WorldWideScience

Sample records for program delivery modalities

  1. Family Coaching as a delivery modality for evidence-based prevention programs.

    Science.gov (United States)

    Rotheram-Borus, Mary Jane; Swendeman, Dallas; Rotheram-Fuller, Erin; Youssef, Maryann K

    2017-08-01

    Family Coaching is proposed as a new delivery format for evidence-based prevention programs (EBPPs). Three recent developments in health promotion support the potential efficacy of Family Coaching: (1) renewed interest in integrated prevention programs for multiple risk factors and behavior changes, (2) broad and long-term impacts of family-based interventions, and (3) popular acceptance of "coaching" as a nonstigmatizing, goal-focused intervention strategy. Family coaches are community members and paraprofessionals trained in common elements of EBPP. Family Coaching has specific goals, is short term, and has definable outcomes. Coaches frame the program's goals to be consistent with the family's values, normalize the family's experience, assess their strengths, and help the family set goals and develop skills and routines to problem solve challenging situations. Broad dissemination of EBPP will be facilitated with delivery formats that are flexible to meet families' priorities and providers' desires and capacities to tailor programs to local contexts.

  2. Clinician-led, peer-led, and internet-delivered dissonance-based eating disorder prevention programs: Acute effectiveness of these delivery modalities.

    Science.gov (United States)

    Stice, Eric; Rohde, Paul; Shaw, Heather; Gau, Jeff M

    2017-09-01

    Because independent trials have provided evidence for the efficacy and effectiveness of the dissonance-based Body Project eating disorder prevention program, the present trial tested whether clinicians produce the largest intervention effects, or whether delivery can be task-shifted to less expensive undergraduate peer educators or to Internet delivery without effect size attenuation, focusing on acute effects. In this study, 680 young women (Mage = 22.2 years, SD = 7.1) recruited at colleges in 2 states were randomized to clinician-led Body Project groups, peer-led Body Project groups, the Internet-based eBody Project, or an educational video control condition. Participants in all 3 variants of the Body Project intervention showed significantly greater reductions in eating disorder risk factors and symptoms than did educational video controls. Participants in clinician-led and peer-led Body Project groups showed significantly greater reductions in risk factors than did eBody Project participants, but effects for the 2 types of groups were similar. Eating disorder onset over 7-month follow-up was significantly lower for peer-led Body Project group participants versus eBody Project participants (2.2% vs. 8.4%) but did not differ significantly between other conditions. The evidence that all 3 dissonance-based prevention programs outperformed an educational video condition, that both group-based interventions outperformed the Internet-based intervention in risk factor reductions, and that the peer-led groups showed lower eating disorder onset over follow-up than did the Internet-based intervention is novel. These acute-effects data suggest that both group-based interventions produce superior eating disorder prevention effects than does the Internet-based intervention and that delivery can be task-shifted to peer leaders. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  3. Modality

    DEFF Research Database (Denmark)

    Klinge, Alex; Müller, Henrik Høeg

    of modality and grappled with ways of capturing it. The 11 studies included here cover the span from contributions that seek to clarify controversial theoretical constructs to studies which take an empirical approach to linguistic categories and cross-linguistic typological issues. The key concepts addressed...... are the structure of modal subcategories, subjective vs. objective modality, force dynamics, evidentiality, Spanish and English modal auxiliaries, modal uses of Italian tenses, linearization patterns in German verb chains, determinant TAM categories, modal polyfunctionality across languages and rapport management...... in discourse. This volume raises new questions and offers re-examination of known phenomena which should provide interesting reading to linguists and students of linguistics of all theoretical persuasions....

  4. Interest in Health Behavior Intervention Delivery Modalities Among Cancer Survivors: A Cross-Sectional Study.

    Science.gov (United States)

    Martin, Emily C; Basen-Engquist, Karen; Cox, Matthew G; Lyons, Elizabeth J; Carmack, Cindy L; Blalock, Janice A; Demark-Wahnefried, Wendy

    2016-02-11

    Effective, broad-reaching channels are important for the delivery of health behavior interventions in order to meet the needs of the growing population of cancer survivors in the United States. New technology presents opportunities to increase the reach of health behavior change interventions and therefore their overall impact. However, evidence suggests that older adults may be slower in their adoption of these technologies than the general population. Survivors' interest for more traditional channels of delivery (eg, clinic) versus new technology-based channels (eg, smartphones) may depend on a variety of factors, including demographics, current health status, and the behavior requiring intervention. The aim of this study was to determine the factors that predict cancer survivors' interest in new technology-based health behavior intervention modalities versus traditional modalities. Surveys were mailed to 1871 survivors of breast, prostate, and colorectal cancer. Participants' demographics, diet and physical activity behaviors, interest in health behavior interventions, and interest in intervention delivery modalities were collected. Using path analysis, we explored the relationship between four intervention modality variables (ie, clinic, telephone, computer, and smartphone) and potential predictors of modality interest. In total, 1053 respondents to the survey (56.3% response rate); 847 provided complete data for this analysis. Delivery channel interest was highest for computer-based interventions (236/847, 27.9% very/extremely interested) and lowest for smartphone-based interventions (73/847, 8.6%), with interest in clinic-based (147/847, 17.3%) and telephone-delivered (143/847, 16.9%) falling in between. Use of other technology platforms, such as Web cameras and social networking sites, was positively predictive of interest in technology-based delivery channels. Older survivors were less likely to report interest in smartphone-based diet interventions

  5. A Cross Sectional Study of the Differences between Generation, Learning Style, Modality and Learning Outcomes within a Faculty Development Program

    Science.gov (United States)

    Weeks, Joseph A., Jr.

    2014-01-01

    This research project was a descriptive study which measured the differences between generation, learning style, modality of course delivery and learning outcomes of the education sessions for participants in the regional higher education institution's professional development program. This research study focused on the faculty development program…

  6. The Effects of Course Delivery Modality on Student Satisfaction And Retention And Gpa In On-Site Vs. Hybrid Courses

    Directory of Open Access Journals (Sweden)

    Stuart S. GOLD

    2007-04-01

    Full Text Available This research project examines the relationship between modality of course delivery and the level of student GPA, satisfaction and retention achieved for students attending either traditional On-site or Hybrid (partial Online and partial On-site delivery modality university courses. The research project incorporates data from 110 courses and 164 students. The results, indicate that there is not a statistically significant difference, between the levels of student satisfaction, student retention or grade point average between students taking classes in the traditional on-site modality vs. those attending class via the hybrid modality.

  7. THE EARLY VIOLENCE PREVENTION: REVISION OF PROGRAMS AND INTERVENTION MODALITIES

    Directory of Open Access Journals (Sweden)

    JUANITA HENAO ESCOBAR

    2005-07-01

    Full Text Available The article presents a review of different kinds of international early violence prevention-intervention programs,which have shown effectiveness in the reduction of preschooler’s aggression, and in some cases, in the prevention ofviolent behavior during adolescence and youth. The central matter of this article is what we can learn from theexperiences on this field of knowledge around the world. First, the target intervention problem is presented andframed in the colombian context. After presenting the main research findings about aggressive behavior in childrenand the risk factors associated with it, the related intervention modalities will be analyzed and described. Finally, thearticle derives some pragmatic conclusions and recommendations.

  8. Hierarchical programming language for modal multi-rate real-time stream processing applications

    NARCIS (Netherlands)

    Geuns, S.J.; Hausmans, J.P.H.M.; Bekooij, Marco Jan Gerrit

    2014-01-01

    Modal multi-rate stream processing applications with real-time constraints which are executed on multi-core embedded systems often cannot be conveniently specified using current programming languages. An important issue is that sequential programming languages do not allow for convenient programming

  9. Multi-modal transfection agent based on monodisperse magnetic nanoparticles for stem cell gene delivery and tracking.

    Science.gov (United States)

    Park, Wooram; Yang, Han Na; Ling, Daishun; Yim, Hyeona; Kim, Kyoung Sub; Hyeon, Taeghwan; Na, Kun; Park, Keun-Hong

    2014-08-01

    Directing the controlled differentiation and tracking of stem cells is essential to achieve successful stem cell therapy. In this work, we describe a multi-modal (MR/optical) transfection agent (MTA) for efficient gene delivery and cell tracking of human mesenchymal stem cells (hMSCs). The MTA was synthesized through a facile two-step approach with 1) ligand exchange of a catechol-functionalized polypeptide (CFP) and 2) chemical immobilization of fluorescence labelled cationic polymer via aminolysis reaction. Cationic polymer-immobilized MTAs with size of ~40 nm exhibit greatly enhanced colloidal stability in aqueous solution. In addition, the MTAs were capable of binding DNA molecules for transfection. The MTA/pDNA complex showed relatively good transfection efficiency in hMSCs (compared to the commercial transfection agent, Lipofectamine) and good biocompatibility. MTA-treated hMSCs were successfully visualized after transplantation via MR and optical imaging system over 14 days. These studies highlight the challenges associated with the potential advantages of designing multi-modal nanostructured materials as tools for genetic materials delivery and cell-tracking in stem cell therapy. Copyright © 2014 Elsevier Ltd. All rights reserved.

  10. Effect of three-drug delivery modalities on olfactory function in chronic sinusitis.

    Science.gov (United States)

    Reychler, Gregory; Colbrant, Coralie; Huart, Caroline; Le Guellec, Sandrine; Vecellio, Laurent; Liistro, Giuseppe; Rombaux, Philippe

    2015-03-01

    Olfactory dysfunction is deemed to be a significant contributor to poor quality of life in chronic rhinosinusitis (CRS). To assess and to compare the effectiveness of three modalities of corticosteroids administration in patients with CRS. A prospective randomized controlled study Thirty patients with CRS were randomized in three groups depending on the route of corticosteroids administration: 16 days by oral route (Medrol (Pfizer, Belgique), 32 mg/8 days -16 mg/4 days-8 mg/4 days); nasal spray (Rhinocort (AstraZeneca, Belgique), 2 × 2 × 64 µg/nostril); or sonic nebulization (Pulmicort (AstraZeneca, Belgique), 2 × 1 mg/4 mL) (Sonic nebulizer, AOHBOX-NL11SN, DTF, France). Olfactory function was assessed using orthonasal threshold discrimination identification and retronasal psychophysical olfactory tests (RNT) before and after the treatment. Same intranasal modalities were previously tested for in vitro airways scintigraphic deposition. In vitro differences in drug deposition pattern between both intranasal modalities were demonstrated. Threshold discrimination identification and RNT were similar between three groups at baseline. Threshold discrimination identification improved by 5.5, 5.8, and -1.1 for sonic nebulization, oral, and nasal spray groups, respectively (P = 0.010). This improvement was clinically relevant for oral and nebulized administration. It was similar between oral and nebulized administration but significantly higher than nasal spray administration. Retronasal psychophysical olfactory tests improved similarly for the three groups (P = 0.231) CONCLUSION: Effectiveness of sonic nebulized and oral administration is demonstrated on orthonasal olfactory. The clinical benefit is better than with nasal spray. © 2014 The American Laryngological, Rhinological and Otological Society, Inc.

  11. Preliminary study of a novel transfection modality for in vivo siRNA delivery to vocal fold fibroblasts.

    Science.gov (United States)

    Kraja, Iv; Bing, Renjie; Hiwatashi, Nao; Rousseau, Bernard; Nalband, Danielle; Kirshenbaum, Kent; Branski, Ryan C

    2017-07-01

    An obstacle to clinical use of RNA-based gene suppression is instability and inefficiency of current delivery modalities. Nanoparticle delivery likely holds great promise, but the kinetics and transfection conditions must be optimized prior to in vivo utility. We investigated a RNA nanoparticle complex incorporating a lipitoid transfection reagent in comparison to a commercially available reagent. In vitro. We investigated which variables influence transfection efficiency of lipitoid oligomers and a commercially available reagent across species, in vitro. These variables included duration, dose, and number of administrations, as well as serum and media conditions. The target gene was Smad3, a signaling protein in the transforming growth factor-β cascade implicated in fibroplasia in the vocal folds and other tissues. The two reagents suppressed Smad3 mRNA for up to 96 hours; lipitoid performed favorably and comparably. Both compounds yielded 60% to 80% mRNA knockdown in rat, rabbit, and human vocal fold fibroblasts (P transfection conditions. These preliminary data are encouraging, and lipitoid warrants further investigation with the goal of clinical utility. NA. Laryngoscope, 127:E231-E237, 2017. © 2016 The American Laryngological, Rhinological and Otological Society, Inc.

  12. Impact of Delivery Modality, Student GPA, and Time-Lapse since High School on Successful Completion of College-Level Math after Taking Developmental Math

    Science.gov (United States)

    Acosta, Diane; North, Teresa Lynn; Avella, John

    2016-01-01

    This study considered whether delivery modality, student GPA, or time since high school affected whether 290 students who had completed a developmental math series as a community college were able to successfully complete college-level math. The data used in the study was comprised of a 4-year period historical student data from Odessa College…

  13. From the podium to the PC: a study on various modalities of lecture delivery within an undergraduate basic pharmacology course

    Science.gov (United States)

    Lancaster, Jason W.; McQueeney, Maureen L.

    2011-07-01

    Background. The need to evolve with our ever-changing student bodies has never been as great as it is today, particularly given the advanced technological aptitude of today's students. Purpose This retrospective study evaluates student outcomes as they relate to overall course score and composite quiz and examination scores from a basic pharmacology course taught over three separate semesters using three different lecture delivery modalities: traditional in-class; blended; and online-only. Sample A total of 48 students from a US university's health sciences bachelor degree programme enrolled in one of these three sections between 2009 and 2010. Design and methods A one-way analysis of variance test with Tukey's honestly significant difference post hoc testing was utilized to determine if any statistical difference existed between the studied outcomes for each of the three teaching modalities. A p-value of less than or equal to 0.05 was considered to be statistically significant. Results The students enrolled in the online-only course scored statistically significantly higher than their counterparts enrolled on the traditional course for all studied outcomes, and higher than those enrolled on the blended course for most of the studied outcomes. Conclusions The results of this study demonstrate that students enrolled in the online-only section achieved scores that were statistically significantly higher than their counterparts enrolled in the traditional and blended lecture settings. These findings reveal that students enrolled in an online course may in fact have improved performance compared with traditional lecture methods, given their generational preferences for learning.

  14. Gadolinium embedded iron oxide nanoclusters as T1-T2 dual-modal MRI-visible vectors for safe and efficient siRNA delivery

    Science.gov (United States)

    Wang, Xiaoyong; Zhou, Zijian; Wang, Zhiyong; Xue, Yunxin; Zeng, Yun; Gao, Jinhao; Zhu, Lei; Zhang, Xianzhong; Liu, Gang; Chen, Xiaoyuan

    2013-08-01

    This report illustrates a new strategy of designing a T1-T2 dual-modal magnetic resonance imaging (MRI)-visible vector for siRNA delivery and MRI. Hydrophobic gadolinium embedded iron oxide (GdIO) nanocrystals are self-assembled into nanoclusters in the water phase with the help of stearic acid modified low molecular weight polyethylenimine (stPEI). The resulting water-dispersible GdIO-stPEI nanoclusters possess good stability, monodispersity with narrow size distribution and competitive T1-T2 dual-modal MR imaging properties. The nanocomposite system is capable of binding and delivering siRNA for knockdown of a gene of interest while maintaining its magnetic properties and biocompatibility. This new gadolinium embedded iron oxide nanocluster provides an important platform for safe and efficient gene delivery with non-invasive T1-T2 dual-modal MRI monitoring capability.This report illustrates a new strategy of designing a T1-T2 dual-modal magnetic resonance imaging (MRI)-visible vector for siRNA delivery and MRI. Hydrophobic gadolinium embedded iron oxide (GdIO) nanocrystals are self-assembled into nanoclusters in the water phase with the help of stearic acid modified low molecular weight polyethylenimine (stPEI). The resulting water-dispersible GdIO-stPEI nanoclusters possess good stability, monodispersity with narrow size distribution and competitive T1-T2 dual-modal MR imaging properties. The nanocomposite system is capable of binding and delivering siRNA for knockdown of a gene of interest while maintaining its magnetic properties and biocompatibility. This new gadolinium embedded iron oxide nanocluster provides an important platform for safe and efficient gene delivery with non-invasive T1-T2 dual-modal MRI monitoring capability. Electronic supplementary information (ESI) available. See DOI: 10.1039/c3nr02797j

  15. Distribution of Iron Oxide Core-Titanium Dioxide Shell Nanoparticles in VX2 Tumor Bearing Rabbits Introduced by Two Different Delivery Modalities

    Directory of Open Access Journals (Sweden)

    Tamer Refaat

    2016-08-01

    Full Text Available This work compares intravenous (IV versus fluoroscopy-guided transarterial intra-catheter (IC delivery of iron oxide core-titanium dioxide shell nanoparticles (NPs in vivo in VX2 model of liver cancer in rabbits. NPs coated with glucose and decorated with a peptide sequence from cortactin were administered to animals with developed VX2 liver cancer. Two hours after NPs delivery tumors, normal liver, kidney, lung and spleen tissues were harvested and used for a series on histological and elemental analysis tests. Quantification of NPs in tissues was done both by bulk inductively coupled plasma mass spectrometry (ICP-MS analysis and by hard X-ray fluorescence microscopy. Both IV and IC NPs injection are feasible modalities for delivering NPs to VX2 liver tumors with comparable tumor accumulation. It is possible that this is an outcome of the fact that VX2 tumors are highly vascularized and hemorrhagic, and therefore enhanced permeability and retention (EPR plays the most significant role in accumulation of nanoparticles in tumor tissue. It is, however, interesting to note that IV delivery led to increased sequestration of NPs by spleen and normal liver tissue, while IC delivery lead to more NP positive Kupffer cells. This difference is most likely a direct outcome of blood flow dynamics. Armed with this knowledge about nanoparticle delivery, we plan to test them as radiosensitizers in the future.

  16. The need for supplemental breast cancer screening modalities: a perspective of population-based breast cancer screening programs in Japan.

    Science.gov (United States)

    Uematsu, Takayoshi

    2017-01-01

    This article discusses possible supplemental breast cancer screening modalities for younger women with dense breasts from a perspective of population-based breast cancer screening program in Japan. Supplemental breast cancer screening modalities have been proposed to increase the sensitivity and detection rates of early stage breast cancer in women with dense breasts; however, there are no global guidelines that recommend the use of supplemental breast cancer screening modalities in such women. Also, no criterion standard exists for breast density assessment. Based on the current situation of breast imaging in Japan, the possible supplemental breast cancer screening modalities are ultrasonography, digital breast tomosynthesis, and breast magnetic resonance imaging. An appropriate population-based breast cancer screening program based on the balance between cost and benefit should be a high priority. Further research based on evidence-based medicine is encouraged. It is very important that the ethnicity, workforce, workflow, and resources for breast cancer screening in each country should be considered when considering supplemental breast cancer screening modalities for women with dense breasts.

  17. Home Delivery Medicament Program: access, inactivity and cardiovascular risk

    Directory of Open Access Journals (Sweden)

    Roque da Silva Araújo

    Full Text Available ABSTRACT Objective: to verify causes of inactivity in the Home Delivery Medicament Program, as referred by users from a Primary Health Care Service in São Paulo, comparing them to the causes registered in the program and analyzing them in the theoretical model Concept of Access to Health. Methods: cross-sectional study, interviewing 111 inactive users; and documentary study in the program records. Results: half of the users did not know the condition of inactivity. Discrepancies were found between the user's and the program's information, observing different levels of agreement: Absence of physician and administrative staff member 0%; Transfer to other service 25%; Death 50%; Option to quit 50%; Address change 57% and Change in therapeutic schedule 80%. The users' feeling of accepting the program was observed. In the health access concept, inactivity can be explained in the information dimension, in the degree of asymmetry between the patient's and the health professional's knowledge, identified through the indicators: education, knowledge and information sources. Conclusions: due to the low education level, the user does not assimilate the information on the steps of the program flowchart, does not return for the assessment that guarantees its continuity. Consequently, (she stops receiving the medication and spends a long time without treatment, increasing the cardiovascular risk of hypertensive (92% of the sample, diabetic (44% and dyslipidemic patients (31%.

  18. Linking the poor to new modalities in service delivery. Partnership innovations in solid waste management in Bogotá, Colombia

    NARCIS (Netherlands)

    I. Turcotte (Isabelle); G.M. Gómez (Georgina)

    2012-01-01

    textabstractWaste picking has become a prominent activity in the urban landscape, bridging the gap between shortfalls in service delivery and personal income generation in virtually all cities of the developing world. Overcoming previous stigmatization and work fragmentation through organization and

  19. Trends in Canadian faculties of education: An overview of graduate programs, curricular offerings, exit requirements, and modes of delivery.

    Directory of Open Access Journals (Sweden)

    Carla Abreu Ellis

    2008-07-01

    Full Text Available Introduction This research investigated universities registered with the Association of Universities and Colleges of Canada (AUCC whose primary instructional language was English. A content analysis was performed on university web pages related to the following content: (a frequency of graduate programs being offered, (b types of degrees being offered, (c frequency and variation of program of study offerings, (d variation of exit requirements, and (e modalities of course delivery. This research provides an overview and analysis of graduate level programs, more precisely Masters and Doctorate degrees, offered through faculties of education in Canada. An understanding of the findings of this research may benefit Canadian university administrative bodies in providing a source in which they may compare findings with their current offerings and programming. Prospective students of graduate programs in education may also benefit from the information provided in this study when choosing a program of study by ameliorating their knowledge of current programs, curriculum offerings, and modes of course delivery being offered by faculties of education in Canada.

  20. The flipped classroom: a modality for mixed asynchronous and synchronous learning in a residency program.

    Science.gov (United States)

    Young, Timothy P; Bailey, Caleb J; Guptill, Mindi; Thorp, Andrea W; Thomas, Tamara L

    2014-11-01

    A "flipped classroom" educational model exchanges the traditional format of a classroom lecture and homework problem set. We piloted two flipped classroom sessions in our emergency medicine (EM) residency didactic schedule. We aimed to learn about resident and faculty impressions of the sessions, in order to develop them as a regular component of our residency curriculum. We evaluated residents' impression of the asynchronous video component and synchronous classroom component using four Likert items. We used open-ended questions to inquire about resident and faculty impressions of the advantages and disadvantages of the format. For the Likert items evaluating the video lectures, 33/35 residents (94%, 95% CI 80%-99%) responded that the video lecture added to their knowledge about the topic, and 33/35 residents felt that watching the video was a valuable use of their time. For items evaluating the flipped classroom format, 36/38 residents (95%, 95% CI 82%-99%) preferred the format to a traditional lecture on the topic, and 38/38 residents (100%, 95% CI 89%-100%) felt that the small group session was effective in helping them learn about the topic. Most residents preferred to see the format monthly in our curriculum and chose an ideal group size of 5.5 (first session) and 7 (second session). Residents cited the interactivity of the sessions and access to experts as advantages of the format. Faculty felt the ability to assess residents' understanding of concepts and provide feedback were advantages. Our flipped classroom model was positively received by EM residents. Residents preferred a small group size and favored frequent use of the format in our curriculum. The flipped classroom represents one modality that programs may use to incorporate a mixture of asynchronous and interactive synchronous learning and provide additional opportunities to evaluate residents.

  1. The Flipped Classroom: A Modality for Mixed Asynchronous and Synchronous Learning in a Residency Program

    Directory of Open Access Journals (Sweden)

    Timothy P. Young

    2014-11-01

    Full Text Available Introduction: A “flipped classroom” educational model exchanges the traditional format of a classroom lecture and homework problem set. We piloted two flipped classroom sessions in our emergency medicine (EM residency didactic schedule. We aimed to learn about resident and faculty impressions of the sessions, in order to develop them as a regular component of our residency curriculum. Methods: We evaluated residents’ impression of the asynchronous video component and synchronous classroom component using four Likert items. We used open-ended questions to inquire about resident and faculty impressions of the advantages and disadvantages of the format. Results: For the Likert items evaluating the video lectures, 33/35 residents (94%, 95% CI 80%-99% responded that the video lecture added to their knowledge about the topic, and 33/35 residents felt that watching the video was a valuable use of their time. For items evaluating the flipped classroom format, 36/38 residents (95%, 95% CI 82%-99% preferred the format to a traditional lecture on the topic, and 38/38 residents (100%, 95% CI 89%-100% felt that the small group session was effective in helping them learn about the topic. Most residents preferred to see the format monthly in our curriculum and chose an ideal group size of 5.5 (first session and 7 (second session. Residents cited the interactivity of the sessions and access to experts as advantages of the format. Faculty felt the ability to assess residents’ understanding of concepts and provide feedback were advantages. Conclusion: Our flipped classroom model was positively received by EM residents. Residents preferred a small group size and favored frequent use of the format in our curriculum. The flipped classroom represents one modality that programs may use to incorporate a mixture of asynchronous and interactive synchronous learning and provide additional opportunities to evaluate residents. [West J Emerg Med. 2014;15(7:-0.

  2. Transportation risk management : international practices for program development and project delivery.

    Science.gov (United States)

    2012-08-01

    Managing transportation networks, including agency : management, program development, and project : delivery, is extremely complex and fraught with : uncertainty. Administrators, planners, and engineers : coordinate a multitude of organizational and ...

  3. What Modals Are: Modal Verbs, Modal Words, and Auxiliary Modals

    Directory of Open Access Journals (Sweden)

    Fazira A. Kakzhanova

    2013-01-01

    Full Text Available The modals are a complicated grammatical phenomenon. As of today, the status of modals is still not precisely defined in the linguistics literature, and they are described under different names: modal verbs, modal words, auxiliary modals, or defective verbs. Modals express the result of the conversion of thought processes (deep structure about the realization of actions into surface structure. As articles determine the status of nouns as indefinite or definite things, modals determine the relation of a person to actions or the quality of an action as realizable or unrealizable. Modals cannot truly be ‘modal verbs’, because they lack the morphological characteristics of verbs (aspect, voice, mood, and tense, and the term ‘defective verb’ is flawed for the same reason. Furthermore, they cannot be ‘auxiliary modals’, because they don’t neutralize their main meanings when they become auxiliary. Thus, I propose to refer to these elements only as modals or modal words.

  4. Theranostic tumor targeted nanoparticles combining drug delivery with dual near infrared and 19F magnetic resonance imaging modalities.

    Science.gov (United States)

    Vu-Quang, Hieu; Vinding, Mads Sloth; Nielsen, Thomas; Ullisch, Marcus Görge; Nielsen, Niels Chr; Kjems, Jørgen

    2016-10-01

    Combining imaging and drug delivery of "theranostic" nanoparticles has enabled concurrent diagnosis and therapy of diseases. Here, we describe a novel theranostic system that combines two imaging tracers, perfluorooctyl bromide (PFOB) for 19F magnetic resonance imaging (MRI) and indocyanine green (ICG) for near infrared (NIR) imaging, with the chemotherapeutic agent doxorubicin (Dox) into poly (lactic-co-glycolic acid)- poly (ethylene-glycol)-folate (PLGA-PEG-folate) nanoparticles. Cell culture studies using flow cytometry, confocal laser scanning microscope imaging, and 19F MRI showed enhanced uptake of nanoparticles via folate receptors expressed on human nasopharyngeal epidermal carcinoma (KB) cells. In vivo, higher MRI and fluorescence signals were obtained from tumors with 19F MRI and NIR, respectively, using folate-receptor-targeted nanoparticles compared with non-targeted equivalents. An in vitro cytotoxicity assay showed that folate-targeted nanoparticles were able to kill cancer cells more efficiently than non-folate conjugated particles. Our results suggest a potential use of PLGA-PEG-folate PFOB/ICG/Dox nanoparticles as a targeted chemotherapy agent traceable by either 19F MRI or NIR imaging. Copyright © 2016 Elsevier Inc. All rights reserved.

  5. Modal concord

    NARCIS (Netherlands)

    Zeijlstra, H.; Gibson, M.; Friedman, T.

    2008-01-01

    Sentences containing two (or more) modal elements of the same modal type and quantificational force often yield a concord reading, where the semantics of the sentence seems to contain only one modal operator, rather than a cumulative reading. In this paper I have argued that Modal Concord is a

  6. Chronic, programmed polypeptide delivery from an implanted, multireservoir microchip device.

    Science.gov (United States)

    Prescott, James H; Lipka, Sara; Baldwin, Samuel; Sheppard, Norman F; Maloney, John M; Coppeta, Jonathan; Yomtov, Barry; Staples, Mark A; Santini, John T

    2006-04-01

    Implanted drug delivery systems are being increasingly used to realize the therapeutic potential of peptides and proteins. Here we describe the controlled pulsatile release of the polypeptide leuprolide from microchip implants over 6 months in dogs. Each microchip contains an array of discrete reservoirs from which dose delivery can be controlled by telemetry.

  7. Dynamic Line Rating Oncor Electric Delivery Smart Grid Program

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Justin; Smith, Cale; Young, Mike; Donohoo, Ken; Owen, Ross; Clark, Eddit; Espejo, Raul; Aivaliotis, Sandy; Stelmak, Ron; Mohr, Ron; Barba, Cristian; Gonzalez, Guillermo; Malkin, Stuart; Dimitrova, Vessela; Ragsdale, Gary; Mitchem, Sean; Jeirath, Nakul; Loomis, Joe; Trevino, Gerardo; Syracuse, Steve; Hurst, Neil; Mereness, Matt; Johnson, Chad; Bivens, Carrie

    2013-05-04

    Electric transmission lines are the lifeline of the electric utility industry, delivering its product from source to consumer. This critical infrastructure is often constrained such that there is inadequate capacity on existing transmission lines to efficiently deliver the power to meet demand in certain areas or to transport energy from high-generation areas to high-consumption regions. When this happens, the cost of the energy rises; more costly sources of power are used to meet the demand or the system operates less reliably. These economic impacts are known as congestion, and they can amount to substantial dollars for any time frame of reference: hour, day or year. There are several solutions to the transmission constraint problem, including: construction of new generation, construction of new transmission facilities, rebuilding and reconductoring of existing transmission assets, and Dynamic Line Rating (DLR). All of these options except DLR are capital intensive, have long lead times and often experience strong public and regulatory opposition. The Smart Grid Demonstration Program (SGDP) project co-funded by the Department of Energy (DOE) and Oncor Electric Delivery Company developed and deployed the most extensive and advanced DLR installation to demonstrate that DLR technology is capable of resolving many transmission capacity constraint problems with a system that is reliable, safe and very cost competitive. The SGDP DLR deployment is the first application of DLR technology to feed transmission line real-time dynamic ratings directly into the system operation’s State Estimator and load dispatch program, which optimizes the matching of generation with load demand on a security, reliability and economic basis. The integrated Dynamic Line Rating (iDLR)1 collects transmission line parameters at remote locations on the lines, calculates the real-time line rating based on the equivalent conductor temperature, ambient temperature and influence of wind and solar

  8. 47 CFR 63.02 - Exemptions for extensions of lines and for systems for the delivery of video programming.

    Science.gov (United States)

    2010-10-01

    ... systems for the delivery of video programming. 63.02 Section 63.02 Telecommunication FEDERAL... systems for the delivery of video programming. (a) Any common carrier is exempt from the requirements of... with respect to the establishment or operation of a system for the delivery of video programming. ...

  9. 77 FR 47383 - Annual Assessment of the Status of Competition in the Market for the Delivery of Video Programming

    Science.gov (United States)

    2012-08-08

    ... COMMISSION Annual Assessment of the Status of Competition in the Market for the Delivery of Video Programming... annually to Congress on the status of competition in markets for the delivery of video programming. This... delivery of video programming for the Commission's Fifteenth Report (15th Report). The 15th Report will...

  10. Preferred Educational Delivery Strategies among Limited Income Older Adults Enrolled in Community Nutrition Education Programs

    Science.gov (United States)

    Parker, Stephany; Powell, Laura; Hermann, Janice; Phelps, Joshua; Brown, Barbara

    2011-01-01

    The study reported here explored educational delivery preference of limited income older Oklahomans. Sixty participants 60 years or older enrolled in Community Nutrition Education Programs observed three educational delivery strategies and participated in a group discussion. Two researchers independently coded focus group transcripts and frequency…

  11. Differential Perceptions of Women Inmates, Correctional Staff, and Correctional Officers Regarding Rehabilitation Program Modalities.

    Science.gov (United States)

    Carlson, Joseph R.

    1997-01-01

    Examines perceptions among correctional officers, correctional staff, and women inmates of the most effective type of rehabilitative programs. Builds on an earlier paper focusing on women inmates' perceptions. Findings indicate that all three groups believed the majority of the programs currently offered to be either "Okay" or "Very…

  12. Home Delivery Medicament Program: access, inactivity and cardiovascular risk.

    Science.gov (United States)

    Araújo, Roque da Silva; Arcuri, Edna Apparecida Moura; Lopes, Victor Cauê

    2016-10-10

    to verify causes of inactivity in the Home Delivery Medicament Program, as referred by users from a Primary Health Care Service in São Paulo, comparing them to the causes registered in the program and analyzing them in the theoretical model Concept of Access to Health. cross-sectional study, interviewing 111 inactive users; and documentary study in the program records. half of the users did not know the condition of inactivity. Discrepancies were found between the user's and the program's information, observing different levels of agreement: Absence of physician and administrative staff member 0%; Transfer to other service 25%; Death 50%; Option to quit 50%; Address change 57% and Change in therapeutic schedule 80%. The users' feeling of accepting the program was observed. In the health access concept, inactivity can be explained in the information dimension, in the degree of asymmetry between the patient's and the health professional's knowledge, identified through the indicators: education, knowledge and information sources. due to the low education level, the user does not assimilate the information on the steps of the program flowchart, does not return for the assessment that guarantees its continuity. Consequently, (s)he stops receiving the medication and spends a long time without treatment, increasing the cardiovascular risk of hypertensive (92% of the sample), diabetic (44%) and dyslipidemic patients (31%). verificar causas de inatividade no Programa Remédio em Casa, referidas por usuários de Unidade Básica de Saúde de São Paulo, comparando-as às registradas pelo programa e analisando-as no modelo teórico Conceito de Acesso à Saúde. estudo transversal entrevistando 111 usuários inativos; e documental, nos registros do programa. metade dos usuários desconhecia a condição de inatividade. Constatadas discrepâncias nas informações usuário versus programa, observando-se diferentes níveis de concordância: Falta de médico e funcion

  13. Perceptions of Programs for Gifted Children: Agreement on Principles, but Disagreement over Modalities.

    Science.gov (United States)

    Gagne, Francoys

    1983-01-01

    Analysis of questionnaire responses by 168 primary and secondary teachers and 165 parents of gifted children revealed general agreement on needs for special programs yet contradictory opinions regarding grouping in special classes and acceleration. (Author/CL)

  14. SUBSIDI BUNGA MODAL YANG DITERIMA RUMAH TANGGA PETERNAK SAPI BINAAN PROGRAM CSR (Corporate Social Responsibilty PETROCHINA JABUNG Ltd

    Directory of Open Access Journals (Sweden)

    Ardi Novra

    2015-10-01

    Full Text Available Penelitian bertujuan untuk evaluasi distribusi ternak sapi bibit program Corporate Social Responsibility (CSR Petrochina Jabung Ltd. Kabupaten Tanjung Jabung Timur.  Estimasi model ekonometrika bentuk triangle recursive yang terdiri dari 3 persamaan dengan 3 variabel endogen dan 3 variabel eksogen menggunakan 2SLS, sedangkan perhitungan besaran subsidi bunga modal dengan pendekatan bunga majemuk. Mayoritas RTP (79,31% penerima sapi bibit program yang telah berjalan selama 4,5 tahun sebagian besar (79,31% sudah mampu melunasi kewajibannya. Rata-rata lama waktu mendapatkan anak dan penarikan pertama masing-masing adalah 18,22 bulan dan 31,56 bulan atau dengan kata lain rataan umur ternak yang disetor mencapai 13,34 bulan. Jangka waktu pengembalian pertama signifikan ditentukan oleh jangka waktu kelahiran pertama, serta tidak terdapat perbedaan signifikan antara kelompok RTP yang menerima 1 jantan dan 2 betina dengan yang menerima 3 induk. Jangka waktu bersama-sama dengan umur pengembalian pertama menentukan jangka waktu pelunasan tetapi dan tidak ada perbedaan signifikan antar kelompok RTP. Program CSR Petrochina Jabung LtD merupakan salah satu bentuk subsidi bunga modal (rataan 0,87%/bulan dan besarannya bervariasi antar RTP yang signifikan ditentukan faktor jangka waktu pengembalian dan pelunasan. Semakin cepat pengembalian pertama semakin rendah subsidi bunga diterima tetapi sebaliknya semakin cepat jangka waktu pelunasan maka semakin tinggi subsidi bunga modal diterima. berdasarkan hasil penelitian dapat disimpulkan bahwa pola gaduhan yang dikembangkan efektif mendorong kepemilikan ternak sapi sebagai asset yang potensial digunakan sarana untuk meningkatkan ekonomi RTP. ABSTRACTThe survey research aims to evaluating the performance of the cattle breeding program under supervised on the Petrochina Jabung Ltd. CSR Program. The unit analysis was 87 household on the CSR area during three month on Geragai Sub-Regency. The sampling technique is

  15. SUBSIDI BUNGA MODAL YANG DITERIMA RUMAH TANGGA PETERNAK SAPI BINAAN PROGRAM CSR (CORPORATE SOCIAL RESPONSIBILTY PETROCHINA JABUNG LTD

    Directory of Open Access Journals (Sweden)

    Ardi Novra

    2015-11-01

    Full Text Available Penelitian bertujuan untuk evaluasi distribusi ternak sapi bibit program Corporate Social Responsibility (CSR Petrochina Jabung Ltd. Kabupaten Tanjung Jabung Timur. Estimasi model ekonometrika bentuk triangle recursive yang terdiri dari 3 persamaan dengan 3 variabel endogen dan 3 variabel eksogen menggunakan 2SLS, sedangkan perhitungan besaran subsidi bunga modal dengan pendekatan bunga majemuk. Mayoritas RTP (79,31% penerima sapi bibit program yang telah berjalan selama 4,5 tahun sebagian besar (79,31% sudah mampu melunasi kewajibannya. Rata-rata lama waktu mendapatkan anak dan penarikan pertama masing-masing adalah 18,22 bulan dan 31,56 bulan atau dengan kata lain rataan umur ternak yang disetor mencapai 13,34 bulan. Jangka waktu pengembalian pertama signifikan ditentukan oleh jangka waktu kelahiran pertama, serta tidak terdapat perbedaan signifikan antara kelompok RTP yang menerima 1 jantan dan 2 betina dengan yang menerima 3 induk. Jangka waktu bersama-sama dengan umur pengembalian pertama menentukan jangka waktu pelunasan tetapi dan tidak ada perbedaan signifikan antar kelompok RTP. Program CSR Petrochina Jabung LtD merupakan salah satu bentuk subsidi bunga modal (rataan 0,87%/bulan dan besarannya bervariasi antar RTP yang signifikan ditentukan faktor jangka waktu pengembalian dan pelunasan. Semakin cepat pengembalian pertama semakin rendah subsidi bunga diterima tetapi sebaliknya semakin cepat jangka waktu pelunasan maka semakin tinggi subsidi bunga modal diterima. berdasarkan hasil penelitian dapat disimpulkan bahwa pola gaduhan yang dikembangkan efektif mendorong kepemilikan ternak sapi sebagai asset yang potensial digunakan sarana untuk meningkatkan ekonomi RTP. ABSTRACT The survey research aims to evaluating the performance of the cattle breeding program under supervised on the Petrochina Jabung Ltd. CSR Program. The unit analysis was 87 household on the CSR area during three month on Geragai Sub-Regency. The sampling technique is

  16. Results from a Multi-Modal Program Evaluation of a Four Year Statewide Juvenile Sex Offender Treatment and Reentry Program

    Science.gov (United States)

    Underwood, Lee A.; Dailey, Frances L. L.; Merino, Carrie; Crump, Yolanda

    2015-01-01

    The results of the Program Evaluation show the OJJ Statewide Sex Offender Treatment program is exceptionally productive in meeting over 90% of its established performance markers. These markers included successful screening and assessment of risk and psychosocial needs, completion of initial and master treatment plans, establishment of sex…

  17. Defeasible modalities

    CSIR Research Space (South Africa)

    Britz, K

    2013-01-01

    Full Text Available with a preference ordering on worlds in Kripke models. The resulting family of modal logics allow for the elegant expression of defeasible modalities. We also propose a tableau calculus which is sound and complete with respect to our preferential...

  18. Public health sealant delivery programs: optimal delivery and the cost of practice acts.

    Science.gov (United States)

    Scherrer, Christina R; Griffin, Paul M; Swann, Julie L

    2007-01-01

    The greatest unmet health need for US children is dental care. School-based sealant programs target low-income, high-risk second graders and are effective in preventing caries for as long as the sealant material remains in place. However, it is not clear whether such programs make efficient use of available resources and staffing. The authors used discrete event simulation to determine the optimal combinations of staffing levels and sealant stations for school-based sealant programs. Using data provided by state programs and the literature, they modeled different-sized programs under different practice act constraints and determined times and associated costs. A detailed economic analysis was done for Wisconsin. For general, direct, or indirect supervision, it is optimal to have only 1 dentist or no dentists for no supervision. For general supervision, it is optimal to have the dentist and dental assistant to come on separate days to screen. The cost savings for adding an assistant and chair averaged over all of the program sizes and travel distances ranged from 4.50% (SE= 0.89) to 10.94% (SE= 0.56). Significant cost savings also result from reducing the required supervision level (8.72% [SE = 1.61] to 29.96% [SE= 1.67]). The cost of the practice act for the state of Wisconsin for 2003 was from USD 83,041 to USD 346,156, significantly more than its annual budget. States could save money by relaxing restrictions on the type of personnel who can deliver sealants in public health settings and by productivity gains through proper consideration of staffing. The savings could be used to improve access to sealant programs and further reduce disparities in oral health.

  19. Energy-efficient Public Procurement: Best Practice in Program Delivery

    Energy Technology Data Exchange (ETDEWEB)

    Payne, Christopher [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Environmental Energy Technologies Division; Weber, Andrew [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). Environmental Energy Technologies Division; Semple, Abby [Public Procurement Analysis, London (United Kingdom)

    2013-02-15

    This document illustrates the key issues and considerations involved in implementing energy-efficient public procurement. Our primary sources of information have been our partners in the Super Efficient Equipment and Appliance Deployment (SEAD) Initiative Procurement Working Group. Where applicable, we have highlighted specific ways in which working group participants have successfully overcome barriers to delivering effective programs. The following key points emerge from this analysis of programs for energy-efficient public procurement. Lessons for both developed and developing programs are highlighted throughout the guide. 1. Policy: Policy provides the initiative to begin a transition from first cost to life-cycle cost based purchasing methods and culture. Effective policy is well-communicated, establishes accountability from top to bottom of organizations and simplifies the processes necessary to comply. Flexibility and responsiveness are essential in policy development and implementation. Mandatory and voluntary policies may complement one another. 2. Procurement Criteria: Procurement staff must be confident that energy-efficient procurement criteria offer the best long-term value for their organization’s money and represent real environmental gains. Involving multiple stakeholders at the early stages of the criteria creation process can result in greater levels of cooperation from private industry. Criteria should make comparison of products easy for purchasers and require minimal additional calculations. Criteria will need to be regularly updated to reflect market developments. 3. Training: Resources for the creation of training programs are usually very limited, but well-targeted training is necessary in order for a program to be effective. Training must emphasize a process that is efficient for purchasers and simplifies compliance. Purchaser resources and policy must be well designed for training to be effective. Training program development is an

  20. Resource consumption of a diffusion model for prevention programs: the PROSPER delivery system.

    Science.gov (United States)

    Crowley, Daniel M; Jones, Damon E; Greenberg, Mark T; Feinberg, Mark E; Spoth, Richard L

    2012-03-01

    To prepare public systems to implement evidence-based prevention programs for adolescents, it is necessary to have accurate estimates of programs' resource consumption. When evidence-based programs are implemented through a specialized prevention delivery system, additional costs may be incurred during cultivation of the delivery infrastructure. Currently, there is limited research on the resource consumption of such delivery systems and programs. In this article, we describe the resource consumption of implementing the PROSPER (PROmoting School-Community-University Partnerships to Enhance Resilience) delivery system for a period of 5 years in one state, and how the financial and economic costs of its implementation affect local communities as well as the Cooperative Extension and University systems. We used a six-step framework for conducting cost analysis, using a Cost-Procedure-Process-Outcome Analysis model (Yates, Analyzing costs, procedures, processes, and outcomes in human services: An introduction, 1996; Yates, 2009). This method entails defining the delivery System; bounding cost parameters; identifying, quantifying, and valuing systemic resource Consumption, and conducting sensitivity analysis of the cost estimates. Our analyses estimated both the financial and economic costs of the PROSPER delivery system. Evaluation of PROSPER illustrated how costs vary over time depending on the primacy of certain activities (e.g., team development, facilitator training, program implementation). Additionally, this work describes how the PROSPER model cultivates a complex resource infrastructure and provides preliminary evidence of systemic efficiencies. This work highlights the need to study the costs of diffusion across time and broadens definitions of what is essential for successful implementation. In particular, cost analyses offer innovative methodologies for analyzing the resource needs of prevention systems. Copyright © 2012 Society for Adolescent Health and

  1. Factors Associated with Teacher Delivery of a Classroom-Based Tier 2 Prevention Program.

    Science.gov (United States)

    Sutherland, Kevin S; Conroy, Maureen A; McLeod, Bryce D; Algina, James; Kunemund, Rachel L

    2018-02-01

    Teachers sometimes struggle to deliver evidence-based programs designed to prevent and ameliorate chronic problem behaviors of young children with integrity. Identifying factors associated with variations in the quantity and quality of delivery is thus an important goal for the field. This study investigated factors associated with teacher treatment integrity of BEST in CLASS, a tier-2 prevention program designed for young children at risk for developing emotional/behavioral disorders. Ninety-two early childhood teachers and 231 young children at-risk for emotional/behavioral disorders participated in the study. Latent growth curve analyses indicated that both adherence and competence of delivery increased across six observed time points. Results suggest that teacher education and initial levels of classroom quality may be important factors to consider when teachers deliver tier-2 (i.e., targeted to children who are not responsive to universal or tier-1 programming) prevention programs in early childhood settings. Teachers with higher levels of education delivered the program with more adherence and competence initially. Teachers with higher initial scores on the Emotional Support subscale of the Classroom Assessment Scoring System (CLASS) delivered the program with more competence initially and exhibited higher growth in both adherence and competence of delivery across time. Teachers with higher initial scores on the Classroom Organization subscale of the CLASS exhibited lower growth in adherence across time. Contrary to hypotheses, teacher self-efficacy did not predict adherence, and teachers who reported higher initial levels of Student Engagement self-efficacy exhibited lower growth in competence of delivery. Results are discussed in relation to teacher delivery of evidence-based programs in early childhood classrooms.

  2. Relational coordination promotes quality of chronic care delivery in Dutch disease-management programs.

    Science.gov (United States)

    Cramm, Jane Murray; Nieboer, Anna Petra

    2012-01-01

    Previous studies have shown that relational coordination is positively associated with the delivery of hospital care, acute care, emergency care, trauma care, and nursing home care. The effect of relational coordination in primary care settings, such as disease-management programs, remains unknown. This study examined relational coordination between general practitioners and other professionals in disease-management programs and assessed the impact of relational coordination on the delivery of chronic illness care. Professionals (n = 188; response rate = 57%) in 19 disease-management programs located throughout the Netherlands completed surveys that assessed relational coordination and chronic care delivery. We used a cross-sectional study design. Our study demonstrated that the delivery of chronic illness care was positively related to relational coordination. We found positive relationships with community linkages (r = .210, p management support (r = .217, p management team members: practice nurses (M = 2.69 vs. 3.73; p management professionals with different disciplines is expected to improve chronic illness care delivery.

  3. A Best Practice Modular Design of a Hybrid Course Delivery Structure for an Executive Education Program

    Science.gov (United States)

    Klotz, Dorothy E.; Wright, Thomas A.

    2017-01-01

    This article highlights a best practice approach that showcases the highly successful deployment of a hybrid course delivery structure for an Operations core course in an Executive MBA Program. A key design element of the approach was the modular design of both the course itself and the learning materials. While other hybrid deployments may stress…

  4. A Comprehensive Planning Model and Delivery System for Leadership Training Programs.

    Science.gov (United States)

    Janosik, Steven M.; Sina, Julie A.

    1988-01-01

    Presents an eight-step planning model that operationally defines a comprehensive delivery systems approach to campuswide leadership training. Lists four goals of the model: to increase efficiency of leadership training through shared resources, to decrease costs, to provide quality control, and to increase impact of programming effort by creating…

  5. Parenting Interventions Implementation Science: How Delivery Format Impacts the Parenting Wisely Program

    Science.gov (United States)

    Cotter, Katie L.; Bacallao, Martica; Smokowski, Paul R.; Robertson, Caroline I. B.

    2013-01-01

    Objectives: This study examines the implementation and effectiveness of Parenting Wisely, an Internet-based parenting skills intervention. The study assesses whether parents benefit from Parenting Wisely participation and whether the delivery format influences program effectiveness. Method: This study uses a quasi-experimental design.…

  6. Using program impact pathways to understand and improve program delivery, utilization, and potential for impact of Helen Keller International's homestead food production program in Cambodia.

    Science.gov (United States)

    Olney, Deanna K; Vicheka, Sao; Kro, Meng; Chakriya, Chhom; Kroeun, Hou; Hoing, Ly Sok; Talukder, Aminzzaman; Quinn, Victoria; Iannotti, Lora; Becker, Elisabeth; Roopnaraine, Terry

    2013-06-01

    Evidence of the impact of homestead food production programs on nutrition outcomes such as anemia and growth is scant. In the absence of information on program impact pathways, it is difficult to understand why these programs, which have been successful in increasing intake of micronutrient-rich foods, have had such limited documented impact on nutrition outcomes. To conduct a process evaluation of Helen Keller International's (HKI's) homestead food production program in Cambodia to assess whether the program was operating as planned (in terms of design, delivery, and utilization) and to identify ways in which the program might need to be strengthened in order to increase its potential for impact. A program theory framework, which laid out the primary components along the hypothesized program impact pathways, was developed in collaboration with HKI and used to design the research. Semistructured interviews and focus group discussions with program beneficiaries (n = 36 and 12, respectively), nonbeneficiaries (n = 12), and program implementers (n = 17 and 2, respectively) and observations of key program delivery points, including health and nutrition training sessions (n = 6), village model farms (n = 6), and household gardens of beneficiaries (n = 36) and nonbeneficiaries (n = 12), were conducted to assess the delivery and utilization of the primary program components along the impact pathways. The majority of program components were being delivered and utilized as planned. However, challenges with some of the key components posited to improve outcomes such as anemia and growth were noted. Among these were a gap in the expected pathway from poultry production to increased intake of eggs and poultry meat, and some weaknesses in the delivery of the health and nutrition training sessions and related improvements in knowledge among the village health volunteers and beneficiaries. Although the program has been successful in delivering the majority of the program

  7. Medical care delivery in the US space program

    Science.gov (United States)

    Stewart, Donald F.

