MAG and di-(DAG acylglycerols of animal fats were prepared according to a chemical glycerolysis method and isolated using column chromatography. The fatty acid composition and δ13C carbon isotope ratio of MAG and DAG derived from individual animal fat were determined separately to establish their identity characteristics. The results showed that the δ13C values of MAG and DAG of lard were significantly different from those of MAG and DAG derived from chicken fat, beef fat and mutton fat. According to the loading plots based on a principle component analysis (PCA, fatty acids namely stearic, oleic and linoleic were the most discriminating parameters to distinctly identify MAG and DAG derived from different animal fats. This demonstrated that the EA-IRMS and the PCA of fatty acid data have considerable potential for discriminating MAG and DAG derived from lard from other animal fats for Halal authentication purposes.Se realizó un estudio para comparar acilgliceroles parciales de la manteca de cerdo con las de grasa de pollo, grasa de vacuno y grasa de cordero utilizando cromatografía de gases-espectrometría de masas (GC-MS y análisis elemental de Isótopos-Espectrometría de Masas (EA-IRMS. Los mono- (MAG y di- (DAG acilgliceroles de grasas animales se prepararon mediante un método de glicerolisis química y se aislaron mediante cromatografía en columna. La composición de ácidos grasos y la relación isotópica de carbono δ13C de los MAG y DAG de las grasas de animales se determinan por separado para establecer sus características de identidad. Los resultados mostraron que los valores de δ13C de MAG y DAG de la manteca de cerdo fue significativamente diferente de los de MAG y DAG derivados de grasa

  10. The array of scintillation detectors with natural boron for EAS neutrons investigations

    Science.gov (United States)

    Gromushkin, D. M.; Bogdanov, F. A.; Khokhlov, S. S.; Kokoulin, R. P.; Kompaniets, K. G.; Petrukhin, A. A.; Shulzhenko, I. A.; Stenkin, Yu. V.; Yashin, I. I.; Yurin, K. O.

    2017-07-01

    The new URAN array has been constructed in the National Research Nuclear University MEPhI (Moscow, Russia). It is aimed at studying of primary cosmic rays in the "knee" region of energy spectrum and detects neutrons produced in interactions of EAS particles with nuclei of atmosphere or matter. The array consists of 72 detectors based on the scintillator with natural boron. Scintillator represents a silicon plate with the granules of ZnS(Ag) and B2O3 mixture. The area of the detector is 0.36 sq. m. Detectors are located on two roofs of the MEPhI laboratory buildings and are combined into clusters of 12 detectors. The structure and the main elements of the URAN array are described.

  11. Stable Carbon Isotope Ratio (δ13C Measurement of Graphite Using EA-IRMS System

    Directory of Open Access Journals (Sweden)

    Andrius Garbaras

    2015-06-01

    Full Text Available δ13C values in non-irradiated natural graphite were measured. The measurements were carried out using an elemental analyzer combined with stable isotope ratio mass spectrometer (EA-IRMS. The samples were prepared with ground and non-ground graphite, the part of which was mixed with Mg (ClO42. The best combustion of graphite in the oxidation furnace of the elemental analyzer was achieved when the amount of pulverized graphite ranged from 200 to 490 µg and the mass ratio C:Mg(ClO42 was approximately 1:10. The method for the graphite burning avoiding the isotope fractionation is proposed.DOI: http://dx.doi.org/10.5755/j01.ms.21.2.6873

  12. Sailuotong Prevents Hydrogen Peroxide (H2O2-Induced Injury in EA.hy926 Cells

    Directory of Open Access Journals (Sweden)

    Sai Wang Seto

    2017-01-01

    Full Text Available Sailuotong (SLT is a standardised three-herb formulation consisting of Panax ginseng, Ginkgo biloba, and Crocus sativus designed for the management of vascular dementia. While the latest clinical trials have demonstrated beneficial effects of SLT in vascular dementia, the underlying cellular mechanisms have not been fully explored. The aim of this study was to assess the ability and mechanisms of SLT to act against hydrogen peroxide (H2O2-induced oxidative damage in cultured human vascular endothelial cells (EAhy926. SLT (1–50 µg/mL significantly suppressed the H2O2-induced cell death and abolished the H2O2-induced reactive oxygen species (ROS generation in a concentration-dependent manner. Similarly, H2O2 (0.5 mM; 24 h caused a ~2-fold increase in lactate dehydrogenase (LDH release from the EA.hy926 cells which were significantly suppressed by SLT (1–50 µg/mL in a concentration-dependent manner. Incubation of SLT (50 µg/mL increased superoxide dismutase (SOD activity and suppressed the H2O2-enhanced Bax/Bcl-2 ratio and cleaved caspase-3 expression. In conclusion, our results suggest that SLT protects EA.hy916 cells against H2O2-mediated injury via direct reduction of intracellular ROS generation and an increase in SOD activity. These protective effects are closely associated with the inhibition of the apoptotic death cascade via the suppression of caspase-3 activation and reduction of Bax/Bcl-2 ratio, thereby indicating a potential mechanism of action for the clinical effects observed.

  13. A qualitative inquiry of educational requirements of selected professions in the Oklahoma aerospace industry

    Science.gov (United States)

    Walker, Casey Jerry Kennon

    Interview of incumbents of intellectual capital positions at Boeing. The aerospace industry is a dynamic industry that requires continual skill updates to keep up with advancements in technology and operational trends within the industry. The purpose of this study was to examine intellectual capital requirements of selected professional positions within the Boeing Company in Oklahoma. Data obtained through interviews was used to determine if educational skills gaps existed. The findings of the study can be used to develop an aerospace educational pipeline based on collaborative relationships between industry and higher education to facilitate educational and training programs. Three broad research questions were used to address and support the findings of this study related to educational background, career progression, and gaps. A purposive sample of 10 professional positions was selected for interview using an interview guide containing 18 questions. Data was analyzed using manual coding techniques. Findings and conclusions. The study found that minimum education requirements for selected professional positions consisted of a bachelor's degree. Although the majority of participants identified a business degree as optimal, several participants indicated that an education background from multiple disciplines would provide the greatest benefit. Data from interviews showed educational degrees were not specialized enough and skills required to perform job functions were obtained through direct on the job experience or through corporate training. Indications from participant responses showed employees with a thorough knowledge of government acronyms had a decided advantage over those that did not. Recommendations included: expanding the study to multiple organizations by conducting a survey; expanding industry and academic partnerships; establishing a structured educational pipeline to fill critical positions; creating broad aerospace curricula degree programs tailored

  14. International conference on Recent Advances in Aerospace Engineering (ICRAAE-2017)

    Science.gov (United States)

    2017-10-01

    Introduction The First International conference on Recent Advances in Aerospace Engineering (ICRAAE-2017) will be conducted by the Department of Aerospace Engineering at Karunya University, Coimbatore, Tamilnadu, India, on 3rd and 4th March, 2017. The conference aims to bring together students, academicians, leading scientists, researchers and industrialists working in diverse fields of Aerospace Engineering. This conference provides an inter-disciplinary platform for the educators, researchers and practitioners to present, share and discuss the recent trends, innovations, concerns and solutions in the cutting edge technologies of Aerospace Engineering for mutual benefit and the growth of the nation. Objectives The conference is devoted to benefit the participants who will have the opportunity to gain insight into state-of-the-art technologies in the field of Aerospace Engineering by the expert lectures of scientists and pioneering researchers from India and abroad. In addition, the two-day conference will enable knowledge sharing by personnel involved in active research working on the recent developments in this diverse field. List of International Deep Drawing Research Group, Conference Topics, Facts and Statistics, Achknowledgement, Keynote Speakers, Scientific Committee, Editors all are available in this PDF.

  15. Factors Influencing Advancement of Women Senior Leaders in Aerospace Companies

    Science.gov (United States)

    Garrett-Howard, Camille Elaine

    The problem researched in this study was the limited number of women in senior leadership positions in the aerospace industry. The purpose of this qualitative phenomenological research study was to interview women senior leaders in the aerospace industry to explore the factors they perceived as beneficial to their advancement to senior leadership positions in the aerospace industry. The research study was guided by a central research question relating to what professional and personal factors might have led to promotional opportunities into senior leadership roles. Transformational leadership was the conceptual framework used to inform the study. The qualitative, phenomenological approach was selected to gain insights of the lived experiences and perceptions relating to career advancement of women to senior leadership positions in the aerospace industry. Data were collected using a modified Van Kaam method, coded, and analyzed to discern themes or patterns. Findings were that the attributes participants contributed to their success, included a focus on leadership, personal development, and the importance of mentoring relationships. This study presented a positive direction in addressing the gaps in the body of knowledge related to women and leadership development by exploring the experiences of women in senior leadership positions in the aerospace industry. Implications for social change include informing organizations and women about specific leadership development practices as one way to promote more women into leadership positions thus reducing the gap between the number of men and women leaders.

  16. Spatially resolved medium resolution spectroscopy of an interacting E+A (post-starburst) system with the Subaru Telescope

    Science.gov (United States)

    Goto, Tomotsugu; Yagi, Masafumi; Yamauchi, Chisato

    2008-12-01

    We have performed spatially resolved medium resolution long-slit spectroscopy of a nearby E+A (post-starburst) galaxy system, SDSSJ161330.18+510335.5, with the FOCAS spectrograph mounted on the Subaru Telescope. This E+A galaxy has an obvious companion galaxy 14kpc in front with the velocity difference of 61.8kms-1. Both galaxies have obviously disturbed morphology. Thus, this E+A system provides us with a perfect opportunity to investigate the relation between the post-starburst phenomena and galaxy-galaxy interaction. We have found that the Hδ equivalent width (EW) of the E+A galaxy is greater than 7Å galaxy wide (8.5kpc) with no significant spatial variation. The E+A galaxy has a weak [OIII] emission (EW ~ 1Å) offset by ~2.6kpc from the peak of the Balmer absorption lines. We detected a rotational velocity in the companion galaxy of >175kms-1. The progenitor of the companion may have been a rotationally supported, but yet passive S0 galaxy. We did not detect significant rotation on the E+A galaxy. A metallicity estimate based on the r - H colour suggests Z = 0.008 and 0.02, for the E+A and the companion galaxies, respectively. Assuming these metallicity estimates, the age of the E+A galaxy after quenching the star formation is estimated to be 100-500Myr, with its centre having a slightly younger stellar population. The companion galaxy is estimated to have an older stellar population of >2Gyr of age with no significant spatial variation. These findings are inconsistent with a simple picture where the dynamical interaction creates infall of the gas reservoir that causes the central starburst/post-starburst. Instead, our results present an important example where the galaxy-galaxy interaction can trigger a galaxy-wide post-starburst phenomenon. Based on data collected at the Subaru Telescope, which is operated by the National Astronomical Observatory of Japan. E-mail: tomo@ifa.hawaii.edu ‡ Japan Society for the Promotion of Science (JSPS) SPD Fellow.

  17. Green Aerospace Fuels from Nonpetroleum Sources

    Science.gov (United States)

    Hepp, Aloysius F.; Kulis, Michael J.; DeLaRee, Ana B.; Zubrin, Robert; Berggren, Mark; Hensel, Joseph D.; Kimble, Michael C.