    1991-01-01

    The stated goal of this meeting is to examine the use of telemedicine in disaster management, public health, and remote health care. NASA has a vested interest in providing health care to crews in remote environments. NASA has unique requirements for telemedicine support, in that our flight crews conduct their job in the most remote of all work environments. Compounding the degree of remoteness are other environmental concerns, including confinement, lack of atmosphere, spaceflight physiological deconditioning, and radiation exposure, to name a few. In-flight medical care is a key component in the overall support for missions, which also includes extensive medical screening during selection, preventive medical programs for astronauts, and in-flight medical monitoring and consultation. This latter element constitutes the telemedicine aspect of crew health care. The level of in-flight resources dedicated to medical care is determined by the perceived risk of a given mission, which in turn is related to mission duration, planned crew activities, and length of time required for return to definitive medical care facilities.

  8. Infection Control Practices and Program Management in Labor and Delivery Units: A Cross-Sectional Study From Iran

    OpenAIRE

    Tabatabaei; Behmanesh Pour; Azadeh

    2016-01-01

    Background Although Iranian women increasingly attend hospitals for childbirth, no information is available on programs and practices related to infection control in labor and delivery units. Objectives This study aims to investigate infection control program management and midwives’ practices in labor and delivery units. Patients and Methods We analyzed data related to infection c...

  9. The effect of a structured neonatal resuscitation program on delivery room practices.

    LENUS (Irish Health Repository)

    Ryan, C A

    2012-02-03

    PURPOSE: This study evaluated the introduction of the Neonatal Resuscitation Program (NRP) of the American Academy of Pediatrics and the American Heart Association into the delivery room of an Irish maternity hospital. DESIGN: Prospective, controlled observational study of 51 deliveries before and 51 deliveries following the training of delivery room personnel in the NRP. SAMPLE: Participants were 33 nurse-midwives and 11 pediatric resident physicians. MAIN OUTCOME VARIABLE: Evaluation of postdelivery, newborn resuscitation practices. RESULTS: The introduction of the NRP was associated with significant improvements in delivery room preparation, in the evaluation and management of the newborn infant, and in thermal protection at birth. Although there was a trend to use more free-flow oxygen following the introduction of the NRP, this was not statistically significant. Bag and mask ventilation was also used more frequently following NRP training. However, there were no significant differences in the use of endotracheal intubation, chest compressions, and medications. Fifteen of the 51 infants became hypothermic prior to the introduction of the NRP; none of the infants developed hypothermia in the post-NRP part of the study.

  10. Rate-programming of nano-particulate delivery systems for smart bioactive scaffolds in tissue engineering.

    Science.gov (United States)

    Izadifar, Mohammad; Haddadi, Azita; Chen, Xiongbiao; Kelly, Michael E

    2015-01-09

    Development of smart bioactive scaffolds is of importance in tissue engineering, where cell proliferation, differentiation and migration within scaffolds can be regulated by the interactions between cells and scaffold through the use of growth factors (GFs) and extra cellular matrix peptides. One challenge in this area is to spatiotemporally control the dose, sequence and profile of release of GFs so as to regulate cellular fates during tissue regeneration. This challenge would be addressed by rate-programming of nano-particulate delivery systems, where the release of GFs via polymeric nanoparticles is controlled by means of the methods of, such as externally-controlled and physicochemically/architecturally-modulated so as to mimic the profile of physiological GFs. Identifying and understanding such factors as the desired release profiles, mechanisms of release, physicochemical characteristics of polymeric nanoparticles, and externally-triggering stimuli are essential for designing and optimizing such delivery systems. This review surveys the recent studies on the desired release profiles of GFs in various tissue engineering applications, elucidates the major release mechanisms and critical factors affecting release profiles, and overviews the role played by the mathematical models for optimizing nano-particulate delivery systems. Potentials of stimuli responsive nanoparticles for spatiotemporal control of GF release are also presented, along with the recent advances in strategies for spatiotemporal control of GF delivery within tissue engineered scaffolds. The recommendation for the future studies to overcome challenges for developing sophisticated particulate delivery systems in tissue engineering is discussed prior to the presentation of conclusions drawn from this paper.

  11. Physical Activity Program Delivery by Professionals versus Volunteers: the TEAM Randomized Trial

    Science.gov (United States)

    Castro, Cynthia M.; Pruitt, Leslie A.; Buman, Matthew P.; King, Abby C.

    2010-01-01

    Background Older adults have low rates of physical activity participation but respond positively to telephone-mediated support programs. Programs are often limited by reliance on professional staff. This study tested telephone-based physical activity advice delivered by professional staff versus trained volunteer peer mentors. Design A 12-month, randomized, controlled clinical trial was executed from 2003–2008. Setting/participants: Twelve volunteer peer mentors and 181 initially inactive adults ages 50 years and older were recruited from the San Francisco Bay Area. Intervention Participants were randomized to: (1) telephone-based physical activity advice delivered by professional staff, (2) telephone-based physical activity advice delivered by trained volunteer peers, or (3) an attention-control arm of staff-delivered telephone support for nutrition. Main Outcome Measures: Moderate-intensity or more vigorous physical activity (MVPA) was assessed at baseline, 6, and 12 months with the CHAMPS Questionnaire, with accelerometry validation (Actigraph) in a randomly selected subsample. Treatment fidelity was examined through analysis of quantity and quality of intervention delivery. Results At 6 and 12 months, both physical activity arms significantly increased MVPA relative to the control arm. Both physical activity arms were comparable in quantity of intervention delivery, but peers demonstrated more versatility and comprehensiveness in quality of intervention content. Conclusions This study demonstrates that trained peer volunteers can effectively promote physical activity increases through telephone-based advice. The results support a program delivery model with good dissemination potential for a variety of community settings. PMID:21553972

  12. A multifunctional poly(curcumin) nanomedicine for dual-modal targeted delivery, intracellular responsive release, dual-drug treatment and imaging of multidrug resistant cancer cells

    OpenAIRE

    Wang, J; Wang, F; Li, F.; Zhang, W.; Shen, Y.; Zhou, D.; Guo, S.

    2016-01-01

    A multifunctional anti-cancer nanomedicine based on a biotin-poly(ethylene glycol)-poly(curcumin-dithiodipropionic acid) (Biotin-PEG-PCDA) polymeric nanocarrier loaded with paclitaxel (PTX), magnetic nanoparticle (MNP) and quantum dot (QD) is developed. It combines advantageous properties of efficient targeted delivery and uptake (via biotin and MNP), intracellular responsive release (via cleavable PCDA polymer), fluorescence imaging (via QD) and combined PTX-curcumin dual-drug treatment, all...

  13. The delivery of distance education--is it time for doctoral programs in gerontology?

    Science.gov (United States)

    Heinz, Melinda; Martin, Peter; Doll, Gayle; Pearson-Scott, Jean

    2015-01-01

    The delivery of higher education in gerontology is changing; students are now able to receive an education solely online. Perhaps it is time to consider offering this option at the doctoral level. A needs assessment was conducted to assess whether a doctoral program in gerontology should be created in the Great Plains Interactive Distance Education Alliance (GPIDEA) program. An online survey was sent to 247 students enrolled in the GPIDEA program and to students who had taken a GPIDEA course in gerontology but were not currently enrolled in the program. One hundred and twenty-three students began the survey, although only 120 students completed the survey. Findings indicated students are interested in a doctoral program in gerontology. Approximately 65% of students were interested in obtaining a PhD from a distance education program. However, an applied program focusing on community outreach and leadership was of most interest to students. Students were less interested in research-based programs or in research residency. Therefore, the development of distance education doctoral degree programs in gerontology may need to be created differently than "traditional" formats.

  14. Modal Indicators for Operational Modal Identification

    DEFF Research Database (Denmark)

    Zhang, L.; Brincker, Rune; Andersen, P.

    2001-01-01

    Modal validation is of paramount importance for all two-stage time domain modal identification algorithms. However, due to a higher noise/signal ratio in operational/ambient modal analysis, being able to determine the right model order and to distinguish between structural modes and computational...... Realization Algorithm (ERA). The three identification algorithms are implemented from a unified point-of-view with the modal indicators. Numerical simulations are conducted on a two-story building structure and on an aircraft model and it is investigated how the modal indicators work to distinguish...... modes become more significant than in traditional modal analysis. The two major modal indicators, i.e. Modal Confidence Factor (MCF) and Modal Amplitude Coherence (MAmC) are extended to two-stage time domain modal identification algorithms, together with a newly developed indicator, named as Modal...

  15. pH-Responsive Tumor-Targetable Theranostic Nanovectors Based on Core Crosslinked (CCL Micelles with Fluorescence and Magnetic Resonance (MR Dual Imaging Modalities and Drug Delivery Performance

    Directory of Open Access Journals (Sweden)

    Sidan Tian

    2016-06-01

    Full Text Available The development of novel theranostic nanovectors is of particular interest in treating formidable diseases (e.g., cancers. Herein, we report a new tumor-targetable theranostic agent based on core crosslinked (CCL micelles, possessing tumor targetable moieties and fluorescence and magnetic resonance (MR dual imaging modalities. An azide-terminated diblock copolymer, N3-POEGMA-b-P(DPA-co-GMA, was synthesized via consecutive atom transfer radical polymerization (ATRP, where OEGMA, DPA, and GMA are oligo(ethylene glycolmethyl ether methacrylate, 2-(diisopropylaminoethyl methacrylate, and glycidyl methacrylate, respectively. The resulting diblock copolymer was further functionalized with DOTA(Gd (DOTA is 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakisacetic acid or benzaldehyde moieties via copper(I-catalyzed alkyne-azide cycloaddition (CuAAC chemistry, resulting in the formation of DOTA(Gd-POEGMA-b-P(DPA-co-GMA and benzaldehyde-POEGMA-b-P(DPA-co-GMA copolymers. The resultant block copolymers co-assembled into mixed micelles at neutral pH in the presence of tetrakis[4-(2-mercaptoethoxyphenyl]ethylene (TPE-4SH, which underwent spontaneous crosslinking reactions with GMA residues embedded within the micellar cores, simultaneously switching on TPE fluorescence due to the restriction of intramolecular rotation. Moreover, camptothecin (CPT was encapsulated into the crosslinked cores at neutral pH, and tumor-targeting pH low insertion peptide (pHLIP, sequence: AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG moieties were attached to the coronas through the Schiff base chemistry, yielding a theranostic nanovector with fluorescence and MR dual imaging modalities and tumor-targeting capability. The nanovectors can be efficiently taken up by A549 cells, as monitored by TPE fluorescence. After internalization, intracellular acidic pH triggered the release of loaded CPT, killing cancer cells in a selective manner. On the other hand, the nanovectors labeled with DOTA

  16. Carboxymethyl cellulose (CMC)-loaded Co-Cu doped manganese ferrite nanorods as a new dual-modal simultaneous contrast agent for magnetic resonance imaging and nanocarrier for drug delivery system

    Science.gov (United States)

    Abbasi Pour, Sajjad; Shaterian, Hamid Reza; Afradi, Mojgan; Yazdani-Elah-Abadi, Afshin

    2017-09-01

    We synthesized Co0.25Cu0.25Mn0.5Fe2O4@CMC (CCMFe2O4@CMC) nanorods as a new dual-modal simultaneous for magnetic resonance imaging contrast agent and nanocarrier for drug delivery system. Impact of CCMFe2O4@CMC nanorods were investigated on the longitudinal (T1), transverse (T2) and transverse (T2∗) relaxation times for in vitro MRI contrast agent in water and also for drug delivery system, L-dopa was coated on CCMFe2O4@CMC nanorods and then in vitro drug release test was carried out at three PHs values and different temperatures. In vitro MR imaging demonstrated that r2 value of CCMFe2O4@CMC nanorods is 138.33 mM-1 s-1, CCMFe2O4@CMC is useful as T2 contrast agent relative to other T2 contrast agants. In vitro drug release test shows the amount of released L-dopa from CCMFe2O4@CMC nanorods at medium with pH = 1.2 is more than pH = 5.3 and 7.4.

  17. Multifunctional hydroxyapatite/Na(Y/Gd)F4:Yb3+,Er3+ composite fibers for drug delivery and dual modal imaging.

    Science.gov (United States)

    Liu, Min; Liu, Hui; Sun, Shufen; Li, Xuejiao; Zhou, Yanmin; Hou, Zhiyao; Lin, Jun

    2014-02-04

    Porous hydroxyapatite (HAp) composite fibers functionalized with up-conversion (UC) luminescent and magnetic Na(Y/Gd)F4:Yb(3+),Er(3+) nanocrystals (NCs) have been fabricated via electrospinning. After transferring hydrophobic oleic acid-capped Na(Y/Gd)F4:Yb(3+),Er(3+) NCs into aqueous solution, these water-dispersible NCs were dispersed into precursor electrospun solution containing CTAB. Na(Y/Gd)F4:Yb(3+),Er(3+)@HAp composite fibers were fabricated by the high temperature treatment of the electrospun Na(Y/Gd)F4:Yb(3+),Er(3+) NCs decorated precursor fibers. The biocompatibility test on MC 3T3-E1 cells using MTT assay shows that the HAp composite fibers have negligible cytotoxity, which reveals the HAp composite fibers could be a drug carrier for drug delivery. Because the contrast brightening is enhanced at increased concentrations of Gd(3+), the HAp composite fibers can serve as T1 magnetic resonance imaging contrast agents. In addition, the composites uptaken by MC 3T3-E1 cells present the UC luminescent emission of Er(3+) under the excitation of a 980 nm near-infrared laser. The above findings reveal Na(Y/Gd)F4:Yb(3+),Er(3+)@HAp composite fibers have potential applications in drug storage/release and magnetic resonance/UC luminescence imaging.

  18. Internet-Based Delivery of Evidence-Based Health Promotion Programs Among American Indian and Alaska Native Youth: A Case Study

    Science.gov (United States)

    Craig Rushing, Stephanie; Jessen, Cornelia; Gorman, Gwenda; Torres, Jennifer; Lambert, William E; Prokhorov, Alexander V; Miller, Leslie; Allums-Featherston, Kelly; Addy, Robert C; Peskin, Melissa F; Shegog, Ross

    2016-01-01

    Background American Indian and Alaska Native (AI/AN) youth face multiple health challenges compared to other racial/ethnic groups, which could potentially be ameliorated by the dissemination of evidence-based adolescent health promotion programs. Previous studies have indicated that limited trained personnel, cultural barriers, and geographic isolation may hinder the reach and implementation of evidence-based health promotion programs among AI/AN youth. Although Internet access is variable in AI/AN communities across the United States, it is swiftly and steadily improving, and it may provide a viable strategy to disseminate evidence-based health promotion programs to this underserved population. Objective We explored the potential of using the Internet to disseminate evidence-based health promotion programs on multiple health topics to AI/AN youth living in diverse communities across 3 geographically dispersed regions of the United States. Specifically, we assessed the Internet’s potential to increase the reach and implementation of evidence-based health promotion programs for AI/AN youth, and to engage AI/AN youth. Methods This randomized controlled trial was conducted in 25 participating sites in Alaska, Arizona, and the Pacific Northwest. Predominantly AI/AN youth, aged 12-14 years, accessed 6 evidence-based health promotion programs delivered via the Internet, which focused on sexual health, hearing loss, alcohol use, tobacco use, drug use, and nutrition and physical activity. Adult site coordinators completed computer-based education inventory surveys, connectivity and bandwidth testing to assess parameters related to program reach (computer access, connectivity, and bandwidth), and implementation logs to assess barriers to implementation (program errors and delivery issues). We assessed youths’ perceptions of program engagement via ratings on ease of use, understandability, credibility, likeability, perceived impact, and motivational appeal, using

  19. Internet-Based Delivery of Evidence-Based Health Promotion Programs Among American Indian and Alaska Native Youth: A Case Study.

    Science.gov (United States)

    Markham, Christine M; Craig Rushing, Stephanie; Jessen, Cornelia; Gorman, Gwenda; Torres, Jennifer; Lambert, William E; Prokhorov, Alexander V; Miller, Leslie; Allums-Featherston, Kelly; Addy, Robert C; Peskin, Melissa F; Shegog, Ross

    2016-11-21

    American Indian and Alaska Native (AI/AN) youth face multiple health challenges compared to other racial/ethnic groups, which could potentially be ameliorated by the dissemination of evidence-based adolescent health promotion programs. Previous studies have indicated that limited trained personnel, cultural barriers, and geographic isolation may hinder the reach and implementation of evidence-based health promotion programs among AI/AN youth. Although Internet access is variable in AI/AN communities across the United States, it is swiftly and steadily improving, and it may provide a viable strategy to disseminate evidence-based health promotion programs to this underserved population. We explored the potential of using the Internet to disseminate evidence-based health promotion programs on multiple health topics to AI/AN youth living in diverse communities across 3 geographically dispersed regions of the United States. Specifically, we assessed the Internet's potential to increase the reach and implementation of evidence-based health promotion programs for AI/AN youth, and to engage AI/AN youth. This randomized controlled trial was conducted in 25 participating sites in Alaska, Arizona, and the Pacific Northwest. Predominantly AI/AN youth, aged 12-14 years, accessed 6 evidence-based health promotion programs delivered via the Internet, which focused on sexual health, hearing loss, alcohol use, tobacco use, drug use, and nutrition and physical activity. Adult site coordinators completed computer-based education inventory surveys, connectivity and bandwidth testing to assess parameters related to program reach (computer access, connectivity, and bandwidth), and implementation logs to assess barriers to implementation (program errors and delivery issues). We assessed youths' perceptions of program engagement via ratings on ease of use, understandability, credibility, likeability, perceived impact, and motivational appeal, using previously established measures. Sites

  20. An in vitro evaluation of the pressure generated during programmed intermittent epidural bolus injection at varying infusion delivery speeds.

    Science.gov (United States)

    Klumpner, Thomas T; Lange, Elizabeth M S; Ahmed, Heena S; Fitzgerald, Paul C; Wong, Cynthia A; Toledo, Paloma

    2016-11-01

    Programmed intermittent bolus injection of epidural anesthetic solution results in decreased anesthetic consumption and better patient satisfaction compared with continuous infusion, presumably by better spread of the anesthetic solution in the epidural space. It is not known whether the delivery speed of the bolus injection influences analgesia outcomes. The objective of this in vitro study was to determine the pressure generated by a programmed intermittent bolus pump at 4 infusion delivery speeds through open-ended, single-orifice and closed-end, multiorifice epidural catheters. In vitro observational study. Not applicable. Not applicable. A CADD-Solis Pain Management System v3.0 with Programmed Intermittent Bolus Model 2110 was connected via a 3-way adapter to an epidural catheter and a digital pressure transducer. Pressures generated by delivery speeds of 100, 175, 300, and 400 mL/h of saline solution were tested with 4 epidural catheters (2 single orifice and 2 multiorifice). These runs were replicated on 5 pumps. Analysis of variance was used to compare the mean peak pressures of each delivery speed within each catheter group (single orifice and multiorifice). Thirty runs at each delivery speed were performed with each type of catheter for a total of 240 experimental runs. Peak pressure increased with increasing delivery speeds in both catheter groups (Pintermittent infusion boluses, the delivery speed of saline solution through epidural catheters was directly related to the peak pressures. Future work should evaluate whether differences in the delivery speed of anesthetic solution into the epidural space correlate with differences in the duration and quality of analgesia during programmed intermittent epidural bolus delivery. Copyright © 2016 Elsevier Inc. All rights reserved.

  1. Delivery of an Engineering Seminar to a High School International Exchange Program

    Science.gov (United States)

    Iwata, Setsuo; Matsuishi, Masakatsu; Yoshida, Keishiro; Kim, Youngjong

    Kanazawa Institute of Technology (KIT) supported a high school international exchange program between Komatsu Senior High School of Japan and Daejeon Science High School of South Korea through the delivery of a two-day pre-college engineering seminar in 2008. Students were asked to build stronger and more attractive bridges using as little balsa wood as possible. We delivered the course content through four pedagogical methods: the Plan-Do-Check-Action Cycle, hands-on exercises, cooperative learning, and presentations in English. Students also gained technical knowledge and an international way of thinking. This paper discusses the experience of supporting a high school international exchange program and the results of student feedback.

  2. The effect of a multicomponent dual-modality exercise program targeting osteoporosis on bone health status and physical function capacity of postmenopausal women.

    Science.gov (United States)

    Tolomio, Silvia; Ermolao, Andrea; Lalli, Alberto; Zaccaria, Marco

    2010-01-01

    Exercise is important for the prevention of osteoporosis and the reduction of fracture risk because it improves muscle mass and strength, besides improving balance. We evaluated the effect of a specific exercise program on bone mass and quality and physical function capacity in postmenopausal women with low bone mineral density. Participants (N = 125) underwent a bone mass (Dual X-ray Absorptiometry), bone quality (osteosonography), and physical functional capacity assessment. Fifty-eight of them took part in an 11-month exercise program (E), that included a multicomponent (strength, aerobic capacity, balance, joint mobility) dual-modality (on ground and in the water; alternating group and home-based exercise periods) exercise regimen. The others represented a control group (C) that did not exercise. After the exercise program all participants were reevaluated. After the training program: femoral neck T-score significantly improved in E; C significantly decreased all bone quality (osteosonography) parameters, whereas E showed no differences; E significantly improved all the physical function capacity parameters, while most of them decreased or did not change in C. A specific exercise program targeting osteoporosis improves physical function capacity, reduces physiological bone loss, and maintains bone quality in low bone mineral density postmenopausal women.

  3. Load Estimation from Modal Parameters

    DEFF Research Database (Denmark)

    Aenlle, Manuel López; Brincker, Rune; Fernández, Pelayo Fernández

    2007-01-01

    In Natural Input Modal Analysis the modal parameters are estimated just from the responses while the loading is not recorded. However, engineers are sometimes interested in knowing some features of the loading acting on a structure. In this paper, a procedure to determine the loading from a FRF...... the accuracy in the load estimation. Finally, the results of an experimental program carried out on a simple structure are presented....

  4. MIPAS-Family-evaluation of a new multi-modal behavioral training program for pediatric headaches: clinical effects and the impact on quality of life.

    Science.gov (United States)

    Gerber, Wolf-Dieter; Petermann, Franz; Gerber-von Müller, Gabriele; Dollwet, Maren; Darabaneanu, Stephanie; Niederberger, Uwe; Schulte, Ilva Elena; Stephani, Ulrich; Andrasik, Frank

    2010-06-01

    Several meta-analyses have demonstrated that the combination of electrical muscle activity and Temperature Biofeedback could be regarded as gold standard in chronic pediatric headaches. However, these techniques seem to be uneconomical and furthermore they are not directed to improve the social competence as well as resolve possible impairments in daily activities of the child. Therefore, multi-modal behavioral techniques have been proposed, but no studies comparing these with the gold standard were conducted. The present study compared the impact of a new multi-modal behavioral education and training program--MIPAS-Family--with a combined Biofeedback treatment, evaluating clinical efficacy as well as the effect on the quality of life (QoL) of children with chronic headaches. Thirty-four children and adolescents with recurrent headache, ranging from 7 to 16 years, were randomly assigned to the MIPAS-Family (N = 19) or the Biofeedback (N = 15) condition. All patients were diagnosed by the criteria of the International Headache Society. The children and their parents completed headache diaries, diaries of daily living activities and a QoL questionnaire (KINDL). Both groups showed significant improvements concerning the headache intensity and headache duration. We found no significant differences in the main headache parameters between both treatments. After the treatments, the children were less disturbed by their headaches in the domains school, homework, and leisure time. In conclusion, MIPAS-Family is as effective as Biofeedback but it is more cost-effective and addresses the whole family and the daily activities.

  5. A graphene quantum dot@Fe3O4@SiO2based nanoprobe for drug delivery sensing and dual-modal fluorescence and MRI imaging in cancer cells.

    Science.gov (United States)

    Su, Xiaoqian; Chan, Chunyu; Shi, Jingyu; Tsang, Ming-Kiu; Pan, Yi; Cheng, Changming; Gerile, Oudeng; Yang, Mo

    2017-06-15

    A novel graphene quantum dot (GQD)@Fe 3 O 4 @SiO 2 based nanoprobe was reported for targeted drug delivery, sensing, dual-modal imaging and therapy. Carboxyl-terminated GQD (C-GQD) was firstly conjugated with Fe 3 O 4 @SiO 2 and then functionalized with cancer targeting molecule folic acid (FA). DOX drug molecules were then loaded on GQD surface of Fe 3 O 4 @SiO 2 @GQD-FA nanoprobe via pi-pi stacking, which resulted in Fe 3 O 4 @SiO 2 @GQD-FA/DOX conjugates based on a FRET mechanism with GQD as donor molecules and DOX as acceptor molecules. Meanwhile, we successfully performed in vitro MRI and fluorescence imaging of living Hela cells and monitored intracellular drug release process using this Fe 3 O 4 @SiO 2 @GQD-FA/DOX nanoprobe. Cell viability study demonstrated the low cytotoxicity of Fe 3 O 4 @SiO 2 @GQD-FA nanocarrier and the enhanced therapeutic efficacy of Fe 3 O 4 @SiO 2 @GQD-FA/DOX nanoprobe for cancer cells. This luminomagnetic nanoprobe will be a potential platform for cancer accurate diagnosis and therapy. Copyright © 2016 Elsevier B.V. All rights reserved.

  6. TPGS-stabilized NaYbF4:Er upconversion nanoparticles for dual-modal fluorescent/CT imaging and anticancer drug delivery to overcome multi-drug resistance.

    Science.gov (United States)

    Tian, Gan; Zheng, Xiaopeng; Zhang, Xiao; Yin, Wenyan; Yu, Jie; Wang, Dongliang; Zhang, Zhiping; Yang, Xiangliang; Gu, Zhanjun; Zhao, Yuliang

    2015-02-01

    Multi-drug resistance (MDR) is a major cause of failure in cancer chemotherapy. Tocopheryl polyethylene glycol 1000 succinate (TPGS) has been extensively investigated for overcoming MDR in cancer therapy because of its ability to inhibit P-glycoprotein (P-gp). In this work, TPGS was for the first time used as a new surface modifier to functionalize NaYbF4:Er upconversion nanoparticles (UNCPs) and endowed the as-prepared products (TPGS-UCNPs) with excellent water-solubility, P-gp inhibition capability and imaging-guided drug delivery property. After the chemotherapeutic drug (doxorubicin, DOX) loading, the as-formed composites (TPGS-UCNPs-DOX) exhibited potent killing ability for DOX-resistant MCF-7 cells. Flow-cytometric assessment and Western blot assay showed that the TPGS-UCNPs could potently decrease the P-gp expression and facilitate the intracellular drug accumulation, thus achieving MDR reversal. Moreover, considering that UCNPs process efficient upconversion emission and Yb element contained in UCNPs has strong X-ray attenuation ability, the as-obtained composite could also serve as a dual-modal probe for upconversion luminescence (UCL) imaging and X-ray computed tomography (CT) imaging, making them promising for imaging-guided cancer therapy. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. Conservative treatment modalities in retinoblastoma

    Science.gov (United States)

    Chawla, Bhavna; Jain, Amit; Azad, Rajvardhan

    2013-01-01

    Retinoblastoma is the most common primary intraocular malignancy of childhood. A potentially curable cancer, its treatment has improved significantly over the last few decades. The purpose of this article is to review the literature on various conservative treatment modalities available for the treatment of retinoblastoma and their effectiveness, when used alone or in combination. Pubmed, Medline, Embase, and the Cochrane library were searched through 2012 for published peer reviewed data on conservative treatment modalities for retinoblastoma. Various studies show that while enucleation remains the standard of care for advanced intraocular tumors, conservative modalities that can result in globe salvage and preservation of useful vision are being increasingly employed. Such modalities include systemic chemotherapy, focal consolidation with transpupillary thermotherapy, laser photocoagulation and cryotherapy, plaque brachytherapy, and delivery of local chemotherapy using subconjunctival, sub-tenon, or intra-arterial routes. When used alone or in combination, these treatment modalities can help in avoidance of external beam radiotherapy or enucleation, thus reducing the potential for long-term side effects, while salvaging useful vision. Radioactive plaque brachytherapy has an established role in selected patients with intraocular retinoblastoma. Local injections of chemotherapeutic agents via the sub-tenon or sub-conjunctival route have been used with varying degrees of success, usually as an adjunct to systemic chemotherapy. Intra-arterial ophthalmic artery delivery of melphalan has shown promising results. It is important to recognize that today, several treatment options are available that can obviate the need for enucleation, and cure the cancer with preservation of functional vision. A thorough knowledge and understanding of these conservative treatment modalities is essential for appropriate management. PMID:24104705

  8. Conservative treatment modalities in retinoblastoma

    Directory of Open Access Journals (Sweden)

    Bhavna Chawla

    2013-01-01

    Full Text Available Retinoblastoma is the most common primary intraocular malignancy of childhood. A potentially curable cancer, its treatment has improved significantly over the last few decades. The purpose of this article is to review the literature on various conservative treatment modalities available for the treatment of retinoblastoma and their effectiveness, when used alone or in combination. Pubmed, Medline, Embase, and the Cochrane library were searched through 2012 for published peer reviewed data on conservative treatment modalities for retinoblastoma. Various studies show that while enucleation remains the standard of care for advanced intraocular tumors, conservative modalities that can result in globe salvage and preservation of useful vision are being increasingly employed. Such modalities include systemic chemotherapy, focal consolidation with transpupillary thermotherapy, laser photocoagulation and cryotherapy, plaque brachytherapy, and delivery of local chemotherapy using subconjunctival, sub-tenon, or intra-arterial routes. When used alone or in combination, these treatment modalities can help in avoidance of external beam radiotherapy or enucleation, thus reducing the potential for long-term side effects, while salvaging useful vision. Radioactive plaque brachytherapy has an established role in selected patients with intraocular retinoblastoma. Local injections of chemotherapeutic agents via the sub-tenon or sub-conjunctival route have been used with varying degrees of success, usually as an adjunct to systemic chemotherapy. Intra-arterial ophthalmic artery delivery of melphalan has shown promising results. It is important to recognize that today, several treatment options are available that can obviate the need for enucleation, and cure the cancer with preservation of functional vision. A thorough knowledge and understanding of these conservative treatment modalities is essential for appropriate management.

  9. Smart human serum albumin-indocyanine green nanoparticles generated by programmed assembly for dual-modal imaging-guided cancer synergistic phototherapy.

    Science.gov (United States)

    Sheng, Zonghai; Hu, Dehong; Zheng, Mingbin; Zhao, Pengfei; Liu, Huilong; Gao, Duyang; Gong, Ping; Gao, Guanhui; Zhang, Pengfei; Ma, Yifan; Cai, Lintao

    2014-12-23

    Phototherapy, including photodynamic therapy (PDT) and photothermal therapy (PTT), is a light-activated local treatment modality that is under intensive preclinical and clinical investigations for cancer. To enhance the treatment efficiency of phototherapy and reduce the light-associated side effects, it is highly desirable to improve drug accumulation and precision guided phototherapy for efficient conversion of the absorbed light energy to reactive oxygen species (ROS) and local hyperthermia. In the present study, a programmed assembly strategy was developed for the preparation of human serum albumin (HSA)-indocyanine green (ICG) nanoparticles (HSA-ICG NPs) by intermolecular disulfide conjugations. This study indicated that HSA-ICG NPs had a high accumulation with tumor-to-normal tissue ratio of 36.12±5.12 at 24 h and a long-term retention with more than 7 days in 4T1 tumor-bearing mice, where the tumor and its margin, normal tissue were clearly identified via ICG-based in vivo near-infrared (NIR) fluorescence and photoacoustic dual-modal imaging and spectrum-resolved technology. Meanwhile, HSA-ICG NPs efficiently induced ROS and local hyperthermia simultaneously for synergetic PDT/PTT treatments under a single NIR laser irradiation. After an intravenous injection of HSA-ICG NPs followed by imaging-guided precision phototherapy (808 nm, 0.8 W/cm2 for 5 min), the tumor was completely suppressed, no tumor recurrence and treatments-induced toxicity were observed. The results suggest that HSA-ICG NPs generated by programmed assembly as smart theranostic nanoplatforms are highly potential for imaging-guided cancer phototherapy with PDT/PTT synergistic effects.

  10. Study protocol: a randomised controlled trial of the effects of a multi-modal exercise program on cognition and physical functioning in older women

    Directory of Open Access Journals (Sweden)

    Vaughan Sue

    2012-09-01

    Full Text Available Abstract Background Intervention studies testing the efficacy of cardiorespiratory exercise have shown some promise in terms of improving cognitive function in later life. Recent developments suggest that a multi-modal exercise intervention that includes motor as well as physical training and requires sustained attention and concentration, may better elicit the actual potency of exercise to enhance cognitive performance. This study will test the effect of a multi-modal exercise program, for older women, on cognitive and physical functioning. Methods/design This randomised controlled trial involves community dwelling women, without cognitive impairment, aged 65–75 years. Participants are randomised to exercise intervention or non-exercise control groups, for 16 weeks. The intervention consists of twice weekly, 60 minute, exercise classes incorporating aerobic, strength, balance, flexibility, co-ordination and agility training. Primary outcomes are measures of cognitive function and secondary outcomes include physical functioning and a neurocognitive biomarker (brain derived neurotrophic factor. Measures are taken at baseline and 16 weeks later and qualitative data related to the experience and acceptability of the program are collected from a sub-sample of the intervention group. Discussion If this randomised controlled trial demonstrates that multimodal exercise (that includes motor fitness training can improve cognitive performance in later life, the benefits will be two-fold. First, an inexpensive, effective strategy will have been developed that could ameliorate the increased prevalence of age-related cognitive impairment predicted to accompany population ageing. Second, more robust evidence will have been provided about the mechanisms that link exercise to cognitive improvement allowing future research to be better focused and potentially more productive. Trial registration Australian and New Zealand Clinical Trial Registration Number

  11. Conservation program delivery in the southern U.S.: Preferences and interactions.

    Science.gov (United States)

    Galik, Christopher S; Grala, Robert K

    2017-08-01

    A lingering challenge in implementation of ecosystem-based planning is translating high-level conservation objectives to discrete management initiatives. Recent research underscores this, emphasizing the importance of the processes by which plans are developed and how programs to implement plans are delivered to stakeholders. This study contributes to the existing program design, research methodology, and conservation practice literature through an assessment of landowner and conservation practitioner relationships in the Gulf Coastal Plains and Ozarks (GCPO) region of the southern U.S. The study utilizes online and mail surveys to gather data on landowner interactions with conservation practitioner organizations and interactions between practitioner organizations themselves. Data from the surveys suggest different patterns of interaction as reported by landowners and those reported by practitioner organizations working in the region, with landowners generally interacting more with extension and industry organizations and conservation practitioners interacting more with state and federal agencies. Key informant data also allows for analysis of the conservation practitioner network in the GCPO region. Resulting analysis suggests a well-connected network among the state and federal organizations critical to development and delivery of conservation programs in the GCPO LCC region. Though such configurations may be beneficial for the diffusion of innovative practices across a network, they may nonetheless require continued efforts to coordinate activities at the regional scale, an important component of practice-driven, ecosystem-level management. Copyright © 2017 Elsevier Ltd. All rights reserved.

  12. Home visitation programs: An untapped opportunity for the delivery of early childhood obesity prevention

    Science.gov (United States)

    Salvy, Sarah-Jeanne; de la Haye, Kayla; Galama, Titus; Goran, Michael I.

    2016-01-01

    Background Extant obesity efforts have had limited impact among low-income underserved children, in part because of limitations inherent to existing programs: 1) short duration and low intensity; 2) late timing of implementation, when children are already overweight or obese; 3) intervention delivery limiting their accessibility and sustainability; and 4) failure to address barriers such as a lack of culturally competent services, poverty and housing instability, which interfere with healthy lifestyle changes. Objective This concept paper proposes an innovative model of obesity prevention implemented in infancy and sustained throughout early childhood to address the limitations of current obesity prevention efforts. Specifically, we propose to integrate sustained, weekly, in-home obesity prevention as part of the services already delivered by ongoing Home Visitation Programs, which currently do not target obesity prevention. Conclusion The home visiting structure represents an ideal model for impactful obesity prevention as home visitation programs: (1) already provide comprehensive services to diverse low-income infants and families who are most at risk for obesity and poor health due to socio-economic and structural conditions; (2) services are initiated in infancy and sustained throughout critical developmental periods for the formation of healthy/unhealthy behaviors; and (3) have been in place for more than 40 years, with a widespread presence across the United States and nationwide, which is critical for the scalability and sustainability of obesity prevention. PMID:27911984

  13. Development and delivery of a pharmacist training program to increase naloxone access in Kentucky.

    Science.gov (United States)

    Palmer, Emma; Hart, Steve; Freeman, Patricia R

    To describe the development and delivery of a comprehensive training program for Kentucky pharmacists to enable dispensation of naloxone per protocol. In May 2015, the Kentucky Board of Pharmacy (KBP) promulgated regulations outlining the requirements for pharmacists to initiate the dispensing of naloxone under a physician-approved protocol. The Advancing Pharmacy Practice in Kentucky Coalition, a partnership between Kentucky's Colleges of Pharmacy, KBP, and state and local pharmacists associations, developed and offered educational programming to fulfill this regulation. Pharmacists who completed the 90-minute program could apply to KBP for registration as a naloxone-certified pharmacist. The program consists of a 90-minute session covering naloxone access, opioid overdoses, the pharmacology and use of naloxone, protocol development, patient identification, and resources. Sessions were offered live and via webinar. Sessions have also been incorporated into the pharmacy curriculum at the 2 colleges of pharmacy in Kentucky. Between June 28, 2015, and June 1, 2016, a total of 1254 pharmacists and 348 student pharmacists completed training. Of those, 646 (52%) have applied to KBP and received naloxone-certified status. The program was well received, with 87% of learners ranking the usefulness of the information presented as excellent. Learners cited screening tips, protocol information, patient screening information, and education resources as information they will implement in their practice. The swift deployment of training to a wide variety of pharmacy professionals has resulted in a substantial number of naloxone-certified pharmacists across Kentucky. Through a coordinated training initiative involving all major pharmacy stakeholders, we reached many individuals rapidly, documenting the value of this approach for future training endeavors. This educational initiative may enhance pharmacy practice across Kentucky and the nation by expanding and educating on the

  14. Programmed co-delivery of paclitaxel and doxorubicin boosted by camouflaging with erythrocyte membrane

    Science.gov (United States)

    Fu, Qiang; Lv, Piping; Chen, Zhongke; Ni, Dezhi; Zhang, Lijun; Yue, Hua; Yue, Zhanguo; Wei, Wei; Ma, Guanghui

    2015-02-01

    Combination chemotherapy has been proven promising for cancer treatment, but unsatisfactory therapeutic data and increased side effects slow down the development in the clinic. In this study, we develop an effective approach to co-encapsulate a hydrophilic-hydrophobic chemotherapeutic drug pair (paclitaxel and doxorubicin) into magnetic O-carboxymethyl-chitosan nanoparticles. To endow them with the ability of programmed delivery, these carriers are further camouflaged with an Arg-Gly-Asp anchored erythrocyte membrane. Compared with the traditional polyethylene glycol coating method, this biomimetic decoration strategy is demonstrated to be superior in prolonging circulation time, improving tumor accumulation, facilitating tumor uptake, and tuning intracellular fate. These outstanding properties enable the as-designed nanodevice to exhibit greater tumor growth inhibition ability and much lower side effects than the combined use of commercial formulations.Combination chemotherapy has been proven promising for cancer treatment, but unsatisfactory therapeutic data and increased side effects slow down the development in the clinic. In this study, we develop an effective approach to co-encapsulate a hydrophilic-hydrophobic chemotherapeutic drug pair (paclitaxel and doxorubicin) into magnetic O-carboxymethyl-chitosan nanoparticles. To endow them with the ability of programmed delivery, these carriers are further camouflaged with an Arg-Gly-Asp anchored erythrocyte membrane. Compared with the traditional polyethylene glycol coating method, this biomimetic decoration strategy is demonstrated to be superior in prolonging circulation time, improving tumor accumulation, facilitating tumor uptake, and tuning intracellular fate. These outstanding properties enable the as-designed nanodevice to exhibit greater tumor growth inhibition ability and much lower side effects than the combined use of commercial formulations. Electronic supplementary information (ESI) available. See DOI

  15. Roles of Social Movement Organizations for Securing Workers' Safety in Korea: A Case Study of Abolition of the 30-Minute Delivery Guarantee Program in Pizza Delivery Service.

    Science.gov (United States)

    Park, Ji-Eun; Kim, Myoung-Hee

    2016-07-01

    Many restaurants in Korea maintain quick-delivery service programs to satisfy customers. This service allows delivery workers limited time to deliver, which frequently put them in danger. Most of the workers are young, work part-time, and are rarely organized into trade unions. In this article, through a case study of the social movement to abolish the 30-minute delivery guarantee program of pizza companies in Korea, we argue that social movements involving social movement organizations (SMOs) and individual citizens could serve as a means to rectify this problem. We show how the SMOs developed and expanded the movement using a framing perspective and how the general public became involved through social media. Data was collected via online searching. Interview scripts from key players of SMOs and unofficial documents they provided were also reviewed. Three SMOs primarily led the movement, successfully forming a frame that emphasized social responsibility. SMOs also utilized social media to link their standing frame with unmobilized citizens and to expand the movement. We identified contributing factors and limitations of the movement and drew lessons that could be applied to other sectors where workers are in vulnerable positions. © The Author(s) 2016.

  16. Load Estimation from Natural input Modal Analysis

    DEFF Research Database (Denmark)

    Aenlle, Manuel López; Brincker, Rune; Canteli, Alfonso Fernández

    2005-01-01

    One application of Natural Input Modal Analysis consists in estimating the unknown load acting on structures such as wind loads, wave loads, traffic loads, etc. In this paper, a procedure to determine loading from a truncated modal model, as well as the results of an experimental testing programme...... estimation. In the experimental program a small structure subjected to vibration was used to estimate the loading from the measurements and the experimental modal space. The modal parameters were estimated by Natural Input Modal Analysis and the scaling factors of the mode shapes obtained by the mass change...

  17. The introduction of multi-modal education: a strategy in process ...

    African Journals Online (AJOL)

    modal approach to delivery has been accepted that includes WebCT as a platform of delivery that complements F2F classroom instruction. At institutional level, the introduction of new technologies for delivery of education forces institutional ...

  18. Synthesis of the project leadership staffing needs for successful development of alternative delivery programs.

    Science.gov (United States)

    2017-08-01

    This research provides a synthesis of practices in organizational structuring and professional staffing of the innovative delivery units in several state DOTs across the nation that are actively utilizing alternative project delivery. Several major c...

  19. A cost effectiveness study of integrated care in health services delivery: a diabetes program in Australia

    Directory of Open Access Journals (Sweden)

    Snow Jill

    2008-10-01

    Full Text Available Abstract Background Type 2 diabetes is rapidly growing as a proportion of the disease burden in Australia as elsewhere. This study addresses the cost effectiveness of an integrated approach to assisting general practitioners (GPs with diabetes management. This approach uses a centralized database of clinical data of an Australian Division of General Practice (a network of GPs to co-ordinate care according to national guidelines. Methods Long term outcomes for patients in the program were derived using clinical parameters after 5 years of program participation, and the United Kingdom Prospective Diabetes Study (UKPDS Outcomes Model, to project outcomes for 40 years from the time of diagnosis and from 5 years post-diagnosis. Cost information was obtained from a range of sources. While program costs are directly available, and costs of complications can be estimated from the UKPDS model, other costs are estimated by comparing costs in the Division with average costs across the state or the nation. The outcome and cost measures are used derive incremental cost-effectiveness ratios. Results The clinical data show that the program is effective in the short term, with improvement or no statistical difference in most clinical measures over 5 years. Average HbA1c levels increased by less than expected over the 5 year period. While the program is estimated to generate treatment cost savings, overall net costs are positive. However, the program led to projected improvements in expected life years and Quality Adjusted Life Expectancy (QALE, with incremental cost effectiveness ratios of $A8,106 per life-year saved and $A9,730 per year of QALE gained. Conclusions The combination of an established model of diabetes progression and generally available data has provided an opportunity to establish robust methods of testing the cost effectiveness of a program for which a formal control group was not available. Based on this methodology, integrated health care

  20. Advanced modalizing problems

    OpenAIRE

    Jago, Mark

    2016-01-01

    I present an internal problem for David Lewis’s genuine modal realism. My aim is to show that his analysis of modality is inconsistent with his metaphysics. I consider several ways of modifying the Lewisian analysis of modality, but argue that none are successful. I argue that the problem also affects theories related to genuine modal realism, including the stage theory of persistence and modal fictionalism.

  1. Modal Epistemology and Conceivability

    DEFF Research Database (Denmark)

    Steffensen, Asger Bo Skjerning

    Philosophical argumentation often depends on modal facts, i.e. facts about what is possible, contingent, or necessary. For thought and cognition outside the domain of philosophy modal facts are also often decisive. It seems we have an easy access to modal facts, but how so? Through a presentation...... of the state-of-the-art in modal epistemology I wish to outline a research project based on conceivability that will try to explain how we come to know modal facts....

  2. National findings regarding health IT use and participation in health care delivery reform programs among office-based physicians.

    Science.gov (United States)

    Heisey-Grove, Dawn; Patel, Vaishali

    2017-01-01

    Our objective was to characterize physicians' participation in delivery and payment reform programs over time and describe how participants in these programs were using health information technology (IT) to coordinate care, engage patients, manage patient populations, and improve quality. A nationally representative cohort of physicians was surveyed in 2012 (unweighted N = 2567) and 2013 (unweighted N = 2399). Regression analyses used those survey responses to identify associations between health IT use and participation in and attrition from patient-centered medical homes (PCMHs), accountable care organizations (ACOs), and pay-for-performance programs (P4Ps). In 2013, 45% of physicians participated in PCMHs, ACOs, or P4Ps. While participation in each program increased (P Health IT use was associated with greater program participation (RR = 1.07-1.16). PCMH, ACO, and P4P participants were more likely than nonparticipants to perform quality improvement and patient engagement activities electronically (RR = 1.09-1.14); only ACO participants were more likely to share information electronically (RR = 1.07-1.09). Participation in delivery and payment reform programs increased between 2012 and 2013. Participating physicians were more likely to use health IT. There was significant attrition from and switching between PCMHs, ACOs, and P4Ps. This work provides the basis for understanding physician participation in and attrition from delivery and payment reform programs, as well as how health IT was used to support those programs. Understanding health IT use by program participants may help to identify factors enabling a smooth transition to alternative payment models. Published by Oxford University Press on behalf of the American Medical Informatics Association 2016. This work is written by US Government employees and is in the public domain in the United States.

  3. Bespoke program design for school-aged therapy disability service delivery.

    Science.gov (United States)

    Weatherill, Pamela; Bahn, Susanne; Cooper, Trudi

    2012-01-01

    This article uses the evaluation of a school-aged therapy service for children with disabilities in Western Australia to investigate models of service delivery. The current literature on family-centered practice, multidisciplinary and transdisciplinary approaches, and 4 models of service are reviewed. The models include the life needs model, the relational goal-orientated model of optimal service delivery to children and families, the quality of life model, and the collaborative model of service delivery. Analysis of the data is presented together with a bespoke model of service delivery for children with disabilities, arguing that local contexts benefit from custom-made service design.

  4. Advances in Modal Logic

    DEFF Research Database (Denmark)

    is the proceedings of the conference of record in its fi eld, Advances in Modal Logic. Its contributions are state-of-the-art papers. The topics include decidability and complexity results for specifi c modal logics, proof theory of modal logic, logics for reasoning about time and space, provability logic, dynamic...

  5. Parametric modal transition systems

    DEFF Research Database (Denmark)

    Beneš, Nikola; Křetínský, Jan; Larsen, Kim Guldstrand

    2011-01-01

    in the refinement process like exclusive, conditional and persistent choices. We introduce a new model called parametric modal transition systems (PMTS) together with a general modal refinement notion that overcome many of the limitations and we investigate the computational complexity of modal refinement checking....

  6. Experimental modal analysis

    DEFF Research Database (Denmark)

    Ibsen, Lars Bo; Liingaard, Morten

    This technical report concerns the basic theory and principles for experimental modal analysis. The sections within the report are: Output-only modal analysis software (section 1.1), general digital analysis (section 1.2), basics of structural dynamics and modal analysis (section 1.3) and system...

  7. Pragmatics in Interlanguage: German Modal Particles.

    Science.gov (United States)

    Mollering, Martina; Nunan, David

    1995-01-01

    Argues that mastery of modal particles is important for interpersonal aspects of language development. The article outlines the difficulty of learning and teaching German modal particles with regard to the theoretical explication. The study shows how a teaching program improved initially poor comprehension and production skills in the area of…

  8. A randomised controlled trial of a web-based multi-modal therapy program to improve executive functioning in children and adolescents with acquired brain injury.

    Science.gov (United States)

    Piovesana, Adina; Ross, Stephanie; Lloyd, Owen; Whittingham, Koa; Ziviani, Jenny; Ware, Robert S; McKinlay, Lynne; Boyd, Roslyn N

    2017-10-01

    To examine the efficacy of a multi-modal web-based therapy program, Move it to improve it (Mitii™) delivered at home to improve Executive Functioning (EF) in children with an acquired brain injury (ABI). Randomised Waitlist controlled trial. Home environment. Sixty children with an ABI were matched in pairs by age and intelligence quotient then randomised to either 20-weeks of Mitii™ training or 20 weeks of Care As Usual (waitlist control; n=30; 17 males; mean age=11y, 11m (±2y, 6m); Full Scale IQ=76.24±17.84). Fifty-eight children completed baseline assessments (32 males; mean age=11.87±2.47; Full Scale IQ=75.21±16.76). Executive functioning was assessed on four domains: attentional control, cognitive flexibility, goal setting, and information processing using subtests from the Wechsler Intelligence Scale for Children (WISC-IV), Delis-Kaplan Executive Functioning System (D-KEFS), Comprehensive Trail Making Test (CTMT), Tower of London (TOL), and Test of Everyday Attention for Children (Tea-Ch). Executive functioning performance in everyday life was assessed via parent questionnaire (Behaviour Rating Inventory of Executive Functioning; BRIEF). No differences were observed at baseline measures. Groups were compared at 20-weeks using linear regression with no significant differences found between groups on all measures of EF. Out of a potential total dose of 60 hours, children in the Mitii™ group completed a mean of 17 hours of Mitii™ intervention. Results indicate no additional benefit to receiving Mitii™ compared to standard care. Mitii™, in its current form, was not shown to improve EF in children with ABI.