    2011-01-01

    Efforts to produce green aerospace propellants from nonpetroleum sources are outlined. The paper begins with an overview of feedstock processing and relevant small molecule or C1 chemistry. Gas-to-liquid technologies, notably Fischer-Tropsch (FT) processing of synthesis gas (CO and H2), are being optimized to enhance the fraction of product stream relevant to aviation (and other transportation) fuels at the NASA Glenn Research Center (GRC). Efforts to produce optimized catalysts are described. Given the high cost of space launch, the recycling of human metabolic and plastic wastes to reduce the need to transport consumables to orbit to support the crew of a space station has long been recognized as a high priority. If the much larger costs of transporting consumables to the Moon or beyond are taken into account, the importance of developing waste recycling systems becomes still more imperative. One promising way to transform organic waste products into useful gases is steam reformation; this well-known technology is currently being optimized by a Colorado company for exploration and planetary surface operations. Reduction of terrestrial waste streams while producing energy and/or valuable raw materials is an opportunity being realized by a new generation of visionary entrepreneurs. A technology that has successfully demonstrated production of fuels and related chemicals from waste plastics developed in Northeast Ohio is described. Technologies being developed by a Massachusetts company to remove sulfur impurities are highlighted. Common issues and concerns for nonpetroleum fuel production are emphasized. Energy utilization is a concern for production of fuels whether a terrestrial operation or on the lunar (or Martian) surface; the term green relates to not only mitigating excess carbon release but also to the efficiency of grid-energy usage. For space exploration, energy efficiency can be an essential concern. Other issues of great concern include minimizing

  18. Evaluability Assessment Thesis and Dissertation Studies in Graduate Professional Degree Programs

    Science.gov (United States)

    Walser, Tamara M.; Trevisan, Michael S.

    2016-01-01

    Evaluability assessment (EA) has potential as a design option for thesis and dissertation studies, serving as a practical training experience for both technical and nontechnical evaluation skills. Based on a content review of a sample of EA theses and dissertations from graduate professional degree programs, the authors of this article found that…

  19. Numerical simulation of dynamics of brushless dc motors for aerospace and other applications. Volume 2: User's guide to computer EMA model

    Science.gov (United States)

    Demerdash, N. A. O.; Nehl, T. W.

    1979-01-01

    A description and user's guide of the computer program developed to simulate the dynamics of an electromechanical actuator for aerospace applications are presented. The effects of the stator phase currents on the permanent magnets of the rotor are examined. The voltage and current waveforms present in the power conditioner network during the motoring, regenerative braking, and plugging modes of operation are presented and discussed.

  20. Lightweight acoustic treatments for aerospace applications

    Science.gov (United States)

    Naify, Christina Jeanne

    2011-12-01

    Increase in the use of composites for aerospace applications has the benefit of decreased structural weight, but at the cost of decreased acoustic performance. Stiff, lightweight structures (such as composites) are traditionally not ideal for acoustic insulation applications because of high transmission loss at low frequencies. A need has thus arisen for effective sound insulation materials for aerospace and automotive applications with low weight addition. Current approaches, such as the addition of mass law dominated materials (foams) also perform poorly when scaled to small thickness and low density. In this dissertation, methods which reduce sound transmission without adding significant weight are investigated. The methods presented are intended to be integrated into currently used lightweight structures such as honeycomb sandwich panels and to cover a wide range of frequencies. Layering gasses of differing acoustic impedances on a panel substantially reduced the amount of sound energy transmitted through the panel with respect to the panel alone or an equivalent-thickness single species gas layer. The additional transmission loss derives from successive impedance mismatches at the interfaces between gas layers and the resulting inefficient energy transfer. Attachment of additional gas layers increased the transmission loss (TL) by as much as 17 dB at high (>1 kHz) frequencies. The location and ordering of the gasses with respect to the panel were important factors in determining the magnitude of the total TL. Theoretical analysis using a transfer matrix method was used to calculate the frequency dependence of sound transmission for the different configurations tested. The method accurately predicted the relative increases in TL observed with the addition of different gas layer configurations. To address low-frequency sound insulation, membrane-type locally resonant acoustic materials (LRAM) were fabricated, characterized, and analyzed to understand their

  1. Aerospace toxicology overview: aerial application and cabin air quality.

    Science.gov (United States)

    Chaturvedi, Arvind K

    2011-01-01

    Aerospace toxicology is a rather recent development and is closely related to aerospace medicine. Aerospace toxicology can be defined as a field of study designed to address the adverse effects of medications, chemicals, and contaminants on humans who fly within or outside the atmosphere in aviation or on space flights. The environment extending above and beyond the surface of the Earth is referred to as aerospace. The term aviation is frequently used interchangeably with aerospace. The focus of the literature review performed to prepare this paper was on aerospace toxicology-related subject matters, aerial application and aircraft cabin air quality. Among the important topics addressed are the following: · Aerial applications of agricultural chemicals, pesticidal toxicity, and exposures to aerially applied mixtures of chemicals and their associated formulating solvents/surfactants The safety of aerially encountered chemicals and the bioanalytical methods used to monitor exposures to some of them · The presence of fumes and smoke, as well as other contaminants that may generally be present in aircraft/space vehicle cabin air · And importantly, the toxic effects of aerially encountered contaminants, with emphasis on the degradation products of oils, fluids, and lubricants used in aircraft, and finally · Analytical methods used for monitoring human exposure to CO and HCN are addressed in the review, as are the signs and symptoms associated with exposures to these combustion gases. Although many agricultural chemical monitoring studies have been published, few have dealt with the occurrence of such chemicals in aircraft cabin air. However, agricultural chemicals do appear in cabin air; indeed, attempts have been made to establish maximum allowable concentrations for several of the more potentially toxic ones that are found in aircraft cabin air. In this article, I emphasize the need for precautionary measures to be taken to minimize exposures to aerially

  2. Atmospheric/Space Environment Support Lessons Learned Regarding Aerospace Vehicle Design and Operations

    Science.gov (United States)

    Vaughan, William W.; Anderson, B. Jeffrey

    2005-01-01

    In modern government and aerospace industry institutions the necessity of controlling current year costs often leads to high mobility in the technical workforce, "one-deep" technical capabilities, and minimal mentoring for young engineers. Thus, formal recording, use, and teaching of lessons learned are especially important in the maintenance and improvement of current knowledge and development of new technologies, regardless of the discipline area. Within the NASA Technical Standards Program Website http://standards.nasa.gov there is a menu item entitled "Lessons Learned/Best Practices". It contains links to a large number of engineering and technical disciplines related data sets that contain a wealth of lessons learned information based on past experiences. This paper has provided a small sample of lessons learned relative to the atmospheric and space environment. There are many more whose subsequent applications have improved our knowledge of the atmosphere and space environment, and the application of this knowledge to the engineering and operations for a variety of aerospace programs.

  3. A retrospective analysis of real-world use of the eaTracker® My Goals website by adults from Ontario and Alberta, Canada.

    Science.gov (United States)

    Lieffers, Jessica R L; Haresign, Helen; Mehling, Christine; Hanning, Rhona M

    2016-09-15

    Little is known about use of goal setting and tracking tools within online programs to support nutrition and physical activity behaviour change. In 2011, Dietitians of Canada added "My Goals," a nutrition and physical activity behaviour goal setting and tracking tool to their free publicly available self-monitoring website (eaTracker® ( http://www.eaTracker.ca/ )). My Goals allows users to: a) set "ready-made" SMART (Specific, Measurable, Attainable, Realistic, Time-related) goals (choice of n = 87 goals from n = 13 categories) or "write your own" goals, and b) track progress using the "My Goals Tracker." The purpose of this study was to characterize: a) My Goals user demographics, b) types of goals set, and c) My Goals Tracker use. Anonymous data on all goals set using the My Goals feature from December 6/2012-April 28/2014 by users ≥19y from Ontario and Alberta, Canada were obtained. This dataset contained: anonymous self-reported user demographic data, user set goals, and My Goals Tracker use data. Write your own goals were categorized by topic and specificity. Data were summarized using descriptive statistics. Multivariate binary logistic regression was used to determine associations between user demographics and a) goal topic areas and b) My Goals Tracker use. Overall, n = 16,511 goal statements (75.4 % ready-made; 24.6 % write your own) set by n = 8,067 adult users 19-85y (83.3 % female; mean age 41.1 ± 15.0y, mean BMI 28.8 ± 7.6kg/m(2)) were included for analysis. Overall, 33.1 % of ready-made goals were from the "Managing your Weight" category. Of write your own goal entries, 42.3 % were solely distal goals (most related to weight management); 38.6 % addressed nutrition behaviour change (16.6 % had unspecific general eating goals); 18.1 % addressed physical activity behaviour change (47.3 % had goals without information on exercise amount and type). Many write your own goals were poor quality (e.g., non-specific (e.g., missing

  4. Study of combined cycle engine for aerospace plane

    OpenAIRE

    苅田, 丈士; Kanda, Takeshi; 工藤, 賢司; Kudo, Kenji

    2002-01-01

    At the Ramjet Propulsion Research Center, the scramjet engine for an aerospace plane has been studied. Other engines are required for the plane to go into orbit. Recently, a combined cycle engine including scramjet mode has been also studied to complete the engine system for the plane. The scramjet and the combined cycle engine are most effective with application to the Single-Stage-to-Orbit (SSTO) aerospace plane, as shown in Figure 1. Recent activity on the combined cycle engine and the SST...

  5. High temperature metal matrix composites for future aerospace systems

    Science.gov (United States)

    Stephens, Joseph R.

    1988-01-01

    Research was conducted on metal matrix composites and intermetallic matrix composites to understand their behavior under anticipated future operating conditions envisioned for aerospace power and propulsion systems of the 21st century. Extremes in environmental conditions, high temperature, long operating lives, and cyclic conditions dictate that the test evaluations not only include laboratory testing, but simulated flight conditions. The various processing techniques employed to fabricate composites are discussed along with the basic research underway to understand the behavior of high temperature composites, and the relationship of this research to future aerospace systems.

  6. Statistical Analysis of Strength Data for an Aerospace Aluminum Alloy

    Science.gov (United States)

    Neergaard, L.; Malone, T.

    2001-01-01

    Aerospace vehicles are produced in limited quantities that do not always allow development of MIL-HDBK-5 A-basis design allowables. One method of examining production and composition variations is to perform 100% lot acceptance testing for aerospace Aluminum (Al) alloys. This paper discusses statistical trends seen in strength data for one Al alloy. A four-step approach reduced the data to residuals, visualized residuals as a function of time, grouped data with quantified scatter, and conducted analysis of variance (ANOVA).

  7. Microcomputer Application of Aerospace Asset Surface Search Planning.

    Science.gov (United States)

    1984-12-14

    heading in decimal) all@ DescentRate , (Aerospace object’s descent rate in feet per minute) illl DescentTime, Object’s descent/glide time through...writeln(’Please enter aerospace object"s rate of descent in’); 8987 write(’feet-per-minute. DESCENT RATE =) ’)-, m988 readln( DescentRate ); M9 if... DescentRate ( 9 then em writeln(’iDescent rate must not be less than zero. Try again!’); 1991 writeln e992 until DescentRate )= 6; e993 DescentTime

  8. Revision of ISO 15859 Aerospace Fluid Standards

    Science.gov (United States)

    Greene, Benjamin; McClure, Mark B.