  9. A Partnership Training Program: Studying Targeted Drug Delivery Using Nanoparticles in Breast Cancer Diagnosis and Therapy

    Science.gov (United States)

    2014-10-01

    adhesion of drug delivery carriers throughout the circulatory system and the in vivo circulation time of the nanomedicine can be controlled by modulating...Environ Sci Process Impacts 2013;15:23–38. Magde D, Elson E, Webb WW. Thermodynamic fluctuations in a reacting system — measurement by fluorescence...nanotechnology in medicine, the use of various nanomaterials as pharmaceutical delivery systems for drugs, DNA, and imaging agents has gained increasing

  10. Programmed delivery of verapamil hydrochloride from tablet in a capsule device

    Directory of Open Access Journals (Sweden)

    Mukesh Lal Sah

    2012-06-01

    Full Text Available The aim of the present work was to develop a programmed drug delivery system which would be able to release the drug after 6 h of lag time by use of hydrophilic polymers. The capsule body was made impermeable by use of formaldehyde vapor treatment, while the cap was untreated. The capsule was filled with two layered tablets (tablet-in-capsule, followed by a sodium bicarbonate:citric acid mixture (SBCM and lactose as bulking agent. Sodium alginate, chitosan, HPMC K15 and chitosan:sodium alginate complex (CSAC were used as the rate modulating layer. Through combined use of HPMC K15 and adjusting the ratio of CSAC, the desired lag time of 6 h was obtained. The effect of the bulking agents on the lag time were also studied and it was found that the lag time was decreased with higher amounts of lactose, and delayed dissolution and decreased lag time was observed at higher amount of effervescent mixture.O objetivo do presente trabalho foi desenvolver sistema de liberação programada de cloridrato de verapamil capaz de liberação imediata do fármaco após 6 h de intervalo de tempo usando polímeros hidrofílicos. O corpo da cápsula foi impermeabilizado por tratamento de vapor de formaldeído, enquanto a tampa não foi submetida ao tratamento. Dois comprimidos foram inseridos na cápsula (comprimidos em cápsula seguido de mistura de bicarbonato de sódio: ácido cítrico e lactose, utilizados como excipientes. O alginato de sódio, a quitosana, o HPMC K15 e o complexo quitosana:alginato de sódio foram utilizados para modular a razão de liberação do fármaco. A combinação entre o HPMC K15 e o ajuste da proporção do complexo quitosana:alginato de sódio permitiu a liberação do fármaco após 6 h. O efeito dos excipientes na liberação do fármaco foi também avaliado. Verificou-se que o tempo de latência foi reduzido na presença de maior quantidade de lactose, enquanto o menor tempo foi observado empregando maior concentração da

  11. Operational Modal Analysis Tutorial

    OpenAIRE

    Brincker, Rune; ANDERSEN, Palle

    2007-01-01

    In this paper the basic principles in operational modal testing and analysis are presented and discussed. A brief review of the techniques for operational modal testing and identification is presented, and it is argued, that there is now a wide range of techniques for effective identification of modal parameters of practical interest - including the mode shape scaling factor - with a high degree of accuracy. It is also argued that the operational technology offers the user a number of advanta...

  12. Blended Synchronous Delivery Mode in Graduate Programs: A Literature Review and Its Implementation in the Master Teacher Program

    Science.gov (United States)

    Lakhal, Sawsen; Bateman, Dianne; Bédard, Janie

    2017-01-01

    The aim of this study is to present a narrative literature review of advantages, challenges, and conditions for the success of blended synchronous course delivery mode. For this purpose, we searched the database EditLib and analyzed 16 existing papers from 2001 to 2016. The conditions for success were operationalized in the Master Teacher Program…

  13. Statewide program to promote institutional delivery in Gujarat, India: who participates and the degree of financial subsidy provided by the Chiranjeevi Yojana program.

    Science.gov (United States)

    Sidney, Kristi; Iyer, Veena; Vora, Kranti; Mavalankar, Dileep; De Costa, Ayesha

    2016-01-27

    The Chiranjeevi Yojana (CY) is a large public-private partnership program in Gujarat, India, under which the state pays private sector obstetricians to provide childbirth services to poor and tribal women. The CY was initiated statewide in 2007 because of the limited ability of the public health sector to provide emergency obstetric care and high out-of-pocket expenditures in the private sector (where most qualified obstetricians work), creating financial access barriers for poor women. Despite a million beneficiaries, there have been few reports studying CY, particularly the proportion of vulnerable women being covered, the expenditures they incur in connection with childbirth, and the level of subsidy provided to beneficiaries by the program. Cross-sectional facility based the survey of participants in three districts of Gujarat in 2012-2013. Women were interviewed to elicit sociodemographic characteristics, out-of-pocket expenditures, and CY program details. Descriptive statistics, chi square, and a multivariable logistic regression were performed. Of the 901 women surveyed in 129 facilities, 150 (16 %) were CY beneficiaries; 336 and 415 delivered in government and private facilities, respectively. Only 36 (24 %) of the 150 CY beneficiaries received a completely cashless delivery. Median out-of-pocket for vaginal/cesarean delivery among CY beneficiaries was $7/$71. The median degree of subsidy for women in CY who delivered vaginally/cesarean was 85/71 % compared to out-of-pocket expenditure of $44/$208 for vaginal/cesarean delivery paid by non-program beneficiaries in the private health sector. CY beneficiaries experienced a substantially subsidized childbirth compared to women who delivered in non-accredited private facilities. However, despite the government's efforts at increasing access to delivery services for poor women in the private sector, uptake was low and very few women experienced a cashless delivery. While the long-term focus remains on

  14. TICS: A System For The Authoring and Delivery Of Interactive Instructional Programs.

    Science.gov (United States)

    Kaplow, Roy; And Others

    The Teacher-Interactive Computer System (TICS) is an on-line and interactive programing system for authoring interactive programs, particularly instructional programs. The system provides a fairly natural language, in which the author's statements for creating items in a program, for examining the structure and flow, for simulating its use by…

  15. Our practice is our passion: development and delivery of a 21st-century doctor of public health program.

    Science.gov (United States)

    DeBate, Rita D; Petersen, Donna J; Wathington, Deanna; Wolfe-Quintero, Kate

    2015-03-01

    Twenty-first century advances have significantly altered the functions of public health professionals, resulting in a need for advanced level training in community health leadership and practice-oriented research without interruption of professional careers. We present an example of an innovative Doctor of Public Health (DrPH) program developed at the University of South Florida College of Public Health. This program incorporates 21st century public health competencies within a competency-based curricular model, delivered in a hybrid format (fall or spring online delivery and a 1-week face-to-face summer institute) in collaboration between academic and practice-based public health professionals at local and national levels. This revised competency-based program is an example of how to meet the needs of the 21st century public health practitioners while maintaining their connections to the practice world.

  16. Operational Modal Analysis Tutorial

    DEFF Research Database (Denmark)

    Brincker, Rune; Andersen, Palle

    In this paper the basic principles in operational modal testing and analysis are presented and discussed. A brief review of the techniques for operational modal testing and identification is presented, and it is argued, that there is now a wide range of techniques for effective identification of ...... estimation, vibration level estimation and fatigue analysis....

  17. Routine Immunization Service Delivery Through the Basic Package of Health Services Program in Afghanistan: Gaps, Challenges, and Opportunities.

    Science.gov (United States)

    Mbaeyi, Chukwuma; Kamawal, Noor Shah; Porter, Kimberly A; Azizi, Adam Khan; Sadaat, Iftekhar; Hadler, Stephen; Ehrhardt, Derek

    2017-07-01

    The Basic Package of Health Services (BPHS) program has increased access to immunization services for children living in rural Afghanistan. However, multiple surveys have indicated persistent immunization coverage gaps. Hence, to identify gaps in implementation, an assessment of the BPHS program was undertaken, with specific focus on the routine immunization (RI) component. A cross-sectional survey was conducted in 2014 on a representative sample drawn from a sampling frame of 1858 BPHS health facilities. Basic descriptive analysis was performed, capturing general characteristics of survey respondents and assessing specific RI components, and χ2 tests were used to evaluate possible differences in service delivery by type of health facility. Of 447 survey respondents, 27% were health subcenters (HSCs), 30% were basic health centers, 32% were comprehensive health centers, and 12% were district hospitals. Eighty-seven percent of all respondents offered RI services, though only 61% of HSCs did so. Compared with other facility types, HSCs were less likely to have adequate stock of vaccines, essential cold-chain equipment, or proper documentation of vaccination activities. There is an urgent need to address manpower and infrastructural deficits in RI service delivery through the BPHS program, especially at the HSC level.

  18. Does involvement of local NGOs enhance public service delivery? Cautionary evidence from a malaria-prevention program in India.

    Science.gov (United States)

    Das, Ashis; Friedman, Jed; Kandpal, Eeshani

    2018-01-01

    Partnerships between government and non-state actors that aim to enhance the quality or efficiency of service delivery are increasingly common in today's development policy landscape. We investigate the impacts of such an approach using data from an experimental supportive intervention to India's malaria control program that leveraged local non-state capacity in order to promote mosquito net usage and recommended fever care-seeking patterns. The supportive activities were conducted simultaneously by 3 NGOs, contracted out by the Indian government, in 2 endemic districts in the state of Odisha. We find that program impact significantly varied by location. Examining 3 potential sources of this variation (differential population characteristics, differential health worker characteristics, and differential implementer characteristics), we provide evidence that both population and NGO characteristics significantly affected the success of the program. Specifically, the results suggest that the quality and effort of the local implementer played a key role in the differential effectiveness. We discuss these findings as they relate to the external validity of development policy evaluations and, specifically, for the ability of health and other service delivery systems to benefit from limited non-state capacity in underresourced areas. Copyright © 2017 John Wiley & Sons, Ltd.

  19. From Entry to Practice to Advanced Nurse Practitioner - The Progression of Competencies and How They Assist in Delivery of eHealth Programs for Healthy Ageing.

    Science.gov (United States)

    Rodger, Daragh; Hussey, Pamela

    2017-01-01

    Most of the health issues encountered in persons of older age are the result of one or more chronic diseases. The evidence base reports that chronic diseases can be prevented or delayed by engaging in healthy behaviors. Education provides a cost effective intervention on both economic grounds in addition to delivery of optimal patient outcomes. Information and Communication Technology (ICT) increasingly is viewed as a critical utility in eHealth delivery, providing scope for expanding online education facilities for older persons. Developing nursing competencies in the delivery of eHealth solutions to deliver user education programs therefore makes sense. This chapter discusses nursing competencies on the development of targeted eHealth programs for healthy ageing. The role of Advanced Nurse Practitioner in Ireland and its associated competency set identifies how a strong action learning model can be designed to deliver eHealth educational programs for effective delivery of healthy ageing in place.

  20. Face-to-face Training is the Preferred Modality of Professional Continuing Education for Librarians of All Ages, but More Evidence is Needed. A Review of: Lynn, V. A., Bose, A., & Boehmer, S. J. (2010. Librarian instruction-delivery modality preferences for professional continuing education. Journal of the Medical Library Association, 98(1, 57-64.

    Directory of Open Access Journals (Sweden)

    Kathryn Oxborrow

    2011-03-01

    Full Text Available Objective – To establish the preferred modality for professional continuing education (CE among members of three library associations. The primary hypothesis was that face-to-face training is the preferred modality, and the secondary hypothesis was that younger librarians are more likely to favour online or blended training modalities. In addition, the authors sought to investigate which factors influence participants’ decisions to take up training.Design – Online questionnaire.Setting – Three library associations based in the United States of America. These were the American Library Association (ALA, the Special Libraries Association (SLA, and the Medical Library Association (MLA.Subjects – A random sample of 328 members of the ALA (86 participants, SLA (63 participants, and MLA (291 participants. Some participants were members of more than one association.Methods – Participants were recruited to complete an online survey via direct e-mail contact (MLA, messages on email discussion lists (SLA and social networks (ALA. The survey asked about participants’ experience of, and preference for, five different training modalities for CE. These were: face-to-face (classroom instruction, web-based synchronous (with real-time participant-instructor interaction, web-based asynchronous (with instructor involvement, but not in real time, blended (a combination of different modalities, and webcasts (live online presentations with limited participant-instructor interaction. Participants were then asked to rank factors which would influence their decision to undertake CE courses. The factors were cost, opportunity to socialize/network, time away from work, learning at their own pace, and having immediate access to either the class instructor or other participants. Participants were also given space to comment on both CE modalities and influencing factors.Main Results – There was a statistically significant preference for face

  1. R&D program benefits estimation: DOE Office of Electricity Delivery and Energy Reliability

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2006-12-04

    The overall mission of the U.S. Department of Energy’s Office of Electricity Delivery and Energy Reliability (OE) is to lead national efforts to modernize the electric grid, enhance the security and reliability of the energy infrastructure, and facilitate recovery from disruptions to the energy supply. In support of this mission, OE conducts a portfolio of research and development (R&D) activities to advance technologies to enhance electric power delivery. Multiple benefits are anticipated to result from the deployment of these technologies, including higher quality and more reliable power, energy savings, and lower cost electricity. In addition, OE engages State and local government decision-makers and the private sector to address issues related to the reliability and security of the grid, including responding to national emergencies that affect energy delivery. The OE R&D activities are comprised of four R&D lines: High Temperature Superconductivity (HTS), Visualization and Controls (V&C), Energy Storage and Power Electronics (ES&PE), and Distributed Systems Integration (DSI).

  2. Modal survey of the Brazilian launch vehicle

    Science.gov (United States)

    Carneiro, S. H. S.; Teixeira, H. S., Jr.; Pirk, R.; Arruda, J. R. F.

    This paper describes the Brazilian satellite launch vehicle modal analysis program being currently performed. A full scale mock-up of the solid propellant four-stage launcher will be tested in five different configurations. To simulate free-free boundary conditions, a pneumatic suspension system was developed, and its influence in the mock-up dynamic behavior was investigated. The theoretical FEM models and preliminary results of the modal test are shown, along with theoretical/experimental correlation discussions.

  3. A prospective comparison of telemedicine versus in-person delivery of an interprofessional education program for adults with inflammatory arthritis.

    Science.gov (United States)

    Kennedy, Carol A; Warmington, Kelly; Flewelling, Carol; Shupak, Rachel; Papachristos, Angelo; Jones, Caroline; Linton, Denise; Beaton, Dorcas E; Lineker, Sydney; Hogg-Johnson, Sheilah

    2017-02-01

    Introduction We evaluated two modes of delivery of an inflammatory arthritis education program ("Prescription for Education" (RxEd)) in improving arthritis self-efficacy and other secondary outcomes. Methods We used a non-randomized, pre-post design to compare videoconferencing (R, remote using telemedicine) versus local (I, in-person) delivery of the program. Data were collected at baseline (T1), immediately following RxEd (T2), and at six months (T3). Self-report questionnaires served as the data collection tool. Measures included demographics, disorder-related, Arthritis Self-Efficacy Scale (SE), previous knowledge (Arthritis Community Research and Evaluation Unit (ACREU) rheumatoid arthritis knowledge questionnaire), coping efficacy, Illness Intrusiveness, and Effective Consumer Scale. Analysis included: baseline comparisons and longitudinal trends (R vs I groups); direct between-group comparisons; and Generalized Estimating Equations (GEE) analysis. Results A total of 123 persons attended the program (I: n = 36; R: n = 87) and 111 completed the baseline questionnaire (T1), with follow-up completed by 95% ( n = 117) at T2 and 62% ( n = 76) at T3. No significant baseline differences were found across patient characteristics and outcome measures. Both groups (R and I) showed immediate effect (improved arthritis SE, mean change (95% confidence interval (CI)): R 1.07 (0.67, 1.48); I 1.48 (0.74, 2.23)) after the program that diminished over six months (mean change (95% CI): R 0.45 (-0.1, 0.1); I 0.73 (-0.25, 1.7)). For each of the secondary outcomes, both groups showed similar trends for improvement (mean change scores (95% CI)) over time. GEE analysis did not show any meaningful differences between groups (R vs I) over time. Discussion Improvements in arthritis self-efficacy and secondary outcomes displayed similar trends for I and R participant groups.

  4. Mixture model modal clustering

    OpenAIRE

    Chacón, José E.

    2016-01-01

    The two most extended density-based approaches to clustering are surely mixture model clustering and modal clustering. In the mixture model approach, the density is represented as a mixture and clusters are associated to the different mixture components. In modal clustering, clusters are understood as regions of high density separated from each other by zones of lower density, so that they are closely related to certain regions around the density modes. If the true density is indeed in the as...

  5. Using Blended Learning as an Innovative Delivery Model for an In-House Language Program

    Science.gov (United States)

    Gadbois, Manon; Quildon, Denise

    2013-01-01

    This paper reports on the development and implementation in 2012 of McGill University's French at Work program for McGill employees, using a blended learning model. The program is an example of how a reduction in face-to-face teaching presents one solution to employees' scheduling constraints and how this model might offer suggestions for the…

  6. Should Your College Start a Center for the Delivery of Contract Training Programs? ERIC Digest.

    Science.gov (United States)

    Deegan, William L.

    Community colleges have been at the forefront in providing contract training programs for clients such as businesses, health care organizations, and government agencies. Many state governments are beginning to provide resources for these programs as an incentive to attract or retain business and industry. One of the consequences of the demand for…

  7. SU-C-BRD-01: Multi-Centre Collaborative Quality Assurance Program for IMRT Planning and Delivery: Year 3 Results

    Energy Technology Data Exchange (ETDEWEB)

    McNiven, A; Jaffray, D; Letourneau, D [Princess Margaret Cancer Centre and Department of Radiation Oncology, University of Toronto, Toronto, ON (Canada)

    2015-06-15

    Purpose: A multi-centre quality assurance program was developed to enable quality improvement by coupling measurement of intensity modulated radiotherapy (IMRT) planning and delivery performance for site-specific planning exercises with diagnostic testing. The third year of the program specifically assessed the quality of spine stereotactic body radiotherapy (SBRT) planning and delivery amongst the participating centres. Methods: A spine SBRT planning exercise (24 Gy in 2 fractions) was created and completed by participants prior to an on-site visit. The delivery portion of the on-site visit included spine SBRT plan delivery and diagnostic testing, which included portal image acquisition for quantification of phantom positioning error and multi-leaf collimator (MLC) calibration accuracy. The measured dose was compared to that calculated in the treatment planning system (TPS) using 3%/2mm composite analysis and 3%/3mm gamma analysis. Results: Fourteen institutions participated, creating 17 spine SBRT plans (15 VMAT and 2 IMRT). Three different TPS, two beam energies (6 MV and 6 MV FFF), and four MLC designs from two linac vendors were tested. Large variation in total monitor units (MU) per plan (2494–6462 MU) and dose-volume parameters was observed. The maximum point dose in the plans ranged from 116–149% and was dependent upon the TPS used. Pass rates for measured to planned dose comparison ranged from 89.4–100% and 97.3–100% for 3%/2mm and 3%/3mm criteria respectively. The largest measured MLC error did Result in one of the poorer pass rates. No direct correlation between phantom positioning error and pass rates overall. Conclusion: Significant differences were observed in the planning exercise for some plan and dose-volume parameters based on the TPS used. Standard evaluation criteria showed good agreement between planned and measured dose for all participants, however on an individual plan basis, diagnostic tests were able to identify contributing

  8. Improving clinical research and cancer care delivery in community settings: evaluating the NCI community cancer centers program

    Directory of Open Access Journals (Sweden)

    Fennell Mary L

    2009-09-01

    Full Text Available Abstract Background In this article, we describe the National Cancer Institute (NCI Community Cancer Centers Program (NCCCP pilot and the evaluation designed to assess its role, function, and relevance to the NCI's research mission. In doing so, we describe the evolution of and rationale for the NCCCP concept, participating sites' characteristics, its multi-faceted aims to enhance clinical research and quality of care in community settings, and the role of strategic partnerships, both within and outside of the NCCCP network, in achieving program objectives. Discussion The evaluation of the NCCCP is conceptualized as a mixed method multi-layered assessment of organizational innovation and performance which includes mapping the evolution of site development as a means of understanding the inter- and intra-organizational change in the pilot, and the application of specific evaluation metrics for assessing the implementation, operations, and performance of the NCCCP pilot. The assessment of the cost of the pilot as an additional means of informing the longer-term feasibility and sustainability of the program is also discussed. Summary The NCCCP is a major systems-level set of organizational innovations to enhance clinical research and care delivery in diverse communities across the United States. Assessment of the extent to which the program achieves its aims will depend on a full understanding of how individual, organizational, and environmental factors align (or fail to align to achieve these improvements, and at what cost.

  9. Potential Cost-Effectiveness of an Influenza Vaccination Program Offering Microneedle Patch for Vaccine Delivery in Children.

    Science.gov (United States)

    Wong, Carlos; Jiang, Minghuan; You, Joyce H S

    2016-01-01

    The influenza vaccine coverage rate of children is low in Hong Kong. Microneedle patches (MNPs) is a technology under development for painless delivery of vaccines. This study aimed to examine the potential clinical outcomes and direct medical costs of an influenza program offering MNP vaccine to children who have declined intramuscular (IM) vaccine in Hong Kong. A decision model was designed to compare potential outcomes between IM vaccine program and a program offering MNP vaccine to those declined IM vaccine (IM/MNP program) in a hypothetical cohort of children over one-year time horizon. The model outcomes included direct medical cost, influenza infection rate, mortality rate, and quality-adjusted life-years (QALYs) loss. Model inputs were retrieved from published literature. Sensitivity analyses were performed to examine the robustness of model results. In base-case analysis, IM/MNP program was more costly per child (USD19.13 versus USD13.69; USD1 = HKD7.8) with lower influenza infection rate (98.9 versus 124.8 per 1,000 children), hospitalization rate (0.83 versus 1.05 per 1,000 children) and influenza-related mortality rate (0.00042 versus 0.00052 per 1,000 children) when compared to IM program. The incremental cost per QALY saved (ICER) of IM/MNP program versus IM program was 27,200 USD/QALY. Using gross domestic product (GDP) per capita of Hong Kong (USD40,594) as threshold of willingness-to-pay (WTP) per QALY, one-way sensitivity analysis found ICER of IM/MNP to exceed WTP when duration of illness in outpatient setting was 1.39-time of IM vaccine cost. In 10,000 Monte Carlo simulations, IM/MNP program was the preferred option in 57.28% and 91.68% of the time, using 1x and 3x GDP per capita as WTP threshold, respectively. Acceptance of IM/MNP program as the preferred program was subject to the WTP threshold, duration of illness in outpatient settings, and cost of MNP vaccine.

  10. Potential Cost-Effectiveness of an Influenza Vaccination Program Offering Microneedle Patch for Vaccine Delivery in Children.

    Directory of Open Access Journals (Sweden)

    Carlos Wong

    Full Text Available The influenza vaccine coverage rate of children is low in Hong Kong. Microneedle patches (MNPs is a technology under development for painless delivery of vaccines. This study aimed to examine the potential clinical outcomes and direct medical costs of an influenza program offering MNP vaccine to children who have declined intramuscular (IM vaccine in Hong Kong.A decision model was designed to compare potential outcomes between IM vaccine program and a program offering MNP vaccine to those declined IM vaccine (IM/MNP program in a hypothetical cohort of children over one-year time horizon. The model outcomes included direct medical cost, influenza infection rate, mortality rate, and quality-adjusted life-years (QALYs loss. Model inputs were retrieved from published literature. Sensitivity analyses were performed to examine the robustness of model results.In base-case analysis, IM/MNP program was more costly per child (USD19.13 versus USD13.69; USD1 = HKD7.8 with lower influenza infection rate (98.9 versus 124.8 per 1,000 children, hospitalization rate (0.83 versus 1.05 per 1,000 children and influenza-related mortality rate (0.00042 versus 0.00052 per 1,000 children when compared to IM program. The incremental cost per QALY saved (ICER of IM/MNP program versus IM program was 27,200 USD/QALY. Using gross domestic product (GDP per capita of Hong Kong (USD40,594 as threshold of willingness-to-pay (WTP per QALY, one-way sensitivity analysis found ICER of IM/MNP to exceed WTP when duration of illness in outpatient setting was 1.39-time of IM vaccine cost. In 10,000 Monte Carlo simulations, IM/MNP program was the preferred option in 57.28% and 91.68% of the time, using 1x and 3x GDP per capita as WTP threshold, respectively.Acceptance of IM/MNP program as the preferred program was subject to the WTP threshold, duration of illness in outpatient settings, and cost of MNP vaccine.

  11. Toward predicate approaches to modality

    CERN Document Server

    Stern, Johannes

    2016-01-01

    In this volume, the author investigates and argues for, a particular answer to the question: What is the right way to logically analyze modalities from natural language within formal languages? The answer is: by formalizing modal expressions in terms of predicates. But, as in the case of truth, the most intuitive modal principles lead to paradox once the modal notions are conceived as predicates. The book discusses the philosophical interpretation of these modal paradoxes and argues that any satisfactory approach to modality will have to face the paradoxes independently of the grammatical category of the modal notion. By systematizing modal principles with respect to their joint consistency and inconsistency, Stern provides an overview of the options and limitations of the predicate approach to modality that may serve as a useful starting point for future work on predicate approaches to modality. Stern also develops a general strategy for constructing philosophically attractive theories of modal notions conce...

  12. Dietary Changes by Expanded Food and Nutrition Education Program (EFNEP) Graduates Are Independent of Program Delivery Method.

    Science.gov (United States)

    Luccia, Barbara H. D.; Kunkel, Mary E.; Cason, Katherine L.

    2003-01-01

    Expanded Food and Nutrition Education Program graduates (n=1,141) who received either individual (21.3%), group (76.2%), or combined (2.5%) instruction were assessed. Independent of method, participants significantly improved the number of servings consumed from grains, vegetables, dairy, and meat and meat alternatives; total calories consumed;…

  13. A Process Evaluation of the Friendships and Dating Program for Adults with Developmental Disabilities: Measuring the Fidelity of Program Delivery

    Science.gov (United States)

    Ward, Karen M.; Windsor, Richard; Atkinson, Julie P.

    2012-01-01

    Adults with intellectual and developmental disabilities are frequently abused in dating and partnered relationships. The Friendships and Dating Program (FDP) was developed to prevent violence in dating and partnered relationships and to teach social skills needed to develop healthy, meaningful relationships among this population. A pilot study…

  14. The effect of pelvic floor muscle exercises program on sexual self-efficacy in primiparous women after delivery.

    Science.gov (United States)

    Golmakani, Nahid; Zare, Zahra; Khadem, Nayereh; Shareh, Hossein; Shakeri, Mohammad Taghi

    2015-01-01

    Selection and acceptance of appropriate sexual behavior and sexual function are made difficult by low sexual self-efficacy in the postpartum period. The general purpose of this research is to define the effects of an 8-week pelvic floor muscle exercise program on sexual self-efficacy in primiparous women after childbirth. This clinical trial was performed on 79 primiparous women who referred to health care centers, Mashhad, Iran in 2013, 8 weeks after delivery, to receive health care services. They were selected by easy sampling. The samples were randomly assigned to either intervention or control group. The intervention group was trained in Kegel exercises for 8 weeks. Both groups were evaluated at 4 and 8 weeks. Data collection tools included: Demographic information, sexual self-efficacy, and Brink scale. Data were analyzed using repeated measures, Friedman test, t-test, and Mann-Whitney test. The results showed significant increase in pelvic floor muscle strength in the intervention group at 4 and 8 weeks after exercises (P exercises (P = 0.001). The findings showed that 8-week pelvic muscle exercises increase the sexual self-efficacy in women after delivery.

  15. A Dynamic Programming Based Improvement Heuristic for a Repetitive Routing Problem of Grasp-and-Delivery Robots

    Science.gov (United States)

    Shurbevski, Aleksandar; Karuno, Yoshiyuki; Nagamochi, Hiroshi

    We consider a repetitive routing problem of a single grasp-and-delivery robot used on a printed circuit board (PCB) assembly line. The robot arranges n identical pins from their current configuration to the next required one by transferring at most one pin at a time. The pins support a PCB from underneath to prevent it from overbending, while an automated manipulator embeds electronic parts in the PCB from above. Given an initial configuration of pins and a sequence of m required configurations, the problem asks to find a transfer route of the robot that minimizes the route length over all m transitions. A polynomial time approximation algorithm with factor two has been proposed by the authors to the problem. In this paper, we design a dynamic programming (DP) procedure to improve its empirical performance, and also conduct numerical experiments to show how well the proposed DP procedure performs.

  16. Competency Based Curriculum. Revised Delivery Systems for Culinary Arts Program. Project Report.

    Science.gov (United States)

    Spokane Community Coll., WA.

    Developed through a grant that enabled faculty members to work together to define goals and set objectives, this curriculum guide contains course objectives for the culinary arts program at Spokane Community College in Washington. Objectives are provided for the following courses: culinary techniques and skill development (two levels),…

  17. 77 FR 27273 - Surface Transportation Project Delivery Pilot Program; Caltrans Audit Report

    Science.gov (United States)

    2012-05-09

    ...) and Environmental Justice information. Caltrans has also developed new CIA guidance. 2. Improved level... in the Pilot Program. Continued errors in the quarterly reports. As has been the case in every audit, the quarterly reports prepared by Caltrans listing environmental approvals and decisions made under...

  18. 77 FR 10599 - Surface Transportation Project Delivery Pilot Program; Caltrans Audit Report

    Science.gov (United States)

    2012-02-22

    ... working team that holds monthly calls to share Community Impact Assessment (CIA) and Environmental Justice... from participation in the Pilot Program. Continued errors in the quarterly reports. As has been the case in every audit, the quarterly reports prepared by Caltrans listing environmental approvals and...

  19. GIS Application to Define Biomass Collection Points as Sources for Linear Programming of Delivery Networks

    NARCIS (Netherlands)

    Velazquez-Marti, B.; Annevelink, E.

    2009-01-01

    Much bio-energy can be obtained from wood pruning operations in forests and fruit orchards. Several spatial studies have been carried out for biomass surveys, and many linear programming models have been developed to model the logistics of bio-energy chains. These models can assist in determining

  20. Course Design and Delivery Specifications as a Tool for Ensuring Quality in an Online Training Program

    Science.gov (United States)

    Docq, Françoise

    2015-01-01

    This case discusses the design, implementation, and regulation of a hybrid training program (60 credits over two years) organised by three business schools in Europe, and stretching over a five-year period. Following an incremental design process, the design team faced multiple challenges, from finding the added value of hybridization to choosing…

  1. Enhancing the Delivery of Supplemental Nutrition Assistance Program Education through Geographic Information Systems

    Science.gov (United States)

    Stone, Matthew

    2011-01-01

    The Network for a Healthy California (Network) employs a Geographic Information System (GIS) to identify the target audience and plan program activities because GIS is a powerful tool for assisting in data integration and planning. This paper describes common uses of GIS by Network contractors as well as demonstrating the possibilities of GIS as a…

  2. Special Deliveries: Certified Nurse-Midwifery Programs Lacking in New England

    Science.gov (United States)

    Franzosa, Alyssa

    2012-01-01

    With Boston serving as a hub of both educational and medical excellence, it's no wonder that New England has a high reputation to uphold in both of these areas. However, Boston and the rest of the region lack a specific degree program that is putting New England below the radars of potential midwives. Certified nurse-midwifery is a popular field…

  3. A New Therapeutic Modality for Acute Myocardial Infarction: Nanoparticle-Mediated Delivery of Pitavastatin Induces Cardioprotection from Ischemia-Reperfusion Injury via Activation of PI3K/Akt Pathway and Anti-Inflammation in a Rat Model.

    Science.gov (United States)

    Nagaoka, Kazuhiro; Matoba, Tetsuya; Mao, Yajing; Nakano, Yasuhiro; Ikeda, Gentaro; Egusa, Shizuka; Tokutome, Masaki; Nagahama, Ryoji; Nakano, Kaku; Sunagawa, Kenji; Egashira, Kensuke

    2015-01-01

    There is an unmet need to develop an innovative cardioprotective modality for acute myocardial infarction (AMI), for which the effectiveness of interventional reperfusion therapy is hampered by myocardial ischemia-reperfusion (IR) injury. Pretreatment with statins before ischemia is shown to reduce MI size in animals. However, no benefit was found in animals and patients with AMI when administered at the time of reperfusion, suggesting insufficient drug targeting into the IR myocardium. Here we tested the hypothesis that nanoparticle-mediated targeting of pitavastatin protects the heart from IR injury. In a rat IR model, poly(lactic acid/glycolic acid) (PLGA) nanoparticle incorporating FITC accumulated in the IR myocardium through enhanced vascular permeability, and in CD11b-positive leukocytes in the IR myocardium and peripheral blood after intravenous treatment. Intravenous treatment with PLGA nanoparticle containing pitavastatin (Pitavastatin-NP, 1 mg/kg) at reperfusion reduced MI size after 24 hours and ameliorated left ventricular dysfunction 4-week after reperfusion; by contrast, pitavastatin alone (as high as 10 mg/kg) showed no therapeutic effects. The therapeutic effects of Pitavastatin-NP were blunted by a PI3K inhibitor wortmannin, but not by a mitochondrial permeability transition pore inhibitor cyclosporine A. Pitavastatin-NP induced phosphorylation of Akt and GSK3β, and inhibited inflammation and cardiomyocyte apoptosis in the IR myocardium. Nanoparticle-mediated targeting of pitavastatin induced cardioprotection from IR injury by activation of PI3K/Akt pathway and inhibition of inflammation and cardiomyocyte death in this model. This strategy can be developed as an innovative cardioprotective modality that may advance currently unsatisfactory reperfusion therapy for AMI.

  4. A New Therapeutic Modality for Acute Myocardial Infarction: Nanoparticle-Mediated Delivery of Pitavastatin Induces Cardioprotection from Ischemia-Reperfusion Injury via Activation of PI3K/Akt Pathway and Anti-Inflammation in a Rat Model.

    Directory of Open Access Journals (Sweden)

    Kazuhiro Nagaoka

    Full Text Available There is an unmet need to develop an innovative cardioprotective modality for acute myocardial infarction (AMI, for which the effectiveness of interventional reperfusion therapy is hampered by myocardial ischemia-reperfusion (IR injury. Pretreatment with statins before ischemia is shown to reduce MI size in animals. However, no benefit was found in animals and patients with AMI when administered at the time of reperfusion, suggesting insufficient drug targeting into the IR myocardium. Here we tested the hypothesis that nanoparticle-mediated targeting of pitavastatin protects the heart from IR injury.In a rat IR model, poly(lactic acid/glycolic acid (PLGA nanoparticle incorporating FITC accumulated in the IR myocardium through enhanced vascular permeability, and in CD11b-positive leukocytes in the IR myocardium and peripheral blood after intravenous treatment. Intravenous treatment with PLGA nanoparticle containing pitavastatin (Pitavastatin-NP, 1 mg/kg at reperfusion reduced MI size after 24 hours and ameliorated left ventricular dysfunction 4-week after reperfusion; by contrast, pitavastatin alone (as high as 10 mg/kg showed no therapeutic effects. The therapeutic effects of Pitavastatin-NP were blunted by a PI3K inhibitor wortmannin, but not by a mitochondrial permeability transition pore inhibitor cyclosporine A. Pitavastatin-NP induced phosphorylation of Akt and GSK3β, and inhibited inflammation and cardiomyocyte apoptosis in the IR myocardium.Nanoparticle-mediated targeting of pitavastatin induced cardioprotection from IR injury by activation of PI3K/Akt pathway and inhibition of inflammation and cardiomyocyte death in this model. This strategy can be developed as an innovative cardioprotective modality that may advance currently unsatisfactory reperfusion therapy for AMI.

  5. Service quality assessment of workers compensation health care delivery programs in New York using SERVQUAL.

    Science.gov (United States)

    Arunasalam, Mark; Paulson, Albert; Wallace, William

    2003-01-01

    Preferred provider organizations (PPOs) provide healthcare services to an expanding proportion of the U.S. population. This paper presents a programmatic assessment of service quality in the workers' compensation environment using two different models: the PPO program model and the fee-for-service (FFS) payor model. The methodology used here will augment currently available research in workers' compensation, which has been lacking in measuring service quality determinants and assessing programmatic success/failure of managed care type programs. Results indicated that the SERVQUAL tool provided a reliable and valid clinical quality assessment tool that ascertained that PPO marketers should focus on promoting physician outreach (to show empathy) and accessibility (to show reliability) for injured workers.

  6. The Subjunctive and Modality.

    Science.gov (United States)

    Wasa, Atsuko

    1999-01-01

    Analysis of the indicative-subjunctive alternation in the compliment of interrogative utterances with the verb "creer" shows that the "modality of reserved epistemic" determines choice of subjunctive. This determination contributes to a hypothesis about the nature of the subjunctive in Spanish. (CP)

  7. A comparison of online versus workbook delivery of a self-help positive parenting program.

    Science.gov (United States)

    Sanders, Matthew R; Dittman, Cassandra K; Farruggia, Susan P; Keown, Louise J

    2014-06-01

    A noninferiority randomized trial design compared the efficacy of two self-help variants of the Triple P-Positive Parenting Program: an online version and a self-help workbook. We randomly assigned families of 193 children displaying early onset disruptive behavior difficulties to the online (N = 97) or workbook (N = 96) interventions. Parents completed questionnaire measures of child behavior, parenting, child maltreatment risk, personal adjustment and relationship quality at pre- and post-intervention and again at 6-month follow up. The short-term intervention effects of the Triple P Online program were not inferior to the workbook on the primary outcomes of disruptive child behavior and dysfunctional parenting as reported by both mothers and fathers. Both interventions were associated with significant and clinically meaningful declines from pre- to post-intervention in levels of disruptive child behavior, dysfunctional parenting styles, risk of child maltreatment, and inter-parental conflict on both mother and father report measures. Intervention effects were largely maintained at 6-month follow up, thus supporting the use of self-help parenting programs within a comprehensive population-based system of parenting support to reduce child maltreatment and behavioral problems in children.

  8. Gender differences in driving under the influence (DUI) program client characteristics: implications for treatment delivery.

    Science.gov (United States)

    Reilly, Kelly; Woodruff, Susan I; Hohman, Melinda; Barker, Melanie

    2018-02-05

    The purpose of this descriptive study was to examine gender differences in the characteristics of clients in a large Driving Under the Influence program in Southern California. We analyzed secondary de-identified data from a large Driving Under the Influence program for the years 2009-2014 (n = 19,619). Sociodemographic characteristics, measures of physical and mental comorbidity, and alcohol use severity measures were compared for male and female clients. Women averaged 32.85 years of age (SD = 10.70), while men were slightly older at 34.2 years (SD = 11.19). Females comprised an increasingly greater percentage of the client population over the time period studied (27.6% to 30.7%). In a multivariable model, compared to male clients, females were more likely to be White non-Hispanic, not currently married, and younger. Women were more likely than men to report anxiety, depression, and a history of domestic violence. Blood alcohol content at arrest and measures of hazardous drinking did not differ significantly by gender. Results suggested that gender-specific DUI programs may be useful.

  9. Hyperbranched Self-Immolative Polymers (hSIPs) for Programmed Payload Delivery and Ultrasensitive Detection.

    Science.gov (United States)

    Liu, Guhuan; Zhang, Guofeng; Hu, Jinming; Wang, Xiaorui; Zhu, Mingqiang; Liu, Shiyong

    2015-09-16

    Upon stimuli-triggered single cleavage of capping moieties at the focal point and chain terminal, self-immolative dendrimers (SIDs) and linear self-immolative polymers (l-SIPs) undergo spontaneous domino-like radial fragmentation and cascade head-to-tail depolymerization, respectively. The nature of response selectivity and signal amplification has rendered them a unique type of stimuli-responsive materials. Moreover, novel design principles are required for further advancement in the field of self-immolative polymers (SIPs). Herein, we report the facile fabrication of water-dispersible SIPs with a new chain topology, hyperbranched self-immolative polymers (hSIPs), by utilizing one-pot AB2 polycondensation methodology and sequential postfunctionalization. The modular engineering of three categories of branching scaffolds, three types of stimuli-cleavable capping moieties at the focal point, and seven different types of peripheral functional groups and polymeric building blocks affords both structurally and functionally diverse hSIPs with chemically tunable amplified-release features. On the basis of the hSIP platform, we explored myriad functions including visible light-triggered intracellular release of peripheral conjugated drugs in a targeted and spatiotemporally controlled fashion, intracellular delivery and cytoplasmic reductive milieu-triggered plasmid DNA release via on/off multivalency switching, mitochondria-targeted fluorescent sensing of H2O2 with a detection limit down to ∼20 nM, and colorimetric H2O2 assay via triggered dispersion of gold nanoparticle aggregates. To further demonstrate the potency and generality of the hSIP platform, we further configure it into biosensor design for the ultrasensitive detection of pathologically relevant antigens (e.g., human carcinoembryonic antigen) by integrating with enzyme-mediated cycle amplification with positive feedback and enzyme-linked immunosorbent assay (ELISA).

  10. MODAL MANUSIA DAN PRODUKTIVITAS

    Directory of Open Access Journals (Sweden)

    Erlinda Puspita Sari

    2014-03-01

    Full Text Available Modal manusia dianggap sebagai salah satu faktor penentu produktivitas. Modal manusia merupakan dimensi kualitatif dari sumberdaya manusia, seperti keahlian dan keterampilan, yang akan memengaruhi kemampuan produktif manusia tersebut. Dimensi kualitatif tersebut diperoleh melalui pendidikan, pelatihan dan kesehatan. Penelitian ini bertujuan untuk menganaliss efek dari modal manusia terhadap tingkat produktivitas di provinsi-provinsi di Indonesia. Dalam penelitian ini, tingkat pendidikan diukur dengan beberapa indikator, yaitu; angka melek huruf dan angka partisipasi murni tingkat SD, SMP maupun SMA. Tingkat kesehatan diukur dengan angka kematian bayi. Data yang digunakan adalah data panel dari 25 provinsi di Indonesia selama perioede 1996-2010 yang dianalisis dengan menggunakan Model Panel Data Fixed Effect. Hasil analisis menunjukkan bahwa modal manusia yang diukur dari tingkat pendidikan (APM dan tingkat kesehatan (AKB merupakan faktor yang berpengaruh dan signifikan untuk menjelaskan variasi produktivitas meskipun magnitude-nya lebih kecil dibandingkan dengan modal fisik. Hasil analisis juga menunjukkan bahwa variabel pendidikan memiliki magnitude yang lebih besar dibandingkan dengan variabel kesehatan. Human capital is regarded as one of the determining factors of productivity. Human capital is qualitative dimension of human resource which includes skills and knowledge. These qualitative dimensions are internalized through education, training and health. This study aimed to analyze the effect of human capital on productivity level across provinces in Indonesia. In this study, the level of education was measured by literacy and school enrollment rate (in primary, secondary and high school. The level of health was measured by infant mortality rate. The study employed a panel data of 25 provinces in Indonesia during the period of 1996-2010. Using fixed effect method, the result showed that secondary school enrollment rate and infant mortality

  11. Struktur modal: Faktor penentu dan pengaruhnya pada nilai perusahaan

    Directory of Open Access Journals (Sweden)

    Sutrisno Sutrisno

    2016-04-01

    Full Text Available Penelitian ini mempunyai dua tujuan utama yakni, pertama untuk mengetahui dan menganalisis faktor-faktor yang menentukan struktur modal, kedua untuk mengetahui dan menganalisis pengaruh faktor-faktor penentu struktur modal terhadap nilai perusahaan dengan struktur modal sebagai variabel pemoderasi. Faktor-faktor yang diduga sebagai penentu struktur modal terdiri dari pertumbuhan perusahaan, profitabilitas, struktur aktiva, leverage, dan ukuran perusahaan. Populasi dalam penelitian ini adalah perusahaan manufaktur yang terdaftar di Bursa Efek Indonesia. Dengan metode purposive sampling, diperoleh data 125 perusahaan dengan periode pengamatan 4 tahun (2008-2011. Alat analisis yang digunakan adalah regresi berganda dengan didukung program e-views. Hasil penelitian menunjukkan bahwa faktor-faktor yang secara signifikan menetukan struktur modal adalah struktur aktiva tetap, leverage, profitabilitas, dan size, sedangkan pertumbuhan perusahaan tidak mempengaruhi struktur modal. Sementara dengan struktur modal sebagi variabel pemoderasi, faktor struktur aktiva, leverage dan profitabilitas secara signifikan mempengaruhi nilai perusahaan, sedangkan faktor pertumbuhan perusahaan dan ukuran perusahaan tidak berpengaruh pada nilai perusahaan.

  12. Adherence to a Prophylactic Swallowing Therapy Program During (Chemo) Radiotherapy: Impact of Service-Delivery Model and Patient Factors.

    Science.gov (United States)

    Wall, Laurelie R; Ward, Elizabeth C; Cartmill, Bena; Hill, Anne J; Porceddu, Sandro V

    2017-04-01

    Intensive, prophylactic swallowing therapy programs have been developed to improve dysphagia outcomes for patients with head/neck cancer (HNC) receiving (chemo)radiotherapy ([C]RT). Across studies, variable therapy adherence rates have been reported. Preliminary research suggests that service-delivery mode and demographic factors may influence adherence. This study examined patient adherence to a prophylactic swallowing therapy protocol across three service-delivery models: (1) clinician-directed face-to-face therapy, (2) technology-assisted therapy using the telepractice application, SwallowIT and (3) independent patient-directed therapy. The secondary aim explored the impact of patient factors on adherence. Patients with oropharyngeal HNC receiving definitive (C)RT were randomised to receive the Pharyngocise exercise protocol via clinician-directed (n = 26), patient-directed (n = 27) or SwallowIT-assisted (n = 26) models. Adherence was calculated as the percentage of prescribed exercise completed. Multiple patient factors were recorded at baseline. Adherence across the 6 weeks in all groups was low (27%), and declined from week 4 of (C)RT. The clinician-directed model yielded significantly (p = 0.014) better adherence than patient-directed therapy in weeks 1-3. There was also a trend for higher adherence in the SwallowIT group compared to patient-directed in weeks 1-3 (p = 0.064). Multivariable linear modelling identified active smoking at baseline (p Telepractice may provide an alternate model to support adherence where service constraints limit intensive clinician-directed therapy.

  13. Osteo-cise: Strong Bones for Life: Protocol for a community-based randomised controlled trial of a multi-modal exercise and osteoporosis education program for older adults at risk of falls and fractures

    Directory of Open Access Journals (Sweden)

    Gianoudis Jenny

    2012-05-01

    Full Text Available Abstract Background Osteoporosis affects over 220 million people worldwide, and currently there is no ‘cure’ for the disease. Thus, there is a need to develop evidence-based, safe and acceptable prevention strategies at the population level that target multiple risk factors for fragility fractures to reduce the health and economic burden of the condition. Methods/design The Osteo-cise: Strong Bones for Life study will investigate the effectiveness and feasibility of a multi-component targeted exercise, osteoporosis education/awareness and behavioural change program for improving bone health and muscle function and reducing falls risk in community-dwelling older adults at an increased risk of fracture. Men and women aged ≥60 years will participate in an 18-month randomised controlled trial comprising a 12-month structured and supervised community-based program and a 6-month ‘research to practise’ translational phase. Participants will be randomly assigned to either the Osteo-cise intervention or a self-management control group. The intervention will comprise a multi-modal exercise program incorporating high velocity progressive resistance training, moderate impact weight-bearing exercise and high challenging balance exercises performed three times weekly at local community-based fitness centres. A behavioural change program will be used to enhance exercise adoption and adherence to the program. Community-based osteoporosis education seminars will be conducted to improve participant knowledge and understanding of the risk factors and preventative measures for osteoporosis, falls and fractures. The primary outcomes measures, to be collected at baseline, 6, 12, and 18 months, will include DXA-derived hip and spine bone mineral density measurements and functional muscle power (timed stair-climb test. Secondary outcomes measures include: MRI-assessed distal femur and proximal tibia trabecular bone micro-architecture, lower limb and back

  14. Osteo-cise: strong bones for life: protocol for a community-based randomised controlled trial of a multi-modal exercise and osteoporosis education program for older adults at risk of falls and fractures.

    Science.gov (United States)

    Gianoudis, Jenny; Bailey, Christine A; Sanders, Kerrie M; Nowson, Caryl A; Hill, Keith; Ebeling, Peter R; Daly, Robin M

    2012-05-28

    Osteoporosis affects over 220 million people worldwide, and currently there is no 'cure' for the disease. Thus, there is a need to develop evidence-based, safe and acceptable prevention strategies at the population level that target multiple risk factors for fragility fractures to reduce the health and economic burden of the condition. The Osteo-cise: Strong Bones for Life study will investigate the effectiveness and feasibility of a multi-component targeted exercise, osteoporosis education/awareness and behavioural change program for improving bone health and muscle function and reducing falls risk in community-dwelling older adults at an increased risk of fracture. Men and women aged ≥60 years will participate in an 18-month randomised controlled trial comprising a 12-month structured and supervised community-based program and a 6-month 'research to practise' translational phase. Participants will be randomly assigned to either the Osteo-cise intervention or a self-management control group. The intervention will comprise a multi-modal exercise program incorporating high velocity progressive resistance training, moderate impact weight-bearing exercise and high challenging balance exercises performed three times weekly at local community-based fitness centres. A behavioural change program will be used to enhance exercise adoption and adherence to the program. Community-based osteoporosis education seminars will be conducted to improve participant knowledge and understanding of the risk factors and preventative measures for osteoporosis, falls and fractures. The primary outcomes measures, to be collected at baseline, 6, 12, and 18 months, will include DXA-derived hip and spine bone mineral density measurements and functional muscle power (timed stair-climb test). Secondary outcomes measures include: MRI-assessed distal femur and proximal tibia trabecular bone micro-architecture, lower limb and back maximal muscle strength, balance and function (four square step

  15. Evaluation of a supervised multi-modal physical exercise program for prostate cancer survivors in the rehabilitation phase: Rationale and study protocol of the ProCaLife study.

    Science.gov (United States)

    Schega, Lutz; Törpel, Alexander; Hein, Nico; Napiontek, André; Wenzel, Constanze; Becker, Tim

    2015-11-01

    After treatment for localized prostate cancer, many survivors experience severe physical and psychological/psychosocial impairments, such as urinary incontinence, erectile dysfunction, fatigue, depressive symptoms and decreased physical functioning. Physical activity and exercise can positively influence such side effects and improve quality of life. However, the majority of prostate cancer survivors are not physically active. Thus, supportive interventions, such as supervised exercise programs, are necessary. But particularly in the post-treatment phase, infrastructure and resources are limited and specific exercise recommendations for prostate cancer survivors do not yet exist. The ProCaLife study is a quasi-randomized controlled intervention trial evaluating a specific 26-week physical exercise program for prostate cancer survivors in the rehabilitation phase following medical treatment. Participants are assigned to one of two intervention groups (supervised multi-modal physical exercise including or not including further behavior-oriented techniques) or a control group (not receiving any supervised intervention). Exercise sessions are performed twice weekly and contain specific aerobic, strengthening, flexibility, balance, relaxation and pelvic floor/sphincter exercises as well as mixed games. Behavior-oriented techniques include physical activity-related knowledge transfer and barriers management. The primary endpoint quality of life and secondary psychological/psychosocial, urological, physical fitness and physical activity outcomes are assessed at pre-intervention, post-intervention and follow-up time points. By evaluating a specific supervised multi-modal physical exercise program, the ProCaLife study contributes to identify effective forms of physical exercise for prostate cancer survivors in the rehabilitation phase. This is of great importance for establishing specific exercise recommendations which are missing so far.