    2012-01-01

    A detailed review of ISO 15859 "Space Systems - Fluid Characteristics, Sampling and Test Methods" was performed An approach to revising Parts 1-9 and 11-13 was developed and concurred by the NASA Technical Standards Program Office. The approach was to align them with the highest level source documents, and not to program-specific requirements. The updated documents were prepared and presented.

  9. Accelerating growth of HFC-227ea (1,1,1,2,3,3,3-heptafluoropropane) in the atmosphere

    DEFF Research Database (Denmark)

    Laube, J.C.; Martinerie, P.; Witrant, E.

    2010-01-01

    We report the first measurements of 1,1,1,2,3,3,3-heptafluoropropane (HFC-227ea), a substitute for ozone depleting compounds, in air samples originating from remote regions of the atmosphere and present evidence for its accelerating growth. Observed mixing ratios ranged from below 0.01 ppt in dee...

  10. Mineral fertilizers improve the sensory quality of East African Highland bananas (Musa AAA-EA, cv. Kisansa)

    NARCIS (Netherlands)

    Taulya, G.; Asten, van P.J.A.; Nowakunda, K.; Kaddu-Mukasa, P.

    2010-01-01

    Some farmers in Uganda believe that fertilizers negatively affect the sensory attributes of cooking type bananas. This belief may hamper the adoption of fertilizers. To verify the validity of this belief, bunches (Musa AAA-EA, cv. ‘Kisansa’) from fertilized (i.e. N-P-K-Mg-Zn-S-B-Mo) and

  11. Ivy leaves dry extract EA 575® decreases LPS-induced IL-6 release from murine macrophages.

    Science.gov (United States)

    Schulte-Michels, J; Runkel, F; Gokorsch, S; Häberlein, H

    2016-03-01

    IL-6 plays a key role in the course of inflammatory processes as well as in the regulation of immune responses by the release of different cytokines. IL-6 is produced e.g. by macrophages recruited to the airways in response to a variety of inflammatory stimuli like allergens and respiratory viruses. Patients with inflammatory airway diseases therefore may benefit from therapies targeting the IL-6 pathway, e.g. reduction of the IL-6 release. Within this context, we tested the influence of the ivy leaves dry extract EA 575® on the LPS-induced release of IL-6 from murine macrophages (J774.2). One point seven µg/ml (5 µM) corticosterone served as positive control and was able to reduce LPS-induced IL-6 release by 46 ± 4%. EA 575® was tested in concentrations between 40 and 400 µg/ml. EA 575® decreased the LPS-induced IL-6 release in a dose-dependent manner and statistically significant by 25 ± 4%, 32 ± 4%, and 40 ± 7% in concentrations of 80, 160, and 400 µg/ml, respectively. The present data suggest an anti-inflammatory effect of EA 575® used in therapy of chronic- and acute inflammatory airway diseases accompanied with cough.

  12. All-optical characterization of large-signal modulation bandwidth of a monolithically integrated DFB-EA

    DEFF Research Database (Denmark)

    Blaaberg, Søren; Mulvad, Hans Christian Hansen; Oxenløwe, Leif Katsuo

    2009-01-01

    We use an all-optical method to characterize the modulation bandwidth of a DFB-EA designed for 100 Gb/s Ethernet. In a large-signal wavelength conversion set-up, we show the device has an all-optical bandwidth of 83 GHz....

  13. 75 FR 42820 - Notice of Availability of a Final Environmental Assessment (Final EA) and a Finding of No...

    Science.gov (United States)

    2010-07-22

    ... conforming to the guidelines of the Terminal Facilities Design Standards for Base Building and Environmental... 1050.1E, ``Environmental Impacts: Policies and Procedures.'' In addition, FAA Order 5050.4B, ``National... Federal Aviation Administration Notice of Availability of a Final Environmental Assessment (Final EA) and...

  14. 75 FR 9015 - Notice of Availability of a Final Environmental Assessment (Final EA) and a Finding of No...

    Science.gov (United States)

    2010-02-26

    ... conform to the guidelines of the Terminal Facilities Design Standards for Base Building and Environmental..., ``Environmental Impacts: Policies and Procedures.'' In addition, FAA Order 5050.4B, ``National Environmental... Federal Aviation Administration Notice of Availability of a Final Environmental Assessment (Final EA) and...

  15. 77 FR 33972 - Channel Spacing and Bandwidth Limitations for Certain Economic Area (EA)-based 800 MHz...

    Science.gov (United States)

    2012-06-08

    ... COMMISSION 47 CFR Part 90 Channel Spacing and Bandwidth Limitations for Certain Economic Area (EA)-based 800... MHz Specialized Mobile Radio (SMR) licensees to exceed a legacy channel spacing and bandwidth.... Licensees are permitted to exceed the channel spacing and bandwidth limitation in the 813.5-824/858.5-869...

  16. 10 CFR Appendix C to Subpart D of... - Classes of Actions that Normally Require EAs But Not Necessarily EISs

    Science.gov (United States)

    2010-01-01

    ..., geothermal, fossil fuel, biomass, and solar energy pilot projects. C13Approval or disapproval of an... 10 Energy 4 2010-01-01 2010-01-01 false Classes of Actions that Normally Require EAs But Not Necessarily EISs C Appendix C to Subpart D of Part 1021 Energy DEPARTMENT OF ENERGY (GENERAL PROVISIONS...

  17. Spectral Analysis, Synthesis, & Energy Distributions of Nearby E+A Galaxies Using SDSS-IV MaNGA

    Science.gov (United States)

    Weaver, Olivia A.; Anderson, Miguel Ricardo; Wally, Muhammad; James, Olivia; Falcone, Julia; Liu, Allen; Wallack, Nicole; Liu, Charles; SDSS Collaboration

    2017-01-01

    Utilizing data from the Mapping Nearby Galaxies at APO (MaNGA) Survey (MaNGA Product Launch-4, or MPL-4), of the latest generation of the Sloan Digital Sky Survey (SDSS-IV), we identified nine post-starburst (E+A) systems that lie within the Green Valley transition zone. We identify the E+A galaxies by their SDSS single fiber spectrum and u-r color, then confirmed their classification as post-starburst by coding/plotting methods and spectral synthesis codes (FIREFLY and PIPE3D), as well as with their Spectral Energy Distributions (SEDs) from 0.15 µm to 22 µm, using GALEX, SDSS, 2MASS, and WISE data. We produced maps of gaussian-fitted fluxes, equivalent widths, stellar velocities, metallicities and age. We also produced spectral line ratio diagrams to classify regions of stellar populations of the galaxies. We found that our sample of E+As retain their post-starburst properties across the entire galaxy, not just at their center. We detected matching a trend line in the ultraviolet and optical bands, consistent with the expected SEDs for an E+A galaxy, and also through the J, H and Ks bands, except for one object. We classified one of the nine galaxies as a luminous infrared galaxy, unusual for a post-starburst object. Our group seeks to further study stellar population properties, spectral energy distributions and quenching properties in E+A galaxies, and investigate their role in galaxy evolution as a whole. This work was supported by the Alfred P. Sloan Foundation via the SDSS-IV Faculty and Student Team (FAST) initiative, ARC Agreement #SSP483 to the CUNY College of Staten Island. This work was also supported by grants to The American Museum of Natural History, and the CUNY College of Staten Island through from National Science Foundation.

  18. KiloPower Program

    Energy Technology Data Exchange (ETDEWEB)

    McClure, Patrick Ray [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-08-04

    These are the slides for a phone interview with Aerospace America magazine of the AIAA. It goes over the KiloPower Program at Los Alamos National Laboratory (LANL), and covers the following: 1 kWe Kilopower, 10 kWe Kilopower, Kilopower Reactor Using Stirling Technology (KRUSTY) Integration Test (DAF), Reactor Configuration, and Platen Positions.

  19. 76 FR 28635 - Airworthiness Directives; British Aerospace Regional Aircraft Model HP.137 Jetstream Mk.1...

    Science.gov (United States)

    2011-05-18

    ... Aerospace Jetstream Series 3100 & 3200 Service Bulletin 32-JA090240, Revision 1, dated January 18, 2010. (2... defined in paragraph 2.D.(4) of British Aerospace Jetstream Series 3100 & 3200 Service Bulletin 32... bores for cracks. Do the inspections following British Aerospace Jetstream Series 3100 & 3200 Service...

  20. 75 FR 19209 - Airworthiness Directives; British Aerospace Regional Aircraft Model HP.137 Jetstream Mk.1...

    Science.gov (United States)

    2010-04-14

    ... Register approved the incorporation by reference of British Aerospace Jetstream Series 3100 & 3200 Service Bulletin No. 32-JA030644, Revision No. 1, dated August 19, 2008; British Aerospace Jetstream Series 3100... Register approved the incorporation by reference of BAE Systems British Aerospace Jetstream Series 3100...

  1. 75 FR 3418 - Airworthiness Directives; British Aerospace Regional Aircraft Model HP.137 Jetstream Mk.1...

    Science.gov (United States)

    2010-01-21

    ... Directives; British Aerospace Regional Aircraft Model HP.137 Jetstream Mk.1, Jetstream Series 200, Jetstream... Service Information BAE Systems (Operations) Limited has issued British Aerospace Jetstream Series 3100 & 3200 Service Bulletin No. 32-JA020741, dated November 2, 2002; British Aerospace Jetstream Series 3100...

  2. 76 FR 14349 - Airworthiness Directives; British Aerospace Regional Aircraft Model HP.137 Jetstream Mk.1...

    Science.gov (United States)

    2011-03-16

    ... Aerospace Regional Aircraft Model HP.137 Jetstream Mk.1, Jetstream Series 200, Jetstream Series 3101, and... issued British Aerospace Jetstream Series 3100 & 3200 Service Bulletin 32-JA090240, Revision 1, dated... British Aerospace Regional Aircraft Model HP.137 Jetstream Mk.1, Jetstream Series 200, Jetstream Series...

  3. RETRACTED ARTICLE: Microstructural evolution of AA7449 aerospace alloy refined by intensive shearing

    Science.gov (United States)

    Haghayeghi, R.; Nastac, L.

    2012-10-01

    Many aerospace alloys are sensitive to their composition thus cannot be chemically grain refined. In addition, only 1% grain refiners can act as nuclei for refining the structure. In this paper, physical refinement by intensive shearing above liquidus as an alternative technique will be investigated for AA7449 aerospace alloy. The results can open a new gateway for aerospace industry for refining their microstructure.

  4. 77 FR 3739 - Executive-led Aerospace and Defense Industry Trade Mission to Turkey-Notification

    Science.gov (United States)

    2012-01-25

    ... International Trade Administration Executive-led Aerospace and Defense Industry Trade Mission to Turkey... Commercial Service (CS) is organizing a U.S.--Turkey Aerospace and Defense Industry Trade Mission to Ankara.... The mission's goal is to introduce a variety of U.S. aerospace and defense industry manufacturers and...

  5. 78 FR 38690 - Aerospace Executive Service Trade Mission at the Singapore Airshow 2014

    Science.gov (United States)

    2013-06-27

    ... International Trade Administration Aerospace Executive Service Trade Mission at the Singapore Airshow 2014... Commercial Service is organizing an Aerospace Executive Service Trade Mission (AESTM) to Singapore in... representatives from a variety of U.S. aerospace-industry manufacturers and service providers. The mission...

  6. 76 FR 51350 - Aerospace Executive Service Trade Mission (AESTM) to Seoul, Korea

    Science.gov (United States)

    2011-08-18

    ... International Trade Administration Aerospace Executive Service Trade Mission (AESTM) to Seoul, Korea AGENCY.... Department of Commerce, International Trade Administration (ITA), Aerospace & Defense Technologies Team and the U.S. Commercial Service in Seoul (CS Korea) are organizing an Aerospace Executive Service Trade...

  7. 76 FR 55347 - Aerospace Executive Service Trade Mission at Singapore Air Show

    Science.gov (United States)

    2011-09-07

    ... International Trade Administration Aerospace Executive Service Trade Mission at Singapore Air Show AGENCY... organizing an Aerospace Executive Service Trade Mission (AESTM) to Singapore in conjunction with the... from a variety of U.S. aerospace-industry manufacturers and service providers. The mission participants...

  8. Metal clad aramid fibers for aerospace wire and cable

    Science.gov (United States)

    Tokarsky, Edward W.; Dunham, Michael G.; Hunt, James E.; Santoleri, E. David; Allen, David B.

    1995-01-01

    High strength light weight metal clad aramid fibers can provide significant weight savings when used to replace conventional metal wire in aerospace cable. An overview of metal clad aramid fiber materials and information on performance and use in braided electrical shielding and signal conductors is provided.

  9. Strain characterization of embedded aerospace smart materials using shearography

    NARCIS (Netherlands)

    Anisimov, A.; Muller, B.; Sinke, J.; Groves, R.M.

    2015-01-01

    The development of smart materials for embedding in aerospace composites provides enhanced functionality for future aircraft structures. Critical flight conditions like icing of the leading edges can affect the aircraft functionality and controllability. Hence, anti-icing and de-icing capabilities

  10. Cryogenic rocket engine development at Delft aerospace rocket engineering

    NARCIS (Netherlands)

    Wink, J; Hermsen, R.; Huijsman, R; Akkermans, C.; Denies, L.; Barreiro, F.; Schutte, A.; Cervone, A.; Zandbergen, B.T.C.

    2016-01-01

    This paper describes the current developments regarding cryogenic rocket engine technology at Delft Aerospace Rocket Engineering (DARE). DARE is a student society based at Delft University of Technology with the goal of being the first student group in the world to launch a rocket into space. After

  11. An Approach to Prognostic Decision Making in the Aerospace Domain

    Science.gov (United States)

    2012-09-01

    performance goals) were also defined for some or all of the elements of ~f , as is done in Goal Pro- gramming ( Tamiz , Jones, & Romero, 1998), for...Level Sys- tem Synthesis (BLISS). In Aerospace sciences meeting and exhibit. Reno, NV. Tamiz , M., Jones, D., & Romero, C. (1998, Decem- ber). Goal

  12. Air Navigation. Aerospace Education II. Instructional Unit III.

    Science.gov (United States)

    Cox, Rodney V., Jr.

    This curriculum guide is an accompanying publication for the textbook entitled "Air Navigation" in the Aerospace Education II series. The guide provides guidelines for teachers using the textbook in terms of objectives, behavioral objectives, suggested outline, orientation, suggested key points, suggestions for teaching, instructional…

  13. Spacecraft and Their Boosters. Aerospace Education I. Instructor Handbook.

    Science.gov (United States)

    Air Univ., Maxwell AFB, AL. Junior Reserve Office Training Corps.

    This curriculum guide is prepared for the textbook entitled "Spacecraft and their Boosters," published in the Aerospace Education I series. Specific guidelines are provided for teachers on each chapter included in the textbook. The guidelines are organized in nine categories: objectives, behavioral objectives, textbook outline,…

  14. Defense of the United States. Aerospace Education III.

    Science.gov (United States)

    Mickey, V. V.

    This publication, one in the series on Aerospace Education III, deals with the background of the defense system of the United States. Description of different wars in which this country was involved includes the development of new military organizations and different weapons. One chapter is devoted in its entirity to the organizational structure…

  15. Aircraft of Today. [Aerospace Education I. Instructor Handbook.

    Science.gov (United States)

    Air Univ., Maxwell AFB, AL. Junior Reserve Office Training Corps.

    This publication is prepared to accompany the textbook entitled "Aircraft of Today," published in the Aerospace Education I series. The curriculum guide provides guidelines for teachers in terms of various concepts stressed in each chapter and suggested methodology for instruction. The subdivisions in the guidebook for each chapter…

  16. Propulsion Systems for Aircraft. Aerospace Education II. Instructional Unit II.

    Science.gov (United States)

    Elmer, James D.

    This curriculum guide accompanies another publication in the Aerospace Education II series entitled "Propulsion Systems for Aircraft." The guide includes specific guidelines for teachers on each chapter in the textbook. Suggestions are included for objectives (traditional and behavioral), suggested outline, orientation, suggested key…

  17. Theory of Aircraft Flight. Aerospace Education II. Instructional Unit I.

    Science.gov (United States)

    Elmer, James D.

    This publication provides guidelines for teachers using the Aerospace Education II series publication entitled "Theory of Aircraft Flight." The organization of the guide for each chapter is according to objectives (traditional and behavioral), suggested outline, orientation, suggested key points, suggestions for teaching, instructional…

  18. Civil Aviation and Facilities. Aerospace Education II. Instructional Unit IV.

    Science.gov (United States)

    Elmer, James D.

    This publication accompanies the textbook entitled "Civil Aviation and Facilities," published in the Aerospace Education II series. It provides teacher guidelines with regard to objectives (traditional and behavioral), suggested outlines, orientation, suggested key points, suggestions for teaching, instructional aids, projects, and…

  19. Human Requirements of Flight. Aerospace Education III. Instructional Unit IV.

    Science.gov (United States)

    Hall, Arthur D.

    This curriculum guide is prepared for the Aerospace Education III series publication entitled "Human Requirements of Flight." It provides specific guidelines for teachers using the textbook. The guidelines for each chapter are organized according to objectives (traditional and behavioral), suggested outline, orientation, suggested key…

  20. Transversely loaded fiber optic grating strain sensors for aerospace applications

    Science.gov (United States)

    Udd, Eric; Schulz, Whitten L.; Seim, John M.; Trego, Angela; Haugse, Eric D.; Johnson, Patrick E.

    2000-05-01

    Most fiber grating sensor technology that has been developed to support strain sensing involves the measurement of axial strain. Fiber grating sensors are however capable of monitoring transverse as well as axial strain. This paper reviews a series of applications of this technology that are of particular interest to aerospace applications.

  1. Developing Interdisciplinary Workforce to Meet Future Aerospace Challenges

    Science.gov (United States)

    Misra, Ajay

    2017-01-01

    The presentation will focus on the importance of interdisciplinary research for addressing future aerospace challenges. Examples of current research activities at NASA's Glenn Research Center will be provided to illustrate the importance of interdisciplinary research. Challenges with conducting interdisciplinary research will be discussed.

  2. Aerospace Power Journal. Volume 16, Number 1, Spring 2002

    Science.gov (United States)

    2002-01-01

    America and Europe qualify, as do many in Asia, such as Singapore; Kuala Lumpur, Malaysia ; and Tokyo, Japan. At the opposite end of the spectrum are...such as tanks Notes 68 AEROSPACE POWER JOURNAL SPRING 2002 and armored personnel carriers, nestled between tall buildings. The results are

  3. Personality and organizational influences on aerospace human performance

    Science.gov (United States)

    Helmreich, Robert L.

    1989-01-01

    Individual and organizational influences on performance in aerospace environments are discussed. A model of personality with demonstrated validity is described along with reasons why personality's effects on performance have been underestimated. Organizational forces including intergroup conflict and coercive pressures are also described. It is suggested that basic and applied research in analog situations is needed to provide necessary guidance for planning future space missions.

  4. Airborne aerospace; interview with business development manager space

    NARCIS (Netherlands)

    Woldendorp, S.; Nevinskala, A.; Gupta, S.

    2013-01-01

    Airborne Composites designs and manufactures composite parts for the Aerospace, Oil & Gas, Marine and other industries since 1995. They are involved in notable hightech projects, from the Galileo Satellites, to the Gulfstream aircraft for Fokker and the ALMA astronomical telescope. The Leonardo

  5. Automation of Production Processes for CFRPs and Hybrids in Aerospace

    OpenAIRE

    Gerngroß, Tobias

    2016-01-01

    The presentation focuses on the field of automated production processes for CFRPs and hybrids in Aerospace. This includes the research activities at the DLR ZLP on automation of manufacturing processes for CFRP and hybrid components. Automation approaches and solutions have been developed in full scale and the presented examples have been demonstrated in a near industrial environment for process development, optimisation, demonstration and verification.

  6. Six Aerospace design projects to learn how to engineer

    NARCIS (Netherlands)

    Kamp, A.

    2013-01-01

    Tomorrow’s engineers are required to have a good balance of deep working knowledge of engineering sciences and engineering skills. In the Bachelor in Aerospace Engineering at TU Delft, students are educated to master these competences so that they are ready to engineer when they graduate. The

  7. Advanced materials for application in the aerospace and automotive industries

    CSIR Research Space (South Africa)

    Damm, O

    2008-11-01

    Full Text Available The CSIR conducts research and development (R&D) involving advanced materials with applications in the local automotive and aerospace industries. The relevance of these R&D programmes is illustrated by positioning them in the context of key industry...

  8. Hybrid Particle-Continuum Numerical Methods for Aerospace Applications

    Science.gov (United States)

    2011-01-01

    methodes de calcul des coulements de gaz rarefies). RTO-EN-AVT-194 14. ABSTRACT Often, rareed ows of interest in aerospace applications are embedded...Many applications of MEMS/NEMS devices, which include micro- turbines [3, 4], micro-sensors for chemical con- centrations or gas ow properties [5, 6, 7

  9. Value-leverage by Aerospace Original Equipment Manufacturers

    NARCIS (Netherlands)

    Beelaerts van Blokland, W.W.A.

    2010-01-01

    With the creation of new aircraft products; Embraer E-170/190, Dassault 7X, Airbus A380 and Boeing B787, aerospace original equipment manufacturers (OEMs) involve suppliers not only with the co-production of aircraft sub systems, but also with the entire development of sub systems, like fuselage and

  10. 78 FR 72554 - Airworthiness Directives; Gulfstream Aerospace Corporation Airplanes

    Science.gov (United States)

    2013-12-03

    ... ] damaged o-ring between the `wet' and `dry' cavities of the boost pump resulted in fuel ingress into the... Corporation, Technical Publications Dept., P.O. Box 2206, Savannah, GA 31402-2206; telephone 800-810-4853; fax... information identified in this AD, contact Gulfstream Aerospace Corporation, Technical Publications Dept., P.O...

  11. Human Requirements of Flight. Aviation and Spaceflight. Aerospace Education III.

    Science.gov (United States)

    Coard, E. A.