  16. Is treatment in a day hospital step-down program superior to outpatient individual psychotherapy for patients with personality disorders? 36 months follow-up of a randomized clinical trial comparing different treatment modalities.

    Science.gov (United States)

    Gullestad, Frida Slagstad; Wilberg, Theresa; Klungsøyr, Ole; Johansen, Merete Selsbakk; Urnes, Oyvind; Karterud, Sigmund

    2012-01-01

    Despite increasing interest in the development of effective treatments for patients with PDs, there is still no consensus about the optimal treatment setting for this group of patients. This study reports the 36 months follow-up of the Ullevål Personality Project (UPP) (n=113), a randomized clinical trial comparing two treatment modalities for patients with PDs: an intensive long-term step-down treatment program, consisting of short-term day hospital treatment followed by combined group and individual psychotherapy organized in a hospital setting, with "ordinary" outpatient individual psychotherapy in private practice for patients with moderate to severe PDs. Patients in both treatment groups showed improvements in several clinical measures after 36 months. However, contrary to our expectations, patients in the outpatient treatment setting improved significantly more. Possible explanations for this surprising finding are discussed. The study cannot exclude the possibility that treatment aspects other than differences in modalities could explain some of the differential effectiveness (e.g. differences between therapists).

  17. Multishaker modal testing

    Science.gov (United States)

    Craig, Roy R., Jr.

    1987-01-01

    The major accomplishments of this research are: (1) the refinement and documentation of a multi-input, multi-output modal parameter estimation algorithm which is applicable to general linear, time-invariant dynamic systems; (2) the development and testing of an unsymmetric block-Lanzcos algorithm for reduced-order modeling of linear systems with arbitrary damping; and (3) the development of a control-structure-interaction (CSI) test facility.

  18. Digital multishaker modal testing

    Science.gov (United States)

    Blair, M.; Craig, R. R., Jr.

    1983-01-01

    A review of several modal testing techniques is made, along with brief discussions of their advantages and limitations. A new technique is presented which overcomes many of the previous limitations. Several simulated experiments are included to verify the validity and accuracy of the new method. Conclusions are drawn from the simulation studies and recommendations for further work are presented. The complete computer code configured for the simulation study is presented.

  19. Constructions, pragmatics and modality

    Directory of Open Access Journals (Sweden)

    Antonio Fortin

    2013-05-01

    Full Text Available This paper rejects the commonplace view that the semantics of certain modal deverbal adjectives (MDAs, which have traditionally been assumed to be non-compositional, require complex lexical or syntactic encoding (cf. e.g. Riehemann 1994 and 1998, Booij 2007 and 2010a. Instead, it shows that productive MDA formation is semantically compositional, and that the prima facie idiosyncratic meanings are, in fact, conversational implicatures.

  20. Nanoparticle-Mediated Delivery of Mitochondrial Division Inhibitor 1 to the Myocardium Protects the Heart From Ischemia-Reperfusion Injury Through Inhibition of Mitochondria Outer Membrane Permeabilization: A New Therapeutic Modality for Acute Myocardial Infarction.

    Science.gov (United States)

    Ishikita, Ayako; Matoba, Tetsuya; Ikeda, Gentaro; Koga, Jun-Ichiro; Mao, Yajing; Nakano, Kaku; Takeuchi, Osamu; Sadoshima, Junichi; Egashira, Kensuke

    2016-07-22

    Mitochondria-mediated cell death plays a critical role in myocardial ischemia-reperfusion (IR) injury. We hypothesized that nanoparticle-mediated drug delivery of mitochondrial division inhibitor 1 (Mdivi1) protects hearts from IR injury through inhibition of mitochondria outer membrane permeabilization (MOMP), which causes mitochondrial-mediated cell death. We formulated poly (lactic-co-glycolic acid) nanoparticles containing Mdivi1 (Mdivi1-NP). We recently demonstrated that these nanoparticles could be successfully delivered to the cytosol and mitochondria of cardiomyocytes under H2O2-induced oxidative stress that mimicked IR injury. Pretreatment with Mdivi1-NP ameliorated H2O2-induced cell death in rat neonatal cardiomyocytes more potently than Mdivi1 alone, as indicated by a lower estimated half-maximal effective concentration and greater maximal effect on cell survival. Mdivi1-NP treatment of Langendorff-perfused mouse hearts through the coronary arteries at the time of reperfusion reduced infarct size after IR injury more effectively than Mdivi1 alone. Mdivi1-NP treatment also inhibited Drp1-mediated Bax translocation to the mitochondria and subsequent cytochrome c leakage into the cytosol, namely, MOMP, in mouse IR hearts. MOMP inhibition was also observed in cyclophilin D knockout (CypD-KO) mice, which lack the mitochondrial permeability transition pore (MPTP) opening. Intravenous Mdivi1-NP treatment in vivo at the time of reperfusion reduced IR injury in wild-type and CypD-KO mice, but not Bax-KO mice. Mdivi1-NP treatment reduced IR injury through inhibition of MOMP, even in the absence of a CypD/MPTP opening. Thus, nanoparticle-mediated drug delivery of Mdivi1 may be a novel treatment strategy for IR injury. © 2016 The Authors. Published on behalf of the American Heart Association, Inc., by Wiley Blackwell.

  1. Diplomatic advantages and threats in global health program selection, design, delivery and implementation: development and application of the Kevany Riposte.

    Science.gov (United States)

    Kevany, Sebastian

    2015-05-27

    Global health programs, as supported by organizations such as the Global Fund to Fight AIDS, Tuberculosis and Malaria and the President's Emergency Plan for AIDS Relief (PEPFAR), stand to make significant contributions to international medical outcomes. Traditional systems of monitoring and evaluation, however, fail to capture downstream, indirect, or collateral advantages (and threats) of intervention selection, design, and implementation from broader donor perspectives, including those of the diplomatic and foreign policy communities, which these programs also generate. This paper describes the development a new métier under which assessment systems designed to consider the diplomatic value of global health initiatives are described and applied based on previously-identified "Top Ten" criteria. The "Kevany Riposte" and the "K-Score" were conceptualized based on a retrospective and collective assessment of the author's participation in the design, implementation and delivery of a range of global health interventions related to the HIV/AIDS epidemic. Responses and associated scores reframe intervention worth or value in terms of global health diplomacy criteria such as "adaptability", "interdependence", "training," and "neutrality". Response options ranged from "highly advantageous" to "significant potential threat". Global health initiatives under review were found to generate significant advantages from the diplomatic perspective. These included (1) intervention visibility and associations with donor altruism and prestige, (2) development of international non-health collaborations and partnerships, (3) adaptability and responsiveness of service delivery to local needs, and (4) advancement of broader strategic goals of the international community. Corresponding threats included (1) an absence of formal training of project staff on broader political and international relations roles and responsibilities, (2) challenges to recipient cultural and religious practices

  2. Erythrocyte membrane-coated NIR-triggered biomimetic nanovectors with programmed delivery for photodynamic therapy of cancer

    Science.gov (United States)

    Ding, Hui; Lv, Yanlin; Ni, Dezhi; Wang, Jie; Tian, Zhiyuan; Wei, Wei; Ma, Guanghui

    2015-05-01

    A new type of photodynamic therapy (PDT) agents using upconversion nanoparticles (UCNPs) with incorporated photosensitizers as the inner core and an erythrocyte membrane (RM) decorated with dual targeting moieties as the cloak is developed. Owing to the endogenous nature of RM, the RM-coating endows the PDT agents with perfect biocompatibility and stealth ability to escape from the entrapment by the reticulo-endothelial system (RES). More importantly, owing to the unique nature of erythrocyte as an oxygen carrier in the blood, the RM outer layer of the agents unequivocally facilitates the permeation of ground-state molecular oxygen (3O2) and the singlet oxygen (1O2) as compared to the previously developed PDT agents with other types of coating. Another salient feature of the as-prepared PDT platform is the decoration of RM with dual targeting moieties for selective recognition of cancer cells and mitochondrial targeting, respectively. The synergistic effect of RM coating and dual-targeting of such feature-packed agents are investigated in tumor-bearing mice and the improved PDT therapeutic efficacy is confirmed, which is the first paradigm where RM-coated NIR-triggered nanovectors with programmed delivery ability is applied in PDT of tumor in vivo.A new type of photodynamic therapy (PDT) agents using upconversion nanoparticles (UCNPs) with incorporated photosensitizers as the inner core and an erythrocyte membrane (RM) decorated with dual targeting moieties as the cloak is developed. Owing to the endogenous nature of RM, the RM-coating endows the PDT agents with perfect biocompatibility and stealth ability to escape from the entrapment by the reticulo-endothelial system (RES). More importantly, owing to the unique nature of erythrocyte as an oxygen carrier in the blood, the RM outer layer of the agents unequivocally facilitates the permeation of ground-state molecular oxygen (3O2) and the singlet oxygen (1O2) as compared to the previously developed PDT agents with

  3. Management Education Benchmarking Designing Customized and Flexible MBA Programs

    Science.gov (United States)

    Hall, Owen P., Jr.; Young, Terry W.

    2007-01-01

    To meet the challenges of the 21st century B-schools are revising curriculum, delivery and outcome assessment modalities. Today, the proportion of electives and other specialty offerings in many MBA programs now constitutes more than 50% of the total curriculum. However, this focus on customization, integration and flexibility is not without its…

  4. Smartphones for smarter delivery of mental health programs: a systematic review.

    Science.gov (United States)

    Donker, Tara; Petrie, Katherine; Proudfoot, Judy; Clarke, Janine; Birch, Mary-Rose; Christensen, Helen

    2013-11-15

    The rapid growth in the use of mobile phone applications (apps) provides the opportunity to increase access to evidence-based mental health care. Our goal was to systematically review the research evidence supporting the efficacy of mental health apps for mobile devices (such as smartphones and tablets) for all ages. A comprehensive literature search (2008-2013) in MEDLINE, Embase, the Cochrane Central Register of Controlled Trials, PsycINFO, PsycTESTS, Compendex, and Inspec was conducted. We included trials that examined the effects of mental health apps (for depression, anxiety, substance use, sleep disturbances, suicidal behavior, self-harm, psychotic disorders, eating disorders, stress, and gambling) delivered on mobile devices with a pre- to posttest design or compared with a control group. The control group could consist of wait list, treatment-as-usual, or another recognized treatment. In total, 5464 abstracts were identified. Of those, 8 papers describing 5 apps targeting depression, anxiety, and substance abuse met the inclusion criteria. Four apps provided support from a mental health professional. Results showed significant reductions in depression, stress, and substance use. Within-group and between-group intention-to-treat effect sizes ranged from 0.29-2.28 and 0.01-0.48 at posttest and follow-up, respectively. Mental health apps have the potential to be effective and may significantly improve treatment accessibility. However, the majority of apps that are currently available lack scientific evidence about their efficacy. The public needs to be educated on how to identify the few evidence-based mental health apps available in the public domain to date. Further rigorous research is required to develop and test evidence-based programs. Given the small number of studies and participants included in this review, the high risk of bias, and unknown efficacy of long-term follow-up, current findings should be interpreted with caution, pending replication. Two

  5. Navigating the high seas of Federal Programs to ensure usable science delivery

    Science.gov (United States)

    Bachelet, D. M.; Gough, M.; Baker, B.; Sheehan, T.; Mutch, T.; Brown, M.

    2016-12-01

    Oregon State University, University of Idaho, and the University of Washington. With much experience with local and regional managers and federal programs we will show examples of exciting successes and report on some challenges in coordinating exchanges and extracting valuable feedback to improve the usability of web applications.

  6. Enhanced Recovery After Surgery Program Implementation in 2 Surgical Populations in an Integrated Health Care Delivery System.

    Science.gov (United States)

    Liu, Vincent X; Rosas, Efren; Hwang, Judith; Cain, Eric; Foss-Durant, Anne; Clopp, Molly; Huang, Mengfei; Lee, Derrick C; Mustille, Alex; Kipnis, Patricia; Parodi, Stephen

    2017-07-19

    Novel approaches to perioperative surgical care focus on optimizing nutrition, mobility, and pain management to minimize adverse events after surgical procedures. To evaluate the outcomes of an enhanced recovery after surgery (ERAS) program among 2 target populations: patients undergoing elective colorectal resection and patients undergoing emergency hip fracture repair. A pre-post difference-in-differences study before and after ERAS implementation in the target populations compared with contemporaneous surgical comparator groups (patients undergoing elective gastrointestinal surgery and emergency orthopedic surgery). Implementation began in February and March 2014 and concluded by the end of 2014 at 20 medical centers within the Kaiser Permanente Northern California integrated health care delivery system. A multifaceted ERAS program designed with a particular focus on perioperative pain management, mobility, nutrition, and patient engagement. The primary outcome was hospital length of stay. Secondary outcomes included hospital mortality, home discharge, 30-day readmission rates, and complication rates. The study included a total of 3768 patients undergoing elective colorectal resection (mean [SD] age, 62.7 [14.1] years; 1812 [48.1%] male) and 5002 patients undergoing emergency hip fracture repair (mean [SD] age, 79.5 [11.8] years; 1586 [31.7%] male). Comparator surgical patients included 5556 patients undergoing elective gastrointestinal surgery and 1523 patients undergoing emergency orthopedic surgery. Most process metrics had significantly greater changes in the ERAS target populations after implementation compared with comparator surgical populations, including those for ambulation, nutrition, and opioid use. Hospital length of stay and postoperative complication rates were also significantly lower among ERAS target populations after implementation. The rate ratios for postoperative complications were 0.68 (95% CI, 0.46-0.99; P = .04) for patients

  7. Monitoring the Results of the Tutoring Program in Its Face-to-Face and Virtual Modalities on the Academic Achievement of Students at a Mexican University

    Science.gov (United States)

    Salazar, Omar Cuevas; López, Ramona Imelda García; Garcia, Javier José Vales; Medina, Isidro Roberto Cruz

    2017-01-01

    The tutorship program is aimed at supporting students throughout their university career and its objective is to prevent future problems of adaptation in the educational ambience as well as intervening in matters of academic achievement. At the Instituto Tecnológico de Sonora (Technological Institute of Sonora) (ITSON), the individual tutorship…

  8. A Godel Modal Logic

    OpenAIRE

    Caicedo, Xavier; Rodriguez, Ricardo Oscar

    2009-01-01

    In this paper we consider an approach where both propositions and the accessibility relation are infinitely many-valued over G\\"{o}del algebras. In particular, we consider separately the $\\Box $-fragment and the $\\Diamond $-fragment of our G\\"{o}del modal logic and prove that both logics are complete with respect to the class of models with values in the linear Hetying algebra [0,1]. In addition, we show that the first fragment is uniquely determined by the class of models having crisp access...

  9. Normal modal preferential consequence

    CSIR Research Space (South Africa)

    Britz, K

    2012-12-01

    Full Text Available .e., for any , 3i def :2i: . We use > as an abbreviation for p _ :p and ? for p ^ :p, for some p 2 P. With L we denote the set of all formulas of the modal language. As for the semantics, we assume the standard possible-worlds one: De nition 1. A Kripke... that are interesting from the standpoint of modern AI cannot be satisfactorily formal- ized in a propositional language. Extensions of the KLM approach have therefore been driven by either extending the syntax [9, 11, 16] or the underlying prefer- ential semantics...

  10. Utilization of clean and safe delivery service package of health services extension program and associated factors in rural kebeles of Kafa Zone, Southwest Ethiopia.

    Science.gov (United States)

    Bayou, Negalign Berhanu; Gacho, Yohannes Haile Michael

    2013-07-01

    In Ethiopia, 94% of births take place at home unattended by trained persons. The government introduced an innovative strategy, Health Services Extension Program in 2003. Clean and safe delivery service is a component of maternal and child healthcare package of the program. However, little is known about the status of uptake of the service. This study thus aimed to assess utilization of clean and safe delivery service and associated factors in rural kebeles of Kafa Zone, Ethiopia. A community based cross sectional survey was conducted in rural kebeles of Kefa Zone from January 21(st) to February 25(th), 2009 using a sample of 229 mothers. Kafa Zone is located 465 kilometres away from Addis Ababa to southwest of Ethiopia. Data were collected using a structured questionnaire and analyzed using SPSS for windows version 16. OR and 95% CI were calculated. Pextension workers should consider antenatal care visits as opportunities for this purpose.

  11. PENGARUH EFIKASI DIRI, LINGKUNGAN SOSIAL, AKSES KEPADA MODAL, DAN KEPEMILIKAN JARINGAN SOSIAL TERHADAP SIKAP KEWIRAUSAHAAN MAHASISWA PROGRAM STUDI PENDIDIKAN AKUNTANSI ANGKATAN 2013 UNIVERSITAS NEGERI SEMARANG

    Directory of Open Access Journals (Sweden)

    Retno Ariyani Puji Lestari

    2017-10-01

    Full Text Available This study aims to find out the influence of self efficacy, social environment, access to capital, and ownership of social networks on student entrepreneurship attitude of Accounting Education Program year 2013 UNNES either simultaneously or partially. The population in this study were students of Accounting Education class of 2013 amounting to 190 students and 129 students sample after treatment with the standard formula Slovin error of 5% then using Random Propotional Sampling as the sampling technique. This study used a questionnaire as a data collection tool. Data were analyzed using descriptive statistical analysis and regression analysis. The results showed that self-efficacy, social environment, access to capital, and the ownership of social network influence simultaneously to accounting education student entrepreneurship attitude (70%. Partially self efficacy affected student entrepreneurship attitude (44,09%, social environment does not affected students entrepreneurship attitude (0,19%, access to capital does not affected student entrepreneurship attitude (0,05%, and ownership of social networks affected student entrepreneurship attitude (13,76%.

  12. No Can Do Modal Verbs

    Directory of Open Access Journals (Sweden)

    Gašper Ilc

    2008-06-01

    Full Text Available The paper presents the systems of modal verbs in Slovene and English, and it focuses on comprehension and usage problems that advanced students of English may have when dealing with modal verb constructions. The paper identifies the key factors that give rise to various problems, such as in-vacuo vs. in-context treatment of modal verbs and absolute vs. relative temporal relations. It is argued that most students fail to fully understand contextualised modal verb constructions mostly due to the polysemy of modal verbs as well as their relative tense value. This is particularly the case when a (narrative text containing modal verb constructions has a past time reference, and combines different narrative techniques.

  13. Moderating effects of parental well-being on parenting efficacy outcomes by intervention delivery model of the early risers conduct problems prevention program.

    Science.gov (United States)

    Piehler, Timothy F; Lee, Susanne S; Bloomquist, Michael L; August, Gerald J

    2014-10-01

    Parent-focused preventive interventions for youth conduct problems are efficacious when offered in different models of delivery (e.g., individual in-home, group center-based). However, we know little about the characteristics of parents associated with a positive response to a particular model of delivery. We randomly assigned the parents of an ethnically diverse sample of kindergarten through second grade students (n = 246) displaying elevated levels of aggression to parent-focused program delivery models emphasizing receiving services in a community center largely with groups (Center; n = 121) or receiving services via an individualized in-home strategy (Outreach; n = 125). In both delivery models, parents received parent skills training and goal setting/case management/referrals over an average of 16 months. Structural equation modeling revealed a significant interaction between parental well-being at baseline and intervention delivery model in predicting parenting efficacy at year 2, while controlling for baseline levels of parenting efficacy. Within the Outreach model, parents with lower levels of well-being as reported at baseline appeared to show greater improvements in parenting efficacy than parents with higher levels of well-being. Within the Center model, parental well-being did not predict parenting efficacy outcomes. The strong response of low well-being parents within the Outreach model suggests that this may be the preferred model for these parents. These findings provide support for further investigation into tailoring delivery model of parent-focused preventive interventions using parental well-being in order to improve parenting outcomes.

  14. Evaluation of modal testing methods

    Science.gov (United States)

    Chen, J.-C.

    1984-01-01

    Modal tests are playing an increasingly important role in structural dynamics efforts which are in need of analytical model verification or trouble shootings. In the meantime, the existing modal testing methods are undergoing great changes as well as new methods are being created. Although devoted advocates of each method can be found to argue the relative advantages and disadvantages, the general superiority, if any, of one or the other is not yet evident. The Galileo spacecraft, a realistic, complex structural system, will be used as a test article for performing modal tests by various methods. The results will be used to evaluate the relative merits of the various modal testing methods.

  15. Metaphysical Modality, Modality of Predicate and the Theory of

    Directory of Open Access Journals (Sweden)

    l nabavi

    2010-05-01

    This paper discusses the historical overview of the metaphysical modality firstly and then shows that the theory of "Decisive Necessity” is true and justified in a model of modal logic with equivalent accessibility relation and homogeneous possible world view (fixed domain.

  16. 20 CFR 663.620 - How do the Welfare-to-Work program and the TANF program relate to the One-Stop delivery system?

    Science.gov (United States)

    2010-04-01

    ... EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR ADULT AND DISLOCATED WORKER ACTIVITIES UNDER... describes the roles of such partners in the One-Stop delivery system and applies to the Welfare-to-Work...

  17. On Modal Refinement and Consistency

    DEFF Research Database (Denmark)

    Nyman, Ulrik; Larsen, Kim Guldstrand; Wasowski, Andrzej

    2007-01-01

    Almost 20 years after the original conception, we revisit several fundamental question about modal transition systems. First, we demonstrate the incompleteness of the standard modal refinement using a counterexample due to Hüttel. Deciding any refinement, complete with respect to the standard...

  18. Treatment Service Patterns and Organizational Structures: An Analysis of Programs in DATOS-A.

    Science.gov (United States)

    Delany, Peter J.; Broome, Kirk M.; Flynn, Patrick M.; Fletcher, Bennett W.

    2001-01-01

    Examined availability of various treatment services within a national sample of programs treating adolescent drug abuse patients. Created treatment service delivery profiles and examined them in context of organizational variables. Found that distinct profiles of services existed within residential and outpatient modalities and that these service…

  19. Factors influencing the selection of delivery with no one present in Northern Nigeria: implications for policy and programs

    Directory of Open Access Journals (Sweden)

    Fapohunda B

    2014-01-01

    Full Text Available Bolaji Fapohunda,1 Nosakhare Orobaton1,21International Division, John Snow Inc, Rosslyn, VA, USA; 2Targeted States High Impact Project (TSHIP, Bauchi, NigeriaAbstract: This paper examines the effects of demographic, socioeconomic, and women's autonomy factors on the utilization of delivery assistance in Sokoto State, Nigeria. Data were obtained from the Nigeria 2008 Demographic and Health Survey (DHS. Bivariate analysis and logistic regression procedures were conducted. The study revealed that delivery with no one present and with unskilled attendance accounted for roughly 95% of all births in Sokoto State. Mothers with existing high risk factors, including higher parity, were more likely to select unsafe/unskilled delivery practices than younger, lower-parity mothers. Evidenced by the high prevalence of delivery with traditional birth attendants, this study demonstrates that expectant mothers are willing to obtain care from a provider, and their odds of using accessible, affordable, skilled delivery is high, should such an option be presented. This conclusion is supported by the high correlation between a mother's socioeconomic status and the likelihood of using skilled attendance. To improve the access to, and increase the affordability of, skilled health attendants, we recommended two solutions: 1 the use of cash subsidies to augment women's incomes in order to reduce finance-related barriers in the use of formal health services, thus increasing demand; and 2 a structural improvement that will increase women's economic security by improving their access to higher education, income, and urban ideation.Keywords: Sokoto State, delivery attendance, maternal mortality rate, maternal health, reproductive health, demographic and health surveys, poverty

  20. Doxorubicin-conjugated β-NaYF4:Gd3+/Tb3+ multifunctional, phosphor nanorods: a multi-modal, luminescent, magnetic probe for simultaneous optical and magnetic resonance imaging and an excellent pH-triggered anti-cancer drug delivery nanovehicle

    Science.gov (United States)

    Padhye, Preeti; Alam, Aftab; Ghorai, Suvankar; Chattopadhyay, Samit; Poddar, Pankaj

    2015-11-01

    Herein, we report the fabrication of a multifunctional nanoprobe based on highly monodispersed, optically and magnetically active, biocompatible, PEI-functionalized, highly crystalline β-NaYF4:Gd3+/Tb3+ nanorods as an excellent multi-modal optical/magnetic imaging tool and a pH-triggered intracellular drug delivery nanovehicle. The static and dynamic photoluminescence spectroscopy showed the presence of sharp emission peaks, with long lifetimes (~3.5 milliseconds), suitable for optical imaging. The static magnetic susceptibility measurements at room temperature showed a strong paramagnetic signal (χ ~ 3.8 × 10-5 emu g-1 Oe-1). The nuclear magnetic resonance (NMR) measurements showed fair T1 relaxivity (r1 = 1.14 s-1 mM-1) and magnetic resonance imaging gave enhanced T1-weighted MRI images with increased concentrations of β-NaYF4:Gd3+/Tb3+ making them suitable for simultaneous magnetic resonance imaging. In addition, an anticancer drug, doxorubicin (DOX) was conjugated to the amine-functionalized β-NaYF4:Gd3+/Tb3+ nanorods via pH-sensitive hydrazone bond linkages enabling them as a pH-triggered, site-specific drug delivery nanovehicle for DOX release inside tumor cells. A comparison between in vitro DOX release studies undertaken in normal physiological (pH 7.4) and acidic (pH 5.0) environments showed an enhanced DOX dissociation (~80%) at pH 5.0. The multifunctional material was also applied as an optical probe to confirm the conjugation of DOX and to monitor DOX release via a fluorescence resonance energy transfer (FRET) mechanism. The DOX-conjugated β-NaYF4:Gd3+/Tb3+ nanorods exhibited a cytotoxic effect on MCF-7 breast cancer cells and their uptake by MCF-7 cells was demonstrated using confocal laser scanning microscopy and flow cytometry. The comparative cellular uptakes of free DOX and DOX-conjugated β-NaYF4:Gd3+/Tb3+ nanorods were studied in tumor microenvironment conditions (pH 6.5) using confocal imaging, which showed an increased uptake of DOX

  1. Recent advances in different modal imaging-guided photothermal therapy.

    Science.gov (United States)

    Chen, Qiwen; Wen, Jia; Li, Hongjuan; Xu, Yongqian; Liu, Fengyu; Sun, Shiguo

    2016-11-01

    Photothermal therapy (PTT) has recently attracted considerable attention owing to its controllable treatment process, high tumour eradication efficiency and minimal side effects on non-cancer cells. PTT can melt cancerous cells by localising tissue hyperthermia induced by internalised therapeutic agents with a high photothermal conversion efficiency under external laser irradiation. Numerous in vitro and in vivo studies have shown the significant potential of PTT to treat tumours in future practical applications. Unfortunately, the lack of visualisation towards agent delivery and internalisation, as well as imaging-guided comprehensive evaluation of therapeutic outcome, limits its further application. Developments in combined photothermal therapeutic nanoplatforms guided by different imaging modalities have compensated for the major drawback of PTT alone, proving PTT to be a promising technique in biomedical applications. In this review, we introduce recent developments in different imaging modalities including single-modal, dual-modal, triple-modal and even multi-modal imaging-guided PTT, together with imaging-guided multi-functional theranostic nanoplatforms. Copyright © 2016 Elsevier Ltd. All rights reserved.

  2. Factors influencing access to education, decision making, and receipt of preferred dialysis modality in unplanned dialysis start patients

    Directory of Open Access Journals (Sweden)

    Machowska A

    2016-11-01

    Full Text Available Anna Machowska,1 Mark Dominik Alscher,2 Satyanarayana Reddy Vanga,3 Michael Koch,4 Michael Aarup,5 Abdul Rashid Qureshi,1 Bengt Lindholm,1 Peter A Rutherford6 1Division of Renal Medicine and Baxter Novum, Department of Clinical Science, Intervention, and Technology, Karolinska Institutet, Stockholm, Sweden; 2Division of Nephrology, Department of Internal Medicine, Robert-Bosch-Krankenhaus, Stuttgart, Germany; 3Department of Renal Medicine, University Hospital of North Staffordshire, Stoke-on-Trent, Staffordshire, UK; 4Center of Nephrology, Nephrologisches Zentrum, Mettmann, Germany; 5Department of Nephrology, Odense University Hospital, Odense, Denmark; 6Baxter Healthcare SA, Zurich, Switzerland Objectives: Unplanned dialysis start (UPS leads to worse clinical outcomes than planned start, and only a minority of patients ever receive education on this topic and are able to make a modality choice, particularly for home dialysis. This study aimed to determine the predictive factors for patients receiving education, making a decision, and receiving their preferred modality choice in UPS patients following a UPS educational program (UPS-EP. Methods: The Offering Patients Therapy Options in Unplanned Start (OPTiONS study examined the impact of the implementation of a specific UPS-EP, including decision support tools and pathway improvement on dialysis modality choice. Linear regression models were used to examine the factors predicting three key steps: referral and receipt of UPS-EP, modality decision making, and actual delivery of preferred modality choice. A simple economic assessment was performed to examine the potential benefit of implementing UPS-EP in terms of dialysis costs. Results: The majority of UPS patients could receive UPS-EP (214/270 patients and were able to make a decision (177/214, although not all patients received their preferred choice (159/177. Regression analysis demonstrated that the initial dialysis modality was a predictive

  3. CHARACTER EDUCATION THROUGH ENGLISH MODALITY

    Directory of Open Access Journals (Sweden)

    Subur Wardoyo

    2010-10-01

    Full Text Available The spread of English in Indonesia carries an inherent philosophy with it. This essay will focus on how the view that ‘there is no absolute truth’ is ingrained in the linguistic modality of English. Furthermore it will show how this philosophy of modality may inevitably shape a student’s character since it allows people to create the shared truths they need or to downgrade the truths of others, with all the potential positive or negative consequences. Finally this essay will also show how a visual picture, descriptive text, and dialogue could serve as teaching aids to shape a student’s character through classroom drills in such modality signifiers as modal auxiliaries, frequency adverbs, reporting frames, tenses etc. On the whole this essay relies heavily on Halliday’s Functional Grammar, von Wright’s Deontic Logic, and Hodge and Kress’s Semiotics while the topic of the picture, text and dialogue heavily centers on the mysterious Alhambra Citadel of Granada.   Keywords    :    Modality, degrees of modality, subjective and objective modality, kinds of truth, deontic logic.

  4. Nurse mentor perceptions in the delivery of a home-based cardiac rehabilitation program to support patients living in rural areas: An interpretive study.

    Science.gov (United States)

    Frohmader, Terence J; Lin, Frances; Chaboyer, Wendy P

    2017-05-01

    Home-based cardiac rehabilitation (CR) programs improve health outcomes for people diagnosed with heart disease. Mentoring of patients by nurses trained in CR has been proposed as an innovative model of cardiac care. Little is known however, about the experience of mentors facilitating such programs and adapting to this new role. The aim of this qualitative study was to explore nurse mentor perceptions of their role in the delivery of a home-based CR program for rural patients unable to attend a hospital or outpatient CR program. Seven nurses mentored patients by telephone providing patients with education, psychosocial support and lifestyle advice during their recovery. An open-ended survey was administered to mentors by email and findings revealed mentors perceived their role to be integral to the success of the program. Nurses were satisfied with the development of their new role as patient mentors. They believed their collaborative skills, knowledge and experience in coronary care, timely support and guidance of patients during their recovery and use of innovative audiovisual resources improved the health outcomes of patients not able to attend traditional programs. Cardiac nurses in this study perceived that they were able to successfully transition from their normal work practices in hospital to mentoring patients in their homes. Crown Copyright © 2017. Published by Elsevier Ltd. All rights reserved.

  5. Effects of Recruiting Midwives into a Family Physician Program on Women's Awareness and Preference for Mode of Delivery and Caesarean Section Rates in Rural Areas of Kurdistan.

    Science.gov (United States)

    Hajizadeh, Shayesteh; Tehrani, Fahimeh Ramezani; Simbar, Masoumeh; Farzadfar, Farshad

    2016-01-01

    The accepted rate rate of caesarean section is 15%. It is expected that an increase in the density of midwives in the family physician program lead to a decrease in this indicator. This study aimed to compare the rates of caesarean section and women's awareness and preference for mode of delivery before and after the implementation of the family physician program in health centres with and without an increase in midwives density. In this cross-sectional study, using multistage cluster sampling method a total of 668 mothers with two-month-old children were selected from among all mothers with two-month-old children who were living in rural areas of Kurdistan province. Using the difference-in-differences model and Matchit statistical model, the factors associated with caesarean section rates and women's awareness and preference for mode of delivery were compared in centres with and without an increase in midwives density after the implementation of the family physician program. To compare the changes before and after the program, we used the data collected from the same number of women in 2005 as the baseline. After adjusting for baseline data collected in 2005, the resutls showed no significant change in caesarean section rates and women's awareness and preference for mode of delivery in the centres with and without an increase in midwives density after the implementation of the family physician program. The Matchit model showed a significant mean increase 14%(0.03-0.25) in women's awareness of the benefits of natural childbirth between 2005 and 2013 in health centres where the density of midwives increased compared with health centres where it did not. The difference-in-differences model showed that the odds ratio of women's preference for caesarean section decreased by 41% among participants who were aware of the benefits of natural childbirth, (OR = 0.59, 95% CI: (0.22-0.85); P>0.001). The results of this study showed that an increase in the density of midwives

  6. A qualitative study on barriers to utilisation of institutional delivery services in Moroto and Napak districts, Uganda: implications for programming.

    Science.gov (United States)

    Wilunda, Calistus; Quaglio, Gianluca; Putoto, Giovanni; Lochoro, Peter; Dall'Oglio, Giovanni; Manenti, Fabio; Atzori, Andrea; Lochiam, Rose Miligan; Takahashi, Risa; Mukundwa, Aline; Oyerinde, Koyejo

    2014-08-04

    Skilled attendance at delivery is critical in prevention of maternal deaths. However, many women in low- and middle-income countries still deliver without skilled assistance. This study was carried out to identify perceived barriers to utilisation of institutional delivery in two districts in Karamoja, Uganda. Data were collected through participatory rural appraisal (PRA) with 887 participants (459 women and 428 men) in 20 villages in Moroto and Napak districts. Data were analysed using deductive content analysis. Notes taken during PRA session were edited, triangulated and coded according to recurring issues. Additionally, participants used matrix ranking to express their perceived relative significance of the barriers identified. The main barriers to utilisation of maternal health services were perceived to be: insecurity, poverty, socio-cultural factors, long distances to health facilities, lack of food at home and at health facilities, lack of supplies, drugs and basic infrastructure at health facilities, poor quality of care at health facilities, lack of participation in planning for health services and the ready availability of traditional birth attendants (TBAs). Factors related to economic and physical inaccessibility and lack of infrastructure, drugs and supplies at health facilities were highly ranked barriers to utilisation of institutional delivery. A comprehensive approach to increasing the utilisation of maternal health care services in Karamoja is needed. This should tackle both demand and supply side barriers using a multi-sectorial approach since the main barriers are outside the scope of the health sector. TBAs are still active in Karamoja and their role and influence on maternal health in this region cannot be ignored. A model for collaboration between skilled health workers and TBAs in order to increase institutional deliveries is needed.

  7. Participant satisfaction with a school telehealth education program using interactive compressed video delivery methods in rural Arkansas.

    Science.gov (United States)

    Bynum, Ann B; Cranford, Charles O; Irwin, Cathy A; Denny, George S

    2002-08-01

    Socioeconomic and demographic factors can affect the impact of telehealth education programs that use interactive compressed video technology. This study assessed program satisfaction among participants in the University of Arkansas for Medical Sciences' School Telehealth Education Program delivered by interactive compressed video. Variables in the one-group posttest study were age, gender, ethnicity, education, community size, and program topics for years 1997-1999. The convenience sample included 3,319 participants in junior high and high schools. The School Telehealth Education Program provided information about health risks, disease prevention, health promotion, personal growth, and health sciences. Adolescents reported medium to high levels of satisfaction regarding program interest and quality. Significantly higher satisfaction was expressed for programs on muscular dystrophy, anatomy of the heart, and tobacco addiction (p Education Program, delivered by interactive compressed video, promoted program satisfaction among rural and minority populations and among junior high and high school students. Effective program methods included an emphasis on participants' learning needs, increasing access in rural areas among ethnic groups, speaker communication, and clarity of the program presentation.

  8. Defining pediatric inpatient cardiology care delivery models: A survey of pediatric cardiology programs in the USA and Canada.

    Science.gov (United States)

    Mott, Antonio R; Neish, Steven R; Challman, Melissa; Feltes, Timothy F

    2017-05-01

    The treatment of children with cardiac disease is one of the most prevalent and costly pediatric inpatient conditions. The design of inpatient medical services for children admitted to and discharged from noncritical cardiology care units, however, is undefined. North American Pediatric Cardiology Programs were surveyed to define noncritical cardiac care unit models in current practice. An online survey that explored institutional and functional domains for noncritical cardiac care unit was crafted. All questions were multi-choice with comment boxes for further explanation. The survey was distributed by email four times over a 5-month period. Most programs (n = 45, 60%) exist in free-standing children's hospitals. Most programs cohort cardiac patients on noncritical cardiac care units that are restricted to cardiac patients in 39 (54%) programs or restricted to cardiac and other subspecialty patients in 23 (32%) programs. The most common frontline providers are categorical pediatric residents (n = 58, 81%) and nurse practitioners (n = 48, 67%). However, nurse practitioners are autonomous providers in only 21 (29%) programs. Only 33% of programs use a postoperative fast-track protocol. When transitioning care to referring physicians, most programs (n = 53, 72%) use facsimile to deliver pertinent patient information. Twenty-two programs (31%) use email to transition care, and eighteen (25%) programs use verbal communication. Most programs exist in free-standing children's hospitals in which the noncritical cardiac care units are in some form restricted to cardiac patients. While nurse practitioners are used on most noncritical cardiac care units, they rarely function as autonomous providers. The majority of programs in this survey do not incorporate any postoperative fast-track protocols in their practice. Given the current era of focused handoffs within hospital systems, relatively few programs utilize verbal handoffs to the referring pediatric

  9. Systematic review of community-based, school-based, and combined delivery modes for reaching school-aged children in mass drug administration programs for schistosomiasis.

    Directory of Open Access Journals (Sweden)

    Michael Burnim

    2017-10-01

    Full Text Available The mainstay of current schistosomiasis control programs is mass preventive chemotherapy of school-aged children with praziquantel. This treatment is delivered through school-based, community-based, or combined school- and community-based systems. Attaining very high coverage rates for children is essential in mass schistosomiasis treatment programs, as is ensuring that there are no persistently untreated subpopulations, a potential challenge for school-based programs in areas with low school enrollment. This review sought to compare the different treatment delivery methods based both on their coverage of school-aged children overall and on their coverage specifically of non-enrolled children. In addition, qualitative community or programmatic factors associated with high or low coverage rates were identified, with suggestions for overall coverage improvement.This review was registered prospectively with PROSPERO (CRD 42015017656. Five hundred forty-nine publication of potential relevance were identified through database searches, reference lists, and personal communications. Eligible studies included those published before October 2015, written in English or French, containing quantitative or qualitative data about coverage rates for MDA of school-aged children with praziquantel. Among the 22 selected studies, combined community- and school-based programs achieved the highest median coverage rates (89%, followed by community-based programs (72%. School-based programs had both the lowest median coverage of children overall (49% and the lowest coverage of the non-enrolled subpopulation of children. Qualitatively, major factors affecting program success included fear of side effects, inadequate education about schistosomiasis, lack of incentives for drug distributors, and inequitable distribution to minority groups.This review provides an evidence-based framework for the development of future schistosomiasis control programs. Based on our results

  10. Systematic review of community-based, school-based, and combined delivery modes for reaching school-aged children in mass drug administration programs for schistosomiasis.

    Science.gov (United States)

    Burnim, Michael; Ivy, Julianne A; King, Charles H

    2017-10-01

    The mainstay of current schistosomiasis control programs is mass preventive chemotherapy of school-aged children with praziquantel. This treatment is delivered through school-based, community-based, or combined school- and community-based systems. Attaining very high coverage rates for children is essential in mass schistosomiasis treatment programs, as is ensuring that there are no persistently untreated subpopulations, a potential challenge for school-based programs in areas with low school enrollment. This review sought to compare the different treatment delivery methods based both on their coverage of school-aged children overall and on their coverage specifically of non-enrolled children. In addition, qualitative community or programmatic factors associated with high or low coverage rates were identified, with suggestions for overall coverage improvement. This review was registered prospectively with PROSPERO (CRD 42015017656). Five hundred forty-nine publication of potential relevance were identified through database searches, reference lists, and personal communications. Eligible studies included those published before October 2015, written in English or French, containing quantitative or qualitative data about coverage rates for MDA of school-aged children with praziquantel. Among the 22 selected studies, combined community- and school-based programs achieved the highest median coverage rates (89%), followed by community-based programs (72%). School-based programs had both the lowest median coverage of children overall (49%) and the lowest coverage of the non-enrolled subpopulation of children. Qualitatively, major factors affecting program success included fear of side effects, inadequate education about schistosomiasis, lack of incentives for drug distributors, and inequitable distribution to minority groups. This review provides an evidence-based framework for the development of future schistosomiasis control programs. Based on our results, a combined

  11. Applied modal analysis of wind turbine blades

    Energy Technology Data Exchange (ETDEWEB)

    Broen Pedersen, H.; Dahl Kristensen, O.J.

    2003-02-01

    In this project modal analysis has been used to determine the natural frequencies, damping and the mode shapes for wind turbine blades. Different methods to measure the position and adjust the direction of the measuring points are discussed. Different equipment for mounting the accelerometers are investigated and the most suitable are chosen. Different excitation techniques are tried during experimental campaigns. After a discussion the pendulum hammer were chosen, and a new improved hammer was manufactured. Some measurement errors are investigated. The ability to repeat the measured results is investigated by repeated measurement on the same wind turbine blade. Furthermore the flexibility of the test set-up is investigated, by use of accelerometers mounted on the flexible adapter plate during the measurement campaign. One experimental campaign investigated the results obtained from a loaded and unloaded wind turbine blade. During this campaign the modal analysis are performed on a blade mounted in a horizontal and a vertical position respectively. Finally the results obtained from modal analysis carried out on a wind turbine blade are compared with results obtained from the Stig Oeyes blade{sub E}V1 program. (au)

  12. TESS Lens-Bezel Assembly Modal Testing

    Science.gov (United States)

    Dilworth, Brandon J.; Karlicek, Alexandra

    2017-01-01

    The Transiting Exoplanet Survey Satellite (TESS) program, led by the Kavli Institute for Astrophysics and Space Research at the Massachusetts Institute of Technology (MIT) will be the first-ever spaceborne all-sky transit survey. MIT Lincoln Laboratory is responsible for the cameras, including the lens assemblies, detector assemblies, lens hoods, and camera mounts. TESS is scheduled to be launched in August of 2017 with the primary goal to detect small planets with bright host starts in the solar neighborhood, so that detailed characterizations of the planets and their atmospheres can be performed. The TESS payload consists of four identical cameras and a data handling unit. Each camera consists of a lens assembly with seven optical elements and a detector assembly with four charge-coupled devices (CCDs) including their associated electronics. The optical prescription requires that several of the lenses are in close proximity to a neighboring element. A finite element model (FEM) was developed to estimate the relative deflections between each lens-bezel assembly under launch loads to predict that there are adequate clearances preventing the lenses from making contact. Modal tests using non-contact response measurements were conducted to experimentally estimate the modal parameters of the lens-bezel assembly, and used to validate the initial FEM assumptions. Key Words Non-contact measurements, modal analysis, model validation

  13. Multi-Modality Phantom Development

    Energy Technology Data Exchange (ETDEWEB)

    Huber, Jennifer S.; Peng, Qiyu; Moses, William W.

    2009-03-20

    Multi-modality imaging has an increasing role in the diagnosis and treatment of a large number of diseases, particularly if both functional and anatomical information are acquired and accurately co-registered. Hence, there is a resulting need for multi modality phantoms in order to validate image co-registration and calibrate the imaging systems. We present our PET-ultrasound phantom development, including PET and ultrasound images of a simple prostate phantom. We use agar and gelatin mixed with a radioactive solution. We also present our development of custom multi-modality phantoms that are compatible with PET, transrectal ultrasound (TRUS), MRI and CT imaging. We describe both our selection of tissue mimicking materials and phantom construction procedures. These custom PET-TRUS-CT-MRI prostate phantoms use agargelatin radioactive mixtures with additional contrast agents and preservatives. We show multi-modality images of these custom prostate phantoms, as well as discuss phantom construction alternatives. Although we are currently focused on prostate imaging, this phantom development is applicable to many multi-modality imaging applications.

  14. Telemedicine delivery of patient education in remote Ontario communities: feasibility of an Advanced Clinician Practitioner in Arthritis Care (ACPAC-led inflammatory arthritis education program

    Directory of Open Access Journals (Sweden)

    Warmington K

    2017-02-01

    Full Text Available Kelly Warmington,1 Carol Flewelling,2 Carol A Kennedy,3,4 Rachel Shupak,5 Angelo Papachristos,5 Caroline Jones,5 Denise Linton,3 Dorcas E Beaton,3,4,6–8 Sydney Lineker9 1Learning Institute, The Hospital for Sick Children, 2Telemedicine Program, 3Musculoskeletal Health & Outcomes Research, St. Michael’s Hospital, 4Institute for Work & Health, 5Martin Family Centre for Arthritis Care & Research, St. Michael’s Hospital, 6Graduate Department of Health Policy, Management and Evaluation, 7Graduate Department of Rehabilitation Science, 8Department of Occupational Science and Occupational Therapy, University of Toronto, 9The Arthritis Society (Ontario Division, Toronto, ON, Canada Objective: Telemedicine-based approaches to health care service delivery improve access to care. It was recognized that adults with inflammatory arthritis (IA living in remote areas had limited access to patient education and could benefit from the 1-day Prescription for Education (RxEd program. The program was delivered by extended role practitioners with advanced training in arthritis care. Normally offered at one urban center, RxEd was adapted for videoconference delivery through two educator development workshops that addressed telemedicine and adult education best practices. This study explores the feasibility of and participant satisfaction with telemedicine delivery of the RxEd program in remote communities.Materials and methods: Participants included adults with IA attending the RxEd program at one of six rural sites. They completed post-course program evaluations and follow-up interviews. Educators provided post-course feedback to identify program improvements that were later implemented.Results: In total, 123 people (36 in-person and 87 remote, across 6 sites participated, attending one of three RxEd sessions. Remote participants were satisfied with the quality of the videoconference (% agree/strongly agree: could hear the presenter (92.9% and discussion

  15. Hubungan Modal Sosial Dengan Pemanfaatan Dan Kelestarian Hutan Lindung

    Directory of Open Access Journals (Sweden)

    Sulistya Ekawati

    2015-05-01

    Full Text Available Konsep modal sosial dan aksi kolektif mulai mendapat perhatian dalam pengelolaan sumberdaya alam bersama (common pool resources, seperti hutan lindung. Wujud modal sosial dalam kajian ini adalah kepemimpinan sosial, adat/nilai budaya/kearifan lokal, kepercayaan dan kelembagaan sosial. Kajian ini bertujuan untuk menganalisis hubungan antara modal sosial, manfaat ekonomi dan manfaat ekologis dengan kelestarian hutan. Penelitian dilakukan di tiga kabupaten, yaitu Kabupaten Tanjung Jabung Timur, Kabupaten Sarolangun (Provinsi Jambi dan Kabupaten Solok Selatan (Provinsi Sumatera Barat. Pengumpulan data dilakukan dengan melakukan wawancara, diskusi kelompok dan observasi lapangan. Analisis data dilakukan dengan program SPPS Statistic 17,0 untuk membuat estimasi kurva (curve estimation pada menu analisis regresi.\tHasil kajian menunjukkan: modal sosial dilihat dari actor perspective maupun public perspective berkorelasi positif terhadap kelestarian hutan; manfaat ekonomi yang dirasakan masyarakat sekitar hutan berkorelasi negatif dengan kelestarian hutan, dan manfaat ekologi berkorelasi positif terhadap kelestarian hutan.

  16. Mitii™ ABI: study protocol of a randomised controlled trial of a web-based multi-modal training program for children and adolescents with an Acquired Brain Injury (ABI).

    Science.gov (United States)

    Boyd, Roslyn N; Baque, Emmah; Piovesana, Adina; Ross, Stephanie; Ziviani, Jenny; Sakzewski, Leanne; Barber, Lee; Lloyd, Owen; McKinlay, Lynne; Whittingham, Koa; Smith, Anthony C; Rose, Stephen; Fiori, Simona; Cunnington, Ross; Ware, Robert; Lewis, Melinda; Comans, Tracy A; Scuffham, Paul A

    2015-08-19

    Acquired brain injury (ABI) refers to multiple disabilities arising from damage to the brain acquired after birth. Children with an ABI may experience physical, cognitive, social and emotional-behavioural impairments which can impact their ability to participate in activities of daily living (ADL). Recent developments in technology have led to the emergence of internet-delivered therapy programs. "Move it to improve it" (Mitii™) is a web-based multi-modal therapy that comprises upper limb (UL) and cognitive training within the context of meaningful physical activity. The proposed study aims to compare the efficacy of Mitii™ to usual care to improve ADL motor and processing skills, gross motor capacity, UL and executive functioning in a randomised waitlist controlled trial. Sixty independently ambulant children (30 in each group) at least 12 months post ABI will be recruited to participate in this trial. Children will be matched in pairs at baseline and randomly allocated to receive either 20 weeks of Mitii™ training (30 min per day, six days a week, with a potential total dose of 60 h) immediately, or be waitlisted for 20 weeks. Outcomes will be assessed at baseline, immediately post-intervention and at 20 weeks post-intervention. The primary outcomes will be the Assessment of Motor and Process Skills and 30 s repetition maximum of functional strength exercises (sit-to-stand, step-ups and half kneel to stand). Measures of body structure and functions, activity, participation and quality of life will assess the efficacy of Mitii™ across all domains of the International Classification of Functioning, Disability and Health framework. A subset of children will undertake three tesla (3T) magnetic resonance imaging scans to evaluate functional neurovascular changes, structural imaging, diffusion imaging and resting state functional connectivity before and after intervention. Mitii™ provides an alternative approach to deliver intensive therapy for children with

  17. National Weatherization Assistance Program Impact Evaluation - Client Satisfaction Survey: WAP Service Delivery from the Client's Perspective

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Carolyn [Carolyn Miller Consulting, Princeton, NJ (United States); Carroll, David [APPRISE, Inc., Princeton, NJ (United States); Berger, Jacqueline [APPRISE, Inc., Princeton, NJ (United States); Driscoll, Colleen [APPRISE, Inc., Princeton, NJ (United States); Tonn, Bruce Edward [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2015-10-01

    This report presents the results of a survey of recipients to measure satisfaction with services provided by local weatherization agencies being supported by funding from Department of Energy's Weatherization Assistance Program.

  18. Therapeutic modality: rehabilitation of the injured athlete.

    Science.gov (United States)

    Nyland, John; Nolan, Michael F

    2004-04-01

    Traditional therapeutic modalities include cryotherapy, sonotherapy, pulsed electrical stimulation, transcutaneous electrical nerve stimulation, high-volt pulsed current, and iotopheresis. Alternative modalities include acupuncture, magnetic field therapy, biofeedback,and massage. All therapeutic modalities should be considered adjuncts to progressive functional exercise. Controlled studies rarely reach consensus regarding the efficacy of therapeutic modalities,so their use should be individualized to the patient.

  19. Double Modals as Single Lexical Items.

    Science.gov (United States)

    Di Paolo, Marianna

    1989-01-01

    Study of East and West Texans' (N=62) use of double modals as single lexical items and their syntactic and semantic characteristics found that neither Aux nor subcategorization analysis could account for both single-modal and double-modal dialects. Double modals, however, could conceivably be analyzed as two-word lexical items such as idioms or…

  20. Modalities in homotopy type theory

    DEFF Research Database (Denmark)

    Rijke, Egbert; Shulman, Michael; Spitters, Bas

    2017-01-01

    Univalent homotopy type theory (HoTT) may be seen as a language for the category of ∞-groupoids. It is being developed as a new foundation for mathematics and as an internal language for (elementary) higher toposes. We develop the theory of factorization systems, reflective subuniverses......, and modalities in homotopy type theory, including their construction using a "localization" higher inductive type. This produces in particular the (n-connected, n-truncated) factorization system as well as internal presentations of subtoposes, through lex modalities. We also develop the semantics...

  1. Identify the endodontic treatment modalities.

    Science.gov (United States)

    Rosenberg, Paul A; Schindler, William G; Krell, Keith V; Hicks, M Lamar; Davis, Stephen B

    2009-12-01

    This paper sought to determine the levels of evidence associated with treatment for specific diagnostic categories and the prognosis of treatment. A review of the literature was conducted using MEDLINE, PubMed, Google Scholar and the Cochrane Database. The Journal of Endodontics, International Journal of Endodontics, Oral Surgery, Oral Medicine, Oral Pathology, Oral Radiology and Endodontology, Endodontic Topics, and Dental Traumatology were also searched. The bibliographies of relevant articles were manually searched. The review found a low level of evidence to assess clinical treatment modalities. The development of higher levels of evidence to facilitate the selection of appropriate treatment modalities for each diagnostic category is recommended.

  2. Space age health care delivery

    Science.gov (United States)

    Jones, W. L.

    1977-01-01

    Space age health care delivery is being delivered to both NASA astronauts and employees with primary emphasis on preventive medicine. The program relies heavily on comprehensive health physical exams, health education, screening programs and physical fitness programs. Medical data from the program is stored in a computer bank so epidemiological significance can be established and better procedures can be obtained. Besides health care delivery to the NASA population, NASA is working with HEW on a telemedicine project STARPAHC, applying space technology to provide health care delivery to remotely located populations.

  3. Literature review of HPV vaccine delivery strategies: considerations for school- and non-school based immunization program.

    Science.gov (United States)

    Paul, Proma; Fabio, Anthony

    2014-01-09

    School-based vaccination is becoming a more widely considered method of delivering HPV immunizations to an adolescent population; however, many countries do not have experience with delivering adolescent vaccines or school-based programs. This literature review will summarize the experiences from countries implementing non-health facility-based and health facility-based vaccination programs and assess HPV vaccine coverage. In October 2012, a systematic search in PubMed for studies related to the evaluation of national/regional, pilot, or demonstration HPV immunization programs that worked within existing health system yielded nine articles, representing seventeen countries. School-based programs achieved high HPV vaccination coverage rates in 9 to 13-year-old girls across the different studies and geographic locations, suggesting non-health facility-based programs are possible for HPV vaccine introduction. Grade-based, compared to age-based, eligibility criteria may be easier to implement in school settings. More studies are needed to explore the methods to standardize estimates for HPV vaccine coverage so that programs can be appropriately evaluated. Copyright © 2013 Elsevier Ltd. All rights reserved.

  4. Linear contextual modal type theory

    DEFF Research Database (Denmark)

    Schack-Nielsen, Anders; Schürmann, Carsten

    Abstract. When one implements a logical framework based on linear type theory, for example the Celf system [?], one is immediately con- fronted with questions about their equational theory and how to deal with logic variables. In this paper, we propose linear contextual modal type theory that gives...

  5. Wavefront reconstruction by modal decomposition

    CSIR Research Space (South Africa)

    Schulze, C

    2012-08-01

    Full Text Available We propose a new method to determine the wavefront of a laser beam based on modal decomposition by computer-generated holograms. The hologram is encoded with a transmission function suitable for measuring the amplitudes and phases of the modes...

  6. Integrated Healthcare Delivery: A Qualitative Research Approach to Identifying and Harmonizing Perspectives of Integrated Neglected Tropical Disease Programs.

    Directory of Open Access Journals (Sweden)

    Arianna Rubin Means

    2016-10-01

    Full Text Available While some evidence supports the beneficial effects of integrating neglected tropical disease (NTD programs to optimize coverage and reduce costs, there is minimal information regarding when or how to effectively operationalize program integration. The lack of systematic analyses of integration experiences and of integration processes may act as an impediment to achieving more effective NTD programming. We aimed to learn about the experiences of NTD stakeholders and their perceptions of integration.We evaluated differences in the definitions, roles, perceived effectiveness, and implementation experiences of integrated NTD programs among a variety of NTD stakeholder groups, including multilateral organizations, funding partners, implementation partners, national Ministry of Health (MOH teams, district MOH teams, volunteer rural health workers, and community members participating in NTD campaigns. Semi-structured key informant interviews were conducted. Coding of themes involved a mix of applying in-vivo open coding and a priori thematic coding from a start list.In total, 41 interviews were conducted. Salient themes varied by stakeholder, however dominant themes on integration included: significant variations in definitions, differential effectiveness of specific integrated NTD activities, community member perceptions of NTD programs, the influence of funders, perceived facilitators, perceived barriers, and the effects of integration on health system strength. In general, stakeholder groups provided unique perspectives, rather than contrarian points of view, on the same topics. The stakeholders identified more advantages to integration than disadvantages, however there are a number of both unique facilitators and challenges to integration from the perspective of each stakeholder group.Qualitative data suggest several structural, process, and technical opportunities that could be addressed to promote more effective and efficient integrated NTD

  7. AFRL/NASA Shaped Sonic Boom Experiment Flight Test Program. Delivery Order 0021: Origins and Overview of the Shaped Sonic Boom Demonstration Program

    National Research Council Canada - National Science Library

    Pawlowski, Joseph W; Graham, David H; Boccadoro, Charles H; Coen, Peter G; Maglieri, Domenic J

    2005-01-01

    The goal of the DARPA Shaped Sonic Boom Demonstration (SSBD) Program was to demonstrate for the first time in flight that sonic booms can be substantially reduced by incorporating specialized aircraft shaping techniques...

  8. From Cancer Screening to Treatment: Service Delivery and Referral in the National Breast and Cervical Cancer Early Detection Program

    Science.gov (United States)

    Miller, Jacqueline W.; Hanson, Vivien; Johnson, Gale D.; Royalty, Janet E.; Richardson, Lisa C.

    2015-01-01

    The National Breast and Cervical Cancer Early Detection Program (NBCCEDP) provides breast and cervical cancer screening and diagnostic services to low-income and underserved women through a network of providers and health care organizations. Although the program serves women 40-64 years old for breast cancer screening and 21-64 years old for cervical cancer screening, the priority populations are women 50-64 years old for breast cancer and women who have never or rarely been screened for cervical cancer. From 1991 through 2011, the NBCCEDP provided screening and diagnostic services to more than 4.3 million women, diagnosing 54,276 breast cancers, 2554 cervical cancers, and 123,563 precancerous cervical lesions. A critical component of providing screening services is to ensure that all women with abnormal screening results receive appropriate and timely diagnostic evaluations. Case management is provided to assist women with overcoming barriers that would delay or prevent follow-up care. Women diagnosed with cancer receive treatment through the states' Breast and Cervical Cancer Treatment Programs (a special waiver for Medicaid) if they are eligible. The NBCCEDP has performance measures that serve as benchmarks to monitor the completeness and timeliness of care. More than 90% of the women receive complete diagnostic care and initiate treatment less than 30 days from the time of their diagnosis. Provision of effective screening and diagnostic services depends on effective program management, networks of providers throughout the community, and the use of evidence-based knowledge, procedures, and technologies. PMID:25099897

  9. 76 FR 25345 - Annual Assessment of the Status of Competition in the Market for the Delivery of Video Programming

    Science.gov (United States)

    2011-05-04

    ...- side economies of scale, where large MVPDs can spread fixed costs over more subscribers or negotiate... than one programming stream as a result of the digital transition increase the competitiveness of... supply-side economies of scale that enable commonly owned broadcast television stations to spread fixed...

  10. The Effectiveness of Distance Education, Using Blended Method of Delivery for Limited-Resource Audiences in the Nutrition Education Program

    Science.gov (United States)

    Campbell, Casey; Koszewski, Wanda M.; Behrends, Donnia

    2013-01-01

    The study reported here sought to determine if the use of distance education lessons for teaching limited resource participants in a nutrition education program (NEP) is as effective as face-to-face methodology. One hundred and six participants were in the experimental group. Data was gathered at entry and examined behavior change, nutrient intake…

  11. The state-led large scale public private partnership 'Chiranjeevi Program' to increase access to institutional delivery among poor women in Gujarat, India: How has it done? What can we learn?

    Science.gov (United States)

    De Costa, Ayesha; Vora, Kranti S; Ryan, Kayleigh; Sankara Raman, Parvathy; Santacatterina, Michele; Mavalankar, Dileep

    2014-01-01

    Many low-middle income countries have focused on improving access to and quality of obstetric care, as part of promoting a facility based intra-partum care strategy to reduce maternal mortality. The state of Gujarat in India, implements a facility based intra-partum care program through its large for-profit private obstetric sector, under a state-led public-private-partnership, the Chiranjeevi Yojana (CY), under which the state pays accredited private obstetricians to perform deliveries for poor/tribal women. We examine CY performance, its contribution to overall trends in institutional deliveries in Gujarat over the last decade and its effect on private and public sector deliveries there. District level institutional delivery data (public, private, CY), national surveys, poverty estimates, census data were used. Institutional delivery trends in Gujarat 2000-2010 are presented; including contributions of different sectors and CY. Piece-wise regression was used to study the influence of the CY program on public and private sector institutional delivery. Institutional delivery rose from 40.7% (2001) to 89.3% (2010), driven by sharp increases in private sector deliveries. Public sector and CY contributed 25-29% and 13-16% respectively of all deliveries each year. In 2007, 860 of 2000 private obstetricians participated in CY. Since 2007, >600,000 CY deliveries occurred i.e. one-third of births in the target population. Caesareans under CY were 6%, higher than the 2% reported among poor women by the DLHS survey just before CY. CY did not influence the already rising proportion of private sector deliveries in Gujarat. This paper reports a state-led, fully state-funded, large-scale public-private partnership to improve poor women's access to institutional delivery - there have been >600,000 beneficiaries. While caesarean proportions are higher under CY than before, it is uncertain if all beneficiaries who require sections receive these. Other issues to explore include

  12. The effect of pelvic floor muscle exercises program on sexual self-efficacy in primiparous women after delivery

    OpenAIRE

    Golmakani, Nahid; Zare, Zahra; Khadem, Nayereh; Shareh, Hossein; Shakeri, Mohammad Taghi

    2015-01-01

    Background: Selection and acceptance of appropriate sexual behavior and sexual function are made difficult by low sexual self-efficacy in the postpartum period. The general purpose of this research is to define the effects of an 8-week pelvic floor muscle exercise program on sexual self-efficacy in primiparous women after childbirth. Materials and Methods: This clinical trial was performed on 79 primiparous women who referred to health care centers, Mashhad, Iran in 2013, 8 weeks after delive...

  13. Operational challenges in delivery of a charity care program for diabetic retinopathy screening in an urban setting.

    Science.gov (United States)

    Chedid, Erica H; Golden, Quin R; Jager, Rama D

    2013-01-01

    The University of Chicago Medicine (UCM) partners with Chicago Family Health Center (Chicago Family) in the Diabetic Retinopathy Screening Program (DRP), a charity care program to screen uninsured and underinsured patients with diabetes for diabetic retinopathy, which is a leading cause of preventable vision loss in the US. The DRP faced operational challenges throughout its pilot year: a high number of ungradable retinal images, slow turnaround time for reading retinal images and sending results, incomplete referrals, and a high rate of no-shows for diagnostic appointments. Chicago Family recalled patients with ungradable images for repeat imaging, and regular training was provided to staff taking the images. Weekly e-mails were sent to the physician champion reminding him to read images, and image software was installed on his laptop. Patients received reminder cards and preappointment and postappointment phone call reminders, and appointment information was shared with referring physicians. The UCM clinic was double-booked, so patients were seen within four weeks of referral. Discussions were held with UCM/Chicago Family teams to stress the influence of timely referrals on no-show rate; reminders were sent to referring physicians for referrals. Complete referrals were received within five days; the overall number of ungradable images decreased; image report turnaround time continued to be a challenge because of difficulties related to physician availability and technology; show rates began to increase. The methods of this intervention will translate well to other programs that provide care for similar patient populations in urban areas.

  14. Design, delivery, and validation of a trainer curriculum for the national laparoscopic colorectal training program in England.

    Science.gov (United States)

    Mackenzie, Hugh; Cuming, Tamzin; Miskovic, Danilo; Wyles, Susannah M; Langsford, Laura; Anderson, John; Thomas-Gibson, Siwan; Valori, Roland; Hanna, George B; Coleman, Mark G; Francis, Nader

    2015-01-01

    To validate the delivery and efficacy of the national laparoscopic colorectal surgery "training the trainer" (Lapco TT) curriculum. The National Training Programme in Laparoscopic Colorectal Surgery designed the Lapco TT curriculum to improve, standardize, and benchmark the quality of training. Evidence for such courses rarely extends beyond subjective feedback. The Lapco TT curriculum tailors key teaching skills for laparoscopic colorectal surgery: training structure, skills deconstruction, trainer intervention, and performance enhancing feedback. Ten Lapco TT courses were delivered to 65 national Lapco trainers since 2010. The course was validated at Kirkpatrick's 4 levels of evaluation: (i) pre- and post-course interviews reflecting initial reaction; (ii) training quality assessment on simulated scenarios using the Structured Training Trainer Assessment Report (STTAR) tool; (iii) follow-up interviews at 4 to 6 months; and (iv) delegate performance ratings, by their trainees, using the mini-STTAR and the delegates' trainees learning curves before and after the course. There were significant improvements in training in the post-course simulated scenario, especially in the "set" (P situations. Findings mirrored in performance ratings by their trainees: overall (4.37 vs 4.46, P = 0.040), agreed learning points (3.65 vs 4.00, P = 0.042), encouraged self-reflection (3.67 vs 3.94, P = 0.046), and encouraged team awareness (3.53 vs 4.05, P = 0.045). The learning curve of delegates' trainees improved after the course. The Lapco TT curriculum improved training performance in the short- and long-term, provided a structured training framework, and enhanced the learning curve of delegates' trainees.

  15. Accommodating Students' Sensory Learning Modalities in Online Formats

    Science.gov (United States)

    Allison, Barbara N.; Rehm, Marsha L.

    2016-01-01

    Online classes have become a popular and viable method of educating students in both K-12 settings and higher education, including in family and consumer sciences (FCS) programs. Online learning dramatically affects the way students learn. This article addresses how online learning can accommodate the sensory learning modalities (sight, hearing,…

  16. Modal abstractions of concurrent behavior

    DEFF Research Database (Denmark)

    Nielson, Flemming; Nanz, Sebastian; Nielson, Hanne Riis

    2011-01-01

    as refutation of safety and liveness properties. However, the algorithmic construction of finite abstractions from potentially infinite concurrent processes is a missing link that prevents their more widespread usage for model checking of concurrent systems. Our algorithm is a worklist algorithm using concepts...... and that supports the definition of a 3-valued modal logic for validating as well as refuting properties of systems. The construction is illustrated on a few examples, including the Ingemarsson-Tang-Wong key agreement protocol. © 2011 ACM....

  17. The expanded program on immunization service delivery in the Dschang health district, west region of Cameroon: a cross sectional survey

    Directory of Open Access Journals (Sweden)

    Walter Ebile Akoh

    2016-08-01

    Full Text Available Abstract Background Vaccination is the most effective intervention strategy, and the provision of vaccination at fixed posts and outreach posts is a backbone of a sustainable vaccination system in developing countries. Access to immunization services is still limited in Cameroon. Several health districts in the west region have recorded new epidemic outbreaks, including the occurrence of a wild polio virus epidemic outbreak in 2013. The aim of this study was to assess immunization service delivery in one of the largest health districts in the west region of Cameroon; the Dschang Health district. Methods It was a cross sectional study conducted in 2013, in 42 health facilities covering 18 health areas in the Dschang Health District. Data were collected with questionnaires administered to health personnel face to face and an observation grid was used to assess resources and tools. Data were entered and analyzed in Epi Info. Results A total of 42 health facilities were assessed and 77 health personnel were interviewed. Overall, 29 (69.0 % health facilities organized one vaccination session monthly, 2 (4.8 % organized an outreach within the last 3 months prior to the study, 15 (35.7 % did not have a vaccination micro plan, 24 (32.9 % health personnel had not been supervised for at least the last 6 months prior to the study, 7 (16.7 % health facilities did not have a functional refrigerator, 1 (2.4 % did not have a vaccine carrier, 23 (54.8 % did not have a means of transport (vehicle or motorcycle and 12 (28.6 % did not have an EPI guideline. The knowledge of health personnel on vaccine and cold chain management, and on diseases of the EPI under epidemiological surveillance was found to be limited. Conclusion The frequency and strategic provision of immunization services in the Dschang Health district is inadequate. Resource availability for an adequate provision of immunization services is insufficient. The knowledge of health personnel

  18. Dissemination of Chronic Disease Self-Management Education (CDSME Programs in the United States: Intervention Delivery by Rurality

    Directory of Open Access Journals (Sweden)

    Matthew Lee Smith

    2017-06-01

    Full Text Available Background: Alongside the dramatic increase of older adults in the United States (U.S., it is projected that the aging population residing in rural areas will continue to grow. As the prevalence of chronic diseases and multiple chronic conditions among adults continues to rise, there is additional need for evidence-based interventions to assist the aging population to improve lifestyle behaviors, and self-manage their chronic conditions. The purpose of this descriptive study was to identify the geospatial dissemination of Chronic Disease Self-Management Education (CDSME Programs across the U.S. in terms of participants enrolled, workshops delivered, and counties reached. These dissemination characteristics were compared across rurality designations (i.e., metro areas; non-metro areas adjacent to metro areas, and non-metro areas not adjacent to metro areas. Methods: This descriptive study analyzed data from a national repository including efforts from 83 grantees spanning 47 states from December 2009 to December 2016. Counts were tabulated and averages were calculated. Results: CDSME Program workshops were delivered in 56.4% of all U.S. counties one or more times during the study period. Of the counties where a workshop was conducted, 50.5% were delivered in non-metro areas. Of the 300,640 participants enrolled in CDSME Programs, 12% attended workshops in non-metro adjacent areas, and 7% attended workshops in non-metro non-adjacent areas. The majority of workshops were delivered in healthcare organizations, senior centers/Area Agencies on Aging, and residential facilities. On average, participants residing in non-metro areas had better workshop attendance and retention rates compared to participants in metro areas. Conclusions: Findings highlight the established role of traditional organizations/entities within the aging services network, to reach remote areas and serve diverse participants (e.g., senior centers. To facilitate growth in rural

  19. Modal test - Measurement and analysis requirements. [for Viking Orbiter

    Science.gov (United States)

    Wada, B. K.

    1975-01-01

    Data from the Viking Orbiter Modal Test Program are used to illustrate modal test measurement and analysis requirements. The test was performed using a multiple shake dwell technique where data were acquired one channel at a time and recorded on paper tape. Up to ten shakers were used simultaneously, with a complete set of data consisting of 290 strain-gage readings and 125 accelerometer readings. The data analysis provided information sufficient to minimize errors in the data. The list of analyses in order of value is orthogonality, residual mass, frequency sweep, data checks to assure good test data, multilevel trends, global kinetic energy, and global strain energy.

  20. Delivery of integrated diabetes care using logistics and information technology--the Joint Asia Diabetes Evaluation (JADE) program.

    Science.gov (United States)

    Chan, Juliana C N; Ozaki, Risa; Luk, Andrea; Kong, Alice P S; Ma, Ronald C W; Chow, Francis C C; Wong, Patrick; Wong, Rebecca; Chung, Harriet; Chiu, Cherry; Wolthers, Troels; Tong, Peter C Y; Ko, Gary T C; So, Wing-Yee; Lyubomirsky, Greg

    2014-12-01

    Diabetes is a global epidemic, and many affected individuals are undiagnosed, untreated, or uncontrolled. The silent and multi-system nature of diabetes and its complications, with complex care protocols, are often associated with omission of periodic assessments, clinical inertia, poor treatment compliance, and care fragmentation. These barriers at the system, patient, and care-provider levels have resulted in poor control of risk factors and under-usage of potentially life-saving medications such as statins and renin-angiotensin system inhibitors. However, in the clinical trial setting, use of nurses and protocol with frequent contact and regular monitoring have resulted in marked differences in event rates compared to epidemiological data collected in the real-world setting. The phenotypic heterogeneity and cognitive-psychological-behavioral needs of people with diabetes call for regular risk stratification to personalize care. Quality improvement initiatives targeted at patient education, task delegation, case management, and self-care promotion had the largest effect size in improving cardio-metabolic risk factors. The Joint Asia Diabetes Evaluation (JADE) program is an innovative care prototype that advocates a change in clinic setting and workflow, coordinated by a doctor-nurse team and augmented by a web-based portal, which incorporates care protocols and a validated risk engine to provide decision support and regular feedback. By using logistics and information technology, supported by a network of health-care professionals to provide integrated, holistic, and evidence-based care, the JADE Program aims to establish a high-quality regional diabetes database to reflect the status of diabetes care in real-world practice, confirm efficacy data, and identify unmet needs. Through collaborative efforts, we shall evaluate the feasibility, acceptability, and cost-effectiveness of this "high tech, soft touch" model to make diabetes and chronic disease care more

  1. Special issue on Operational Modal Analysis

    DEFF Research Database (Denmark)

    Kirkegaard, Poul Henning; Brincker, Rune

    2010-01-01

    Operational Modal Analysis (OMA) is not really a new discipline; it has been present from the very beginning of the development of modal testing and analysis going back to the sixties and early seventies.......Operational Modal Analysis (OMA) is not really a new discipline; it has been present from the very beginning of the development of modal testing and analysis going back to the sixties and early seventies....

  2. Modal analysis of interior noise fields

    Science.gov (United States)

    Chao, C. F. B.

    1981-08-01

    A method and associated computer program were developed to compute the acoustic natural modes and natural frequencies of a cavity of arbitrary geometry. Simplified and efficient numerical techniques for solving the resulting algebraic equations are presented. The method has applicability to both two and three dimensional irregularly shaped cavities. Comparisons of present calculated results and other theoretical and experimental values show generally good agreement. The theoretical model was applied to predict the noise transmission through a single wall or a double wall/cavity system into a cavity. The reverberation process in a rectangular room for the low frequency range was also investigated. The room walls were covered with absorption material which is characterized by a normal incidence boundary condition or by Bliss' bulk reaction boundary condition. Results for modal reverberation time and overall reverberation time show considerable error may be introduced by treating a bulk-reacting liner as a point-reacting liner.

  3. Refinement Checking on Parametric Modal Transition Systems

    DEFF Research Database (Denmark)

    Benes, Nikola; Kretínsky, Jan; Larsen, Kim Guldstrand

    2015-01-01

    in the refinement process like exclusive, conditional and persistent choices. We introduce a new model called parametric modal transition systems (PMTS) together with a general modal refinement notion that overcomes many of the limitations. We investigate the computational complexity of modal and thorough...

  4. After Delivery

    Science.gov (United States)

    ... for Association Events Messaging Tools Recruiting Advocates Local Market Planning Training Webinars News & Events Advocacy News Call ... A Listen En Español After Delivery After your baby arrives, your body begins to recover from the ...

  5. Forceps Delivery

    Science.gov (United States)

    ... 2015. Related Signs of labor Forceps delivery About Advertisement Mayo Clinic does not endorse companies or products. ... a Job Site Map About This Site Twitter Facebook Google YouTube Pinterest Mayo Clinic is a not- ...

  6. The Feasibility of Embedding Data Collection into the Routine Service Delivery of a Multi-Component Program for High-Risk Young People

    Directory of Open Access Journals (Sweden)

    Alice Knight

    2017-02-01

    Full Text Available Background: There is little evidence about how to improve outcomes for high-risk young people, of whom Indigenous young people are disproportionately represented, due to few evaluation studies of interventions. One way to increase the evidence is to have researchers and service providers collaborate to embed evaluation into the routine delivery of services, so program delivery and evaluation occur simultaneously. This study aims to demonstrate the feasibility of integrating best-evidence measures into the routine data collection processes of a service for high-risk young people, and identify the number and nature of risk factors experienced by participants. Methods: The youth service is a rural based NGO comprised of multiple program components: (i engagement activities; (ii case management; (iii diversionary activities; (iv personal development; and (v learning and skills. A best-evidence assessment tool was developed by staff and researchers and embedded into the service’s existing intake procedure. Assessment items were organised into demographic characteristics and four domains of risk: education and employment; health and wellbeing; substance use; and crime. Descriptive data are presented and summary risk variables were created for each domain of risk. A count of these summary variables represented the number of co-occurring risks experienced by each participant. The feasibility of this process was determined by the proportion of participants who completed the intake assessment and provided research consent. Results: This study shows 85% of participants completed the assessment tool demonstrating that data on participant risk factors can feasibly be collected by embedding a best-evidence assessment tool into the routine data collection processes of a service. The most prevalent risk factors were school absence, unemployment, suicide ideation, mental distress, substance use, low levels of physical activity, low health service utilisation

  7. Modalization as Persuasion in the Discourse of MA Dissertation Introductions

    Directory of Open Access Journals (Sweden)

    Elaine Cristine Fernandes da Silva

    2011-07-01

    Full Text Available This article highlights some basic aspects of the Systemic Functional Grammar described by Halliday (1984 and 1994]and his followers; we intend to analyze the modalization in the construction of discursive strategies in MA dissertation introductions. The corpus is composed of 10 MA dissertation introductions with emphasis in the arguments for the research, which are reinforced by the constant occurrence of NECESSITY JUSTIFICATION and AIMS OF THE RESEARCH. We adopt the methodology called case study; therefore we analyze a specifi c discourse community and, for this, we used the software Wordsmith Tools (Scott, 1996, a device that allowed us to analyze in a detailed manner the lexical items from the texts. The analysis of our corpus showed that, at the Program in Applied Linguistics and Language Studies of PUC-SP, modalization is frequently used through modal verbs in the excerpts called NECESSITY JUSTIFICATION and AIMS OF THE RESEARCH.

  8. Vibration fatigue using modal decomposition

    Science.gov (United States)

    Mršnik, Matjaž; Slavič, Janko; Boltežar, Miha

    2018-01-01

    Vibration-fatigue analysis deals with the material fatigue of flexible structures operating close to natural frequencies. Based on the uniaxial stress response, calculated in the frequency domain, the high-cycle fatigue model using the S-N curve material data and the Palmgren-Miner hypothesis of damage accumulation is applied. The multiaxial criterion is used to obtain the equivalent uniaxial stress response followed by the spectral moment approach to the cycle-amplitude probability density estimation. The vibration-fatigue analysis relates the fatigue analysis in the frequency domain to the structural dynamics. However, once the stress response within a node is obtained, the physical model of the structure dictating that response is discarded and does not propagate through the fatigue-analysis procedure. The structural model can be used to evaluate how specific dynamic properties (e.g., damping, modal shapes) affect the damage intensity. A new approach based on modal decomposition is presented in this research that directly links the fatigue-damage intensity with the dynamic properties of the system. It thus offers a valuable insight into how different modes of vibration contribute to the total damage to the material. A numerical study was performed showing good agreement between results obtained using the newly presented approach with those obtained using the classical method, especially with regards to the distribution of damage intensity and critical point location. The presented approach also offers orders of magnitude faster calculation in comparison with the conventional procedure. Furthermore, it can be applied in a straightforward way to strain experimental modal analysis results, taking advantage of experimentally measured strains.

  9. The use of emerging informatics techniques to evaluate the delivery of NMAETC programs to address HIV and AIDS disparities.

    Science.gov (United States)

    Hsu, Chiehwen Ed; Watson, Keisha; Boekeloo, Bradley; Shang, Ning; Metzger, Christiana; Downer, Goulda

    2010-12-01

    Information technologies are employed to evaluate health program and better target recruitment of health care workforce for underserved communities, where needs for providers are greatest. With increased resources in reducing human immunodeficiency virus (HIV)/AIDS disparities and provider training, it may be important to know whether training is delivered in geographic areas where HIV/AIDS demonstrates high prevalence. The present study employs an informatics approach to identifying effectiveness of AIDS educational intervention in minority populations adversely affected by the disease. We seek to assess the National Minority AIDS Education and Training Center (NMAETC) on whether training activities are delivered appropriately in areas with high AIDS prevalence. A geographic information systems application was developed to relate NMAETC provider training activities to its spatial relationship of AIDS prevalence of 4 major US racial/ethnic groups (fiscal years 2005-2006). Trainees' locations were geocoded by zip code. We overlaid AIDS prevalence of major demographic communities by state with the US Census region and division boundaries to visually inspect the patterns of distribution and potential spatial association. NMAETC training better targeted providers in 3 US Census regions and census divisions. The regions with higher provider training level generally corresponded to geographic areas with high AIDS prevalence for some minority populations. Additional efforts could be extended to recruit providers in the areas where the incidences were high for some communities. Most NMAETC provider training activities occurred in the states with a high AIDS prevalence. Additional efforts could be extended to recruit the providers in those regions where HIV/AIDS are more prevalent for some minority populations.

  10. Theranostic agents for intracellular gene delivery with spatiotemporal imaging

    OpenAIRE

    Knipe, Jennifer M.; Peters, Jonathan T.; Peppas, Nicholas A.

    2013-01-01

    Gene therapy is the modification of gene expression to treat a disease. However, efficient intracellular delivery and monitoring of gene therapeutic agents is an ongoing challenge. Use of theranostic agents with suitable targeted, controlled delivery and imaging modalities has the potential to greatly advance gene therapy. Inorganic nanoparticles including magnetic nanoparticles, gold nanoparticles, and quantum dots have been shown to be effective theranostic agents for the delivery and spati...

  11. Computer-Assisted Traffic Engineering Using Assignment, Optimal Signal Setting, and Modal Split

    Science.gov (United States)

    1978-05-01

    Methods of traffic assignment, traffic signal setting, and modal split analysis are combined in a set of computer-assisted traffic engineering programs. The system optimization and user optimization traffic assignments are described. Travel time func...

  12. Patient- and delivery-level factors related to acceptance of HIV counseling and testing services among tuberculosis patients in South Africa: a qualitative study with community health workers and program managers.

    Science.gov (United States)

    Heunis, J Christo; Wouters, Edwin; Norton, Wynne E; Engelbrecht, Michelle C; Kigozi, N Gladys; Sharma, Anjali; Ragin, Camille

    2011-03-23

    South Africa has a high tuberculosis (TB)-human immunodeficiency virus (HIV) coinfection rate of 73%, yet only 46% of TB patients are tested for HIV. To date, relatively little work has focused on understanding why TB patients may not accept effective services or participate in programs that are readily available in healthcare delivery systems. The objective of the study was to explore barriers to and facilitators of participation in HIV counseling and testing (HCT) among TB patients in the Free State Province, from the perspective of community health workers and program managers who offer services to patients on a daily basis. These two provider groups are positioned to alter the delivery of HCT services in order to improve patient participation and, ultimately, health outcomes. Group discussions and semistructured interviews were conducted with 40 lay counselors, 57 directly observed therapy (DOT) supporters, and 13 TB and HIV/acquired immune deficiency syndrome (AIDS) program managers in the Free State Province between September 2007 and March 2008. Sessions were audio-recorded, transcribed, and thematically analyzed. The themes emerging from the focus group discussions and interviews included four main suggested barrier factors: (1) fears of HIV/AIDS, TB-HIV coinfection, death, and stigma; (2) perceived lack of confidentiality of HIV test results; (3) staff shortages and high workload; and (4) poor infrastructure to encourage, monitor, and deliver HCT. The four main facilitating factors emerging from the group and individual interviews were (1) encouragement and motivation by health workers, (2) alleviation of health worker shortages, (3) improved HCT training of professional and lay health workers, and (4) community outreach activities. Our findings provide insight into the relatively low acceptance rate of HCT services among TB patients from the perspective of two healthcare workforce groups that play an integral role in the delivery of effective health

  13. Load Estimation from Natural input Modal Analysis

    OpenAIRE

    Aenlle, Manuel López; Brincker, Rune; Canteli, Alfonso Fernández

    2005-01-01

    One application of Natural Input Modal Analysis consists in estimating the unknown load acting on structures such as wind loads, wave loads, traffic loads, etc. In this paper, a procedure to determine loading from a truncated modal model, as well as the results of an experimental testing programme, are presented. The method involves the inversion of the FRF matrix partly solving the numerical problems that appear because of the truncation of the modal space. However, the error in the load est...

  14. Modality Effects on Sentence Memory and Understanding

    OpenAIRE

    岡, 直樹; 田中, 裕佳

    2016-01-01

    In this study, poems were presented in one of three modalities: auditory, visual, or audiovisual. Modality differences in recall performance were observed only in a word memory test, revealing that visual and audiovisual presentation exhibited superiority over auditory presentation. The modality effect was not observed in the serial recall test, or the meaning understanding test. These results are discussed in terms of sentence memory and understanding.

  15. Modal Analysis with the Mobile Modal Testing Unit

    Science.gov (United States)

    Wilder, Andrew J.

    2013-01-01

    Recently, National Aeronautics and Space Administration's (NASA's) White Sands Test Facility (WSTF) has tested rocket engines with high pulse frequencies. This has resulted in the use of some of WSTF's existing thrust stands, which were designed for static loading, in tests with large dynamic forces. In order to ensure that the thrust stands can withstand the dynamic loading of high pulse frequency engines while still accurately reporting the test data, their vibrational modes must be characterized. If it is found that they have vibrational modes with frequencies near the pulsing frequency of the test, then they must be modified to withstand the dynamic forces from the pulsing rocket engines. To make this determination the Mobile Modal Testing Unit (MMTU), a system capable of determining the resonant frequencies and mode shapes of a structure, was used on the test stands at WSTF. Once the resonant frequency has been determined for a test stand, it can be compared to the pulse frequency of a test engine to determine whether or not that stand can avoid resonance and reliably test that engine. After analysis of test stand 406 at White Sands Test Facility, it was determined that natural frequencies for the structure are located around 75, 125, and 240 Hz, and thus should be avoided during testing.

  16. Modalities for an Allegorical Conceptual Data Model

    Directory of Open Access Journals (Sweden)

    Bartosz Zieliński

    2014-05-01

    Full Text Available Allegories are enriched categories generalizing a category of sets and binary relations. In this paper, we extend a new, recently-introduced conceptual data model based on allegories by adding support for modal operators and developing a modal interpretation of the model in any allegory satisfying certain additional (but natural axioms. The possibility of using different allegories allows us to transparently use alternative logical frameworks, such as fuzzy relations. Mathematically, our work demonstrates how to enrich with modal operators and to give a many world semantics to an abstract algebraic logic framework. We also give some examples of applications of the modal extension.

  17. The missing sense modality: the immune system.

    Science.gov (United States)

    Bedford, Felice L

    2011-01-01

    The five senses were handed down by Aristotle. I argue that it has only taken two millennia to recognize that the immune system has been the hidden sensory modality. The immune system completes the range of operation allowing detection of meaningful entities at all distances, from very near to very far. It also withstands the often implicit criteria for being a sense modality. Finally, cross-modal interactions between the immune system and vision and other sense modalities should be possible, opening up new research directions.

  18. Capacity for Cancer Care Delivery Research in National Cancer Institute Community Oncology Research Program Community Practices: Availability of Radiology and Primary Care Research Partners.

    Science.gov (United States)

    Carlos, Ruth C; Sicks, JoRean D; Chang, George J; Lyss, Alan P; Stewart, Teresa L; Sung, Lillian; Weaver, Kathryn E

    2017-12-01

    Cancer care spans the spectrum from screening and diagnosis through therapy and into survivorship. Delivering appropriate care requires patient transitions across multiple specialties, such as primary care, radiology, and oncology. From the program's inception, the National Cancer Institute Community Oncology Research Program (NCORP) sites were tasked with conducting cancer care delivery research (CCDR) that evaluates structural, organizational, and social factors, including care transitions that determine patient outcomes. The aim of this study is to describe the capacity of the NCORP to conduct multidisciplinary CCDR that includes radiology and primary care practices. The NCORP includes 34 community and 12 minority and underserved community sites. The Landscape Capacity Assessment was conducted in 2015 across these 46 sites, composed of the 401 components and subcomponents designated to conduct CCDR. Each respondent had the opportunity to designate an operational practice group, defined as a group of components and subcomponents with common care practices and resources. The primary outcomes were the proportion of adult oncology practice groups with affiliated radiology and primary care practices. The secondary outcomes were the proportion of those affiliated radiology and primary care groups that participate in research. Eighty-seven percent of components and subcomponents responded to at least some portion of the assessment, representing 230 practice groups. Analyzing the 201 adult oncology practice groups, 85% had affiliated radiologists, 69% of whom participate in research. Seventy-nine percent had affiliated primary care practitioners, 31% of whom participate in research. Institutional size, multidisciplinary group practice, and ownership by large regional or multistate health systems was associated with research participation by affiliated radiology and primary care groups. Research participation by these affiliated specialists was not significantly

  19. Stage 1 of the meaningful use incentive program for electronic health records: a study of readiness for change in ambulatory practice settings in one integrated delivery system

    National Research Council Canada - National Science Library

    Shea, Christopher M; Reiter, Kristin L; Weaver, Mark A; McIntyre, Molly; Mose, Jason; Thornhill, Jonathan; Malone, Robb; Weiner, Bryan J

    2014-01-01

    Meaningful Use (MU) provides financial incentives for electronic health record (EHR) implementation. EHR implementation holds promise for improving healthcare delivery, but also requires substantial changes for providers and staff...

  20. Language: perspectives from another modality.

    Science.gov (United States)

    Bellugi, U; Klima, E S

    1979-01-01

    Human languages have been forged in auditory-vocal channels throughout evolution. This paper examines the formal properties of a communication system that has developed in the absence of speech: the sign language of the deaf. The objective is to investigate to what extent the overall form and organization of language is determined by the articulatory and perceptual modality in which it has developed (its transmission system) and to what extent its form and organization represent more fundamental aspects of the human mind (intellect). Experimental and linguistic evidence is brought to bear on the analysis of the sign: studies of coding and processing of signs in memory; of slips of the hand; of historical change in signs over time; the heightened use of language in poetry and wit. American Sign Language differs dramatically from English and other spoken languages in the mechanisms by which its lexical units are modified. For the form of its morphological processes, the mode in which the language develops appears to make a crucial difference. Finally, the issue of cerebral specialization with respect to a visual-manual language is addressed.

  1. Three-valued logics in modal logic

    NARCIS (Netherlands)

    Kooi, Barteld; Tamminga, Allard

    2013-01-01

    Every truth-functional three-valued propositional logic can be conservatively translated into the modal logic S5. We prove this claim constructively in two steps. First, we define a Translation Manual that converts any propositional formula of any three-valued logic into a modal formula. Second, we

  2. Modal Characterization of a Piezoelectric Shaker Table

    Science.gov (United States)

    2015-06-01

    MODAL CHARACTERIZATION OF A PIEZOELECTRIC SHAKER TABLE THESIS MARCH 2015 Randall J. Hodkin Jr...15-J-001 MODAL CHARACTERIZATION OF A PIEZOELECTRIC SHAKER TABLE THESIS Presented to the Faculty Department of Aeronautics and... PIEZOELECTRIC SHAKER TABLE Randall J. Hodkin Jr., BS Captain, USAF Committee Membership: Dr. A. N. Palazotto Chair Dr. M. B. Ruggles-Wrenn

  3. MRI Modality transformation in demon registration

    NARCIS (Netherlands)

    Kroon, Dirk-Jan; Slump, Cornelis H.

    2009-01-01

    Nonrigid local image registration plays an important role in medical imaging. In this paper we focus on demon registration which is introduced by Thirion [1], and is comparable to fluid registration. Because demon registration cannot deal with multiple MRI modalities, we introduce a MRI modality

  4. Modal Transition Systems with Weight Intervals

    DEFF Research Database (Denmark)

    Juhl, Line; Larsen, Kim Guldstrand; Srba, Jiri

    2012-01-01

    We propose weighted modal transition systems, an extension to the well-studied specification formalism of modal transition systems that allows to express both required and optional behaviours of their intended implementations. In our extension we decorate each transition with a weight interval th...

  5. History of Civil Engineering Modal Analysis

    DEFF Research Database (Denmark)

    Brincker, Rune

    2008-01-01

    techniques are available for civil engineering modal analysis. The testing of civil structures defers from the traditional modal testing in the sense, that very often it is difficult, or sometimes impossible, to artificially excite a large civil engineering structure. Also, many times, even though...

  6. Fixed Base Modal Survey of the MPCV Orion European Service Module Structural Test Article

    Science.gov (United States)

    Winkel, James P.; Akers, J. C.; Suarez, Vicente J.; Staab, Lucas D.; Napolitano, Kevin L.

    2017-01-01

    Recently, the MPCV Orion European Service Module Structural Test Article (E-STA) underwent sine vibration testing using the multi-axis shaker system at NASA GRC Plum Brook Station Mechanical Vibration Facility (MVF). An innovative approach using measured constraint shapes at the interface of E-STA to the MVF allowed high-quality fixed base modal parameters of the E-STA to be extracted, which have been used to update the E-STA finite element model (FEM), without the need for a traditional fixed base modal survey. This innovative approach provided considerable program cost and test schedule savings. This paper documents this modal survey, which includes the modal pretest analysis sensor selection, the fixed base methodology using measured constraint shapes as virtual references and measured frequency response functions, and post-survey comparison between measured and analysis fixed base modal parameters.

  7. Boilerplate Test Article (BTA) Modal Test Correlation

    Science.gov (United States)

    Vassilakos, Gregory J.; Corliss, James M.; Mark, Stephen D.

    2017-01-01

    Modal testing of the Boilerplate Test Article (BTA) was performed to obtain data to determine the accuracy of the BTA LS- DYNA model in determining the structural response. The BTA is a full-scale steel and aluminum test article that is representative of the Orion Crew Module (CM), with similar outer-mold-line geometry, mass properties, and some similar structural features, including an internal pressure vessel connected to a backshell and heatshield via longerons, Retention and Release (R&R) brackets, and an aft ring. The structural design of the Orion CM is being developed based on LS-DYNA water landing simulations. To obtain data to evaluate the accuracy of LS-DYNA water impact landing simulations, a series of BTA water impacts was conducted at NASA Langley Research Center (LaRC). Discrepancies between test and simulation data are attributed to three causes:(1) Test data variability and uncertainty, (2) LS-DYNA water model and fluid-structure coupling approximations; and (3) LS-DYNA structural modeling approximations. Two activities have been undertaken to assess the accuracy of the BTA LS-DYNA structural model separately from the fluid-structure coupling portion of the water landing simulations: 1) modal testing, and 2) static load testing. The results from the static load tests are documented in a separate report. For the modal test series, the following tests were performed: (1) BTA Fully-Assembled Model Test, (2) BTA Backshell Removed Modal Test, (3) Standalone Heatshield Modal Test, (4) Standalone Windward Backshell Panel Modal Test; and (5) Standalone Leeward Backshell Panel Modal Test. This report documents findings from correlation of modal test data with LS-DYNA modal analysis results. The following figures illustrate the correlation of the modal frequencies. Where multiple closely spaced modes have been identified, the points representing the upper and lower frequencies are shown connected by a dotted line.

  8. A multifunctional poly(curcumin) nanomedicine for dual-modal targeted delivery, intracellular responsive release, dual-drug treatment and imaging of multidrug resistant cancer cells? ?Electronic supplementary information (ESI) available: The synthesis procedure of Biotin?PEG?PCDA and the experimental results of MTT. See DOI: 10.1039/c5tb02450a Click here for additional data file.

    OpenAIRE

    Wang, Jining; Wang, Feihu; Li, Fangzhou; Zhang, Wenjun; Shen, Yuanyuan; Zhou, Dejian; Guo, Shengrong

    2016-01-01

    A multifunctional anti-cancer nanomedicine based on a biotin?poly(ethylene glycol)?poly(curcumin-dithio dipropionic acid) (Biotin?PEG?PCDA) polymeric nanocarrier loaded with paclitaxel (PTX), magnetic nanoparticles (MNPs) and quantum dots (QDs) is developed. It combines advantageous properties of efficient targeted delivery and uptake (via biotin and MNP), intracellular responsive release (via cleavable PCDA polymer), fluorescence imaging (via QD) and combined PTX-curcumin dual-drug treatment...

  9. The influence of a constraint and bimanual training program using a variety of modalities on endurance and on the cardiac autonomic regulation system of children with unilateral cerebral palsy: A self-control clinical trial.

    Science.gov (United States)

    Cohen-Holzer, Marilyn; Sorek, Gilad; Schweizer, Maayan; Katz-Leurer, Michal

    2017-01-01

    An intensive hybrid program, combining constraint with bimanual training, improves upper extremity function as well as walking endurance of children with unilateral cerebral palsy (UCP). Endurance improvement may be associated with the cardiac autonomic regulation system (CARS) adaptation, known to be impaired among these children. To examine the influence of an intensive hybrid program on CARS, walking endurance and the correlation with upper extremity function of children with UCP. Twenty-four children aged 6-10 years with UCP participated in a hybrid program, 10 days, 6 hours per day. Data were collected pre-, post- and 3-months post-intervention. Main outcome measures included the Polar RS800CX for heart rate (HR) and heart rate variability (HRV) data, the 6-Minute Walk Test (6MWT) for endurance, and the Assisting Hand Assessment (AHA) and Jebsen-Taylor Test of Hand Function (JTTHF) for bimanual and unimanual function. A significant reduction in HR and an increase in HRV at post- and 3-month post-intervention was noted (χ22= 8.3, p = 0.016) along with a significant increase in 6MWT with a median increase of 81 meters (χ22= 11.0, p = 0.004) at the same interval. A significant improvement was noted in unimanual and bimanual performance following the intervention. An intensive hybrid program effectively improved CARS function as well as walking endurance and upper extremity function in children with UCP (213).

  10. The physiology of judo-specific training modalities.

    Science.gov (United States)

    Franchini, Emerson; Brito, Ciro José; Fukuda, David H; Artioli, Guilherme G

    2014-05-01

    Understanding the physiological response to the most common judo training modalities may help to improve the prescription and monitoring of training programs. This review is based on search results using the following terms: "judo," "judo and training," "judo and physiology," "judo and specific exercises," and "judo and combat practice." Uchi-komi (repetitive technical training) is a specific judo exercise that can be used to improve aerobic and anaerobic fitness. Effort to pause ratio, total session duration, number and duration of individual sets, and the type of technique can be manipulated to emphasize specific components of metabolism. "Nage-komi" (repetitive throwing training) can also be used to improve aerobic and anaerobic fitness, depending on the format of the training session. "Randori" (combat or fight practice; sparring) is the training modality most closely related to actual judo matches. Despite the similarities, the physiological demands of randori practice are not as high as observed during real competitive matches. Heart rate has not shown to be an accurate measure of training intensity during any of the previously mentioned judo training modalities. High-volume, high-intensity training programs often lead judo athletes to experience overtraining-related symptoms, with immunosuppression being one of the most common. In conclusion, judo training and judo-specific exercise should be manipulated to maximize training response and competitive performance.

  11. Enhancing Tumor Drug Delivery by Laser-Activated Vascular Barrier Disruption

    National Research Council Canada - National Science Library

    Chen, Bin; He, Chong

    2006-01-01

    .... We found that vascular targeting photodynamic therapy (PDT), a modality involving the combination of a photosensitizer and laser light, is able to disrupt tumor vascular barrier, a significant hindrance to drug delivery...

  12. Enhancing Tumor Drug Delivery by Laser-Activated Vascular Barrier Disruption

    National Research Council Canada - National Science Library

    Chen, Bin; He, Chong

    2007-01-01

    .... We found that vascular targeting photodynamic therapy (PDT), a modality involving the combination of a photosensitizer and laser light, is able to disrupt tumor vascular barrier, a significant hindrance to drug delivery...

  13. Eccentric exercise training: modalities, applications and perspectives.

    Science.gov (United States)

    Isner-Horobeti, Marie-Eve; Dufour, Stéphane Pascal; Vautravers, Philippe; Geny, Bernard; Coudeyre, Emmanuel; Richard, Ruddy

    2013-06-01

    greater cardiovascular stress is observed during ECC muscle work. This observation underlines the need of cautious interpretation of the heart rate values for training load management because the same training heart rate actually elicits a lower VO2 in ECC muscle work than in concentric muscle work. The last part of this article reviews the documented applications of ECC exercise training and, when possible, presents information on single-joint movement training and cycling or running training programs, respectively. The available knowledge is then summarized according to the specific training objectives including performance improvement for healthy subjects and athletes, and prevention of and/or rehabilitation after injury. The final part of the article also details the current knowledge on the effects of ECC exercise training in elderly populations and in patients with chronic cardiac, respiratory, metabolic or neurological disease, as well as cancer. In conclusion, ECC exercise is a promising training modality with many different domains of application. However, more research work is needed to better understand how the neuromuscular system adapts to ECC exercise training in order to optimize and better individualize future ECC training strategies.