    This book, one in the series on Aerospace Education III, deals with the general nature of human physiology during space flights. Chapter 1 begins with a brief discussion of the nature of the atmosphere. Other topics examined in this chapter include respiration and circulation, principles and problems of vision, noise and vibration, and…

  12. THE VALIDITY AND RELIABILITY STUDIES OF THE COMPUTER ANXIETY SCALE ON EDUCATIONAL ADMINISTRATORS (CAS-EA

    Directory of Open Access Journals (Sweden)

    Esmahan AGAOGLU

    2008-07-01

    Full Text Available ABSTRACT This study aims at investigating the validity and reliability studies of the “Computer Anxiety Scale” (Ceyhan & Gurcan Namlu, 2000 on educational administrators. The data gathered from 143 educational administrators of state schools located in Eskişehir show that the scale consists of 2 factors. The first of these factors, affective anxiety regarding computers independently explains 37.99 % of the variance; the second factor, cognitive anxiety regarding computers forms 12.49 % of the variance. These two factors, which consist of 20 items altogether, explain 50.48 % of the variance. It was found that the scale was able to discriminate the computer anxiety level of educational administrators with respect to computer efficacy. With the scale, the correlation between Spielberger State and Trait Anxiety Inventory (Öner and Le Compte,1983 was calculated as 0.34 and 0.25. In addition, the correlation coefficient between the scale and Happner and Petersen’s Problem-Solving Inventory (Şahin, Şahin, Happner,1993 was found to be 0.40. The internal consistency coefficient was calculated as (a 0.87. Item total score reliability coefficients were calculated between 0.23 and 0.71. As a result, the “Computer Anxiety Scale of Educational Administrators” (CAS-EA was developed.

  13. Comparing ANNs, EAs, and Trees: a basic machine-learning approach to predictive environmental models.

    Science.gov (United States)

    Williams, J.; Poff, N.

    2005-05-01

    Machine learning techniques for ecological applications or "eco-informatics" are becoming increasingly useful and accessible for ecologists. We evaluated the predictive ability of three commercially available (i.e. user-friendly) software packages for artificial neural networks (ANNs), evolutionary algorithms (EAs), and classification/regression trees (Trees). We analyzed fish and habitat data for streams in the mid-Atlantic region of the U.S., which was collected by the U.S. Environmental Protection Agency (EPA). The data includes over 200 environmental descriptors summarizing watershed, stream, and water chemistry characteristics in addition to derived fish community metrics (i.e. richness, IBI scores, % exotics). In our analysis we predicted individual species presence/absence and fish community metrics as a function of these local and regional scale habitat variables. Predictive ability is evaluated with independent validation data. These approaches could prove especially useful for conservation or management applications where ecologists seek to utilize the most comprehensive data to make predictions at various scales. By employing "user-friendly" software we hope to show that ecologists, without extensive knowledge of computational science, can benefit from these techniques by extracting more information about complex ecosystems. Relative strengths and weaknesses of these three approaches are compared and recommendations for their use in conservation applications are presented.

  14. Extensive Air Shower Array at the University of Puebla (EAS-BUAP)

    Science.gov (United States)

    Salazar, H.; Martinez, O.; Moreno, E.; Cotzomi, J.; Villaseñor, L.

    2003-06-01

    We describe the design and operation of the first stage of the EAS-UAP extensive air shower array, as a detector of very high energy cosmic rays (1016 > Eo > 1014eV). The array is located at the Campus of Puebla University. It consist of 18 liquid scintillator detectors, with an active surface of 1 m2 each and a detector spacing of 20 m in a square grid. One Auger Water Cherenkov detector is also included as part of the array. In this report we discuss the stability, the calibration, the arrival direction and lateral distribution function reconstruction capabilities of the detector array, as derived from the 10 detectors in operation in the first stage. Our results shows that the angular accuracy in arrival direction is less than 5.5° in the range from 20° to 60°. The measurements in the Water Cherenkov Detector show us the possibility to separete electromagnetic and muon component. The main characteristics of the array allow us also to use it as educational and training facility.

  15. A Multi-Level Investigation into the Antecedents of Enterprise Architecture (EA) Assimilation in the U.S. Federal Government: A Longitudinal Mixed Methods Research Study

    Science.gov (United States)

    Makiya, George K.

    2012-01-01

    This dissertation reports on a multi-dimensional longitudinal investigation of the factors that influence Enterprise Architecture (EA) diffusion and assimilation within the U.S. federal government. The study uses publicly available datasets of 123 U.S. federal departments and agencies, as well as interview data among CIOs and EA managers within…

  16. The experimental cascade curves of EAS at E sub 0 10(17) eV obtained by the method of detection of Cherenkov pulse shape

    Science.gov (United States)

    Fomin, Y. A.; Kalmykov, G. B.; Khristiansen, M. V.; Motova, M. V.; Nechin, Y. A.; Prosin, V. V.; Zhukov, V. Y.; Efimov, N. N.; Grigoriev, V. M.; Nikiforova, E. S.

    1985-01-01

    The individual cascade curves of EAS with E sub 0 10 to the 17th power eV/I to 3/ were studied by detection of EAS Cherenkov light pulses. The scintillators located at the center of the Yakutsk EAS array within a 500-m radius circle were used to select the showers and to determine the main EAS parameters. The individual cascade curves N(t) were obtained using the EAS Cherenkov light pulses satisfying the following requirements: (1) the signal-to-noise ratio fm/delta sub n 15, (2) the EAS axis-detector distance tau sub 350 m, (3) the zenith angle theta 30 deg, (4) the probability for EAS to be detected by scintillators W 0.8. Condition (1) arises from the desire to reduce the amplitude distortion of Cherenkov pulses due to noise and determines the range of EAS sizes, N(t). The resolution times of the Cherenkov pulse shape detectors are tau sub 0 approx. 23 ns which results in distortion of a pulse during the process of the detection. The distortion of pulses due to the finiteness of tau sub 0 value was estimated. It is shown that the rise time of pulse becomes greater as tau sub 0.5/tau sub 0 ratio decreases.

  17. Guide to Canadian Aerospace Related Industries,

    Science.gov (United States)

    1986-02-28

    select them and electronics products to the US military and civil aviation. for use in the MOHAWK, APACHE . SEAHAWK, AHIP (OH-58D) and BLACKHAWK programs...Piston engine related accessories are also overhauled. Address: 120 East Cordova St The company overhauls the above mentioned engines for corn- Vancouver

  18. Center of Excellence in Aerospace Automation

    Science.gov (United States)

    1986-05-01

    Lisp programs developed by [Steele 1978?1 and extended by [Brooks, Gabriel and Steele 19821 was further refined. In the TAIL compiler there are two...State Sensors Conference, Hilton Head, SC, June 6-8, 1984) as one of the two main factors re- tarding the penetration of silicon sensors into the

  19. NASA/DOD Aerospace Knowledge Diffusion Research Project. Paper 42: An analysis of the transfer of Scientific and Technical Information (STI) in the US aerospace industry

    Science.gov (United States)

    Kennedy, John M.; Pinelli, Thomas E.; Hecht, Laura F.; Barclay, Rebecca O.

    1994-01-01

    The U.S. aerospace industry has a long history of federal support for research related to its needs. Since the establishment of the National Advisory Committee for Aeronautics (NACA) in 1915, the federal government has provided continuous research support related to flight and aircraft design. This research has contributed to the international preeminence of the U.S. aerospace industry. In this paper, we present a sociological analysis of aerospace engineers and scientists and how their attitudes and behaviors impact the flow of scientific and technical information (STI). We use a constructivist framework to explain the spotty dissemination of federally funded aerospace research. Our research is aimed towards providing federal policymakers with a clearer understanding of how and when federally funded aerospace research is used. This understanding will help policymakers design improved information transfer systems that will aid the competitiveness of the U.S. aerospace industry.

  20. Assessing the Training and Operational Proficiency of China’s Aerospace Forces: Selections from the Inaugural Conference of the China Aerospace Studies Institute (CASI)

    Science.gov (United States)

    2016-01-01

    Edmund J. Burke, Astrid Stuth Cevallos, Mark R. Cozad, Timothy R. Heath Assessing the Training and Operational Proficiency of China’s Aerospace ...Forces Selections from the Inaugural Conference of the China Aerospace Studies Institute (CASI) C O R P O R A T I O N Limited Print and Electronic...iii Preface On June 22, 2015, the China Aerospace Studies Institute (CASI), in conjunction with Headquarters, Air Force, held a day-long

  1. NASA/DOD Aerospace Knowledge Diffusion Research Project. Paper 49: Becoming an aerospace engineer: A cross-gender comparison

    Science.gov (United States)

    Hecht, Laura M.; Pinelli, Thomas E.; Barclay, Rebecca O.; Kennedy, John M.

    1995-01-01

    We conducted a mail (self-reported) survey of 4300 student members of the American Institute of Aeronautics and Astronautics (AIAA) during the spring of 1993 as a Phase 3 activity of the NASA/DoD Aerospace Knowledge Diffusion Research Project. The survey was designed to explore students' career goals and aspirations, communications skills training, and their use of information sources, products, and services. We received 1723 completed questionnaires for an adjusted response rate of 42%. In this article, we compare the responses of female and male aerospace engineering students in the context of two general aspects of their educational experience. First, we explore the extent to which women and men differ in regard to factors that lead to the choice to study aerospace engineering, their current level of satisfaction with that choice, and their career-related goals and aspirations. Second, we examine students' responses to questions about communications skills training and the helpfulness of that training, and their use of and the importance to them of selected information sources, products, and services. The cross-gender comparison revealed more similarities than differences. Female students appear to be more satisfied than their male counterparts with the decision to major in aerospace engineering. Both female and male student respondents consider communications skills important for professional success, but females place a higher value than males do on oral communications skills. Women students also place a higher value than men do on the roles of other students and faculty members in satisfying their needs for information.

  2. Automated Modeling and Simulation Using the Bond Graph Method for the Aerospace Industry

    Science.gov (United States)

    Granda, Jose J.; Montgomery, Raymond C.

    2003-01-01

    Bond graph modeling was originally developed in the late 1950s by the late Prof. Henry M. Paynter of M.I.T. Prof. Paynter acted well before his time as the main advantage of his creation, other than the modeling insight that it provides and the ability of effectively dealing with Mechatronics, came into fruition only with the recent advent of modern computer technology and the tools derived as a result of it, including symbolic manipulation, MATLAB, and SIMULINK and the Computer Aided Modeling Program (CAMPG). Thus, only recently have these tools been available allowing one to fully utilize the advantages that the bond graph method has to offer. The purpose of this paper is to help fill the knowledge void concerning its use of bond graphs in the aerospace industry. The paper first presents simple examples to serve as a tutorial on bond graphs for those not familiar with the technique. The reader is given the basic understanding needed to appreciate the applications that follow. After that, several aerospace applications are developed such as modeling of an arresting system for aircraft carrier landings, suspension models used for landing gears and multibody dynamics. The paper presents also an update on NASA's progress in modeling the International Space Station (ISS) using bond graph techniques, and an advanced actuation system utilizing shape memory alloys. The later covers the Mechatronics advantages of the bond graph method, applications that simultaneously involves mechanical, hydraulic, thermal, and electrical subsystem modeling.

  3. Lithium-Ion Polymer Rechargeable Battery Developed for Aerospace and Military Applications

    Science.gov (United States)

    Hagedorn, orman H.

    1999-01-01

    A recently completed 3 -year project funded by the Defense Advanced Research Projects Agency (DARPA) under the Technology Reinvestment Program has resulted in the development and scaleup of new lithium-ion polymer battery technology for military and aerospace applications. The contractors for this cost-shared project were Lockheed Martin Missiles & Space and Ultralife Batteries, Inc. The NASA Lewis Research Center provided contract management and technical oversight. The final products of the project were a portable 15-volt (V), 10-ampere-hour (A-hr) military radio battery and a 30-V, 50-A-hr marine/aerospace battery. Lewis will test the 50-A-hr battery. The new lithium-ion polymer battery technology offers a threefold or fourfold reduction in mass and volume, relative to today s commonly used nickel-cadmium, nickel-hydrogen, and nickel-metal hydride batteries. This is of special importance for orbiting satellites. It has been determined for a particular commercial communications satellite that the replacement of 1 kg of battery mass with 1 kg of transponder mass could increase the annual revenue flow by $100 000! Since this lithium-ion polymer technology offers battery mass reductions on the order of hundreds of kilograms for some satellites, the potential revenue increases are impressive.

  4. NASA Perspective and Modeling of Thermal Runaway Propagation Mitigation in Aerospace Batteries

    Science.gov (United States)

    Shack, P.; Iannello, C.; Rickman, S.; Button, R.

    2014-01-01

    NASA has traditionally sought to reduce the likelihood of a single cell thermal runaway (TR) in their aerospace batteries to an absolute minimum by employing rigorous screening program of the cells. There was generally a belief that TR propagation resulting in catastrophic failure of the battery was a forgone conclusion for densely packed aerospace lithium-ion batteries. As it turns out, this may not be the case. An increasing number of purportedly TR propagation-resistant batteries are appearing among NASA partners in the commercial sector and the Department of Defense. In the recent update of the battery safety standard (JSC 20793) to address this paradigm shift, the NASA community included requirements for assessing TR severity and identifying simple, low-cost severity reduction measures. Unfortunately, there are no best-practice guidelines for this work in the Agency, so the first project team attempting to meet these requirements would have an undue burden placed upon them. A NASA engineering Safety Center (NESC) team set out to perform pathfinding activities for meeting those requirements. This presentation will provide contextual background to this effort, as well as initial results in attempting to model and simulate TR heat transfer and propagation within battery designs.

  5. Person-job and person-organization fits: Co-op fits in an aerospace engineering environment

    Science.gov (United States)

    Urban, Anthony John, Jr.

    This dissertation research was a replication of a quantitative study completed by Dr. Cynthia Shantz at Wayne State University during 2003. The intent of the research was to investigate the fits of college students who participated in cooperative academic-work programs (co-ops) to employment positions within aerospace engineering. The objective of investigating person-job (P-J) and person-organization (P-O) fits was to determine if variables could be identified that indicated an individual's aptitude to complete successfully aerospace engineering standard work. Research participants were co-op employees who were surveyed during their employment to identify indications of their fits into their organization and job assignments. Dr. Shantz's research led to the thought employment success might increase when P-J and P-O fits increase. For example, reduced initial training investments and increased employee retention might result with improved P-O and P-J fits. Research data were gathered from surveys of co-ops who worked at a Connecticut aerospace engineering company. Data were collected by distributing invitations to co-ops to participate in three online surveys over a 9-11 week period. Distribution of survey invitations was accomplished through the Human Resources Department to ensure that respondent identities were maintained private. To protect anonymity and privacy further, no identifying information about individuals or the company is published. However, some demographic information was collected to ensure that correlations were based on valid and reliable data and research and analysis methods. One objective of this research was to determine if co-op characteristics could be correlated with successful employment in an aerospace engineering environment. A second objective was to determine if P-J and P-O fits vary over time as co-ops become increasing familiar with their assignments, organization, and environment. Understanding and incorporating the use P-J and P

  6. Integration of Machining and Inspection in Aerospace Manufacturing

    Science.gov (United States)

    Simpson, Bart; Dicken, Peter J.

    2011-12-01

    The main challenge for aerospace manufacturers today is to develop the ability to produce high-quality products on a consistent basis as quickly as possible and at the lowest-possible cost. At the same time, rising material prices are making the cost of scrap higher than ever so making it more important to minimise waste. Proper inspection and quality control methods are no longer a luxury; they are an essential part of every manufacturing operation that wants to grow and be successful. However, simply bolting on some quality control procedures to the existing manufacturing processes is not enough. Inspection must be fully-integrated with manufacturing for the investment to really produce significant improvements. The traditional relationship between manufacturing and inspection is that machining is completed first on the company's machine tools and the components are then transferred to dedicated inspection equipment to be approved or rejected. However, as machining techniques become more sophisticated, and as components become larger and more complex, there are a growing number of cases where closer integration is required to give the highest productivity and the biggest reductions in wastage. Instead of a simple linear progression from CAD to CAM to machining to inspection, a more complicated series of steps is needed, with extra data needed to fill any gaps in the information available at the various stages. These new processes can be grouped under the heading of "adaptive machining". The programming of most machining operations is based around knowing three things: the position of the workpiece on the machine, the starting shape of the material to be machined, and the final shape that needs to be achieved at the end of the operation. Adaptive machining techniques allow successful machining when at least one of those elements is unknown, by using in-process measurement to close the information gaps in the process chain. It also allows any errors to be spotted

  7. NASA/DOD Aerospace Knowledge Diffusion Research Project. Paper 60: Culture and Workplace Communications: A Comparison of the Technical Communications Practices of Japanese and US Aerospace Engineers and Scientists

    Science.gov (United States)

    Pinelli, Thomas E.; Sato, Yuko; Barclay, Rebecca O.; Kennedy, John M.

    1997-01-01

    The advent of global markets elevates the role and importance of culture as a mitigating factor in the diffusion of knowledge and technology and in product and process innovation. This is especially true in the Large Commercial Aircraft (LCA) sector where the production and market aspects are becoming increasingly international. As firms expand beyond their national borders, using such methods as risk- sharing partnerships, joint ventures, outsourcing, and alliances, they have to contend with national and corporate cultures. Our focus is on Japan, a 'program participant' in the production of the Boeing Company's 777; the influence of Japanese culture on the diffusion of knowledge and technology in aerospace at the national and international levels; those cultural determinants-the propensity to work together, a willingness to subsume individual interests to a greater good, and an emphasis on consensual decisionmaking-that have a direct bearing on the ability of Japanese firms to form alliances and compete in international markets; and those cultural determinants thought to influence the information- seeking behaviors and workplace communication practices of Japanese aerospace engineers and scientists. In this paper, we report selective results from a survey of Japanese and U.S. aerospace engineers and scientists that focused on workplace communications. Data are presented for the following topics: importance of and time spent communicating information, collaborative writing, need for an undergraduate course in technical communication, use of libraries, use and importance of electronic (computer) networks, and the use and importance of foreign and domestically produced technical reports.

  8. U.S. Aerospace and Aviation Industry: A State-By-State Analysis

    Science.gov (United States)

    2002-01-01

    President George W. Bush and the Congress created the Commission on the Future of the United States Aerospace Industry to evaluate the current and future health of the industry as well as the challenges that lie ahead for the U.S. workforce and the economy. To accomplish our mission, we commissioned a study on the economic impact of the aerospace industry nationally and on a state-by-state basis, using the best available U.S. government data. This study sought to define the core of the aerospace industry. The resulting data represents that very core those jobs specifically tied to commercial and civilian aerospace. U.S. Aerospace and Aviation: A State-by-State Analysis examines the civilian and commercial aerospace and aviation industry by employment, wages, payroll, and establishments. The report found that the U.S. civilian and commercial aerospace and aviation industry employed over 2 million workers in 2001.

  9. 75 FR 3209 - Mission Statement: U.S. Aerospace Business Development Mission to Canada, April 14-15, 2010

    Science.gov (United States)

    2010-01-20

    ... International Trade Administration Mission Statement: U.S. Aerospace Business Development Mission to Canada.... and Foreign Commercial Service is organizing a U.S. Aerospace Business Development Mission to Montreal, Canada, April 14-15, 2010. This aerospace mission is designed to provide U.S. aerospace export-ready...

  10. Liminality in cultural transition: applying ID-EA to advance a concept into theory-based practice.

    Science.gov (United States)

    Baird, Martha B; Reed, Pamela G

    2015-01-01

    As global migration increases worldwide, nursing interventions are needed to address the effects of migration on health. The concept of liminality emerged as a pivotal concept in the situation-specific theory of well-being in refugee women experiencing cultural transition. As a relatively new concept in the discipline of nursing, liminality is explored using a method, called ID-EA, which we developed to advance a theoretical concept for application to nursing practice. Liminality in the context of cultural transition is further developed using the five steps of inquiry of the ID-EA method. The five steps are as follows: (1) inductive inquiry: qualitative research, (2) deductive inquiry: literature review, (3) synthesis of inductive and deductive inquiry, (4) evaluation inquiry, and (5) application-to-practice inquiry. The overall goal of this particular work was to develop situation-specific, theory-based interventions that facilitate cultural transitions for immigrants and refugees.

  11. Elements of a collaborative systems model within the aerospace industry

    Science.gov (United States)

    Westphalen, Bailee R.

    2000-10-01

    Scope and method of study. The purpose of this study was to determine the components of current aerospace collaborative efforts. There were 44 participants from two selected groups surveyed for this study. Nineteen were from the Oklahoma Air National Guard based in Oklahoma City representing the aviation group. Twenty-five participants were from the NASA Johnson Space Center in Houston representing the aerospace group. The surveys for the aviation group were completed in reference to planning missions necessary to their operations. The surveys for the aerospace group were completed in reference to a well-defined and focused goal from a current mission. A questionnaire was developed to survey active participants of collaborative systems in order to consider various components found within the literature. Results were analyzed and aggregated through a database along with content analysis of open-ended question comments from respondents. Findings and conclusions. This study found and determined elements of a collaborative systems model in the aerospace industry. The elements were (1) purpose or mission for the group or team; (2) commitment or dedication to the challenge; (3) group or team meetings and discussions; (4) constraints of deadlines and budgets; (5) tools and resources for project and simulations; (6) significant contributors to the collaboration; (7) decision-making formats; (8) reviews of project; (9) participants education and employment longevity; (10) cross functionality of team or group members; (11) training on the job plus teambuilding; (12) other key elements identified relevant by the respondents but not included in the model such as communication and teamwork; (13) individual and group accountability; (14) conflict, learning, and performance; along with (15) intraorganizational coordination. These elements supported and allowed multiple individuals working together to solve a common problem or to develop innovation that could not have been

  12. Aerospace Medicine and Biology: A Continuing Bibliography With Indexes

    Science.gov (United States)

    1997-01-01

    This issue of Aerospace Medicine and Biology, A Continuing Bibliography with Indexes NASA SP-7O11 lists reports, articles, and other documents recently announced in the NASA STI Database. In its subject coverage, Aerospace Medicine and Biology concentrates on the biological, physiological, psychological, and environmental effects to which humans are subjected during and following simulated or actual flight in the Earth's atmosphere or in interplanetary space. References describing similar effects on biological organisms of lower order are also included. Such related topics as sanitary problems, pharmacology, toxicology, safety and survival, life support systems, exobiology, and personnel factors receive appropriate attention. Applied research receives the most emphasis, but references to fundamental studies and theoretical principles related to experimental development also qualify for inclusion.