  14. NIF Periscope Wall Modal Study Comparison of Results for 2 FEA Models with 2 Modal Tests

    Energy Technology Data Exchange (ETDEWEB)

    Eli, M W; Gerhard, M A; Lee, C L; Sommer, S C; Woehrle, T G

    2000-10-26

    This report summarizes experimentally and numerically determined modal properties for one of the reinforced concrete end walls of the NIF Periscope Support Structure in Laser Bay 1. Two methods were used to determine these modal properties: (1) Computational finite-element analyses (modal extraction process); and (2) Experimental modal analysis based on measured test data. This report also includes experimentally determined modal properties for a prototype LM3/Polarizer line-replaceable unit (LRU) and a prototype PEPC LRU. Two important parameters, used during the design phase, are validated through testing [ref 1]. These parameters are the natural frequencies and modal damping (of the system in question) for the first several global modes of vibration. Experimental modal testing provides these modal values, along with the corresponding mode shapes. Another important parameter, the input excitation (expected during normal operation of the NIF laser system) [ref 1], can be verified by performing a series of ambient vibration measurements in the vicinity of the particular system (or subsystem) of interest. The topic of ambient input excitation will be covered in a separate report. Due to the large mass of the Periscope Pedestal, it is difficult to excite the entire series of Periscope Pedestal Walls all at once. It was decided that the experimental modal tests would be performed on just one Periscope End Wall in Laser Bay 1. Experimental modal properties for the Periscope End Wall have been used to validate and update the FE analyses. Results from the analyses and modal tests support the conclusion that the Periscope Pedestal will not exceed the stability budget, which is described in reference 1. The results of the modal tests for the Periscope End Wall in Laser Bay 1 have provided examples of modal properties that can be derived from future modal tests of the entire Periscope Assembly (excluding the LRU's). This next series of larger modal tests can be

  15. Conceptual structure within and between modalities

    Directory of Open Access Journals (Sweden)

    Katia eDilkina

    2013-01-01

    Full Text Available Current views of semantic memory share the assumption that conceptual representations are based on multi-modal experience, which activates distinct modality-specific brain regions. This proposition is widely accepted, yet little is known about how each modality contributes to conceptual knowledge and how the structure of this contribution varies across these multiple information sources. We used verbal feature lists, features from drawings and verbal co-occurrence statistics from latent semantic analysis to examine the informational structure in four domains of knowledge: perceptual, functional, encyclopedic and verbal. The goals of the analysis were three-fold: (1 to assess the structure within individual modalities; (2 to compare structures between modalities; and (3 to assess the degree to which concepts organize categorically or randomly.Our results indicated significant and unique structure in all four modalities: perceptually, concepts organize based on prominent features such as shape, size, color and parts; functionally, they group based on use and interaction; encyclopedically, they arrange based on commonality in location or behavior; and verbally, they group associatively or relationally. Visual/perceptual knowledge gives rise to the strongest hierarchical organization and is closest to classic taxonomic structure. Information is organized somewhat similarly in the perceptual and encyclopedic domains, which differs significantly from the structure in the functional and verbal domains. Notably, the verbal modality has the most unique organization, which is not at all categorical but also not random. The idiosyncrasy and complexity of conceptual structure across modalities begs the question of how all of these modality-specific experiences are fused together into coherent, multi-faceted yet unified concepts. Accordingly, both methodological and theoretical implications of the present findings are discussed.

  16. Effect of a package of integrated demand- and supply-side interventions on facility delivery rates in rural Bangladesh: Implications for large-scale programs.

    Directory of Open Access Journals (Sweden)

    Sayedur Rahman

    Full Text Available According to the Bangladesh Demographic and Health Survey 2014, only approximately 37 percent of women deliver in a health facility. Among the eight administrative divisions of Bangladesh, the facility delivery rate is lowest in the Sylhet division (22.6 percent where we assessed the effect of integrated supply- and demand-side interventions on the facility-based delivery rate.Population-based cohort data of pregnant women from an ongoing maternal and newborn health improvement study being conducted in a population of ~120,000 in Sylhet district were used. The study required collection and processing of biological samples immediately after delivery. Therefore, the project assembled various strategies to increase institutional delivery rates. The supply-side intervention included capacity expansion of the health facilities through service provider refresher training, 24/7 service coverage, additions of drugs and supplies, and incentives to the providers. The demand-side component involved financial incentives to cover expenses, a provision of emergency transport, and referral support to a tertiary-level hospital. We conducted a before-and-after observational study to assess the impact of the intervention in a total of 1,861 deliveries between December 2014 and November 2016.Overall, implementation of the intervention package was associated with 52.6 percentage point increase in the proportions of facility-based deliveries from a baseline rate of 25.0 percent to 77.6 percent in 24 months. We observed lower rates of institutional deliveries when only supply-side interventions were implemented. The proportion rose to 47.1 percent and continued increasing when the project emphasized addressing the financial barriers to accessing obstetric care in a health facility.An integrated supply- and demand-side intervention was associated with a substantial increase in institutional delivery. The package can be tailored to identify which combination of

  17. Effect of a package of integrated demand- and supply-side interventions on facility delivery rates in rural Bangladesh: Implications for large-scale programs.

    Science.gov (United States)

    Rahman, Sayedur; Choudhury, Aziz Ahmed; Khanam, Rasheda; Moin, Syed Mamun Ibne; Ahmed, Salahuddin; Begum, Nazma; Shoma, Nurun Naher; Quaiyum, Md Abdul; Baqui, Abdullah H

    2017-01-01

    According to the Bangladesh Demographic and Health Survey 2014, only approximately 37 percent of women deliver in a health facility. Among the eight administrative divisions of Bangladesh, the facility delivery rate is lowest in the Sylhet division (22.6 percent) where we assessed the effect of integrated supply- and demand-side interventions on the facility-based delivery rate. Population-based cohort data of pregnant women from an ongoing maternal and newborn health improvement study being conducted in a population of ~120,000 in Sylhet district were used. The study required collection and processing of biological samples immediately after delivery. Therefore, the project assembled various strategies to increase institutional delivery rates. The supply-side intervention included capacity expansion of the health facilities through service provider refresher training, 24/7 service coverage, additions of drugs and supplies, and incentives to the providers. The demand-side component involved financial incentives to cover expenses, a provision of emergency transport, and referral support to a tertiary-level hospital. We conducted a before-and-after observational study to assess the impact of the intervention in a total of 1,861 deliveries between December 2014 and November 2016. Overall, implementation of the intervention package was associated with 52.6 percentage point increase in the proportions of facility-based deliveries from a baseline rate of 25.0 percent to 77.6 percent in 24 months. We observed lower rates of institutional deliveries when only supply-side interventions were implemented. The proportion rose to 47.1 percent and continued increasing when the project emphasized addressing the financial barriers to accessing obstetric care in a health facility. An integrated supply- and demand-side intervention was associated with a substantial increase in institutional delivery. The package can be tailored to identify which combination of interventions may

  18. Extending Modal Transition Systems with Structured Labels

    DEFF Research Database (Denmark)

    Bauer, Sebastian S.; Juhl, Line; Larsen, Kim Guldstrand

    2012-01-01

    We introduce a novel formalism of label-structured modal transition systems that combines the classical may/must modalities on transitions with structured labels that represent quantitative aspects of the model. On the one hand, the specification formalism is general enough to include models like...... weighted modal transition systems and allows the system developers to employ more complex label refinement than in the previously studied theories. On the other hand, the formalism maintains the desirable properties required by any specification theory supporting compositional reasoning. In particular, we...

  19. Focused Ultrasound: An Emerging Therapeutic Modality for Neurologic Disease.

    Science.gov (United States)

    Fishman, Paul S; Frenkel, Victor

    2017-04-01

    Therapeutic ultrasound is only beginning to be applied to neurologic conditions, but the potential of this modality for a wide spectrum of brain applications is high. Engineering advances now allow sound waves to be targeted through the skull to a brain region selected with real time magnetic resonance imaging and thermography, using a commercial array of focused emitters. High intensities of sonic energy can create a coagulation lesion similar to that of older radiofrequency stereotactic methods, but without opening the skull. This has led to the recent Food and Drug Administration approval of focused ultrasound (FUS) thalamotomy for unilateral treatment of essential tremor. Clinical studies of stereotactic FUS for aspects of Parkinson's disease, chronic pain, and refractory psychiatric indications are underway, with promising results. Moderate-intensity FUS has the potential to safely open the blood-brain barrier for localized delivery of therapeutics, while low levels of sonic energy can be used as a form of neuromodulation.

  20. Cross-modal versus within-modal recall: differences in behavioral and brain responses.

    Science.gov (United States)

    Butler, Andrew J; James, Karin H

    2011-10-31

    Although human experience is multisensory in nature, previous research has focused predominantly on memory for unisensory as opposed to multisensory information. In this work, we sought to investigate behavioral and neural differences between the cued recall of cross-modal audiovisual associations versus within-modal visual or auditory associations. Participants were presented with cue-target associations comprised of pairs of nonsense objects, pairs of nonsense sounds, objects paired with sounds, and sounds paired with objects. Subsequently, they were required to recall the modality of the target given the cue while behavioral accuracy, reaction time, and blood oxygenation level dependent (BOLD) activation were measured. Successful within-modal recall was associated with modality-specific reactivation in primary perceptual regions, and was more accurate than cross-modal retrieval. When auditory targets were correctly or incorrectly recalled using a cross-modal visual cue, there was re-activation in auditory association cortex, and recall of information from cross-modal associations activated the hippocampus to a greater degree than within-modal associations. Findings support theories that propose an overlap between regions active during perception and memory, and show that behavioral and neural differences exist between within- and cross-modal associations. Overall the current study highlights the importance of the role of multisensory information in memory. Copyright © 2011 Elsevier B.V. All rights reserved.

  1. Modal Specifications for Probabilistic Timed Systems

    Directory of Open Access Journals (Sweden)

    Tingting Han

    2013-06-01

    Full Text Available Modal automata are a classic formal model for component-based systems that comes equipped with a rich specification theory supporting abstraction, refinement and compositional reasoning. In recent years, quantitative variants of modal automata were introduced for specifying and reasoning about component-based designs for embedded and mobile systems. These respectively generalize modal specification theories for timed and probabilistic systems. In this paper, we define a modal specification language for combined probabilistic timed systems, called abstract probabilistic timed automata, which generalizes existing formalisms. We introduce appropriate syntactic and semantic refinement notions and discuss consistency of our specification language, also with respect to time-divergence. We identify a subclass of our models for which we define the fundamental operations for abstraction, conjunction and parallel composition, and show several compositionality results.

  2. Modal analysis of isotropic beams in peridynamics

    Science.gov (United States)

    Freimanis, A.; Paeglītis, A.

    2017-10-01

    Modal analysis in continuum mechanics is widely used in damage detection, quality control and to validate numerical simulations. Peridynamics is a reformulation of continuum mechanics that allow discontinuities, such as cracks and voids, to arise and propagate without any special techniques, however, modal analysis in peridynamics has not been explored in detail. In this study we simulate the modal response of an aluminium plate with clamped-free boundary conditions in peridynamics, and compare results to a FE simulation and an experimental modal test. The natural frequencies from peridynamics agree better with the experimental results than frequencies from finite-elements for all modes except mode 1. Differences between peridynamic and experimental results ranged (in magnitude) from 0.13% to 10.38%, and between peridynamic and finite-element results from 0.23% to 9.72%. All mode shapes calculated in peridynamics corresponded to those from finite-elements and experimental measurements.

  3. Representation learning for cross-modality classification

    NARCIS (Netherlands)

    G. van Tulder (Gijs); M. de Bruijne (Marleen)

    2017-01-01

    textabstractDifferences in scanning parameters or modalities can complicate image analysis based on supervised classification. This paper presents two representation learning approaches, based on autoencoders, that address this problem by learning representations that are similar across domains.

  4. Disentangling Linguistic Modality Effects in Semantic Processing.

    Science.gov (United States)

    Moita, Mara; Nunes, Maria Vânia

    2017-04-01

    Sensory systems are essential for perceiving and conceptualizing our semantic knowledge about the world and the way we interact with it. Despite studies reporting neural changes to compensate for the absence of a given sensory modality, studies focusing on the assessment of semantic processing reveal poor performances by deaf individuals when compared with hearing individuals. However, the majority of those studies were not performed in the linguistic modality considered the most adequate to their sensory capabilities (i.e., sign language). Therefore, this exploratory study was developed focusing on linguistic modality effects during semantic retrieval in deaf individuals in comparison with their hearing peers through a category fluency task. Results show a difference in performance between the two linguistic modalities by deaf individuals as well as in the type of linguistic clusters most chosen by participants, suggesting a complex clustering tendency by deaf individuals.

  5. Operational modal identification using variational Bayes

    Science.gov (United States)

    Li, Binbin; Der Kiureghian, Armen

    2017-05-01

    Operational modal analysis is the primary tool for modal parameter identification in civil engineering. Bayesian statistics offers an ideal framework for analyzing uncertainties associated with the identified modal parameters. However, the exact Bayesian formulation is usually intractable due to the high computational demand in obtaining the posterior distributions of modal parameters. In this paper, the variational Bayes method is employed to provide an approximate solution. Unlike the Laplace approximation and Monte Carlo sampling, the variational Bayes approach provides a gradient-free algorithm to analytically approximate the posterior distributions. Working with the state-space representation of a dynamical system, the variational Bayes approach for identification of modal parameters is derived by ignoring statistical correlation between latent variables and the model parameters. In this approach, the joint distribution of the state-transition and observation matrices as well as the joint distribution of the process noise and measurement error are firstly calculated analytically using conjugate priors. The distribution of modal parameters is extracted from these obtained joint distributions using a first-order Taylor series expansion. A robust implementation of the method is discussed by using square-root filtering and Cholesky decomposition. The proposed approach is illustrated by its application to an example mass-spring system and the One Rincon Hill Tower in San Francisco.

  6. The Function of Modality in Translation

    Directory of Open Access Journals (Sweden)

    Mohamed Abdou Moindjie

    2015-04-01

    Full Text Available Modality deals with the assessment of the intrinsic and extrinsic meanings of a statement in terms of control over a situation and judgement of truth value. This paper focuses on the functionality and translatability of expressing modality from Arabic into English and French to determine its effects in translation. The analyses are carried out on literary translations from Arabic into English and French. The data reflective to the occurrence of expressing modality are identified, collected, categorized and analyzed. The analysis reveals that there are more modality use in the English translations than in the Arabic source texts and French target texts, which reflects some aspects of Arabic language and French language peculiarities on the one hand and some aspects of English language peculiarities on the other hand. Moreover, the frequent use of modality in English is found to be more functional in that it enhances more the meaning. Keywords: Modality translatability, language peculiarity, probability, obligatoriness, willingness, usuality, Arabic English translation, Arabic French translation

  7. Training Modalities to Increase Sensorimotor Adaptability

    Science.gov (United States)

    Bloomberg, J. J.; Mulavara, A. P.; Peters, B. T.; Brady, R.; Audas, C.; Cohen, H. S.

    2009-01-01

    During the acute phase of adaptation to novel gravitational environments, sensorimotor disturbances have the potential to disrupt the ability of astronauts to perform required mission tasks. The goal of our current series of studies is develop a sensorimotor adaptability (SA) training program designed to facilitate recovery of functional capabilities when astronauts transition to different gravitational environments. The project has conducted a series of studies investigating the efficacy of treadmill training combined with a variety of sensory challenges (incongruent visual input, support surface instability) designed to increase adaptability. SA training using a treadmill combined with exposure to altered visual input was effective in producing increased adaptability in a more complex over-ground ambulatory task on an obstacle course. This confirms that for a complex task like walking, treadmill training contains enough of the critical features of overground walking to be an effective training modality. SA training can be optimized by using a periodized training schedule. Test sessions that each contain short-duration exposures to multiple perturbation stimuli allows subjects to acquire a greater ability to rapidly reorganize appropriate response strategies when encountering a novel sensory environment. Using a treadmill mounted on top of a six degree-of-freedom motion base platform we investigated locomotor training responses produced by subjects introduced to a dynamic walking surface combined with alterations in visual flow. Subjects who received this training had improved locomotor performance and faster reaction times when exposed to the novel sensory stimuli compared to control subjects. Results also demonstrate that individual sensory biases (i.e. increased visual dependency) can predict adaptive responses to novel sensory environments suggesting that individual training prescription can be developed to enhance adaptability. These data indicate that SA

  8. Perfect and Imperfect Modals in Romance Some syntactic remarks on the Tense/Modality interaction

    Directory of Open Access Journals (Sweden)

    Elena Soare

    2008-01-01

    Full Text Available This paper addresses the interplay between Tense-Aspect and Modality in Romanian and some Romance languages, in ambiguous sentences that exhibit what has been called “perfective raising”. It is observed that Romanian does not behave like French, for instance, inasmuch perfective forces actuality entailment on modals. I show that this contrast is connected to the structure of Romanian modal sentences: as commonly assumed in the literature, modal verbs in Romanian behave like lexical verbs with clausal complements; they have their own temporal-aspectual domain, which has to obey interpretive constraints. I propose that the ambiguity between root and epistemic readings in the perfective is the effect of two combined factors: perfective/imperfective Aspect and a high degree of grammaticalization of the modal (i.e. monoclausal structures for modals.

  9. Advanced drug delivery and targeting technologies for the ocular diseases

    OpenAIRE

    Barar, Jaleh; Aghanejad, Ayuob; Fathi, Marziyeh; Omidi, Yadollah

    2016-01-01

    Introduction: Ocular targeted therapy has enormously been advanced by implementation of new methods of drug delivery and targeting using implantable drug delivery systems (DDSs) or devices (DDDs), stimuli-responsive advanced biomaterials, multimodal nanomedicines, cell therapy modalities and medical bioMEMs. These technologies tackle several ocular diseases such as inflammation-based diseases (e.g., scleritis, keratitis, uveitis, iritis, conjunctivitis, chorioretinitis, choroiditis, retinitis...

  10. Bi-objective optimization for multi-modal transportation routing planning problem based on Pareto optimality

    Directory of Open Access Journals (Sweden)

    Yan Sun

    2015-09-01

    Full Text Available Purpose: The purpose of study is to solve the multi-modal transportation routing planning problem that aims to select an optimal route to move a consignment of goods from its origin to its destination through the multi-modal transportation network. And the optimization is from two viewpoints including cost and time. Design/methodology/approach: In this study, a bi-objective mixed integer linear programming model is proposed to optimize the multi-modal transportation routing planning problem. Minimizing the total transportation cost and the total transportation time are set as the optimization objectives of the model. In order to balance the benefit between the two objectives, Pareto optimality is utilized to solve the model by gaining its Pareto frontier. The Pareto frontier of the model can provide the multi-modal transportation operator (MTO and customers with better decision support and it is gained by the normalized normal constraint method. Then, an experimental case study is designed to verify the feasibility of the model and Pareto optimality by using the mathematical programming software Lingo. Finally, the sensitivity analysis of the demand and supply in the multi-modal transportation organization is performed based on the designed case. Findings: The calculation results indicate that the proposed model and Pareto optimality have good performance in dealing with the bi-objective optimization. The sensitivity analysis also shows the influence of the variation of the demand and supply on the multi-modal transportation organization clearly. Therefore, this method can be further promoted to the practice. Originality/value: A bi-objective mixed integer linear programming model is proposed to optimize the multi-modal transportation routing planning problem. The Pareto frontier based sensitivity analysis of the demand and supply in the multi-modal transportation organization is performed based on the designed case.

  11. Modal Parameters from a Wind Turbine Wing by Operational Modal Analysis

    DEFF Research Database (Denmark)

    Herlufsen, H.; Møller, N.; Brincker, Rune

    2002-01-01

    Operational Modal Analysis also known as Ambient Modal Analysis has an increasing interest in mechanical engineering. Especially on big structures where the excitation and not less important the determination of the forces is most often a problem. In a structure like a wind turbine wing where...... the modes occur both close in frequency and bidirectional the Ambient excitation has big advantages. In this paper modal parameters are identified from the wing by operational modal analysis. For the parameter identification both parametric and non-parametric techniques are used. Advantages...

  12. Metaphysical Modality, Modality of Predicate and the Theory of "Decisive Necessity”

    Directory of Open Access Journals (Sweden)

    L. Nabavi

    2010-01-01

    Full Text Available Aristotle in the Organon (1949: 9,30 a ,15-19 explicitly states that in a categorical syllogism when the minor premise is absolute (without modality operator and the major is necessary, the conclusion will be necessary too. This Aristotle's view has been the source of many conflicts and disputes in the history of logic. The famous logicians and historians of logic in the twentieth century as "Nicholas Rescher" and "Becker" believe that Aristotle's view is justifiable and defensible (at least compared to the first figure only if, the modality of major premise is considered as the property of predicate (modality de re. Today, we know very well that the modality of predicate is closely linked to Metaphysical and philosophical Modality. “Shihab al-Din al- Suhrawardi” in the theory of "Decisive (Battateh Necessity” by accepting this base, explicitly states that, in the beginning, the modality must be mentioned as a part of the predicate and then the modality of relation or copula is summarized and reduced to necessity. The modern formalization of the most important part of this theory is as follows: ("x (àAx É à Bx º ("x □ (àAx É à BxThis paper discusses the historical overview of the metaphysical modality firstly and then shows that the theory of "Decisive Necessity” is true and justified in a model of modal logic with equivalent accessibility relation and homogeneous possible world view (fixed domain.

  13. Detailed modal testing of a solid rocket motor using a portable test system

    Science.gov (United States)

    Glozman, Vladimir; Brillhart, Ralph D.

    1990-01-01

    Modern analytical techniques have expended the ability to evaluate solid rocket motors used in launch vehicles. As more detailed models of solid rocket motors were developed, testing methods were required to verify the models. Experimental modal analysis (modal testing) of space structures and launch vehicles has been a requirement for model validation for many years. However, previous testing of solid rocket motors has not typically involved dynamic modal testing of full scale motors for verification of solid propellant or system assembly properties. Innovative approaches to the testing of solid rocket motors were developed and modal testing of a full scale, two segment Titan 34D Solid Rocket Motor (SRM) was performed to validate detailed computer modeling. Special modifications were made to convert an existing facility into a temporary modal test facility which would accommodate the test article. The assembly of conventional data acquisition equipment into a multiple channel count portable system has made modal testing in the field feasible. Special purpose hydraulic exciters were configured to apply the dynamic driving forces required. All instrumentation and data collection equipment were installed at the test site for the duration of the test program and removed upon completion. Conversion of an existing test facility into a temporary modal test facility, and use of a multiple channel count portable test data acquisition system allowed all test objectives to be met and resulted in validation of the computer model in a minimum time.

  14. MODALITIES OF TRAINING PARAMETER ALTERNATION IN NOWADAYS STRENGTH TRAINING PRACTICE

    Directory of Open Access Journals (Sweden)

    RANISAVLJEV IGOR

    2010-12-01

    Full Text Available Large number of variables could be alternated during the process of planning and programming in sports training. Superior training results in majority of sports are achieved by optimally manipulating training parameters in appropriate sequences and combinations. Additionally, in some sports they might be the result of appropriate periodization pattern. Today's tendency in strength training practice is training movements instead of training muscles. Exercise classification according to the dominant movement types, allows creating new modalities in training alternation. Additional variations in volume, intensity, rest brakes, repetition velocity andinter-repetition rest can be the important part of functional strength training program. Alternation and combination of different training parameters makes appropriate training stimulus for strength increase in the most of nowadays sports. Optimal alternation of basic training parameters should be the first part in the processof planning and programming. As a result, majority of athletes might not need advanced periodization patterns for optimal improvement in muscle strength and power

  15. Neighborhood semantics for modal many-valued logics

    Czech Academy of Sciences Publication Activity Database

    Cintula, Petr; Noguera, Carles

    online 18 October 2017 (2018) ISSN 0165-0114 R&D Projects: GA ČR(CZ) GF15-34650L EU Projects: European Commission(XE) 689176 - SYSMICS Grant - others:AV ČR(CZ) JSPS-16-08; Austrian Science Fund(AT) I1897-N25 Program:Bilaterální spolupráce Institutional support: RVO:67985807 ; RVO:67985556 Keywords : mathematical fuzzy logic * modal fuzzy logics * neighborhood frames * Kripke semantics * many-valued logics Subject RIV: BA - General Mathematics; BA - General Mathematics (UTIA-B) Impact factor: 2.718, year: 2016

  16. The metaphysics of quantum mechanics: Modal interpretations

    Science.gov (United States)

    Gluck, Stuart Murray

    2004-11-01

    This dissertation begins with the argument that a preferred way of doing metaphysics is through philosophy of physics. An understanding of quantum physics is vital to answering questions such as: What counts as an individual object in physical ontology? Is the universe fundamentally indeterministic? Are indiscernibles identical? This study explores how the various modal interpretations of quantum mechanics answer these sorts of questions; modal accounts are one of the two classes of interpretations along with so-called collapse accounts. This study suggests a new alternative within the class of modal views that yields a more plausible ontology, one in which the Principle of the Identity of Indisceribles is necessarily true. Next, it shows that modal interpretations can consistently deny that the universe must be fundamentally indeterministic so long as they accept certain other metaphysical commitments: either a perfect initial distribution of states in the universe or some form of primitive dispositional properties. Finally, the study sketches out a future research project for modal interpretations based on developing quantified quantum logic.

  17. Automated Modal Parameter Estimation for Operational Modal Analysis of Large Systems

    DEFF Research Database (Denmark)

    Andersen, Palle; Brincker, Rune; Goursat, Maurice

    2007-01-01

    In this paper the problems of doing automatic modal parameter extraction and how to account for large number of data to process are considered. Two different approaches for obtaining the modal parameters automatically using OMA are presented: The Frequency Domain Decomposition (FDD) technique and...

  18. Affirmation Modality in Bulgarian, Macedonian and Serbian

    Directory of Open Access Journals (Sweden)

    Marcin Grygiel

    2015-06-01

    Full Text Available Affirmation Modality in Bulgarian, Macedonian and Serbian In the case of affirmation modality the speakers transform their utterances by stressing or attributing a positive value as an additional component added to the semantic structure of a proposition. This type of affirmative polarization is triggered in opposition to negation or hypothetically negative contexts. The goal of the present paper is twofold: on the one hand to compare and contrast affirmative periphrastic constructions in Bulgarian, Macedonian and Serbian and, on the other hand, to ascertain what these constructions reveal regarding the organization of grammatical categories in general and the status of affirmation modality as a coherent and homogenous category with a linguistic validity.

  19. Nonlinear modal interactions in a microcantilever

    Science.gov (United States)

    Westra, Hidde; van der Zant, Herre; Venstra, Warner

    2012-02-01

    We study the nonlinear interactions between vibrational modes in a microcantilever. The flexural-flexural, torsional-torsional and torsional-flexural modal interactions are investigated theoretically and experimentally. In a cantilever, the nonlinearity arising from geometrical and inertial effects couples the different modes. The motion of one mode influences the resonance frequency of the other modes. We show that depending on the amplitude of one mode, both frequency stiffening and weakening of the other mode occurs. The modal interactions in clamped-clamped beam resonators is recently studied, and several applications have been proposed. Microcantilevers are frequently used in instrumentation, and the modal interactions presented here enable such schemes, including Q-factor tuning and self-detection.

  20. Modal Identification Using OMA Techniques: Nonlinearity Effect

    Directory of Open Access Journals (Sweden)

    E. Zhang

    2015-01-01

    Full Text Available This paper is focused on an assessment of the state of the art of operational modal analysis (OMA methodologies in estimating modal parameters from output responses of nonlinear structures. By means of the Volterra series, the nonlinear structure excited by random excitation is modeled as best linear approximation plus a term representing nonlinear distortions. As the nonlinear distortions are of stochastic nature and thus indistinguishable from the measurement noise, a protocol based on the use of the random phase multisine is proposed to reveal the accuracy and robustness of the linear OMA technique in the presence of the system nonlinearity. Several frequency- and time-domain based OMA techniques are examined for the modal identification of simulated and real nonlinear mechanical systems. Theoretical analyses are also provided to understand how the system nonlinearity degrades the performance of the OMA algorithms.

  1. Modal confidence factor in vibration testing

    Science.gov (United States)

    Ibrahim, S. R.

    1978-01-01

    The modal confidence factor (MCF) is a number calculated for every identified mode for a structure under test. The MCF varies from 0.00 for a distorted nonlinear, or noise mode to 100.0 for a pure structural mode. The theory of the MCF is based on the correlation that exists between the modal deflection at a certain station and the modal deflection at the same station delayed in time. The theory and application of the MCF are illustrated by two experiments. The first experiment deals with simulated responses from a two-degree-of-freedom system with 20%, 40%, and 100% noise added. The second experiment was run on a generalized payload model. The free decay response from the payload model contained 22% noise.

  2. Sensor Placement for Modal Parameter Subset Estimation

    DEFF Research Database (Denmark)

    Ulriksen, Martin Dalgaard; Bernal, Dionisio; Damkilde, Lars

    2016-01-01

    The present paper proposes an approach for deciding on sensor placements in the context of modal parameter estimation from vibration measurements. The approach is based on placing sensors, of which the amount is determined a priori, such that the minimum Fisher information that the frequency...... responses carry on the selected modal parameter subset is, in some sense, maximized. The approach is validated in the context of a simple 10-DOF mass-spring-damper system by computing the variance of a set of identified modal parameters in a Monte Carlo setting for a set of sensor configurations, whose...... anticipated effectiveness are ranked according to the noted criterion. It is contended that the examined max-min criterion satisfies the objective of optimizing the accuracy of an identification setup more effectively than the more commonly used trace or determinant of the Fisher information matrix (FIM...

  3. Comparison of particle-radiation-therapy modalities

    Energy Technology Data Exchange (ETDEWEB)

    Fairchild, R.G.; Bond, V.P.

    1981-01-01

    The characteristics of dose distribution, beam alignment, and radiobiological advantages accorded to high LET radiation were reviewed and compared for various particle beam radiotherapeutic modalities (neutron, Auger electrons, p, ..pi../sup -/, He, C, Ne, and Ar ions). Merit factors were evaluated on the basis of effective dose to tumor relative to normal tissue, linear energy transfer (LET), and dose localization, at depths of 1, 4, and 10 cm. In general, it was found that neutron capture therapy using an epithermal neutron beam provided the best merit factors available for depths up to 8 cm. The position of fast neutron therapy on the Merit Factor Tables was consistently lower than that of other particle modalities, and above only /sup 60/Co. The largest body of clinical data exists for fast neutron therapy; results are considered by some to be encouraging. It then follows that if benefits with fast neutron therapy are real, additional gains are within reach with other modalities.

  4. The effect of a multidisciplinary obstetric emergency team training program, the In Time course, on diagnosis to delivery interval following umbilical cord prolapse - A retrospective cohort study.

    Science.gov (United States)

    Copson, Sean; Calvert, Katrina; Raman, Puvaneswary; Nathan, Elizabeth; Epee, Mathias

    2017-06-01

    Cord prolapse is an uncommon obstetric emergency, with potentially fatal consequences for the baby if prompt action is not taken. Simulation training provides a means by which uncommon emergencies can be practised, with the aim of improving teamwork and clinical outcomes. This study aimed to determine if the introduction of a simulation-based training course was associated with an improvement in the management of cord prolapse, in particular the diagnosis to delivery interval. We also aimed to investigate if an improvement in perinatal outcomes could be demonstrated. A retrospective cohort study was performed. All cases of cord prolapse in the designated time period were identified and reviewed and a comparison of outcome measures pre- and post-training was undertaken. Thirty-one cases were identified in the pre-training period, and compared to 64 cases post-training. Documentation improved significantly post-training. There were non-significant improvements in use of spinal anaesthetic, and in the length of stay in the special care neonatal unit. There was a significant increase in the number of babies with Apgar scores less than seven at 5 min. There were no differences in the diagnosis to delivery interval, or in perinatal mortality rates. Obstetric emergency training was associated with improved teamwork, as evidenced by the improved documentation post-training in this study, but not with improved diagnosis to delivery interval. Long-term follow-up studies are required to ascertain whether training has an impact on longer-term paediatric outcomes, such as cerebral palsy rates. © 2016 The Royal Australian and New Zealand College of Obstetricians and Gynaecologists.

  5. Artificial Vision, New Visual Modalities and Neuroadaptation

    Directory of Open Access Journals (Sweden)

    Hilmi Or

    2012-01-01

    Full Text Available To study the descriptions from which artificial vision derives, to explore the new visual modalities resulting from eye surgeries and diseases, and to gain awareness of the use of machine vision systems for both enhancement of visual perception and better understanding of neuroadaptation. Science could not define until today what vision is. However, some optical-based systems and definitions have been established considering some factors for the formation of seeing. The best known system includes Gabor filter and Gabor patch which work on edge perception, describing the visual perception in the best known way. These systems are used today in industry and technology of machines, robots and computers to provide their "seeing". These definitions are used beyond the machinery in humans for neuroadaptation in new visual modalities after some eye surgeries or to improve the quality of some already known visual modalities. Beside this, “the blindsight” -which was not known to exist until 35 years ago - can be stimulated with visual exercises. Gabor system is a description of visual perception definable in machine vision as well as in human visual perception. This system is used today in robotic vision. There are new visual modalities which arise after some eye surgeries or with the use of some visual optical devices. Also, blindsight is a different visual modality starting to be defined even though the exact etiology is not known. In all the new visual modalities, new vision stimulating therapies using the Gabor systems can be applied. (Turk J Oph thal mol 2012; 42: 61-5

  6. Modal seismic analysis of a nuclear power plant control panel and comparison with SAP 4

    Science.gov (United States)

    Pamidi, M. R.; Pamidi, P. R.

    1976-01-01

    The application of NASTRAN to seismic analysis by considering the example of a nuclear power plant control panel was considered. A modal analysis of a three-dimensional model of the panel, consisting of beam and quadri-lateral membrane elements, is performed. Using the results of this analysis and a typical response spectrum of an earthquake, the seismic response of the structure is obtained. ALTERs required to the program in order to compute the maximum modal responses as well as the resultant response are given. The results are compared with those obtained by using the SAP IV computer program.

  7. New treatment modalities for granuloma faciale.

    Science.gov (United States)

    Ludwig, E; Allam, J-P; Bieber, T; Novak, N

    2003-09-01

    Granuloma faciale (GF) is a rare, chronic skin disorder in which numerous treatment modalities have been used without any consistent long-term effect. We report three cases of GF, two of which were successfully treated with the Laserscope potassium-titanyl-phosphate 532-nm laser within 2 weeks and one with topical tacrolimus ointment 0.1%. Our observations suggest that these new treatment modalities for GF, which we report here for the first time, can provide effective and non-invasive treatment for this disease.

  8. Modal interaction in postbuckled plates. Theory

    Science.gov (United States)

    Thurston, Gaylen A.

    1989-01-01

    Plates can have more than one buckled solution for a fixed set of boundary conditions. The theory for the identification and the computation of multiple solutions in buckled plates is examined. The theory predicts modal interaction (which is also called change in buckle pattern or secondary buckling) in experiments on certain plates with multiple theoretical solutions. A set of coordinate functions is defined for Galerkin's method so that the von Karman plate equations are reduced to a coupled set of cubic equations in generalized coordinates that are uncoupled in the linear terms. An iterative procedure for solving modal interaction problems is suggested based on this cubic form.

  9. Finite Dynamic Elements and Modal Analysis

    Directory of Open Access Journals (Sweden)

    N.J. Fergusson

    1993-01-01

    Full Text Available A general modal analysis scheme is derived for forced response that makes use of high accuracy modes computed by the dynamic element method. The new procedure differs from the usual modal analysis in that the modes are obtained from a power series expansion for the dynamic stiffness matrix that includes an extra dynamic correction term in addition to the static stiffness matrix and the consistent mass matrix based on static displacement. A cantilevered beam example is used to demonstrate the relative accuracies of the dynamic element and the traditional finite element methods.

  10. Tense and modality in the nominal domain

    Directory of Open Access Journals (Sweden)

    Negin Ilkhanipour

    2016-12-01

    Full Text Available It is well discussed in the literature that epistemic modals (Mod epis are base-generated higher than Tense (T, while non-epistemic/root modals (Mod root are base-generated lower than T, and that high modals are evaluated in the context of the speech event (i.e., with regard to the speaker at the speech time, whereas low modals are evaluated in the context of the VP event (with regard to an argument at the event time. In this study, looking with favour upon the presence of tense and modal functional projections in the nominal domain, and following the idea that adjectives are basegenerated in the specifiers of distinct functional projections, I argue that, similar to the structure of CPs, epistemic and root modal elements have different positions in DPs; epistemic adjectives appear in the specifier of Mod epis.NP above nominal tense (TNP, while root adjectives appear in the specifier of Mod root.NP below TNP, where nominal tense is the time of the existence or occurrence of the modified noun. With this aim in view, first, I show that the ambiguity of the adjective qæbli ‘previous’ is due to the two positions this adjective can occupy: the specifier of TNP and the specifier of ordinalP, where the adjective receives temporal and ordinal interpretations, respectively. Next, I explain that this structural ambiguity is observed when qæbli ‘previous’ cooccurs with root adjectives, such as qabel-e-ɁeɁtemad ‘reliable’. This suggests that the position of root adjectives is lower than TN, where it is interpreted with respect to the modified noun at the event time. With epistemic adjectives, such as Ɂehtemali ‘probable’, the adjective qæbli ‘previous’ is not ambiguous; it can be interpreted only as an ordinal modifier. This implies that the epistemic modal is higher than TN, where it is evaluated with regard to the speaker’s knowledge at the speech time. Thus, we see that the interaction of temporal and modal adjectives in DPs

  11. Nonoperative Modalities to Treat Symptomatic Cervical Spondylosis

    Directory of Open Access Journals (Sweden)

    Kieran Michael Hirpara

    2012-01-01

    Full Text Available Cervical spondylosis is a common and disabling condition. It is generally felt that the initial management should be nonoperative, and these modalities include physiotherapy, analgesia and selective nerve root injections. Surgery should be reserved for moderate to severe myelopathy patients who have failed a period of conservative treatment and patients whose symptoms are not adequately controlled by nonoperative means. A review of the literature supporting various modalities of conservative management is presented, and it is concluded that although effective, nonoperative treatment is labour intensive, requiring regular review and careful selection of medications and physical therapy on a case by case basis.

  12. Nonoperative modalities to treat symptomatic cervical spondylosis.

    LENUS (Irish Health Repository)

    Hirpara, Kieran Michael

    2012-01-01

    Cervical spondylosis is a common and disabling condition. It is generally felt that the initial management should be nonoperative, and these modalities include physiotherapy, analgesia and selective nerve root injections. Surgery should be reserved for moderate to severe myelopathy patients who have failed a period of conservative treatment and patients whose symptoms are not adequately controlled by nonoperative means. A review of the literature supporting various modalities of conservative management is presented, and it is concluded that although effective, nonoperative treatment is labour intensive, requiring regular review and careful selection of medications and physical therapy on a case by case basis.

  13. Training versus Education: eLearning, Hybrid, and Face-to-Face Modalities - a Participatory Debate

    Directory of Open Access Journals (Sweden)

    Risa Blair

    2016-10-01

    Full Text Available Is training education or is education training? Universities and organizations treat training and education synonymously, but it is worth exploring the differences. Universities are scrambling to standardize a preferred delivery method of education and training. With the blended modalities of eLearning, face-to-face, and hybrid learning, the educational delivery seems to be equalizing. The disruptive shift with technology in education or training is complicated by the expectations of our millennial, Gen Y, and Gen Z students. As an added pressure at the university level, even more importantly, the expectation of the administration and the accrediting bodies keep changing the 'play book' on requirements. Given the ever changing complexities of today's paradigm-shift in education and learning, we explored the complexities of navigating the delivery methods to achieve educational goals in higher education or training goals in corporate America.

  14. Disentangling Linguistic Modality Effects in Semantic Processing

    Science.gov (United States)

    Moita, Mara; Nunes, Maria Vânia

    2017-01-01

    Sensory systems are essential for perceiving and conceptualizing our semantic knowledge about the world and the way we interact with it. Despite studies reporting neural changes to compensate for the absence of a given sensory modality, studies focusing on the assessment of semantic processing reveal poor performances by deaf individuals when…

  15. Established rheumatoid arthritis - new imaging modalities

    DEFF Research Database (Denmark)

    McQueen, Fiona M; Østergaard, Mikkel

    2007-01-01

    New imaging modalities are assuming an increasingly important role in the investigation and management of rheumatoid arthritis. It is now possible to obtain information about all tissues within the joint in three dimensions using tomographic techniques such as magnetic resonance imaging (MRI...

  16. Computing modal dispersion characteristics of radially Asymmetric ...

    African Journals Online (AJOL)

    determine how the modal characteristics change as circular Bragg fiber is changed to asymmetric Bragg fiber. The key to this transfer matrix method (TMM) is the accurate calculation of the propagation constants of modes. And validity of this method is verified by FDTD method. We compare these results with obtained from ...

  17. Modal-insensitive biconical-taper couplers.

    Science.gov (United States)

    Tremblay, Y; Kawasaki, B S; Bilodeau, F

    1982-10-01

    A method for fabricating optical-fiber fused biconical-taper couplers that have coupling ratios insensitive to the modal distribution of light in the input fiber arms is demonstrated. Comparison measurements of the performance of these couplers and those made by the previous technique are presented and discussed.

  18. Seeking Conceptual Clarity in the Action Modalities

    Science.gov (United States)

    Raelin, Joe

    2009-01-01

    This article begins with the presumption that action learning has not made as deep an impact in promoting participatory social change as its supporters may have hoped for, but nor has its cousin action modalities, such as action research and action science. These action strategies have evolved separately along distinct traditions and, rather than…

  19. A Spatial Modality Effect in Serial Memory

    Science.gov (United States)

    Tremblay, Sebastien; Parmentier, Fabrice B. R.; Guerard, Katherine; Nicholls, Alastair P.; Jones, Dylan M.

    2006-01-01

    In 2 experiments, the authors tested whether the classical modality effect--that is, the stronger recency effect for auditory items relative to visual items--can be extended to the spatial domain. An order reconstruction task was undertaken with four types of material: visual-spatial, auditory-spatial, visual-verbal, and auditory-verbal.…

  20. Cost-effectiveness of Different Diabetic Retinopathy Screening Modalities.

    Science.gov (United States)

    Pasquel, Francisco J; Hendrick, Andrew M; Ryan, Martha; Cason, Emily; Ali, Mohammed K; Narayan, K M Venkat

    2015-12-29

    Current screening strategies aimed at detection of diabetic retinopathy (DR) historically have poor compliance, but advancements in technology can enable improved access to care. Nearly 80% of all persons with diabetes live in low- and middle-income countries (LMICs), highlighting the importance of a cost effective screening program. Establishing mechanisms to reach populations with geographic and financial barriers to access is essential to prevent visual disability. Teleretinal programs leverage technology to improve access and reduce cost. The quality of currently employed screening modalities depends on many variables including the instrument used, use of pupillary mydriasis, number of photographic fields, and the qualifications of the photographer and image interpreter. Recent telemedicine and newer technological approaches have been introduced, but data for these technologies is yet limited. We present results of a systematic review of studies evaluating cost-effectiveness of DR screening, and discuss potential relevance for LMICs. © 2015 Diabetes Technology Society.

  1. Evidentiality, Epistemic Modality, and Epistemic Status

    Directory of Open Access Journals (Sweden)

    Rezeda Dilshatovna Shakirova

    2016-09-01

    Full Text Available The article discusses the interaction of evidentiality categories, typical of many Turkic, Finno-Ugric, Samoyed, certain Slavic, and other languages with the categories of epistemic modality, which is widely represented particularly in Germanic languages. The methodological framework of this study consists of the general philosophic, general scientific and private levels. The general philosophic methodology is based on the analytic philosophy, under the linguistic trend of which the language study was carried out to solve philosophic problems. The general scientific methodological bases of the study are related to the principle of identifying similarities and differences of the categories analyzed and the systematicity of description, whereas the descriptive method and techniques thereof are used primarily as the private-linguistic methods. In contrast to evidentiality, indicating the source of information, the epistemic modality marks different level of the information reliability. In the modern German language, the categories studied have a zone of intersection in terms of community within the means of expression, to which modal words and modal verbs as well as the verb scheinen can be primarily related. However, in the modern German language, there is no question of the category of evidentiality in the plane, within which it is currently being studied basing on the material of those languages, to the fragment of the grammatical system of which it is primarily inherent. As a rule, the semantics of evidentiality in these languages provides no information on the degree of reliability of the source of knowledge. To overcome the contradiction of such nature, this work suggests paying attention to the category of epistemic status of an utterance, the semantic structure of which is wider than evidentiality and epistemic modality and includes the level of reliability of the source of knowledge along with the designation thereof. In today's German

  2. Imaging modalities in Focal Therapy: Multiparametric Ultrasound.

    Science.gov (United States)

    Wildeboer, R R; Panfilova, A P; Mischi, M; Wijkstra, H

    2016-07-01

    Prostate cancer (PCa) is the most common form of cancer among men in the US and the second most common cause of death. It has been observed that an increasing number of newly diagnosed patients exhibit low-risk features and that over-treatment with radical prostatectomy is a growing problem. The feasibility of focal therapy as an organsparing alternative, however, depends on the reliability of imaging techniques to identify, localize and monitor clinically relevant PCa lesions. The aim of this review is to investigate the potential of multiparametric ultrasound (mpUS) for focal therapy. We briefly introduce the most common focal therapies and thoroughly discuss the ability of available ultrasound modalities to localize PCa and reflect tissue properties. The imaging requirements of the focal therapies are studied to put the performance of the US techniques into perspective. We found that transrectal greyscale echography, Doppler sonography, elastography, contrast-enhanced ultrasonography and computerized ultrasound have been studied for the purpose of prostate imaging. Several of these modalities are already frequently used in current clinical practice; to add to the diagnostic process of PCa, to guide and monitor the application of focal therapy or to perform follow-up after treatment. Despite their capability to detect a large fraction of the PCa lesions, none of these modalities is currently considered sufficiently accurate for stand-alone tumour detection and localization. However, although there are only few studies reporting on a combined use of different ultrasound modalities, the results of an mpUS approach seem promising. Several US modalities have been successfully applied as a viable alternative to monitor tissue destruction during and after treatment. In view of the advantages of US and the promising results of a multiparametric approach in PCa detection and localization, researchers are urged to further investigate mpUS for therapeutic purposes.

  3. Modality-specific axonal regeneration: toward selective regenerative neural interfaces.

    Science.gov (United States)

    Lotfi, Parisa; Garde, Kshitija; Chouhan, Amit K; Bengali, Ebrahim; Romero-Ortega, Mario I

    2011-01-01

    Regenerative peripheral nerve interfaces have been proposed as viable alternatives for the natural control of robotic prosthetic devices. However, sensory and motor axons at the neural interface are of mixed sub-modality types, which difficult the specific recording from motor axons and the eliciting of precise sensory modalities through selective stimulation. Here we evaluated the possibility of using type specific neurotrophins to preferentially entice the regeneration of defined axonal populations from transected peripheral nerves into separate compartments. Segregation of mixed sensory fibers from dorsal root ganglion neurons was evaluated in vitro by compartmentalized diffusion delivery of nerve growth factor (NGF) and neurotrophin-3 (NT-3), to preferentially entice the growth of TrkA+ nociceptive and TrkC+ proprioceptive subsets of sensory neurons, respectively. The average axon length in the NGF channel increased 2.5-fold compared to that in saline or NT-3, whereas the number of branches increased threefold in the NT-3 channels. These results were confirmed using a 3D "Y"-shaped in vitro assay showing that the arm containing NGF was able to entice a fivefold increase in axonal length of unbranched fibers. To address if such segregation can be enticed in vivo, a "Y"-shaped tubing was used to allow regeneration of the transected adult rat sciatic nerve into separate compartments filled with either NFG or NT-3. A significant increase in the number of CGRP+ pain fibers were attracted toward the sural nerve, while N-52+ large-diameter axons were observed in the tibial and NT-3 compartments. This study demonstrates the guided enrichment of sensory axons in specific regenerative chambers, and supports the notion that neurotrophic factors can be used to segregate sensory and perhaps motor axons in separate peripheral interfaces.

  4. Established rheumatoid arthritis - new imaging modalities

    DEFF Research Database (Denmark)

    McQueen, Fiona M; Østergaard, Mikkel

    2007-01-01

    ) and single photon emission tomography (SPECT) can reveal actively metabolizing bone and the proliferation of synovial cells via radioactive labeling. Bioluminescence and fluorescence reflectance imaging are other approaches that allow imaging, and potentially the delivery of therapeutic agents...

  5. Correlation Results for a Mass Loaded Vehicle Panel Test Article Finite Element Models and Modal Survey Tests

    Science.gov (United States)

    Maasha, Rumaasha; Towner, Robert L.

    2012-01-01

    High-fidelity Finite Element Models (FEMs) were developed to support a recent test program at Marshall Space Flight Center (MSFC). The FEMs correspond to test articles used for a series of acoustic tests. Modal survey tests were used to validate the FEMs for five acoustic tests (a bare panel and four different mass-loaded panel configurations). An additional modal survey test was performed on the empty test fixture (orthogrid panel mounting fixture, between the reverb and anechoic chambers). Modal survey tests were used to test-validate the dynamic characteristics of FEMs used for acoustic test excitation. Modal survey testing and subsequent model correlation has validated the natural frequencies and mode shapes of the FEMs. The modal survey test results provide a basis for the analysis models used for acoustic loading response test and analysis comparisons

  6. Photoacoustic/ultrasound dual-modality contrast agent and its application to thermotherapy

    Science.gov (United States)

    Wang, Yu-Hsin; Liao, Ai-Ho; Chen, Jui-Hao; Chris Wang, Churng-Ren; Li, Pai-Chi

    2012-04-01

    This study investigates a photoacoustic/ultrasound dual-modality contrast agent, including extending its applications from image-contrast enhancement to combined diagnosis and therapy with site-specific targeting. The contrast agent comprises albumin-shelled microbubbles with encapsulated gold nanorods (AuMBs). The gas-filled microbubbles, whose diameters range from submicrometer to several micrometers, are not only echogenic but also can serve as drug-delivery vehicles. The gold nanorods are used to enhance the generation of both photoacoustic and photothermal signals. The optical absorption peak of the gold nanorods is tuned to 760 nm and is invariant after microbubble encapsulation. Dual-modality contrast enhancement is first described here, and the applications to cellular targeting and laser-induced thermotherapy in a phantom are demonstrated. Photoacoustic imaging can be used to monitor temperature increases during the treatment. The targeting capability of AuMBs was verified, and the temperature increased by 26°C for a laser power of 980 mW, demonstrating the potential of combined diagnosis and therapy with the dual-modality agent. Targeted photo- or acoustic-mediated delivery is also possible.

  7. Modal Density and Modal Distribution of Bending Wave Vibration Fields in Ribbed Plates

    DEFF Research Database (Denmark)

    Dickow, Kristoffer Ahrens; Brunskog, Jonas; Ohlrich, Mogens

    2013-01-01

    Plates reinforced by ribs or joists are common elements in lightweight building structures, as well as in other engineering structures such as vehicles, ships, and aircraft. These structures, however, are often not well suited for simple structural acoustic prediction models such as statistical...... energy analysis. One reason is that the modal density is not uniformly distributed due to the spatial periodicity introduced by the ribs. This phenomenon is investigated in the present paper, using a modal model of a ribbed plate. The modal model uses the Fourier sine modes, and the coupling between...... the plate and ribs is incorporated using Hamilton’s principle. This model is then used to investigate the modal density of the considered spatially periodic structure, and a grouping of the modes in different dominating directions is proposed. Suggestions are also given regarding how to proceed towards...

  8. Modal density and modal distribution of bending wave vibration fields in ribbed plates

    DEFF Research Database (Denmark)

    Dickow, Kristoffer Ahrens; Brunskog, Jonas; Ohlrich, Mogens

    2013-01-01

    Plates reinforced by ribs or joists are common elements in lightweight building structures, as well as in other engineering structures such as vehicles, ships, and aircraft. These structures, however, are often not well suited for simple structural acoustic prediction models such as statistical...... energy analysis. One reason is that the modal density is not uniformly distributed due to the spatial periodicity introduced by the ribs. This phenomenon is investigated in the present paper, using a modal model of a ribbed plate. The modal model uses the Fourier sine modes, and the coupling between...... the plate and ribs is incorporated using Hamilton's principle. This model is then used to investigate the modal density of the considered spatially periodic structure, and a grouping of the modes in different dominating directions is proposed. Suggestions are also given regarding how to proceed towards...