  13. Aerospace Medicine and Biology: A Continuing Bibliography. Supplement 476

    Science.gov (United States)

    1998-01-01

    This supplemental issue of Aerospace Medicine and Biology, A Continuing Bibliography with Indexes (NASA/SP-1998-7011) lists reports, articles, and other documents recently announced in the NASA STI Database. In its subject coverage, Aerospace Medicine and Biology concentrates on the biological, physiological, psychological, and environmental effects to which humans are subjected during and following simulated or actual flight in the Earth's atmosphere or in interplanetary space. References describing similar effects on biological organisms of lower order are also included. Such related topics as sanitary problems, pharmacology, toxicology, safety and survival, life support systems, exobiology, and personnel factors receive appropriate attention. Applied research receives the most emphasis, but references to fundamental studies and theoretical principles related to experimental development also qualify for inclusion. Each entry in the publication consists of a standard bibliographic citation accompanied, in most cases, by an abstract.

  14. Aerospace Medicine and Biology: A Continuing Bibliography. Supplement 475

    Science.gov (United States)

    1998-01-01

    This supplemental issue of Aerospace Medicine and Biology, A Continuing Bibliography with Indexes lists reports, articles, and other documents recently announced in the NASA STI Database. In its subject coverage, Aerospace Medicine and Biology concentrates on the biological, physiological, psychological, and environmental effects to which humans are subjected during and following simulated or actual flight in the Earth's atmosphere or in interplanetary space. References describing similar effects on biological organisms of lower order are also included. Such related topics as sanitary problems, pharmacology, toxicology, safety and survival, life support systems, exobiology, and personnel factors receive appropriate attention. Applied research receives the most emphasis, but references to fundamental studies and theoretical principles related to experimental development also qualify for inclusion.

  15. D3: A Collaborative Infrastructure for Aerospace Design

    Science.gov (United States)

    Walton, Joan; Filman, Robert E.; Knight, Chris; Korsmeyer, David J.; Lee, Diana D.; Clancy, Daniel (Technical Monitor)

    2001-01-01

    DARWIN is a NASA developed, Internet-based system for enabling aerospace researchers to securely and remotely access and collaborate on the analysis of aerospace vehicle design data, primarily the results of wind-tunnel testing and numeric (e.g., computational fluid dynamics) model executions. DARWIN captures, stores and indexes data, manages derived knowledge (such as visualizations across multiple data sets) and provides an environment for designers to collaborate in the analysis of the results of testing. DARWIN is an interesting application because it supports high volumes of data, integrates multiple modalities of data display (e.g. images and data visualizations), and provides non-trivial access control mechanisms. DARWIN enables collaboration by allowing not only sharing visualizations of data, but also commentary about and view of data.

  16. Extended GTST-MLD for aerospace system safety analysis.

    Science.gov (United States)

    Guo, Chiming; Gong, Shiyu; Tan, Lin; Guo, Bo

    2012-06-01

    The hazards caused by complex interactions in the aerospace system have become a problem that urgently needs to be settled. This article introduces a method for aerospace system hazard interaction identification based on extended GTST-MLD (goal tree-success tree-master logic diagram) during the design stage. GTST-MLD is a functional modeling framework with a simple architecture. Ontology is used to extend the ability of system interaction description in GTST-MLD by adding the system design knowledge and the past accident experience. From the level of functionality and equipment, respectively, this approach can help the technician detect potential hazard interactions. Finally, a case is used to show the method. © 2011 Society for Risk Analysis.

  17. Aerospace Communications Technologies in Support of NASA Mission

    Science.gov (United States)

    Miranda, Felix A.

    2016-01-01

    NASA is endeavoring in expanding communications capabilities to enable and enhance robotic and human exploration of space and to advance aero communications here on Earth. This presentation will discuss some of the research and technology development work being performed at the NASA Glenn Research Center in aerospace communications in support of NASAs mission. An overview of the work conducted in-house and in collaboration with academia, industry, and other government agencies (OGA) to advance radio frequency (RF) and optical communications technologies in the areas of antennas, ultra-sensitive receivers, power amplifiers, among others, will be presented. In addition, the role of these and other related RF and optical communications technologies in enabling the NASA next generation aerospace communications architecture will be also discussed.

  18. Measurement of baseline and orientation between distributed aerospace platforms.

    Science.gov (United States)

    Wang, Wen-Qin

    2013-01-01

    Distributed platforms play an important role in aerospace remote sensing, radar navigation, and wireless communication applications. However, besides the requirement of high accurate time and frequency synchronization for coherent signal processing, the baseline between the transmitting platform and receiving platform and the orientation of platform towards each other during data recording must be measured in real time. In this paper, we propose an improved pulsed duplex microwave ranging approach, which allows determining the spatial baseline and orientation between distributed aerospace platforms by the proposed high-precision time-interval estimation method. This approach is novel in the sense that it cancels the effect of oscillator frequency synchronization errors due to separate oscillators that are used in the platforms. Several performance specifications are also discussed. The effectiveness of the approach is verified by simulation results.

  19. A Taxonomy for Insourcing in the Aerospace Industry

    Science.gov (United States)

    2011-06-01

    1 A TAXONOMY FOR INSOURCING IN THE AEROSPACE INDUSTRY Chapter 1 Introduction A 2010 study by Forbes and Lederman ...trying to attract new business (Forbes and Lederman 2010). If insourcing is better when adaptability, flexibility, and cost are needed; why do...May 2011. Forbes, Silke, and Mara Lederman . “Does Vertical Integration Affect Firm ? Evidence from the Airline Industry,” Rand Journal of

  20. Aerospace Medicine and Biology: A Continuing Bibliography with Indexes

    Science.gov (United States)

    1987-09-01

    plantar flexion, third finger flexion, handgrip, group compared to 25.0 percent in the control group. There were and knee extension. Muscle ischemia...MONSON, WILLIAM J. SEARS, and the bottom up under the command of microprocessors . O.C. FRED J. ABELES (Grumman Aerospace Corp., Space Systems Div...behavior type in frustrating circumstances components in lie detection and mental prosthesis . GRA and professional success is emphasized. Examples of

  1. Industrial Design in Aerospace/Role of Aesthetics

    Science.gov (United States)

    Bushnell, Dennis M.

    2006-01-01

    Industrial design creates and develops concepts and specifications that seek to simultaneously and synergistically optimize function, production, value and appearance. The inclusion of appearance, or esthetics, as a major design metric represents both an augmentation of conventional engineering design and an intersection with artistic endeavor(s). Report surveys past and current industrial design practices and examples across aerospace including aircraft and spacecraft, both exterior and interior.

  2. Multistage aerospace craft. [perspective drawings of conceptual design

    Science.gov (United States)

    Kelly, D. L. (Inventor)

    1973-01-01

    A conceptual design of a multi-stage aerospace craft is presented. Two perspective views of the vehicle are developed to show the two component configuration with delta wing, four vertical tail surfaces, tricycle landing gear, and two rocket exhaust nozzles at the rear of the fuselage. Engines for propulsion in the atmosphere are mounted on the fuselage in front of the wing root attachment.

  3. Aerothermodynamic Optimization of Aerospace Plane Airfoil Leading Edge

    OpenAIRE

    Zhou, Chen; Wang, Zhijin; Zhi, Jiaoyang; Kretov, Anatolii

    2017-01-01

    ABSTRACT: Aiming to mitigate the aerodynamic heating during hypersonic re-entry, the aerothermodynamic optimization of aerospace plane airfoil leading edge is conducted. Lift-to-drag ratio at landing condition is taken as a constraint to ensure the landing aerodynamic performance. First, airfoil profile is parametrically described to be more advantageous during the optimization process, and the Hicks-Henne type function is improved considering its application on the airfoil leading edge. Comp...

  4. Aerospace Battery Activities at NASA/Goddard Space Flight Center

    Science.gov (United States)

    Rao, Gopalakrishna M.

    2006-01-01

    Goddard Space Flight Center has "pioneered" rechargeable secondary battery design, test, infusion and in-orbit battery management among NASA installations. Nickel cadmium batteries of various designs and sizes have been infused for LEO, GEO and Libration Point spacecraft. Nickel-Hydrogen batteries have currently been baselined for the majority of our missions. Li-Ion batteries from ABSL, JSB, SaFT and Lithion have been designed and tested for aerospace application.

  5. Testing Aerospace Gears for Bending Fatigue, Pitting, and Scuffing

    Science.gov (United States)

    Krantz, Timothy; Anderson, Cody; Shareef, Iqbal; Fetty, Jason

    2017-01-01

    This work was motivated by the goal to increase the power to weight ratio of rotorcraft drive systems. Experiments were conducted to establish the performance of gears made from an aerospace alloy used in production aircraft. Bending fatigue, pitting, and scuffing test procedures and results are documented. The data establishes a baseline for evaluation of new technologies. Recommendations are made to improve test procedures for future work.

  6. The aerospace energy systems laboratory: Hardware and software implementation

    Science.gov (United States)

    Glover, Richard D.; Oneil-Rood, Nora

    1989-01-01

    For many years NASA Ames Research Center, Dryden Flight Research Facility has employed automation in the servicing of flight critical aircraft batteries. Recently a major upgrade to Dryden's computerized Battery Systems Laboratory was initiated to incorporate distributed processing and a centralized database. The new facility, called the Aerospace Energy Systems Laboratory (AESL), is being mechanized with iAPX86 and iAPX286 hardware running iRMX86. The hardware configuration and software structure for the AESL are described.

  7. Alternative Solvents and Technologies for Precision Cleaning of Aerospace Components

    Science.gov (United States)

    Grandelli, Heather; Maloney, Phillip; DeVor, Robert; Hintze, Paul

    2014-01-01

    Precision cleaning solvents for aerospace components and oxygen fuel systems, including currently used Vertrel-MCA, have a negative environmental legacy, high global warming potential, and have polluted cleaning sites. Thus, alternative solvents and technologies are being investigated with the aim of achieving precision contamination levels of less than 1 mg/sq ft. The technologies being evaluated are ultrasonic bath cleaning, plasma cleaning and supercritical carbon dioxide cleaning.

  8. Output Feedback M-MRAC Backstepping With Aerospace Applications

    Science.gov (United States)

    Stepanyan, Vahram; Krishnakumar, Kalmanje Sriniva

    2014-01-01

    The paper presents a certainty equivalence output feedback backstepping adaptive control design method for the systems of any relative degree with unmatched uncertainties without over-parametrization. It uses a fast prediction model to estimate the unknown parameters, which is independent of the control design. It is shown that the system's input and output tracking errors can be systematically decreased by the proper choice of the design parameters. The approach is applied to aerospace control problems and tested in numerical simulations.

  9. Magnetic Gearing Versus Conventional Gearing in Actuators for Aerospace Applications

    Science.gov (United States)

    Puchhammer, Gregor

    2014-01-01

    Magnetic geared actuators (MGA) are designed to perform highly reliable, robust and precise motion on satellite platforms or aerospace vehicles. The design allows MGA to be used for various tasks in space applications. In contrast to conventional geared drives, the contact and lubrication free force transmitting elements lead to a considerable lifetime and range extension of drive systems. This paper describes the fundamentals of magnetic wobbling gears (MWG) and the deduced inherent characteristics, and compares conventional and magnetic gearing.

  10. Standard Terminology Relating to Aerospace Transparent Materials and Enclosures

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2005-01-01

    1.1 These definitions cover generic optical terms which appear in one of more standards relating to aerospace transparent materials and enclosures. 1.2 The definitions cover, in most cases, special meanings used in the transparency industry. No attempt has been made to include common meanings of the same terms as used outside of the transparency industry. 1.3 Definitions included have, in general, been approved as standard.

  11. Aerospace Structural Metals Handbook. Volume 5. Supplement XI. Nonferrous Alloys

    Science.gov (United States)

    1978-12-01

    TD Nickel Dec 70 4116 68Ni-29Cu-3A1-0.5Ti... TD . J Cr Sep T1 1977. [,elfour Stulen, Inc. AEROSPACE STRUCTURAL METALS...SýImeraltc,yl;." Paperip.7sentd at ASMNall~c llt, Stii 1 4lv, ndSuea 0ly " S’: 7 2l5A(172 Steesgilt Nickel Base Al loy,’’ (19104) Clarek t’eptgaii’t

  12. NASA/DOD Aerospace Knowledge Diffusion Research Project. Paper 14: An analysis of the technical communications practices reported by Israeli and US aerospace engineers and scientists

    Science.gov (United States)

    Barclay, Rebecca O.; Pinelli, Thomas E.; Elazar, David; Kennedy, John M.

    1991-01-01

    As part of Phase 4 of the NASA/DoD Aerospace Knowledge Diffusion Research Project, two pilot studies were conducted that investigated the technical communications practices of Israeli and U.S. aerospace engineers and scientists. Both studies had the same five objectives: first, to solicit the opinions of aerospace engineers and scientists regarding the importance of technical communications to their profession; second, to determine the use and production of technical communications by aerospace engineers and scientists; third, to seek their view about the appropriate content of an undergraduate course in technical communications; fourth, to determine aerospace engineers' and scientists' use of libraries, technical information centers, and on-line databases; and fifth, to determine the use and importance of computer and information technology to them. A self-administered questionnaire was mailed to randomly selected U.S. aerospace engineers and scientists who are working in cryogenics, adaptive walls, and magnetic suspension. A slightly modified version was sent to Israeli aerospace engineers and scientists working at Israel Aircraft Industries, LTD. Responses of the Israeli and U.S. aerospace engineers and scientists to selected questions are presented in this paper.

  13. Improving Attitudes and Practices in Teaching/Learning by Means of Aerospace In-Service Teacher Education. Aerospace Teacher Education Statistical Study.

    Science.gov (United States)

    Romero, J. Christian

    The purpose of this investigation was to examine the relationship of the first two aerospace education workshops conducted by the United States Space Foundation and sponsored by the Univesity of Colorado, Colorado Springs, and the United States Air Force Academy to attitudes and practices of workshop participants regarding aerospace education. To…

  14. Integrated Manufacturing of Aerospace Components by Superplastic Forming Technology

    Directory of Open Access Journals (Sweden)

    Ju Min Kyung

    2015-01-01

    Full Text Available Aerospace vehicle requires lightweight structures to obtain weight saving and fuel efficiency. It is known that superplastic characteristics of some materials provide significant opportunity for forming complicated, lightweight components of aerospace structure. One of the most important advantages of using superplastic forming process is its simplicity to form integral parts and economy in tooling[1]. For instance, it can be applied to blow-forming, in which a metal sheet is deformed due to the pressure difference of hydrostatic gas on both sides of the sheet. Since the loading medium is gas pressure difference, this forming is different from conventional sheet metal forming technique in that this is stress-controlled rather than strain and strain rate controlled. This method is especially advantageous when several sheet metals are formed into complex shapes. In this study, it is demonstrated that superplastic forming process with titanium and steel alloy can be applied to manufacturing lightweight integral structures of aerospace structural parts and rocket propulsion components. The result shows that the technology to design and develop the forming process of superplastic forming can be applied for near net shape forming of a complex contour of a thrust chamber and a toroidal fuel tank.

  15. PREFACE: Trends in Aerospace Manufacturing 2009 International Conference

    Science.gov (United States)

    Ridgway, Keith; Gault, Rosemary; Allen, Adrian

    2011-12-01

    The aerospace industry is rapidly changing. New aircraft structures are being developed and aero-engines are becoming lighter and more environmentally friendly. In both areas, innovative materials and manufacturing methods are used in an attempt to get maximum performance for minimum cost. At the same time, the structure of the industry has changed and there has been a move from large companies designing, manufacturing components and assembling aircraft to one of large global supply chains headed by large system integrators. All these changes have forced engineers and managers to bring in innovations in design, materials, manufacturing technologies and supply chain management. In September 2009, the Advanced Manufacturing Research Centre (AMRC) at the University of Sheffield held the inaugural Trends in Aerospace Manufacturing conference (TRAM09). This brought together 28 speakers over two days, who presented in sessions on advanced manufacturing trends for the aerospace sector. Areas covered included new materials, including composites, advanced machining, state of the art additive manufacturing techniques, assembly and supply chain issues.

  16. Sensor Selection and Optimization for Health Assessment of Aerospace Systems

    Science.gov (United States)

    Maul, William A.; Kopasakis, George; Santi, Louis M.; Sowers, Thomas S.; Chicatelli, Amy

    2008-01-01

    Aerospace systems are developed similarly to other large-scale systems through a series of reviews, where designs are modified as system requirements are refined. For space-based systems few are built and placed into service these research vehicles have limited historical experience to draw from and formidable reliability and safety requirements, due to the remote and severe environment of space. Aeronautical systems have similar reliability and safety requirements, and while these systems may have historical information to access, commercial and military systems require longevity under a range of operational conditions and applied loads. Historically, the design of aerospace systems, particularly the selection of sensors, is based on the requirements for control and performance rather than on health assessment needs. Furthermore, the safety and reliability requirements are met through sensor suite augmentation in an ad hoc, heuristic manner, rather than any systematic approach. A review of the current sensor selection practice within and outside of the aerospace community was conducted and a sensor selection architecture is proposed that will provide a justifiable, defendable sensor suite to address system health assessment requirements.

  17. Aerospace Engineering Systems and the Advanced Design Technologies Testbed Experience

    Science.gov (United States)

    VanDalsem, William R.; Livingston, Mary E.; Melton, John E.; Torres, Francisco J.; Stremel, Paul M.

    1999-01-01

    Continuous improvement of aerospace product development processes is a driving requirement across much of the aerospace community. As up to 90% of the cost of an aerospace product is committed during the first 10% of the development cycle, there is a strong emphasis on capturing, creating, and communicating better information (both requirements and performance) early in the product development process. The community has responded by pursuing the development of computer-based systems designed to enhance the decision-making capabilities of product development individuals and teams. Recently, the historical foci on sharing the geometrical representation and on configuration management are being augmented: 1) Physics-based analysis tools for filling the design space database; 2) Distributed computational resources to reduce response time and cost; 3) Web-based technologies to relieve machine-dependence; and 4) Artificial intelligence technologies to accelerate processes and reduce process variability. The Advanced Design Technologies Testbed (ADTT) activity at NASA Ames Research Center was initiated to study the strengths and weaknesses of the technologies supporting each of these trends, as well as the overall impact of the combination of these trends on a product development event. Lessons learned and recommendations for future activities are reported.

  18. An e-learning platform for aerospace medicine.

    Science.gov (United States)

    Bamidis, P D; Konstantinidis, S; Papadelis, C L; Perantoni, E; Styliadis, C; Kourtidou-Papadeli, C; Kourtidou-Papadeli, C; Pappas, C

    2008-08-01

    The appeal of online education and distance learning as an educational alternative is ever increasing. To support and accommodate the over-specialized knowledge available by different experts, information technology can be employed to develop virtual distributed pools of autonomous specialized educational modules and provide the mechanisms for retrieving and sharing them. New educational standards such as SCORM and Healthcare LOM enhance this process of sharing by offering qualities like interoperability, accessibility, and reusability, so that learning material remains credible, up-to-date and tracks changes and developments of medical techniques and standards through time. Given that only a few e-learning courses exist in aerospace medicine the material of which may be exchanged among teachers, the aim of this paper is to illustrate the procedure of creating a SCORM compliant course that incorporates notions of recent advances in social web technologies. The course is in accordance with main educational and technological details and is specific to pulmonary disorders in aerospace medicine. As new educational trends place much emphasis in continuing medical education, the expansion of a general practitioner's knowledge in topics such as aviation and aerospace pulmonary disorders for crew and passengers becomes a societal requirement.

  19. Aerospace Sensor Systems: From Sensor Development To Vehicle Application

    Science.gov (United States)

    Hunter, Gary W.

    2008-01-01

    This paper presents an overview of years of sensor system development and application for aerospace systems. The emphasis of this work is on developing advanced capabilities for measurement and control of aeropropulsion and crew vehicle systems as well as monitoring the safety of those systems. Specific areas of work include chemical species sensors, thin film thermocouples and strain gages, heat flux gages, fuel gages, SiC based electronic devices and sensors, space qualified electronics, and MicroElectroMechanical Systems (MEMS) as well as integrated and multifunctional sensor systems. Each sensor type has its own technical challenges related to integration and reliability in a given application. The general approach has been to develop base sensor technology using microfabrication techniques, integrate sensors with "smart" hardware and software, and demonstrate those systems in a range of aerospace applications. Descriptions of the sensor elements, their integration into sensors systems, and examples of sensor system applications will be discussed. Finally, suggestions related to the future of sensor technology will be given. It is concluded that smart micro/nano sensor technology can revolutionize aerospace applications, but significant challenges exist in maturing the technology and demonstrating its value in real-life applications.

  20. Resource Management and Contingencies in Aerospace Concurrent Engineering

    Science.gov (United States)

    Karpati, Gabe; Hyde, Tupper; Peabody, Hume; Garrison, Matthew

    2012-01-01

    significant concern in designing complex systems implementing new technologies is that while knowledge about the system is acquired incrementally, substantial financial commitments, even make-or-break decisions, must be made upfront, essentially in the unknown. One practice that helps in dealing with this dichotomy is the smart embedding of contingencies and margins in the design to serve as buffers against surprises. This issue presents itself in full force in the aerospace industry, where unprecedented systems are formulated and committed to as a matter of routine. As more and more aerospace mission concepts are generated by concurrent design laboratories, it is imperative that such laboratories apply well thought-out contingency and margin structures to their designs. The first part of this publication provides an overview of resource management techniques and standards used in the aerospace industry. That is followed by a thought provoking treatise on margin policies. The expose presents the actual flight telemetry data recorded by the thermal discipline during several recent NASA Goddard Space Flight Center missions. The margins actually achieved in flight are compared against pre-flight predictions, and the appropriateness and the ramifications of having designed with rigid margins to bounding stacked worst case conditions are assessed. The second half of the paper examines the particular issues associated with the application of contingencies and margins in the concurrent engineering environment. In closure, a discipline-by-discipline disclosure of the contingency and margin policies in use at the Integrated Design Center at NASA s Goddard Space Flight Center is made.