  9. Supervised Cross-Modal Factor Analysis for Multiple Modal Data Classification

    KAUST Repository

    Wang, Jingbin

    2015-10-09

    In this paper we study the problem of learning from multiple modal data for purpose of document classification. In this problem, each document is composed two different modals of data, i.e., An image and a text. Cross-modal factor analysis (CFA) has been proposed to project the two different modals of data to a shared data space, so that the classification of a image or a text can be performed directly in this space. A disadvantage of CFA is that it has ignored the supervision information. In this paper, we improve CFA by incorporating the supervision information to represent and classify both image and text modals of documents. We project both image and text data to a shared data space by factor analysis, and then train a class label predictor in the shared space to use the class label information. The factor analysis parameter and the predictor parameter are learned jointly by solving one single objective function. With this objective function, we minimize the distance between the projections of image and text of the same document, and the classification error of the projection measured by hinge loss function. The objective function is optimized by an alternate optimization strategy in an iterative algorithm. Experiments in two different multiple modal document data sets show the advantage of the proposed algorithm over other CFA methods.

  10. Course Modality Choice and Student Performance in Business Statistics Courses in Post Secondary Institutions

    Science.gov (United States)

    Radners, Richard Harry, Jr.

    2011-01-01

    Limited research has been conducted on the role of course modality choice (face-to-face [FTF] or online [OL]) on course grades. At the study site, an independent college, the research problem was the lack of research on the proportions of undergraduate students who completed a statistics course as part of their academic program, in either OL or…

  11. Modal Testing of Mechanical Structures Subject to Operational Excitation Forces

    DEFF Research Database (Denmark)

    Møller, N.; Brincker, Rune; Herlufsen, H.

    2000-01-01

    Operational Modal Analysis also known as Output Only Modal Analysis has in the recent years been used for extracting modal parameters of civil engineering structures and is now becoming popular for mechanical structures. The advantage of the method is that no artificial excitation need...... to the Operational Modal Analysis. For Operational Modal Analysis two different estimation techniques are used: a non-parametric technique based on Frequency Domain Decomposition (FDD), and a parametric technique working on the raw data in time domain, a data driven Stochastic Subspace Identification (SSI) algorithm....... These are compared to other methods such as traditional Modal Analysis....

  12. China’s Conversion of Cropland to Forest Program for Household Delivery of Ecosystem Services: How Important is a Local Implementation Regime to Survival Rate Outcomes?

    Directory of Open Access Journals (Sweden)

    Michael T. Bennett

    2014-09-01

    Full Text Available China’s Conversion of Cropland to Forests Program (CCFP is the world’s largest afforestation-based Payments for Ecosystem Services (PES program, having retired and afforested over 24 million ha involving 32 million rural households. Prior research has primarily focused on the CCFP’s rural welfare impacts, with few studies on program-induced environmental improvements, particularly at the household level. In this study, data from a 2010 survey covering 2808 rural households from across China was analyzed using an interval regression model to explain household-reported survival rates of trees planted on program-enrolled cropland. In addition to household-level factors, we explore the influence of local conditions and institutional configurations by exploiting the wide diversity of contexts covered by the data set. We find that households with more available labor and more forestry experience manage trees better, but that higher opportunity costs for both land and labor have the opposite effect. We also find that the local implementation regime- e.g., the degree of prior consultation with participants and regular monitoring - has a strong positive effect on reported survivorship. We suggest that the level of subsidy support to participating households will be key to survivorship of trees in planted CCFP forests for some time to come.

  13. Race, welfare reform and caseworkers' treatment of welfare recipients: an examination of an alternative service delivery system-the Wisconsin Works (W-2) Program.

    Science.gov (United States)

    Bonds, Michael

    2006-01-01

    This study examined how welfare recipients in the Wisconsin Works Program were treated by community-based organizations' caseworkers, as opposed to government agencies, to determine if racial disparities existed. The same racial disparities found with public agencies existed. And CBOs were not providing Blacks with services needed to get off welfare.

  14. Model Design of Piezoelectric Micromachined Modal Gyroscope

    Directory of Open Access Journals (Sweden)

    Xiaojun Hu

    2011-01-01

    Full Text Available This paper reports a novel kind of solid-state microgyroscope, which is called piezoelectric micromachined modal gyroscope (PMMG. PMMG has large stiffness and robust resistance to shake and strike because there is no evident mass-spring component in its structure. This work focused on quantitative optimization of the gyroscope, which is still blank for such gyroscope. The modal analysis by the finite element method (FEM was firstly conducted. A set of quantitative indicators were developed to optimize the operation mode. By FEM, the harmonic analysis was conducted to find the way to efficiently actuate the operational mode needed. The optimal configuration of driving electrodes was obtained. At last, the Coriolis analysis was conducted to show the relation between angular velocity and differential output voltage by the Coriolis force under working condition. The results obtained in this paper provide theoretical basis for realizing this novel kind of micromachined gyroscope.

  15. Modality shift effects mimic multisensory interactions

    DEFF Research Database (Denmark)

    Gondan, Matthias; Vorberg, D.; Greenlee, M.W.

    2007-01-01

    A frequent approach to study interactions of the auditory and the visual system is to measure event-related potentials (ERPs) to auditory, visual, and auditory-visual stimuli (A, V, AV). A nonzero result of the AV - (A + V) comparison indicates that the sensory systems interact at a specific...... processing stage. Two possible biases weaken the conclusions drawn by this approach: first, subtracting two ERPs from one requires that A, V, and AV do not share any common activity. We have shown before (Gondan and Röder in Brain Res 1073-1074:389-397, 2006) that the problem of common activity can...... be avoided using an additional tactile stimulus (T) and evaluating the ERP difference (T + TAV) - (TA + TV). A second possible confound is the modality shift effect (MSE): for example, the auditory N1 is increased if an auditory stimulus follows a visual stimulus, whereas it is smaller if the modality...

  16. The life trajectories modality of oral history

    Directory of Open Access Journals (Sweden)

    Rita de Cássia Gonçalves

    2007-05-01

    Full Text Available This article seeks to explore the potential of qualitative research. It presents the life trajectory modality of the oral history method, to discuss the possibility of its utilization in scientific research in the Social Work profession. The epistemological foundations of oral history are discussed to establish its scientific character. The life trajectories modality is presented as a historic and social construction that utilizes different interview techniques to give voice to previously invisible subjects, indicating the principal phases of the methodological procedures used in this approach. The conclusions highlight the importance of the construction of this model and its projection as a research proposal that implies a process of understanding and analyzing the social universes that are contextualized and interconnected, considering the realities of the life trajectories of the subjects studied.

  17. On the Bicriterion Multi Modal Assignment Problem

    DEFF Research Database (Denmark)

    Pedersen, Christian Roed; Nielsen, L.R.; Andersen, K.A.

    2005-01-01

    We consider the bicriterion multi modal assignment problem which is a new generalization of the classical linear assignment problem. A two-phase solution method using an effective ranking scheme is presented. The algorithm is valid for generating all nondominated criterion points or an approximat......We consider the bicriterion multi modal assignment problem which is a new generalization of the classical linear assignment problem. A two-phase solution method using an effective ranking scheme is presented. The algorithm is valid for generating all nondominated criterion points...... or an approximation. Extensive computational results are conducted on a large library of test instances to test the performance of the algorithm and to identify hard test instances. Also, test results of the algorithm applied to the bicriterion assignment problem is given. Here our algorithm outperforms all...

  18. Optical imaging modalities for biomedical applications.

    Science.gov (United States)

    Dhawan, Atam P; D'Alessandro, Brian; Fu, Xiaolei

    2010-01-01

    Optical photographic imaging is a well known imaging method that has been successfully translated into biomedical applications such as microscopy and endoscopy. Although several advanced medical imaging modalities are used today to acquire anatomical, physiological, metabolic, and functional information from the human body, optical imaging modalities including optical coherence tomography, confocal microscopy, multiphoton microscopy, multispectral endoscopy, and diffuse reflectance imaging have recently emerged with significant potential for non-invasive, portable, and cost-effective imaging for biomedical applications spanning tissue, cellular, and molecular levels. This paper reviews methods for modeling the propagation of light photons in a biological medium, as well as optical imaging from organ to cellular levels using visible and near-infrared wavelengths for biomedical and clinical applications.

  19. Multipoint laser vibrometer for modal analysis.

    Science.gov (United States)

    MacPherson, William N; Reeves, Mark; Towers, David P; Moore, Andrew J; Jones, Julian D C; Dale, Martin; Edwards, Craig

    2007-06-01

    Experimental modal analysis of multifrequency vibration requires a measurement system with appropriate temporal and spatial resolution to recover the mode shapes. To fully understand the vibration it is necessary to be able to measure not only the vibration amplitude but also the vibration phase. We describe a multipoint laser vibrometer that is capable of high spatial and temporal resolution with simultaneous measurement of 256 points along a line at up to 80 kHz. The multipoint vibrometer is demonstrated by recovering modal vibration data from a simple test object subject to transient excitation. A practical application is presented in which the vibrometer is used to measure vibration on a squealing rotating disk brake.

  20. Deception Detection, Transmission, & Modality in Age & Sex

    Directory of Open Access Journals (Sweden)

    Charlotte Dorothy Sweeney

    2014-06-01

    Full Text Available This study is the first to create and use spontaneous (i.e. unrehearsed pro-social lies in an ecological setting. Creation of the stimuli involved fifty-one older adult and forty-four college student senders who lied authentically in that their lies were spontaneous in the service of protecting a research assistant. In the main study, seventy-seven older adult and eighty-four college raters attempted to detect lies in the older adult and college senders in three modalities: audio, visual, and audiovisual. Raters of both age groups were best at detecting lies in the audiovisual and worst in the visual modalities. Overall, college students were better detectors than older adults. There was an age-matching effect for college students but not for older adults. Older adult males were the hardest to detect. The older the adult was the worse the ability to detect deception.

  1. Alternative Therapeutic Modalities in Sports Medicine.

    Science.gov (United States)

    Patel, Deepan N; Strauss, Eric J

    2015-06-01

    Bone marrow aspirate, prolotherapy, platelet-rich plasma,and autologous conditioned serum represent alternative treatment options that have emerged to address various musculoskeletal ailments. We have reviewed the basic science, physiology, and clinical evidence of each of these modalities and discovered that each treatment has its individual place in the management of common orthopaedic pathologies. Bone marrow aspirates are successful in treating early arthritis and cartilage defects. Prolotherapy and platelet-rich plasma have demonstrated good efficacy in treating inflammatory processes and early arthritis. Finally, autologous conditioned serum (Orthokine) represents a promising treatment option for chronic joint arthritis. The clinical evidence supporting these alternative treatment modalities is insufficient and further level 1 evidence is needed before we can begin to employ these techniques in our daily orthopaedic practice.

  2. Exercise modality and metabolic efficiency in children.

    Science.gov (United States)

    Verweij, Bob G F; Stoner, Lee; Shultz, Sarah P

    2013-09-01

    Current exercise prescription guidelines for children recommend at least 60 min of moderate-to-vigorous physical activity every day. However, little is known about the efficacy of different cardiorespiratory exercise modalities prescribed to the pediatric cohort. Sixteen healthy children (8-12 years) completed 5-min trials of treadmill walking, cycling, and elliptical training in a randomized order. The treadmill walking speed was determined from measurements collected during a self-selected walking trial. The workloads for treadmill walking, cycling, and elliptical training were matched (40.3 W). Mechanical efficiency (ME%), perceived exertion (RPE), oxygen uptake, metabolic equivalents, and net energy expenditure were measured. ME% in walking was significantly higher than in cycling (P = 0.001) and elliptical training (P exercise prescription for otherwise healthy children; however, longitudinal studies need to be implemented to investigate the long-term benefits of each exercise modality.

  3. Human papillomavirus vaccine uptake in boys and girls in a school-based vaccine delivery program in Prince Edward Island, Canada.

    Science.gov (United States)

    McClure, Carol A; MacSwain, Mary-Ann; Morrison, Heather; Sanford, Carolyn J

    2015-04-08

    In 2013, Prince Edward Island was the first province to introduce HPV vaccine universally to grade six boys in a school-based program. Because uptake rates in boys are unknown in this type of vaccination program, uptake of HPV vaccination in boys was measured and compared with uptake rates in girls and then analyzed with factors such as county, urban-rural location of the school, and school board to identify where the vaccine program could be improved. HPV vaccination records from the provincial childhood immunization registry in PEI were merged with Department of Education data containing all grade six girls and boys in PEI. Vaccine uptakes between years and between sexes were compared using two sample tests of proportions. Logistic regression modeling which accounted for the hierarchical nature of the data was used to analyze associations between factors and uptake rates. Although uptake was high in boys and girls, a significantly greater proportion of girls (85%) received all three doses of the HPV vaccine compared to boys (79%; p=0.004). The odds of grade six girls being fully vaccinated for HPV were 1.5 times greater than of grade six boys, and the odds of students in the English Language School Board receiving all three doses were more than twice as great as the odds of French Language School Board students. HPV vaccination for boys in PEI has had a successful launch, almost reaching the Canadian Immunization Committee recommendations of >80% for the early years of a program. PEI has a highly organized Public Health Nursing program that is involved in all childhood and school-based vaccinations in PEI and in this context very high coverage rates were obtained. Areas to target for improving uptake include the boys and the students in the French Language School Board. Copyright © 2015 The Authors. Published by Elsevier Ltd.. All rights reserved.

  4. Estimation of Modal Parameters and their Uncertainties

    DEFF Research Database (Denmark)

    Andersen, P.; Brincker, Rune

    1999-01-01

    In this paper it is shown how to estimate the modal parameters as well as their uncertainties using the prediction error method of a dynamic system on the basis of uotput measurements only. The estimation scheme is assessed by means of a simulation study. As a part of the introduction, an example...... is given showing how the uncertainty estimates can be used in applications such as damage detection....

  5. Perlindungan Hukum Bagi Investor Dalam Pasar Modal

    Directory of Open Access Journals (Sweden)

    Hilda Hilmiah Dimyati

    2015-05-01

    Full Text Available Abstract: Legal Protection for Investors in the Capital Market. Supervision in the financial services industry capital markets experienced a change of control by Bapepam-LK be supervised by the Financial Services Authority. Institutionally, Bapepam-LK is responsible to the Minister of Finance, as Bapepam-LK is under the auspices of the Ministry of Finance, while the Financial Services Authority is responsible to Parliament or the public. Crucial aspect on which the formation of the FSA is not maximum protection of the interests of consumers of financial services. In accordance with the problems that occur as above, the authors feel the need to examine the legal protection in the capital market. This writing will also examine the parties are entitled to legal protection based on Law No. 8 of 1995 and the Capital Market Law No. 21 of 2011 on the Financial Services Authority. Abstrak: Perlindungan Hukum Bagi Investor Dalam Pasar Modal. Pengawasan di bidang industri jasa keuangan pasar modal mengalami perubahan dari pengawasan yang dilakukan oleh Bapepam-LK menjadi diawasi oleh Otoritas Jasa Keuangan. Secara kelembagaan, Bapepam-LK bertanggung jawab kepada Menteri Keuangan, karena Bapepam-LK berada di bawah naungan Kementrian Keuangan, sedangkan Otoritas Jasa Keuangan bertanggung jawab kepada Dewan Perwakilan Rakyat atau masyarakat. Aspek krusial yang menjadi dasar pembentukan OJK adalah tidak maksimalnya perlindungan kepentingan konsumen jasa keuangan. Sesuai dengan permasalahan yang terjadi seperti diatas, maka penulis merasa perlu untuk meneliti tentang perlindungan hukum di pasar modal. Penulisan ini juga akan meneliti para pihak yang berhak atas perlindungan hukum berdasarkan pada Undang-Undang Nomor 8 Tahun 1995 Tentang Pasar Modal dan Undang-Undang Nomor 21 Tahun 2011 Tentang Otoritas Jasa Keuangan. DOI: 10.15408/jch.v1i2.1473

  6. Gingival prosthesis: A treatment modality for recession

    Directory of Open Access Journals (Sweden)

    Pallavi Samatha Yalamanchili

    2013-01-01

    Full Text Available Gingival recession caused due to periodontal disease disturbs patients because of sensitivity and esthetics. Gingival prosthesis may be fixed or removable and can be made from silicones, acrylics, composite resins or ceramics according to what is best suited for the case. The gingival veneer is esthetically appealing and easy to maintain. This case report describes the use of gingival veneer as a treatment modality for recession.

  7. Artificial Vision, New Visual Modalities and Neuroadaptation

    OpenAIRE

    Hilmi Or

    2012-01-01

    To study the descriptions from which artificial vision derives, to explore the new visual modalities resulting from eye surgeries and diseases, and to gain awareness of the use of machine vision systems for both enhancement of visual perception and better understanding of neuroadaptation. Science could not define until today what vision is. However, some optical-based systems and definitions have been established considering some factors for the formation of seeing. The best known...

  8. Multi modal child-to-child interaction

    DEFF Research Database (Denmark)

    Fisker, Tine Basse

    In this presentation the interaction and relation of three boys is analyzed using multi modal analysis. The analysis clearly, and surprisingly demonstrates that the boys interact via different modes and that they are able to handle several interaction partners at the same time. They co-construct ......-construct interaction in rather complex and unexpected ways using verbal as well as non-verbal modes in interaction....

  9. Tri-modality small animal imaging system

    Energy Technology Data Exchange (ETDEWEB)

    Kundu, B.K.; Stolin, A.V.; Pole, J.; Baumgart, L.; Fontaine, M.; Wojcik, R.; Kross, B.; Zorn, C.; Majewski, S.; Williams, M.B.

    2006-02-01

    Our group is developing a scanner that combines x-ray, single gamma, and optical imaging on the same rotating gantry. Two functional modalities (SPECT and optical) are included because they have different strengths and weaknesses in terms of spatial and temporal decay lengths in the context of in vivo imaging, and because of the recent advent of multiple reporter gene constructs. The effect of attenuation by biological tissue on the detected intensity of the emitted signal was measured for both gamma and optical imaging. Attenuation by biological tissue was quantified for both the bioluminescent emission of luciferace and for the emission light of the near infrared fluorophore cyanine 5.5, using a fixed excitation light intensity. Experiments were performed to test the feasibility of using either single gamma or x-ray imaging to make depth-dependent corrections to the measured optical signal. Our results suggest that significant improvements in quantitation of optical emission are possible using straightforward correction techniques based on information from other modalities. Development of an integrated scanner in which data from each modality are obtained with the animal in a common configuration will greatly simplify this process.

  10. New biometric modalities using internal physical characteristics

    Science.gov (United States)

    Mortenson, Juliana (Brooks)

    2010-04-01

    Biometrics is described as the science of identifying people based on physical characteristics such as their fingerprints, facial features, hand geometry, iris patterns, palm prints, or speech recognition. Notably, all of these physical characteristics are visible or detectable from the exterior of the body. These external characteristics can be lifted, photographed, copied or recorded for unauthorized access to a biometric system. Individual humans are unique internally, however, just as they are unique externally. New biometric modalities have been developed which identify people based on their unique internal characteristics. For example, "BoneprintsTM" use acoustic fields to scan the unique bone density pattern of a thumb pressed on a small acoustic sensor. Thanks to advances in piezoelectric materials the acoustic sensor can be placed in virtually any device such as a steering wheel, door handle, or keyboard. Similarly, "Imp-PrintsTM" measure the electrical impedance patterns of a hand to identify or verify a person's identity. Small impedance sensors can be easily embedded in devices such as smart cards, handles, or wall mounts. These internal biometric modalities rely on physical characteristics which are not visible or photographable, providing an added level of security. In addition, both the acoustic and impedance methods can be combined with physiologic measurements such as acoustic Doppler or impedance plethysmography, respectively. Added verification that the biometric pattern came from a living person can be obtained. These new biometric modalities have the potential to allay user concerns over protection of privacy, while providing a higher level of security.*

  11. Treatment modalities and evaluation models for periodontitis

    Science.gov (United States)

    Tariq, Mohammad; Iqbal, Zeenat; Ali, Javed; Baboota, Sanjula; Talegaonkar, Sushama; Ahmad, Zulfiqar; Sahni, Jasjeet K

    2012-01-01

    Periodontitis is the most common localized dental inflammatory disease related with several pathological conditions like inflammation of gums (gingivitis), degeneration of periodontal ligament, dental cementum and alveolar bone loss. In this perspective, the various preventive and treatment modalities, including oral hygiene, gingival irrigations, mechanical instrumentation, full mouth disinfection, host modulation and antimicrobial therapy, which are used either as adjunctive treatments or as stand-alone therapies in the non-surgical management of periodontal infections, have been discussed. Intra-pocket, sustained release systems have emerged as a novel paradigm for the future research. In this article, special consideration is given to different locally delivered anti-microbial and anti inflammatory medications which are either commercially available or are currently under consideration for Food and Drug Administration (FDA) approval. The various in vitro dissolution models and microbiological strain investigated to impersonate the infected and inflamed periodontal cavity and to predict the in vivo performance of treatment modalities have also been thrashed out. Animal models that have been employed to explore the pathology at the different stages of periodontitis and to evaluate its treatment modalities are enlightened in this proposed review. PMID:23373002

  12. Imaging Breast Density: Established and Emerging Modalities

    Directory of Open Access Journals (Sweden)

    Jeon-Hor Chen

    2015-12-01

    Full Text Available Mammographic density has been proven as an independent risk factor for breast cancer. Women with dense breast tissue visible on a mammogram have a much higher cancer risk than women with little density. A great research effort has been devoted to incorporate breast density into risk prediction models to better estimate each individual’s cancer risk. In recent years, the passage of breast density notification legislation in many states in USA requires that every mammography report should provide information regarding the patient’s breast density. Accurate definition and measurement of breast density are thus important, which may allow all the potential clinical applications of breast density to be implemented. Because the two-dimensional mammography-based measurement is subject to tissue overlapping and thus not able to provide volumetric information, there is an urgent need to develop reliable quantitative measurements of breast density. Various new imaging technologies are being developed. Among these new modalities, volumetric mammographic density methods and three-dimensional magnetic resonance imaging are the most well studied. Besides, emerging modalities, including different x-ray–based, optical imaging, and ultrasound-based methods, have also been investigated. All these modalities may either overcome some fundamental problems related to mammographic density or provide additional density and/or compositional information. The present review article aimed to summarize the current established and emerging imaging techniques for the measurement of breast density and the evidence of the clinical use of these density methods from the literature.

  13. Signaling modalities during oogenesis in mammals.

    Science.gov (United States)

    McGinnis, Lynda K; Limback, S Darlene; Albertini, David F

    2013-01-01

    During oogenesis in mammals, the germ line interacts with ovarian somatic cells as follicles assemble, grow, ovulate, and die. As a result, these interactions with granulosa cells determine germ cell fate as the oocyte undergoes hypertrophy, the final stages of meiosis, and preparations required for successful fertilization. Over the past 15 years, investigators using a range of experimental approaches have uncovered the existence of multiple modalities for signaling between the oocyte and companion granulosa cells that play essential and sometimes overlapping roles during the growth and maturative phases of oogenesis. Five modalities of intercellular signaling are considered in the context of regulating oocyte gene expression, metabolism, spatial patterning, and the cell cycle. While some forms of signaling predominate at specific stages of oogenesis, such as during the assembly of primordial follicles, it is apparent that combinations of modalities work in concert to control events associated with ovulation when both nuclear and cytoplasmic maturation occur. A final key feature of the signaling platform underscoring the protracted process of oogenesis is the existence of negative and positive feedback loops designed to coordinate the tempo of oogenesis and folliculogenesis at key developmental transitions. Copyright © 2013 Elsevier Inc. All rights reserved.

  14. Survival by Dialysis Modality-Who Cares?

    Science.gov (United States)

    Lee, Martin B; Bargman, Joanne M

    2016-06-06

    In light of the recent emphasis on patient-centered outcomes and quality of life for patients with kidney disease, we contend that the nephrology community should no longer fund, perform, or publish studies that compare survival by dialysis modality. These studies have become redundant; they are methodologically limited, unhelpful in practice, and therefore a waste of resources. More than two decades of these publications show similar survival between patients undergoing peritoneal dialysis and those receiving thrice-weekly conventional hemodialysis, with differences only for specific subgroups. In clinical practice, modality choice should be individualized with the aim of maximizing quality of life, patient-reported outcomes, and achieving patient-centered goals. Expected survival is often irrelevant to modality choice. Even for the younger and fitter home hemodialysis population, quality of life, not just duration of survival, is a major priority. On the other hand, increasing evidence suggests that patients with ESRD continue to experience poor quality of life because of high symptom burden, unsolved clinical problems, and unmet needs. Patients care more about how they will live instead of how long. It is our responsibility to align our research with their needs. Only by doing so can we meet the challenges of ESRD patient care in the coming decades. Copyright © 2016 by the American Society of Nephrology.

  15. Prediction of Modal Shift Using Artificial Neural Networks

    Directory of Open Access Journals (Sweden)

    Kadir Akgöl

    2014-08-01

    Full Text Available Various public transport concepts have been developed to provide solutions to the ever growing problem of traffic in modern times. For instance, intelligent subscription bus service is one of them. This concept aims to provide a means of transport at near private car comfort as well as at near public transport cost. By this means, a shift from other modes of transport, especially private car, to public transport is aimed to encourage use of public transport. An artificial neural network model has been developed in this study to be able to calculate modal shift using three sources of data obtained from two questionnaire surveys conducted at Akdeniz University campus and a computer model's output (based on shortest route algorithms. The relationship between the results of the second questionnaire survey and the other data have been entered into Weka and Rapid Miner programs, the accuracy of this machine learning has been calculated and finally the modal shift originated by the intelligent subscription bus services has been estimated. The findings have yielded very reliable results which revealed the potential of applying the technique easily to similar problems.

  16. Assisted Vaginal Delivery

    Science.gov (United States)

    ... prescription. If sitting is uncomfortable, sit on a pillow. There also are special cushions that may be ... vagina. Cesarean Delivery: Delivery of a baby through surgical incisions made in the mother’s abdomen and uterus. ...

  17. Integrating photoluminescence, magnetism and thermal conversion for potential photothermal therapy and dual-modal bioimaging.

    Science.gov (United States)

    Sui, Jingting; Liu, Guixia; Song, Yan; Li, Dan; Dong, Xiangting; Wang, Jinxian; Yu, Wensheng

    2018-01-15

    Multifunctional nanocomposites (NCs) incorporating magnetic, luminescent and photothermal conversion properties are endowed with potential application in many fields such as imaging, tumor detection, drug delivery and therapy. Here, multifunctional MWCNTs-NaGdF4:Yb3+, Er3+, Eu3+ NCs, which offer the potential for integrated bioimaging and photothermal therapy (PTT) were fabricated by a facile hydrothermal method. The resulting sample exhibits uniform morphology, bright dual-modal luminescence and intrinsic paramagnetic properties. Under near-infrared laser excitation, NCs have excellent photothermal conversion properties. In addition, the MTT assay in HeLa cells shows that the NCs have good biocompatibility. Moreover, the up-conversion luminescence (UCL) imaging, X-ray computed tomography (CT) imaging and PTT in vitro of NCs were investigated. The results indicate that NCs can be used for dual-modal imaging-guided diagnose and PTT of cancer cells. Copyright © 2017 Elsevier Inc. All rights reserved.

  18. Technology Research, Integration, and Demonstration (TRIAD) Program, Delivery Order 0013: High Strain Rate Tension Testing of Titanium 6-2-4-2S at Temperature

    Science.gov (United States)

    2016-06-01

    SMART Lab Point of contact : John Chumack Telephone/Fax: 937-229-4426 Address: Manufacturer: MTS 2 Poster Frame & controller Manufacturer’s reference...public release. Distribution is unlimited. Station# 6 Goekel_AFRL_High Rate Tensile Program LB9021 Testing laboratory: SMART Lab Point of contact ...Dantec Dyanmics Q400 low speed imaging system, 17mm lens Dantec Dynamics Q450 high speed DIC 3D Imaging Camera system 100mm lenses & 3x extentions

  19. Real-World Effectiveness of a Medically Supervised Weight Management Program in a Large Integrated Health Care Delivery System: Five-Year Outcomes

    Science.gov (United States)

    Krishnaswami, Ashok; Ashok, Rohini; Sidney, Stephen; Okimura, Michael; Kramer, Beth; Hogan, Lindsey; Sorel, Michael; Pruitt, Sheri; Smith, Wayne

    2018-01-01

    Context There are insufficient data on the long-term, nonsurgical, nonpharmacologic treatment of obesity. Objective To determine changes in weight over 5 years in participants enrolled between April 1, 2007, and December 31, 2014, in a medically supervised weight management program at Kaiser Permanente Northern California Medical Centers. The program consisted of 3 phases: Complete meal replacement for 16 weeks; transition phase, 17 to 29 weeks; and lifestyle maintenance phase, 30 to 82 weeks. Design Retrospective observational study of 10,693 participants (2777 available for analysis at 5 years); no comparator group. Main Outcome Measures Average change in weight from baseline to follow-up. Results Average age was 51.1 (standard deviation = 12.4) years, and 72.8% were women. Average baseline weight in the entire cohort was 112.9 kg (standard error [SE] = 0.23). Weight (kg) significantly changed over time: 4 months, −17.3 (SE = 0.12); 1 year, −14.2 (SE = 0.12); 2 years, −8.6 (SE = 0.14); 3 years, −6.9 (SE = 0.17); 4 years, −6.5 (SE = 0.16), and 5 years, −6.4 (SE = 0.29); p obese adults who participated in a medically supervised weight management program, with available 5-year data, was a statistically and clinically significant 5.8% weight loss from baseline. PMID:29401050

  20. Automated Modal Parameter Estimation of Civil Engineering Structures

    DEFF Research Database (Denmark)

    Andersen, Palle; Brincker, Rune; Goursat, Maurice

    In this paper the problems of doing automatic modal parameter extraction of ambient excited civil engineering structures is considered. Two different approaches for obtaining the modal parameters automatically are presented: The Frequency Domain Decomposition (FDD) technique and a correlation...

  1. PACS storage requirements - influence of changes in imaging modalities

    NARCIS (Netherlands)

    van Ooijen, PMA; ten Bhomer, PJM; Oudkerk, M; Lemke, HU; Inamura, K; Doi, K; Vannier, MW; Farman, AG

    2005-01-01

    In current radiology departments, imaging modalities are changing rapidly. One reason for these changes is the continuous technical development providing new imaging modalities with higher spatial and temporal resolution and increased capabilities. Another important reason for change is the

  2. Evaluation of Retrofit Delivery Packages

    Energy Technology Data Exchange (ETDEWEB)

    Berman, M.; Smith, P.; Porse, E.

    2013-07-01

    Residential energy retrofit activities are a critical component of efforts to increase energy efficiency in the U.S. building stock; however, retrofits account for a small percentage of aggregate energy savings at relatively high per unit costs. This report by Building America research team, Alliance for Residential Building Innovation (ARBI), describes barriers to widespread retrofits and evaluates opportunities to improve delivery of home retrofit measures by identifying economies of scale in marketing, energy assessments, and bulk purchasing through pilot programs in portions of Sonoma, Los Angeles, and San Joaquin Counties, CA. These targeted communities show potential and have revealed key strategies for program design, as outlined in the report.

  3. Statistical approach for uncertainty quantification of experimental modal model parameters

    DEFF Research Database (Denmark)

    Luczak, M.; Peeters, B.; Kahsin, M.

    2014-01-01

    . This paper aims at a systematic approach for uncertainty quantification of the parameters of the modal models estimated from experimentally obtained data. Statistical analysis of modal parameters is implemented to derive an assessment of the entire modal model uncertainty measure. Investigated structures...... estimates obtained from vibration experiments. Modal testing results are influenced by numerous factors introducing uncertainty to the measurement results. Different experimental techniques applied to the same test item or testing numerous nominally identical specimens yields different test results...

  4. On sine dwell or broadband methods for modal testing

    Science.gov (United States)

    Chen, Jay-Chung; Wada, Ben K.

    1987-01-01

    For large, complex spacecraft structural systems, the objectives of the modal test are outlined. Based on these objectives, the comparison criteria for the modal test methods, namely, the broadband excitation and the sine dwell methods are established. Using the Galileo spacecraft modal test and the Centaur G Prime upper stage vehicle modal test as examples, the relative advantages or disadvantages of each method are examined. The usefulness or shortcoming of the methods are given from a practicing engineer's view point.

  5. Comparison of sine dwell and broadband methods for modal testing

    Science.gov (United States)

    Chen, Jay-Chung

    1989-01-01

    The objectives of modal tests for large complex spacecraft structural systems are outlined. The comparison criteria for the modal test methods, namely, the broadband excitation and the sine dwell methods, are established. Using the Galileo spacecraft modal test and the Centaur G Prime upper stage vehicle modal test as examples, the relative advantage or disadvantage of each method is examined. The usefulness or shortcomings of the methods are given from a practical engineering viewpoint.

  6. Lexical exponents of hypothetical modality in Polish and Lithuanian

    OpenAIRE

    Roman Roszko

    2015-01-01

    Lexical exponents of hypothetical modality in Polish and Lithuanian The article focuses on the lexical exponents of hypothetical modality in Polish and Lithuanian. The purpose for comparing and contrasting the lexical exponents of hypothetical modality is not only to identify all the lexemes in both languages but also find the answer to the following question: whether the morphological exponents of hypothetical modality (so-called modus relativus) familiar to the Lithuanian language have/...

  7. Converging modalities ground abstract categories: the case of politics.

    Science.gov (United States)

    Farias, Ana Rita; Garrido, Margarida V; Semin, Gün R

    2013-01-01

    Three studies are reported examining the grounding of abstract concepts across two modalities (visual and auditory) and their symbolic representation. A comparison of the outcomes across these studies reveals that the symbolic representation of political concepts and their visual and auditory modalities is convergent. In other words, the spatial relationships between specific instances of the political categories are highly overlapping across the symbolic, visual and auditory modalities. These findings suggest that abstract categories display redundancy across modal and amodal representations, and are multimodal.

  8. Early Cervical Neoplasia: Advances in Screening and Treatment Modalities

    Science.gov (United States)

    Tierney, Brent; Westin, Shannon N.; Schlumbrecht, Matthew P.; Ramirez, Pedro T.

    2015-01-01

    Cervical cancer is one of the most common causes of cancer in women worldwide. However, improvements in screening programs and treatment modalities have significantly reduced the morbidity and mortality of this disease. The discovery that infection with the human papillomavirus (HPV) is a crucial part of the causative pathway in cervical cancer pathogenesis has revolutionized screening, and prompted investigations into alternatives to traditional cytologic evaluation which may be useful in low-resource settings. Concomitant with improved screening has been a shift towards greater detection of both pre-invasive and early-stage neoplastic disease. Earlier detection not only allows for surgical management of disease, with the avoidance of chemotherapy and radiation, but also the possibility of fertility preservation. As surgical technologies advance to encompass minimally-invasive procedures, interventions for early-stage cervical cancer are becoming increasingly effective in disease eradication while permitting patients to maintain their quality of life. PMID:20966891

  9. Large-deformation modal coordinates for nonrigid vehicle dynamics

    Science.gov (United States)

    Likins, P. W.; Fleischer, G. E.

    1972-01-01

    The derivation of minimum-dimension sets of discrete-coordinate and hybrid-coordinate equations of motion of a system consisting of an arbitrary number of hinge-connected rigid bodies assembled in tree topology is presented. These equations are useful for the simulation of dynamical systems that can be idealized as tree-like arrangements of substructures, with each substructure consisting of either a rigid body or a collection of elastically interconnected rigid bodies restricted to small relative rotations at each connection. Thus, some of the substructures represent elastic bodies subjected to small strains or local deformations, but possibly large gross deformations, in the hybrid formulation, distributed coordinates referred to herein as large-deformation modal coordinates, are used for the deformations of these substructures. The equations are in a form suitable for incorporation into one or more computer programs to be used as multipurpose tools in the simulation of spacecraft and other complex electromechanical systems.

  10. The modality effect of ego depletion: Auditory task modality reduces ego depletion.

    Science.gov (United States)

    Li, Qiong; Wang, Zhenhong

    2016-08-01

    An initial act of self-control that impairs subsequent acts of self-control is called ego depletion. The ego depletion phenomenon has been observed consistently. The modality effect refers to the effect of the presentation modality on the processing of stimuli. The modality effect was also robustly found in a large body of research. However, no study to date has examined the modality effects of ego depletion. This issue was addressed in the current study. In Experiment 1, after all participants completed a handgrip task, one group's participants completed a visual attention regulation task and the other group's participants completed an auditory attention regulation task, and then all participants again completed a handgrip task. The ego depletion phenomenon was observed in both the visual and the auditory attention regulation task. Moreover, participants who completed the visual task performed worse on the handgrip task than participants who completed the auditory task, which indicated that there was high ego depletion in the visual task condition. In Experiment 2, participants completed an initial task that either did or did not deplete self-control resources, and then they completed a second visual or auditory attention control task. The results indicated that depleted participants performed better on the auditory attention control task than the visual attention control task. These findings suggest that altering task modality may reduce ego depletion. © 2016 Scandinavian Psychological Associations and John Wiley & Sons Ltd.

  11. Quantitative modal determination of geological samples based on X-ray multielemental map acquisition.

    Science.gov (United States)

    Cossio, Roberto; Borghi, Alessandro; Ruffini, Raffaella

    2002-04-01

    Multielemental X-ray maps collected by a remote scanning system of the electron beam are processed by a dedicated software program performing accurate modal determination of geological samples. The classification of different mineral phases is based on elemental concentrations. The software program Petromod loads the maps into a database and computes a matrix consisting of numerical values proportional to the elemental concentrations. After an initial calibration, the program can perform the chemical composition calculated on the basis of a fixed number of oxygens for a selected area. In this way, it is possible to identify all the mineral phases occurring in the sample. Up to three elements can be selected to calculate the modal percentage of the identified mineral. An automated routine scans the whole set of maps and assigns each pixel that satisfies the imposed requirements to the selected phase. Repeating this procedure for every mineral phase occurring in the mapped area, a modal distribution of the rock-forming minerals can be performed. The final output consists of a digitized image, which can be further analyzed by common image analysis software, and a table containing the calculated modal percentages. The method is here applied to a volcanic and a metamorphic rock sample.

  12. Modality effects in implicit Artificial Grammar Learning: an EEG study.

    Science.gov (United States)

    Silva, Susana; Folia, Vasiliki; Inácio, Filomena; Castro, São Luís; Petersson, Karl Magnus

    2018-02-21

    Recently, it has been proposed that sequence learning engages a combination of modality-specific operating networks and modality-independent computational principles. In the present study, we compared the behavioural and EEG outcomes of implicit artificial grammar learning in the visual vs. auditory modality. We controlled for the influence of surface characteristics of sequences (Associative Chunk Strength), thus focusing on the strictly structural aspects of sequence learning, and we adapted the paradigms to compensate for known frailties of the visual modality compared to audition (temporal presentation, fast presentation rate). The behavioural outcomes were similar across modalities. Favouring the idea of modality-specificity, ERPs in response to grammar violations differed in topography and latency (earlier and more anterior component in the visual modality), and ERPs in response to surface features emerged only in the auditory modality. In favour of modality-independence, we observed three common functional properties in the late ERPs of the two grammars: both were free of interactions between structural and surface influences, both were more extended in a grammaticality classification test than in a preference classification test, and both correlated positively and strongly with theta event-related-synchronization during baseline testing. Our findings support the idea of modality-specificity combined with modality-independence, and suggest that memory for visual vs. auditory sequences may largely contribute to cross-modal differences. Copyright © 2018. Published by Elsevier B.V.

  13. Fuzzy Reasoning Based on First-Order Modal Logic,

    NARCIS (Netherlands)

    Zhang, Xiaoru; Zhang, Z.; Sui, Y.; Huang, Z.

    2008-01-01

    As an extension of traditional modal logics, this paper proposes a fuzzy first-order modal logic based on believable degree, and gives out a description of the fuzzy first-order modal logic based on constant domain semantics. In order to make the reasoning procedure between the fuzzy assertions

  14. Towards a Unified Knowledge-Based Approach to Modality Choice

    NARCIS (Netherlands)

    Bachvarova, Y.S.; van Dijk, Elisabeth M.A.G.; Nijholt, Antinus; van der Sluis, I; Theune, Mariet; Reiter, E.; Krahmer, E.

    2007-01-01

    This paper advances a unified knowledge-based approach to the process of choosing the most appropriate modality or combination of modalities in multimodal output generation. We propose a Modality Ontology (MO) that models the knowledge needed to support the two most fundamental processes determining

  15. Modal Testing of Mechanical Structures Subject to Operational Excitation Forces

    DEFF Research Database (Denmark)

    Møller, N.; Brincker, Rune; Herlufsen, H.

    2000-01-01

    Operational Modal Analysis also known as Output Only Modal Analysis has in the recent years been used for extracting modal parameters of civil engineering structures and is now becoming popular for mechanical structures. The advantage of the method is that no artificial excitation need to be appl...

  16. Modal Testing of Mechanical Structures subject to Operational Excitation Forces

    DEFF Research Database (Denmark)

    Møller, N.; Brincker, Rune; Herlufsen, H.

    2001-01-01

    Operational Modal Analysis also known as Output Only Modal Analysis has in the recent years been used for extracting modal parameters of civil engineering structures and is now becoming popular for mechanical structures. The advantage of the method is that no artificial excitation need to be appl...

  17. Electrotherapy modalities for adhesive capsulitis (frozen shoulder).

    Science.gov (United States)

    Page, Matthew J; Green, Sally; Kramer, Sharon; Johnston, Renea V; McBain, Brodwen; Buchbinder, Rachelle

    2014-10-01

    Adhesive capsulitis (also termed frozen shoulder) is a common condition characterised by spontaneous onset of pain, progressive restriction of movement of the shoulder and disability that restricts activities of daily living, work and leisure. Electrotherapy modalities, which aim to reduce pain and improve function via an increase in energy (electrical, sound, light, thermal) into the body, are often delivered as components of a physical therapy intervention. This review is one in a series of reviews which form an update of the Cochrane review 'Physiotherapy interventions for shoulder pain'. To synthesise the available evidence regarding the benefits and harms of electrotherapy modalities, delivered alone or in combination with other interventions, for the treatment of adhesive capsulitis. We searched CENTRAL, MEDLINE, EMBASE, CINAHL Plus and the ClinicalTrials.gov and World Health Organization (WHO) International Clinical Trials Registry Platform (ICTRP) clinical trials registries up to May 2014, unrestricted by language, and reviewed the reference lists of review articles and retrieved trials to identify any other potentially relevant trials. We included randomised controlled trials (RCTs) and controlled clinical trials using a quasi-randomised method of allocation that included adults with adhesive capsulitis and compared any electrotherapy modality to placebo, no treatment, a different electrotherapy modality, or any other intervention. The two main questions of the review focused on whether electrotherapy modalities are effective compared to placebo or no treatment, or if they are an effective adjunct to manual therapy or exercise (or both). The main outcomes of interest were participant-reported pain relief of 30% or greater, overall pain, function, global assessment of treatment success, active shoulder abduction, quality of life, and the number of participants experiencing any adverse event. Two review authors independently selected trials for inclusion

  18. Optimal content delivery with network coding

    OpenAIRE

    Leong, Derek; Ho, Tracey; Cathey, Rebecca

    2009-01-01

    We present a unified linear program formulation for optimal content delivery in content delivery networks (CDNs), taking into account various costs and constraints associated with content dissemination from the origin server to storage nodes, data storage, and the eventual fetching of content from storage nodes by end users. Our formulation can be used to achieve a variety of performance goals and system behavior, including the bounding of fetch delay, load balancing, and robustness against...

  19. [The use of the Debriefing Assessment for Simulation in Healthcare (DASH) in a simulation-based team learning program for newborn resuscitation in the delivery room].

    Science.gov (United States)

    Durand, C; Secheresse, T; Leconte, M

    2017-12-01

    To evaluate the contribution of the Debriefing Assessment for Simulation in Healthcare (DASH, Centre for Medical Simulation, Harvard) in a high-fidelity simulation in situ program used for newborn resuscitation training. The DASH was scored by trainees and instructors at the end of the session. The instructors' feedback and opinions were collected. The study included 16 training sessions (ten maternity units) with 156 trainees and ten instructors (45 DASH). The mean DASH score was rated at 6.6/7 by the learners and 5.4/7 by the instructors. For each element, the instructors scored the DASH lower than the learners (Pdebriefing with high-level DASH scores, thus validating the educational aim of the program. In contrast, the instructors' DASH scores were lower and heterogeneous. Debriefing high-fidelity simulations remains a complex exercise. The use of the DASH can be a helpful measure for instructors in regard of their own practice. Its main advantage could be in providing a validated tool that will allow a "debriefing of debriefing". Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  20. Family group interventions in an early psychosis program: A re-evaluation of practice after 10 years of service delivery.

    Science.gov (United States)

    Day, Kate; Starbuck, Rachael; Petrakis, Melissa

    2017-08-01

    The role of family in supporting service users in coping with illness and engaging in relapse prevention in early psychosis is important. Taking on this caring though is stressful and challenging, and it has been found that support and information for carers assists in their coping and reduces isolation. To evaluate the current utility of a psychoeducation group program in a public adult mental health service, for the families of people experiencing early psychosis. A purpose-designed pre- and post-intervention questionnaire was administered to quantitatively measure group participants' changes in perceptions of their understanding of mental illness and its treatment through attending the group. Additional qualitative items were used to determine other knowledge, benefits and any critical feedback. The group program continues to result in highly significant improvements in family members' understanding of psychosis, recovery, medications, relapse prevention and substance co-morbidities. Additional feedback reaffirmed previous findings that family members find group peer support valuable and that this reduces isolation and the experience of stigma. The current evaluation, conducted following 10 years of early psychosis group work, found there to be efficacy in family peer support groups and that it is important to provide family interventions in public early psychosis mental health services.

  1. Does Modality Matter? The Effects of Reading, Listening, and Dual Modality on Comprehension

    Directory of Open Access Journals (Sweden)

    Beth A. Rogowsky

    2016-09-01

    Full Text Available With advancing technology, there is increasing interest in differences between listening versus reading comprehension or doing both simultaneously. Ninety-one participants were randomly assigned to one of three groups that received the same instructional material (the preface and a chapter from a non-fiction book, but each in a different input modality (digital audiobook, e-text, dual modality. After completing the material, participants took the same comprehension test in written form to establish both immediate comprehension (Time 1 and 2-week retention (Time 2. No statistically significant differences were found for any analyses pertaining to effects of the three different instructional conditions on comprehension at Time 1 or Time 2. Additional analyses showed that both males and females in each condition recalled an equal amount of information, regardless of whether they listened to an audiobook, read from an electronic tablet, or both listened and read simultaneously (dual modality.

  2. Water as an Independent Taste Modality

    Directory of Open Access Journals (Sweden)

    Andrew M Rosen

    2010-10-01

    Full Text Available To qualify as a basic taste quality or modality, defined as a group of chemicals that taste alike, three empirical benchmarks have commonly been used. The first is that a candidate group of tastants must have a dedicated transduction mechanism in the peripheral nervous system. The second is that the tastants evoke physiological responses in dedicated afferent taste nerves innervating the oropharyngeal cavity. Last, the taste stimuli evoke activity in central gustatory neurons, some of which may respond only to that group of tastants. Here we argue that water may also be an independent taste modality. This argument is based on the identification of a water dedicated transduction mechanism in the peripheral nervous system, water responsive fibers of the peripheral taste nerves and the observation of water responsive neurons in all gustatory regions within the central nervous system. We have described electrophysiological responses from single neurons in nucleus of the solitary tract (NTS and parabrachial nucleus of the pons (PbN, respectively the first two central relay nuclei in the rodent brainstem, to water presented as a taste stimulus in anesthetized rats. Responses to water were in some cases as robust as responses to other taste qualities and sometimes occurred in the absence of responses to other tastants. Both excitatory and inhibitory responses were observed. Also, the temporal features of the water response resembled those of other taste responses. We argue that water may constitute an independent taste modality that is processed by dedicated neural channels at all levels of the gustatory neuraxis. Water-dedicated neurons in the brainstem may constitute key elements in the regulatory system for fluid in the body, i.e. thirst, and as part of the swallowing reflex circuitry.

  3. Modality-specificity of selective attention networks

    Directory of Open Access Journals (Sweden)

    Hannah Jamieson Stewart

    2015-11-01

    Full Text Available Objective: To establish the modality specificity and generality of selective attention networks. Method: Forty-eight young adults completed a battery of four auditory and visual selective attention tests based upon the Attention Network framework: the visual and auditory Attention Network Tests (vANT, aANT, the Test of Everyday Attention (TEA, and the Test of Attention in Listening (TAiL. These provided independent measures for auditory and visual alerting, orienting, and conflict resolution networks. The measures were subjected to an exploratory factor analysis to assess underlying attention constructs. Results: The analysis yielded a four-component solution. The first component comprised of a range of measures from the TEA and was labeled ‘general attention’. The third component was labeled ‘auditory attention’, as it only contained measures from the TAiL using pitch as the attended stimulus feature. The second and fourth components were labeled as ‘spatial orienting’ and ‘spatial conflict’, respectively – they were comprised of orienting and conflict resolution measures from the vANT, aANT and TAiL attend-location task – all tasks based upon spatial judgments (e.g., the direction of a target arrow or sound location. Conclusions: These results do not support our a-priori hypothesis that attention networks are either modality specific or supramodal. Auditory attention separated into selectively attending to spatial and non-spatial features, with the auditory spatial attention loading onto the same factor as visual spatial attention, suggesting spatial attention is supramodal. However, since our study did not include a non-spatial measure of visual attention, further research will be required to ascertain whether non-spatial attention is modality-specific.

  4. UAV Delivery Monitoring System

    Directory of Open Access Journals (Sweden)

    San Khin Thida

    2018-01-01

    Full Text Available UAV-based delivery systems are increasingly being used in the logistics field, particularly to achieve faster last-mile delivery. This study develops a UAV delivery system that manages delivery order assignments, autonomous flight operation, real time control for UAV flights, and delivery status tracking. To manage the delivery item assignments, we apply the concurrent scheduler approach with a genetic algorithm. The present paper describes real time flight data based on a micro air vehicle communication protocol (MAVLink. It also presents the detailed hardware components used for the field tests. Finally, we provide UAV component analysis to choose the suitable components for delivery in terms of battery capacity, flight time, payload weight and motor thrust ratio.

  5. Delivery of HIV care during the 2007 post-election crisis in Kenya: a case study analyzing the response of the Academic Model Providing Access to Healthcare (AMPATH) program.

    Science.gov (United States)

    Goodrich, Suzanne; Ndege, Samson; Kimaiyo, Sylvester; Some, Hosea; Wachira, Juddy; Braitstein, Paula; Sidle, John E; Sitienei, Jackline; Owino, Regina; Chesoli, Cleophas; Gichunge, Catherine; Komen, Fanice; Ojwang, Claris; Sang, Edwin; Siika, Abraham; Wools-Kaloustian, Kara

    2013-12-01

    Widespread violence followed the 2007 presidential elections in Kenya resulting in the deaths of a reported 1,133 people and the displacement of approximately 660,000 others. At the time of the crisis the United States Agency for International Development-Academic Model Providing Access to Healthcare (USAID-AMPATH) Partnership was operating 17 primary HIV clinics in western Kenya and treating 59,437 HIV positive patients (23,437 on antiretroviral therapy (ART)). This case study examines AMPATH's provision of care and maintenance of patients on ART throughout the period of disruption. This was accomplished by implementing immediate interventions including rapid information dissemination through the media, emergency hotlines and community liaisons; organization of a Crisis Response leadership team; the prompt assembly of multidisciplinary teams to address patient care, including psychological support staff (in clinics and in camps for internally displaced persons (IDP)); and the use of the AMPATH Medical Records System to identify patients on ART who had missed clinic appointments. These interventions resulted in the opening of all AMPATH clinics within five days of their scheduled post-holiday opening dates, 23,949 patient visits in January 2008 (23,259 previously scheduled), uninterrupted availability of antiretrovirals at all clinics, treatment of 1,420 HIV patients in IDP camps, distribution of basic provisions, mobilization of outreach services to locate missing AMPATH patients and delivery of psychosocial support to 300 staff members and 632 patients in IDP camps. Key lessons learned in maintaining the delivery of HIV care in a crisis situation include the importance of advance planning to develop programs that can function during a crisis, an emphasis on a rapid programmatic response, the ability of clinics to function autonomously, patient knowledge of their disease, the use of community and patient networks, addressing staff needs and developing effective

  6. Diagnostic Approach in Impotence and Imaging Modalities

    Directory of Open Access Journals (Sweden)

    Medih Celiktas

    2015-06-01

    Full Text Available Penile erection results from a complex interplay between central nerveus system and local factors. Several aspects of these interactions have been the subject of many reviews. Nocturnal penile tumescence (NPT monitoring is the best single non-invasive examination to differentiate organic from psychogenic impotence. Angiography and pharmaco-cevernosometry are accepted as gold standard modalities in the assesment of vasculojenic impotence. Recently color Doppler sonography made the detection of vessels easier and the correction of the Doppler angle more accurate, resulting in more rapid and accurate acquisition of data. [Cukurova Med J 2015; 40(2.000: 208-211

  7. Laguerre-Gaussian modal q-plates.

    Science.gov (United States)

    Rafayelyan, Mushegh; Brasselet, Etienne

    2017-05-15

    We propose space-variant uniaxial flat optical elements designed to generate pure Laguerre-Gaussian modes with arbitrary azimuthal and radial indices l and p from an incident Gaussian beam. This is done via the combined use of the dynamic and the geometric phases. Optimal design protocol for the mode conversion efficiency is derived, and the corresponding characteristics are given for -6≤l≤6 and 0≤p≤5. The obtained "modal q-plates" may find many applications whenever the radial degree of freedom of a light field is at play.

  8. Development of Hardware Dual Modality Tomography System

    Directory of Open Access Journals (Sweden)

    R. M. Zain

    2009-06-01

    Full Text Available The paper describes the hardware development and performance of the Dual Modality Tomography (DMT system. DMT consists of optical and capacitance sensors. The optical sensors consist of 16 LEDs and 16 photodiodes. The Electrical Capacitance Tomography (ECT electrode design use eight electrode plates as the detecting sensor. The digital timing and the control unit have been developing in order to control the light projection of optical emitters, switching the capacitance electrodes and to synchronize the operation of data acquisition. As a result, the developed system is able to provide a maximum 529 set data per second received from the signal conditioning circuit to the computer.

  9. Modal Based Fatigue Monitoring of Steel Structures

    DEFF Research Database (Denmark)

    Graugaard-Jensen, J.; Brincker, Rune; Hjelm, H. P.

    2005-01-01

    In this paper it is shown how the accumulated fatigue in steel structures can be estimated with high accuracy by continuously measuring the accelerations in a few points of the structure. First step is to obtain a good estimate of the mode shapes by performing a natural input modal analysis. The so...... by applying the mode shapes of the calibrated Finite Element model and strains are obtained using the shape functions for the actual elements. The technique has been applied on a model frame structure in the laboratory and on a wind loaded lattice pylon structure. In both cases the estimated stresses has been...

  10. Hybrid modal reduction for poroelastic materials

    Science.gov (United States)

    Batifol, Cédric; Ichchou, Mohamed N.; Galland, Marie-Annick

    2008-10-01

    A modal-like projection method for poroelastic materials is proposed and implemented for finite element calculations. Non-physical Dirichlet conditions are imposed at the junction interface, involving constrained fluid displacements and free solid displacements. The ( u,U) formulation is used. The resulting frequency-dependent eigenproblem is solved without simplification using the non-linear Arnoldi algorithm. The projection subspace is spanned by calculated dynamic modes and fluid static boundary functions. A convergence study is performed and results are compared to classical Craig and Bampton and MacNeal approaches. The hybrid basis proves to be efficient. To cite this article: C. Batifol et al., C. R. Mecanique 336 (2008).

  11. Deception Detection, Transmission, & Modality in Age & Sex

    OpenAIRE

    Charlotte Dorothy Sweeney; Ceci, Stephen J.

    2014-01-01

    This study is the first to create and use spontaneous (i.e. unrehearsed) pro-social lies in an ecological setting. Creation of the stimuli involved fifty-one older adult and forty-four college student senders who lied authentically in that their lies were spontaneous in the service of protecting a research assistant. In the main study, seventy-seven older adult and eighty-four college raters attempted to detect lies in the older adult and college senders in three modalities: audio, visual, a...

  12. Ares I-X Launch Vehicle Modal Test Measurements and Data Quality Assessments

    Science.gov (United States)

    Templeton, Justin D.; Buehrle, Ralph D.; Gaspar, James L.; Parks, Russell A.; Lazor, Daniel R.

    2010-01-01

    The Ares I-X modal test program consisted of three modal tests conducted at the Vehicle Assembly Building at NASA s Kennedy Space Center. The first test was performed on the 71-foot 53,000-pound top segment of the Ares I-X launch vehicle known as Super Stack 5 and the second test was performed on the 66-foot 146,000- pound middle segment known as Super Stack 1. For these tests, two 250 lb-peak electro-dynamic shakers were used to excite bending and shell modes with the test articles resting on the floor. The third modal test was performed on the 327-foot 1,800,000-pound Ares I-X launch vehicle mounted to the Mobile Launcher Platform. The excitation for this test consisted of four 1000+ lb-peak hydraulic shakers arranged to excite the vehicle s cantilevered bending modes. Because the frequencies of interest for these modal tests ranged from 0.02 to 30 Hz, high sensitivity capacitive accelerometers were used. Excitation techniques included impact, burst random, pure random, and force controlled sine sweep. This paper provides the test details for the companion papers covering the Ares I-X finite element model calibration process. Topics to be discussed include test setups, procedures, measurements, data quality assessments, and consistency of modal parameter estimates.

  13. How much does it cost to get a dose of vaccine to the service delivery location? Empirical evidence from Vietnam's Expanded Program on Immunization.

    Science.gov (United States)

    Mvundura, Mercy; Kien, Vu Duy; Nga, Nguyen Tuyet; Robertson, Joanie; Cuong, Nguyen Van; Tung, Ho Thanh; Hong, Duong Thi; Levin, Carol

    2014-02-07

    Few studies document the costs of operating vaccine supply chains, but decision-makers need this information to inform cost projections for investments to accommodate new vaccine introduction. This paper presents empirical estimates of vaccine supply chain costs for Vietnam's Expanded Program on Immunization (EPI) for routine vaccines at each level of the supply chain, before and after the introduction of the pentavalent vaccine. We used micro-costing methods to collect resource-use data associated with storage and transportation of vaccines and immunization supplies at the national store, the four regional stores, and a sample of provinces, districts, and commune health centers. We collected stock ledger data on the total number of doses of vaccines handled by each facility during the assessment year. Total supply chain costs were estimated at approximately US$65,000 at the national store and an average of US$39,000 per region, US$5800 per province, US$2200 per district, and US$300 per commune health center. Across all levels, cold chain equipment capital costs and labor were the largest drivers of costs. The cost per dose delivered was estimated at US$0.19 before the introduction of pentavalent and US$0.24 cents after introduction. At commune health centers, supply chain costs were 104% of the value of vaccines before introduction of pentavalent vaccine and 24% after introduction, mainly due to the higher price per dose of the pentavalent vaccine. The aggregated costs at the last tier of the health system can be substantial because of the large number of facilities. Even in countries with high-functioning systems, empirical evidence on current costs from all levels of the system can help estimate resource requirements for expanding and strengthening resources to meet future immunization program needs. Other low- and middle-income countries can benefit from similar studies, in view of new vaccine introductions that will put strains on existing systems. Copyright

  14. The Electrode Modality Development in Pulsed Electric Field Treatment Facilitates Biocellular Mechanism Study and Improves Cancer Ablation Efficacy

    OpenAIRE

    Cen, Chao; Chen, Xinhua

    2017-01-01

    Pulsed electric field treatment is now widely used in diverse biological and medical applications: gene delivery, electrochemotherapy, and cancer therapy. This minimally invasive technique has several advantages over traditional ablation techniques, such as nonthermal elimination and blood vessel spare effect. Different electrodes are subsequently developed for a specific treatment purpose. Here, we provide a systematic review of electrode modality development in pulsed electric field treatme...

  15. Nanoparticle-based drug delivery to the vagina: a review

    Science.gov (United States)

    Ensign, Laura M.; Cone, Richard; Hanes, Justin

    2014-01-01

    Vaginal drug administration can improve prophylaxis and treatment of many conditions affecting the female reproductive tract, including sexually transmitted diseases, fungal and bacterial infections, and cancer. However, achieving sustained local drug concentrations in the vagina can be challenging, due to the high permeability of the vaginal epithelium and expulsion of conventional soluble drug dosage forms. Nanoparticle-based drug delivery platforms have received considerable attention for vaginal drug delivery, as nanoparticles can provide sustained release, cellular targeting, and even intrinsic antimicrobial or adjuvant properties that can improve the potency and/or efficacy of prophylactic and therapeutic modalities. Here, we review the use of polymeric nanoparticles, liposomes, dendrimers, and inorganic nanoparticles for vaginal drug delivery. Although most of the work toward nanoparticle-based drug delivery in the vagina has been focused on HIV prevention, strategies for treatment and prevention of other sexually transmitted infections, treatment for reproductive tract cancer, and treatment of fungal and bacterial infections are also highlighted. PMID:24830303

  16. Animal models for evaluation of oral delivery of biopharmaceuticals

    DEFF Research Database (Denmark)

    Harloff-Helleberg, Stine; Nielsen, Line Hagner; Nielsen, Hanne Mørck

    2017-01-01

    of systems for oral delivery of biopharmaceuticals may result in new treatment modalities to increase the patient compliance and reduce product cost. In the preclinical development phase, use of experimental animal models is essential for evaluation of new formulation designs. In general, the limited oral...... bioavailability of biopharmaceuticals, of just a few percent, is expected, and therefore, the animal models and the experimental settings must be chosen with utmost care. More knowledge and focus on this topic is highly needed, despite experience from the numerous studies evaluating animal models for oral drug...... delivery of small molecule drugs. This review highlights and discusses pros and cons of the most currently used animal models and settings. Additionally, it also looks into the influence of anesthetics and sampling methods for evaluation of drug delivery systems for oral delivery of biopharmaceuticals...

  17. MENDORONG PASAR MODAL EFISIEN DAN BERDAYA SAING GLOBAL

    Directory of Open Access Journals (Sweden)

    Satia Nur Maharani

    2006-01-01

    Full Text Available Globalisasi semakin memperpendek jarak dan waktu. Kemampuannya mampu  merubah wajah planet bumi menjadi” just a small village “ melalui peningkatan ilmu pengetahuan dan teknologi. Perubahan tersebut bertransformasi pula pada  sistem ekonomi. Modal berdiri sendiri tanpa identitas dan siapa saja berhak untuk berinvestasi tanpa batas melalui sebuah mekanisme antar negara dan benua. Salah satu lintasan modal untuk meraih keuntungan adalah melalui mekanisme pasar modal. Pasar modal manakah yang diminati oleh arus modal masuk adalah pasar modal yang mampu memberikan jamuan terbaik berupa keuntungan yang tinggi dengan resiko yang optimal. Maka untuk mencapai pelayan yang maksimal bagi masyarakat pemodal , pasar modal harus efisien dan berdaya saing global. Maka keterbukaan informasi, peningkatan teknologi, efisiensi biaya penegakan hukum, partisipasi masyarakat dan pemerintah, inovasi produk mutlak untuk dievaluasi dan ditingkatkan

  18. The expressive power of modal logic with inclusion atoms

    Directory of Open Access Journals (Sweden)

    Lauri Hella

    2015-09-01

    Full Text Available Modal inclusion logic is the extension of basic modal logic with inclusion atoms, and its semantics is defined on Kripke models with teams. A team of a Kripke model is just a subset of its domain. In this paper we give a complete characterisation for the expressive power of modal inclusion logic: a class of Kripke models with teams is definable in modal inclusion logic if and only if it is closed under k-bisimulation for some integer k, it is closed under unions, and it has the empty team property. We also prove that the same expressive power can be obtained by adding a single unary nonemptiness operator to modal logic. Furthermore, we establish an exponential lower bound for the size of the translation from modal inclusion logic to modal logic with the nonemptiness operator.

  19. Potential Therapeutic Modalities in Cancer Gene Therapy

    Directory of Open Access Journals (Sweden)

    Prithvi Sinha

    2017-04-01

    Full Text Available In spite of huge concerted efforts, the treatment of cancer, a disease frequently associated with genetic alterations caused due to hereditary or environmental factors, remains a challenge. The last few years have witnessed emergence of several innovative and effective modalities for the treatment of solid tumours and hematological malignancies. Gene therapy has shown enormous potential for cancer treatment, especially for metastatic cancers which unlike localized solid tumours, may not be amenable to surgery or other treatment options. Gene therapy aims to introduce a correct copy of the malfunctioning gene in the tumour environment by using viral or non-viral methods to impede or inhibit its growth. This review provides an overview of three main approaches for cancer gene therapy namely immunotherapy, oncolytic therapy and gene transfer therapy. Immunotherapy augments the host immune system in order to destroy cancer cells while oncolytic therapy uses genetically engineered viruses such as to effectively kill cancer cells. Clinical studies so far have shown that cells can be engineered to express gene products that can specifically target cancer cells and prevents their growth and metastasis. Though gene therapy for cancer is yet to see extensive clinical use, it is likely that in combination with other treatment modalities, it will help in controlling and possibly curing cancer in the near future.

  20. Vulnerable Plaques, Inflammation and Newer Imaging Modalities

    Directory of Open Access Journals (Sweden)

    Bhatia V

    2003-01-01

    Full Text Available Currently, inflammation is considered to be the central player in the pathogenesis of atherosclerosis. It leads to the formation of multiple plaques in the arterial beds including coronary vasculature. Recent studies using the latest imaging techniques have shown that in patients with acute coronary syndromes (ACS multiple plaques are ruptured and have thrombus formation on them. Various factors make these plaques unstable, these include structural components of plaque like thin fibrous cap, high lipid content of the plaque core and inflammation, both localized and generalized. It has been shown that most of the ACS are caused by plaques causing non-critical stenosis as seen on traditional X-ray angiography. Also, the phenomenon of remodelling makes angiography a poor technique for plaque visualization. Hence newer modalities are required to identify these 'vulnerable plaques'. Intravascular ultrasound (IVUS, thermography and Magnetic Resonance Imaging (MRI are a few such promising techniques. Here we review the invasive and non-invasive modalities that can be helpful in the identification of these plaques before they become unstable and cause ACS, and also the available therapies to stabilize these plaques.

  1. Short communication: Change in dose delivery of prostaglandin F2α in a 5-day timed artificial insemination program in lactating dairy cows.

    Science.gov (United States)

    Stevenson, J S; Pulley, S L; Hill, S L

    2013-09-01

    We hypothesized that 50mg of prostaglandin F2α (PG) on d 6 would induce luteolysis in a traditional 5-d Ovsynch-72 program [GnRH 5 d before (d 0) and 72 h after (d 8) 25-mg PG doses (d 5 and 6 after GnRH); timed artificial insemination (AI) on d 8]. Experiment 1 monitored luteal regression of original and GnRH-induced luteal tissue (corpus luteum, CL) by transrectal ultrasonography and blood serum concentrations of progesterone after both 25-mg doses of PG (d 5 and 6; control; n=31) or a single 50-mg dose of PG on d 6 (n=30). Estrous cycles were presynchronized (GnRH 7d before 25 mg of PG); 11 d later, cows were enrolled in a 5-d Ovsynch-72 program (62 to 71 d in milk) and treatments were administered. Blood was sampled for progesterone analysis and luteal structures were measured on d 0 (original CL) and d 5 through 9 to monitor original and new GnRH-induced CL. Control PG reduced luteal tissue area of original CL on d 6 and 7 compared with PG administered only on d 6, but no difference between treatments was detected by d 9. In contrast, no differences were detected in luteal tissue area of the induced CL on d 5 through 9. Serum progesterone on d 5 through 9 differed only on d 6 for control and the 50-mg dose. Luteolysis occurred in all 31 controls, but luteolytic failure occurred in 2 of 30 cows receiving 50mg, in which no CL were present on d 0 but 1 or 3 new CL were present on d 5 in these 2 cows. Pregnancy outcome 32 d after AI was 14 of 30 (40%) compared with 15 of 30 (50%) for control versus 50-mg dose, respectively. Experiment 2 monitored luteolysis in nonpregnant repeat-service cows subsequently treated with the same 2 treatments as in experiment 1. Serum progesterone in 63 cows (serum progesterone ≥1 ng/mL on d 5) on d 5, 6, and 8 differed only on d 6 for control and the 50-mg dose. Luteolysis occurred in 32 of 34 controls and in 29 of 29 cows treated with 50mg. Pregnancy outcome 32 d after AI was 17 of 33 (52%) compared with 13 of 29 (45%) for

  2. Vaginal delivery of breech presentation.

    Science.gov (United States)

    Kotaska, Andrew; Menticoglou, Savas; Gagnon, Robert

    2009-06-01

    To review the physiology of breech birth; to discern the risks and benefits of a trial of labour versus planned Caesarean section; and to recommend to obstetricians, family physicians, midwives, obstetrical nurses, anaesthesiologists, pediatricians, and other health care providers selection criteria, intrapartum management parameters, and delivery techniques for a trial of vaginal breech birth. Trial of labour in an appropriate setting or delivery by pre-emptive Caesarean section for women with a singleton breech fetus at term. Reduced perinatal mortality, short-term neonatal morbidity, long-term infant morbidity, and short- and long-term maternal morbidity and mortality. Medline was searched for randomized trials, prospective cohort studies, and selected retrospective cohort studies comparing planned Caesarean section with a planned trial of labour; selected epidemiological studies comparing delivery by Caesarean section with vaginal breech delivery; and studies comparing long-term outcomes in breech infants born vaginally or by Caesarean section. Additional articles were identified through bibliography tracing up to June 1, 2008. The evidence collected was reviewed by the Maternal Fetal Medicine Committee of the Society of Obstetricians and Gynaecologists of Canada (SOGC) and quantified using the criteria and classifications of the Canadian Task Force on Preventive Health Care. This guideline was compared with the 2006 American College of Obstetrician's Committee Opinion on the mode of term singleton breech delivery and with the 2006 Royal College of Obstetrician and Gynaecologists Green Top Guideline: The Management of Breech Presentation. The document was reviewed by Canadian and International clinicians with particular expertise in breech vaginal delivery. The Society of Obstetricians and Gynaecologists of Canada. SUMMARY STATEMENTS: 1. Vaginal breech birth can be associated with a higher risk of perinatal mortality and short-term neonatal morbidity than

  3. Learning Modalities and Delivery Systems for Officer Professional Development Period 3: Literature Review

    Science.gov (United States)

    2014-06-01

    learning objectives must be clearly defined in terms of actionable outcomes. While both education and training share the psychological constructs of...1980). The modern practice of adult education : From pedagogy to andragogy. Englewood Cliffs: Prentice Hall/Cambridge. Retrieved from http...OECD CERI. (2005). E Learning in Tertiary Education : Where do we stand? OECD. Ormrod, J. E. (2006). Educational psychology : Developing learners (5th ed

  4. Magnetofluorescent Carbon Dots Derived from Crab Shell for Targeted Dual-Modality Bioimaging and Drug Delivery.

    Science.gov (United States)

    Yao, Yueh-Yun; Gedda, Gangaraju; Girma, Wubshet Mekonnen; Yen, Chia-Liang; Ling, Yong-Chien; Chang, Jia-Yaw

    2017-04-26

    We propose a one-pot microwave-assisted pyrolysis method for fabrication of magnetofluorescent carbon quantum dots (MFCQDs), using a combination of waste crab shell and three different transition-metal ions, Gd(3+), Mn(2+), and Eu(3+), referred to as Gd@CQDs, Mn@CQDs, and Eu@CQDs, respectively. Chitin from waste crab shell acted not only as a carbon source but also as a chelating ligand to form complexes with transition-metal ions. Gd@CQDs exhibited a high r1 relaxivity of 4.78 mM(-1)·s(-1) and a low r2/r1 ratio of 1.33, suggesting that they show excellent potential as a T1 contrast agent. Mn@CQDs and Eu@CQDs showed high r2 relaxivity values of 140.7 and 28.32 mM(-1)·s(-1), respectively, suggesting their potential for use as T2 contrast agents. Further conjugation of Gd@CQDs with folic acid (FA) enabled specific targeting to folate receptor-positive HeLa cells, as confirmed via in vitro magnetic resonance and fluorescence imaging. Doxorubicin (DOX) was selected as a model drug for conjugation with FA-Gd@CQDs. The as-prepared nanocomposites showed significantly higher cytotoxicity toward HeLa cells than free DOX. No apparent cytotoxicity was observed in vivo (zebrafish embryos) or in vitro (cell viability), suggesting that MFCQDs show potential for development as diagnostic probes or theranostic agents.

  5. Modalities through the looking glass: a study on coalgebraic modal logics and their applications

    NARCIS (Netherlands)

    Leal, R.A.

    2011-01-01

    Raúl Andrés Leal deed onderzoek naar coalgebra’s en modale logica’s. Coalgabra’s vormen de basis voor een wiskundig theorie van computersystemen. Met coalgabra’s kunnen systemen bestudeerd worden waartoe slechts beperkt toegang is, of waarvan de toestanden niet volledig bekend zijn. Dit heet het

  6. English Modal Verbs in Modal Verb Phrase Structures and Lexical Associations of Modality in ‘Standard Terms and Conditions of Sale’

    Directory of Open Access Journals (Sweden)

    Nataša Gajšt

    2012-12-01

    Full Text Available This paper presents the findings of a corpus-based analysis of English modal verbs and semi-modals in modal verb phrase structures as well as lexical association of modality in ‘standard terms and conditions of sale’, which are legally binding documents in the domain of commerce and whose purpose is to govern the obligations and rights of sellers and buyers in the transaction of goods for payment. Our research has established that the most frequent modal verbs in these documents are shall, will, may, must and can, and that the most common modal verb phrase structures in are ‘modal+infinitive’ and ‘modal+be+past participle’. We found 718 different lexical verbs that indicate actions, states and conditions associated with commercial transactions. These results correspond with the definition of these documents. Our findings are a demonstration of how language expresses the characteristics of a legal text type in a professional domain of commerce/trade.

  7. HEAVY-DUTY DIESEL VEHICLE MODAL EMISSION MODEL (HDDV-MEM): VOLUME I: MODAL EMISSION MODELING FRAMEWORK; VOLUME II: MODAL COMPONENTS AND OUTPUTS

    Science.gov (United States)

    This research outlines a proposed Heavy-Duty Diesel Vehicle Modal Emission Modeling Framework (HDDV-MEMF) for heavy-duty diesel-powered trucks and buses. The heavy-duty vehicle modal modules being developed under this research effort, although different, should be compatible wi...

  8. Bioadhesive delivery systems for mucosal vaccine delivery.

    Science.gov (United States)

    Baudner, Barbara C; O'Hagan, Derek T

    2010-12-01

    Mucosal vaccine delivery potentially induces mucosal as well as systemic immune responses and may have advantages particularly for optimal protection against pathogens that infect the host through mucosal surfaces. However, the delivery of antigens through mucosal membranes remains a major challenge due to unfavorable physiological conditions (pH and enzymes) and significant biological barriers, which restrict the uptake of antigens. To improve mucosal vaccine delivery, the use of bioadhesive delivery systems offers numerous advantages, including protection from degradation, increasing concentration of antigen in the vicinity of mucosal tissue for better absorption, extending their residence time, and/or targeting them to sites of antigen uptake. Although some bioadhesives have direct immune stimulating properties, it appears most likely that successful mucosal vaccination will require the addition of vaccine adjuvants for optimal immune responses, particularly if they are to be used in an unprimed population. Thus, complex vaccine formulations and delivery strategies have to be carefully designed to appropriately stimulate immune response for the target pathogen. In addition, careful consideration is needed to define the "best" route for mucosal immunization for each individual pathogen.

  9. Electrotherapy modalities for rotator cuff disease.

    Science.gov (United States)

    Page, Matthew J; Green, Sally; Mrocki, Marshall A; Surace, Stephen J; Deitch, Jessica; McBain, Brodwen; Lyttle, Nicolette; Buchbinder, Rachelle

    2016-06-10

    Management of rotator cuff disease may include use of electrotherapy modalities (also known as electrophysical agents), which aim to reduce pain and improve function via an increase in energy (electrical, sound, light, or thermal) into the body. Examples include therapeutic ultrasound, low-level laser therapy (LLLT), transcutaneous electrical nerve stimulation (TENS), and pulsed electromagnetic field therapy (PEMF). These modalities are usually delivered as components of a physical therapy intervention. This review is one of a series of reviews that form an update of the Cochrane review, 'Physiotherapy interventions for shoulder pain'. To synthesise available evidence regarding the benefits and harms of electrotherapy modalities for the treatment of people with rotator cuff disease. We searched the Cochrane Central Register of Controlled Trials (CENTRAL; 2015, Issue 3), Ovid MEDLINE (January 1966 to March 2015), Ovid EMBASE (January 1980 to March 2015), CINAHL Plus (EBSCOhost, January 1937 to March 2015), ClinicalTrials.gov and the WHO ICTRP clinical trials registries up to March 2015, unrestricted by language, and reviewed the reference lists of review articles and retrieved trials, to identify potentially relevant trials. We included randomised controlled trials (RCTs) and quasi-randomised trials, including adults with rotator cuff disease (e.g. subacromial impingement syndrome, rotator cuff tendinitis, calcific tendinitis), and comparing any electrotherapy modality with placebo, no intervention, a different electrotherapy modality or any other intervention (e.g. glucocorticoid injection). Trials investigating whether electrotherapy modalities were more effective than placebo or no treatment, or were an effective addition to another physical therapy intervention (e.g. manual therapy or exercise) were the main comparisons of interest. Main outcomes of interest were overall pain, function, pain on motion, patient-reported global assessment of treatment success

  10. Project delivery system (PDS)

    CERN Document Server

    2001-01-01

    As business environments become increasingly competitive, companies seek more comprehensive solutions to the delivery of their projects. "Project Delivery System: Fourth Edition" describes the process-driven project delivery systems which incorporates the best practices from Total Quality and is aligned with the Project Management Institute and ISO Quality Standards is the means by which projects are consistently and efficiently planned, executed and completed to the satisfaction of clients and customers.

  11. A modal view of atmospheric variability

    Science.gov (United States)

    Zagar, Nedjeljka

    2014-05-01

    Eigensolutions of the linearized primitive equations, known as normal modes, have been in use for almost forty years. In particular, their application has been extensively pursued in eighties through the development of the nonlinear normal-mode initialization for numerical weather prediction. In addition, global horizontal structures of normal modes, known as Hough functions, have been used to identify the large-scale structure of some of the leading balanced (quasi-rotational or Rossby type) modes in the atmosphere. However, the main application of normal modes with respect to observations has been in the Tropics; here, the Kelvin, the mixed Rossby-gravity and the equatorially trapped Rossby and inertio-gravity (IG) modes with the lowest meridional mode have been associated with the most energetic modes of variability in both the atmosphere and the ocean. Recently an application of 3D-orthogonal normal-mode function (NMF) formulation has been revived focusing on model levels in order to analyze in details data assimilation systems and analysis datasets (e.g. Zagar et a., 2013). A goal is to quantify the unbalanced component of global circulation and its role in data assimilation and predictability. Namely, today's global observing systems, data assimilation modelling and reanalysis datasets have reached a resolution and stage which allow realistic representation of gravity waves. The applied modal analysis provides an attractive way to quantify the IG component by splitting circulation into parts projecting on the vorticity-dominated and divergence-dominated (IG) components. The approach is particularly suitable for the tropics where the IG circulation dominates on all scales. Three-dimensional orthogonality allows quantification of energy in each horizontal and vertical scale and mode type therefore filtering the IG circulation, its variability and its comparison between reanalyses and climate models. I would presents the modal view of time-averaged and time

  12. Factors influencing access to education, decision making, and receipt of preferred dialysis modality in unplanned dialysis start patients

    DEFF Research Database (Denmark)

    Machowska, Anna; Alscher, Mark Dominik; Vanga, Satyanarayana Reddy

    2016-01-01

    Objectives: Unplanned dialysis start (UPS) leads to worse clinical outcomes than planned start, and only a minority of patients ever receive education on this topic and are able to make a modality choice, particularly for home dialysis. This study aimed to determine the predictive factors....../countries is an important predictor of UPS patient management and modality choice independent of patient-related factors. Additional work is required to understand and improve patient pathways to ensure that modality preference is enacted. There appears to be a cost benefit of delivering education, supporting choice...... for patients receiving education, making a decision, and receiving their preferred modality choice in UPS patients following a UPS educational program (UPS-EP). Methods: The Offering Patients Therapy Options in Unplanned Start (OPTiONS) study examined the impact of the implementation of a specific UPS...

  13. Monte Carlo simulations of medical imaging modalities

    Energy Technology Data Exchange (ETDEWEB)

    Estes, G.P. [Los Alamos National Lab., NM (United States)

    1998-09-01

    Because continuous-energy Monte Carlo radiation transport calculations can be nearly exact simulations of physical reality (within data limitations, geometric approximations, transport algorithms, etc.), it follows that one should be able to closely approximate the results of many experiments from first-principles computations. This line of reasoning has led to various MCNP studies that involve simulations of medical imaging modalities and other visualization methods such as radiography, Anger camera, computerized tomography (CT) scans, and SABRINA particle track visualization. It is the intent of this paper to summarize some of these imaging simulations in the hope of stimulating further work, especially as computer power increases. Improved interpretation and prediction of medical images should ultimately lead to enhanced medical treatments. It is also reasonable to assume that such computations could be used to design new or more effective imaging instruments.

  14. Nanophotonic modal dichroism: mode-multiplexed modulators.

    Science.gov (United States)

    Das, Susobhan; Fardad, Shima; Kim, Inki; Rho, Junsuk; Hui, Rongqing; Salandrino, Alessandro

    2016-09-15

    As the diffraction limit is approached, device miniaturization to integrate more functionality per area becomes more and more challenging. Here we propose a strategy to increase the functionality-per-area by exploiting the modal properties of a waveguide system. With such an approach the design of a mode-multiplexed nanophotonic modulator relying on the mode-selective absorption of a patterned indium-tin-oxide (ITO) is proposed. Full-wave simulations of a device operating at the telecom wavelength of 1550 nm show that two modes can be independently modulated, while maintaining performances in line with conventional single-mode ITO modulators reported in the recent literature. The proposed design principles can pave the way to a class of mode-multiplexed compact photonic devices able to effectively multiply the functionality-per-area in integrated photonic systems.

  15. The elementary fusion modalities of osteoclasts

    DEFF Research Database (Denmark)

    Søe, Kent; Hobolt-Pedersen, Anne-Sofie; Delaisse, Jean-Marie

    2015-01-01

    , are not known for the osteoclast. Here we show that osteoclast fusion partners are characterized by differences in mobility, nuclearity, and differentiation level. Our demonstration was based on time-laps videos of human osteoclast preparations from three donors where 656 fusion events were analyzed. Fusions......The last step of the osteoclast differentiation process is cell fusion. Most efforts to understand the fusion mechanism have focused on the identification of molecules involved in the fusion process. Surprisingly, the basic fusion modalities, which are well known for fusion of other cell types...... between a mobile and an immobile partner were most frequent (62%), while fusion between two mobile (26%) or two immobile partners (12%) was less frequent (pfusion partner contained more nuclei than the mobile one (p

  16. A dual-modality photoswitchable supramolecular polymer.

    Science.gov (United States)

    Zhang, Qiwei; Qu, Da-Hui; Wu, Junchen; Ma, Xiang; Wang, Qiaochun; Tian, He

    2013-04-30

    Covalent or noncovalent linked polymers with stimuli-responsive properties have been well researched as a kind of advanced functional materials. However, little effort has been devoted to establishing a bridge for switching between covalent polymers and noncovalent polymers. Actually, such unitive system is promising because it can combine their chemical advantages of two types of polymers in a single and tunable platform. Herein, by taking advantage of reversible photodimerization of coumarins and host-guest assemblies with γ-cyclodextrin (γ-CD), we demonstrate a simple and effective way to construct a dual-modality supramolecular polymer, which can be switched between a noncovalent polymer and its corresponding covalent polymer in response to light stimuli. Moreover, this unique switchable polymer can also be employed to construct a dual-stimuli responsive supramolecular hydrogel with the surfactant cetyl trimethylammonium bromide (CTAB). This methodology establishes a bridge between the two "polymer mansions" and is promising to open a new class of photoswitchable materials.

  17. Hydrogen storage and delivery system development

    Energy Technology Data Exchange (ETDEWEB)

    Handrock, J.L.; Wally, K.; Raber, T.N. [Sandia National Labs., Livermore, CA (United States)

    1995-09-01

    Hydrogen storage and delivery is an important element in effective hydrogen utilization for energy applications and is an important part of the FY1994-1998 Hydrogen Program Implementation Plan. The purpose of this project is to develop a platform for the engineering evaluation of hydrogen storage and delivery systems with an added focus on lightweight hydride utilization. Hybrid vehicles represent the primary application area of interest, with secondary interests including such items as existing vehicles and stationary uses. The near term goal is the demonstration of an internal combustion engine/storage/delivery subsystem. The long term goal is optimization of storage technologies for both vehicular and industrial stationary uses. In this project an integrated approach is being used to couple system operating characteristics to hardware development. A model has been developed which integrates engine and storage material characteristics into the design of hydride storage and delivery systems. By specifying engine operating parameters, as well as a variety of storage/delivery design features, hydride bed sizing calculations are completed. The model allows engineering trade-off studies to be completed on various hydride material/delivery system configurations. A more generalized model is also being developed to allow the performance characteristics of various hydrogen storage and delivery systems to be compared (liquid, activated carbon, etc.). Many of the features of the hydride storage model are applicable to the development of this more generalized model.

  18. STRUKTUR MODAL DAN MODAL KERJA PT XYZ SERTA PENGARUHNYA TERHADAP KINERJA PERUSAHAAN

    Directory of Open Access Journals (Sweden)

    Untung Setiono

    2017-01-01

    Full Text Available n 2012, the electronic payment system transactions reached IDR 104.830 trillion or increase 46,52% from the previous year.  PT. XYZ is the  pioneer in the electronic payment system Indonesia  and still one of the leading companies in electronic payment system interbank, through ATM (Automatic Teller Machine and EDC (Electronic Data Capture in Indonesia.  In 2012 the company spent USD 3,4 million on software tandem from a foreign vendor.  Therefore it is important to study (1 policy on the modal structure of the company, (2 the working capital policy of the company, (3 the monetary performance relationship of the company based on the 2 policies.  The method used to analyze the data is multiple linear regression analysis; this method is used to calculate the relationship between the structure variable of the capital and working capital.  The result is; 1 the structure policy on the capital of the company is in accordance with the Pecking Order theory where the company uses their own capital before applying the long term debt to the others, 2 the inefficient policy on the company’s working capital is because most of the active asset is in monthly deposit bonds and even extended  the active debt, 3 the relationship between short term debt and liquidity ratio is negative while the total debt (short and long term has a positive correlation with the solvability/leverage ratio of the company.  The research recommends the management to decrease the active asset and uses it for long term investment not only for timed deposit.Keywords:  ATM, EDC, capital structure, financial performance     AbstrakVoulme transaksi dalam menggunakan sistem pembayaran elektronis pada tahun 2012 mencapai Rp104.830 triliun atau meningkat sekitar 46,52% dari tahun sebelumnya. PT XYZ adalah salah satu perusahaan pionir dalam sistem bidang pembayaran elektronis di Indonesia dan tetap menjadi pemain utama dalam sistem pembayaran elektronis antar bank, ATM

  19. Chained lightning: part III--Emerging technology, novel therapeutic strategies, and new energy modalities for radiosurgery.

    Science.gov (United States)

    Hoh, Daniel J; Liu, Charles Y; Chen, Joseph C T; Pagnini, Paul G; Yu, Cheng; Wang, Michael Y; Apuzzo, Michael L J

    2007-12-01

    Radiosurgery is fundamentally the harnessing of energy and delivering it to a focal target for a therapeutic effect. The evolution of radiosurgical technology and practice has served toward refining methodologies for better conformal energy delivery. In the past, this has resulted in developing strategies for improved beam generation and delivery. Ultimately, however, our current instrumentation and treatment modalities may be approaching a practical limit with regard to further optimizing energy containment. In looking forward, several strategies are emerging to circumvent these limitations and improve conformal radiosurgery. Refinement of imaging techniques through functional imaging and nanoprobes for cancer detection may benefit lesion localization and targeting. Methods for enhancing the biological effect while reducing radiation-induced changes are being examined through dose fractionation schedules. Radiosensitizers and photosensitizers are being investigated as agents for modulating the biological response of tissues to radiation and alternative energy forms. Discovery of new energy modalities is being pursued through development of microplanar beams, free electron lasers, and high-intensity focused ultrasound. The exploration of these future possibilities will provide the tools for radiosurgical treatment of a broader spectrum of diseases for the next generation.

  20. Thermotherapy with a photoacoustic/ultrasound dual-modality agent

    Science.gov (United States)

    Wang, Yu-Hsin; Liao, Ai-Ho; Chen, Jui-Hao; Lee, Yi-Hsien; Wang, Churng-Ren; Li, Pai-Chi

    2011-03-01

    A microbubble-based imaging/therapeutic agent is introduced. Specifically, gold nanoparticles (AuNRs) are encapsulated in microbubbles (MBs) for both ultrasound (US) imaging and laser-induced thermotherapy (LIT). In addition, this agent, AuNR-MB, takes albumin microbubble as a carrier and includes the AuNRs that maintain the original absorption peak at around 760nm. AuNR-MBs in different sizes are synthesized. Imaging is first performed to evaluate its feasibility. The enhanced PA and US signals in polyacrylamide gel for in vitro study are measured. The PA spectroscopy is then performed and the results generally agree with the measured optical absorption although its peak is slightly broadened and shifted possibly due to mixing. In phantoms, the contrast is 1.531, 2.447, 2.085, 1.994, 0.768, and 0.573 at wavelength of 720, 760, 800, 860, 900, and 940 nm respectively. Finally, the application of the new agent to LIT is presented. A continuous wave laser at 800 nm is used to heat the samples with the power at 1W. The photoacoustic (PA) intensity in the region of interest (ROI) is increased by an average of 5.2dB. The increased signal level implies that the temperature in the ROI can be increased to 44.3°C in aqueous filled setup. Furthermore, the dual-modality agent has the potential to be used in HIFU therapy, drug delivery and loading of DNA for gene transfer.

  1. A Modal Model to Simulate Typical Structural Dynamic Nonlinearity

    Energy Technology Data Exchange (ETDEWEB)

    Pacini, Benjamin Robert [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Mayes, Randall L. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Roettgen, Daniel R [Univ. of Wisconsin, Madison, WI (United States)

    2015-10-01

    Some initial investigations have been published which simulate nonlinear response with almost traditional modal models: instead of connecting the modal mass to ground through the traditional spring and damper, a nonlinear Iwan element was added. This assumes that the mode shapes do not change with amplitude and there are no interactions between modal degrees of freedom. This work expands on these previous studies. An impact experiment is performed on a structure which exhibits typical structural dynamic nonlinear response, i.e. weak frequency dependence and strong damping dependence on the amplitude of vibration. Use of low level modal test results in combination with high level impacts are processed using various combinations of modal filtering, the Hilbert Transform and band-pass filtering to develop response data that are then fit with various nonlinear elements to create a nonlinear pseudo-modal model. Simulations of forced response are compared with high level experimental data for various nonlinear element assumptions.

  2. A mobile phone integrated health care delivery system of medical images.

    Science.gov (United States)

    Tang, Fuk-hay; Law, Maria Y Y; Lee, Ares C H; Chan, Lawrence W C

    2004-09-01

    With the growing computing capability of mobile phones, a handy mobile controller is developed for accessing the picture archiving and communication system (PACS) to enhance image management for clinicians with nearly no restriction in time and location using various wireless communication modes. The PACS is an integrated system for the distribution and archival of medical images that are acquired by different imaging modalities such as CT (computed tomography) scanners, CR (computed radiography) units, DR (digital radiography) units, US (ultrasonography) scanners, and MR (magnetic resonance) scanners. The mobile controller allows image management of the PACS including display, worklisting, query and retrieval of medical images in DICOM format. In this mobile system, a server program is developed in a PACS Web server which serves as an interface for client programs in the mobile phone and the enterprise PACS for image distribution in hospitals. The application processing is performed on the server side to reduce computational loading in the mobile device. The communication method of mobile phones can be adapted to multiple wireless environments in Hong Kong. This allows greater feasibility to accommodate the rapidly changing communication technology. No complicated computer hardware or software is necessary. Using a mobile phone embedded with the mobile controller client program, this system would serve as a tool for heath care and medical professionals to improve the efficiency of the health care services by speedy delivery of image information. This is particularly important in case of urgent consultation, and it allows health care workers better use of the time for patient care.

  3. Micro-optical fiber devices used with modal domain sensing

    OpenAIRE

    Flax, Amy

    1988-01-01

    In order to develop more compact optical fiber sensing systems, modal filtering can be performed in-line by using micro-optical devices. Two such devices are a laterally offset few-moded optical fiber mechanical splice and a modal conversion optical fiber coupler. A third device, the air-gap splice used with multimode fibers, can examine the modal content of an optical fiber. A basic theoretical understanding on how these devices operate is reviewed. A splice loss calculation f...

  4. Prediction of preterm delivery

    NARCIS (Netherlands)

    Wilms, F.F.

    2014-01-01

    Preterm delivery is in quantity and in severity an important issue in the obstetric care in the Western world. There is considerable knowledge on maternal and obstetric risk factors of preterm delivery. Of the women presenting with preterm labor, the majority is pregnant with a male fetus and in

  5. [The moon and delivery].

    Science.gov (United States)

    Romero Martínez, Jorge; Guerrero Guijo, Inmaculada; Artura Serrano, Antonio

    2004-11-01

    In different cultures and mythologies, the moon is related with fertility, pregnancy and delivery. Professional obstetricians also notice an increase in care demands on the days when the moon is full. Many studies have been made which try to correlate delivery processes to the phases of the moon with contradictory results. The authors plan to try to find any basis in fact which support these popular beliefs and to discover if lunar phases bear an influence on the distribution of deliveries. They carried out a descriptive transversal study on a total of 1715 unassisted deliveries over the course of ten complete lunar cycles. The authors have carried out a descriptive and inferential analysis, a one way ANOVA and a Kruskal Wallis test on their three data bases which are general, primipara and multipara in which they contemplated the total number of deliveries per phase, the mean of each phase, as well as the central day in each phase of the lunar cycle. The differences found in the distribution of deliveries over the four lunar phases, along with the comparison of the means and the comparison of the number of deliveries on the central day in each phase are not statistically significant. The different phases in the lunar cycle and especially the full moon do not appear to have any influence over the distribution of deliveries in this study.

  6. Global Delivery Models

    DEFF Research Database (Denmark)

    Manning, Stephan; Larsen, Marcus M.; Bharati, Pratyush

    2013-01-01

    This article examines antecedents and performance implications of global delivery models (GDMs) in global business services. GDMs require geographically distributed operations to exploit both proximity to clients and time-zone spread for efficient service delivery. We propose and empirically show...

  7. Ultrasonography - A diagnostic modality for oral and maxillofacial diseases

    National Research Council Canada - National Science Library

    Priya Shirish Joshi; Jaydeep Pol; Ahale Sumeet Sudesh

    2014-01-01

    Background: Many diseases present themselves in oral and maxillofacial regions and various modalities may be applied for their diagnosis, including intraoral and panoramic radiography, ultrasonography (USG...

  8. The redundant target effect is affected by modality switch costs

    DEFF Research Database (Denmark)

    Gondan, Matthias; Lange, K.; Rösler, F.

    2004-01-01

    When participants have to respond to stimuli of two modalities, faster reaction times are observed for simultaneous, bimodal events than for unimodal events (the redundant target effect [RTE]). This finding has been interpreted as reflecting processing gains for bimodal relative to unimodal stimuli......, possibly due to multisensory interactions. In random stimulus sequences, reaction times are slower when the stimulus is preceded by a stimulus of a different modality (modality switch effect [MSE]). Simple reaction time redundant target experiments with auditory-visual, visual-tactile, and auditory...... for the MSE, supporting the hypothesis that coactivation occurs independently of modality switch costs....

  9. The measurement of the modal strain fields using digital shearography

    National Research Council Canada - National Science Library

    Lopes, H; Ribeiro, J.E; Vaz, M; Gomes, J.M

    2010-01-01

    This work presents a Michelson shearography interferometer configuration associated with stroboscopic double illumination technique for the measurement of modal rotation fields and their strain fields...

  10. Multimodal Image Alignment via Linear Mapping between Feature Modalities

    Directory of Open Access Journals (Sweden)

    Yanyun Jiang

    2017-01-01

    Full Text Available We propose a novel landmark matching based method for aligning multimodal images, which is accomplished uniquely by resolving a linear mapping between different feature modalities. This linear mapping results in a new measurement on similarity of images captured from different modalities. In addition, our method simultaneously solves this linear mapping and the landmark correspondences by minimizing a convex quadratic function. Our method can estimate complex image relationship between different modalities and nonlinear nonrigid spatial transformations even in the presence of heavy noise, as shown in our experiments carried out by using a variety of image modalities.

  11. Modal testing for model validation of structures with discrete nonlinearities

    National Research Council Canada - National Science Library

    Ewins, D J; Weekes, B; delli Carri, A

    2015-01-01

    Model validation using data from modal tests is now widely practiced in many industries for advanced structural dynamic design analysis, especially where structural integrity is a primary requirement...

  12. DISTRIBUTED ANOMALY DETECTION USING SATELLITE DATA FROM MULTIPLE MODALITIES

    Data.gov (United States)

    National Aeronautics and Space Administration — DISTRIBUTED ANOMALY DETECTION USING SATELLITE DATA FROM MULTIPLE MODALITIES KANISHKA BHADURI*, KAMALIKA DAS, AND PETR VOTAVA* Abstract. There has been a tremendous...

  13. Correlating Musical Memorization Styles and Perceptual Learning Modalities

    National Research Council Canada - National Science Library

    Mishra, Jennifer

    2007-01-01

    ... (aural, visual, kinesthetic). Generally, weak correlations were found between preferred learning modalities and memorization styles with only visual learners tending to prefer visual memorization strategies (r = .34...

  14. The perceptual basis of the modality effect in multimedia learning.

    Science.gov (United States)

    Rummer, Ralf; Schweppe, Judith; Fürstenberg, Anne; Scheiter, Katharina; Zindler, Antje

    2011-06-01

    Various studies have demonstrated an advantage of auditory over visual text modality when learning with texts and pictures. To explain this modality effect, two complementary assumptions are proposed by cognitive theories of multimedia learning: first, the visuospatial load hypothesis, which explains the modality effect in terms of visuospatial working memory overload in the visual text condition; and second, the temporal contiguity assumption, according to which the modality effect occurs because solely auditory texts and pictures can be attended to simultaneously. The latter explanation applies only to simultaneous presentation, the former to both simultaneous and sequential presentation. This paper introduces a third explanation, according to which parts of the modality effect are due to early, sensory processes. This account predicts that-for texts longer than one sentence-the modality effect with sequential presentation is restricted to the information presented most recently. Two multimedia experiments tested the influence of text modality across three different conditions: simultaneous presentation of texts and pictures versus sequential presentation versus presentation of text only. Text comprehension and picture recognition served as dependent variables. An advantage for auditory texts was restricted to the most recent text information and occurred under all presentation conditions. With picture recognition, the modality effect was restricted to the simultaneous condition. These findings clearly support the idea that the modality effect can be attributed to early processes in perception and sensory memory rather than to a working memory bottleneck.

  15. Applicability Limits of Operational Modal Analysis to Operational Wind Turbines

    DEFF Research Database (Denmark)

    Tcherniak, D.; Chauhan, Shashank; Hansen, Morten Hartvig

    2011-01-01

    Operational Modal Analysis (OMA) is one of the branches of experimental modal analysis which allows extracting modal parameters based on measuring only the responses of a structure under ambient or operational excitation which is not needed to be measured. This makes OMA extremely attractive...... to modal analysis of big structures such as wind turbines where providing measured excitation force is an extremely difficult task. One of the main OMA assumption concerning the excitation is that it is distributed randomly both temporally and spatially. Obviously, closer the real excitation...

  16. Microneedles: A New Frontier in Nanomedicine Delivery.

    Science.gov (United States)

    Larrañeta, Eneko; McCrudden, Maelíosa T C; Courtenay, Aaron J; Donnelly, Ryan F

    2016-05-01

    This review aims to concisely chart the development of two individual research fields, namely nanomedicines, with specific emphasis on nanoparticles (NP) and microparticles (MP), and microneedle (MN) technologies, which have, in the recent past, been exploited in combinatorial approaches for the efficient delivery of a variety of medicinal agents across the skin. This is an emerging and exciting area of pharmaceutical sciences research within the remit of transdermal drug delivery and as such will undoubtedly continue to grow with the emergence of new formulation and fabrication methodologies for particles and MN. Firstly, the fundamental aspects of skin architecture and structure are outlined, with particular reference to their influence on NP and MP penetration. Following on from this, a variety of different particles are described, as are the diverse range of MN modalities currently under development. The review concludes by highlighting some of the novel delivery systems which have been described in the literature exploiting these two approaches and directs the reader towards emerging uses for nanomedicines in combination with MN.

  17. Regional Multiteam Systems in Cancer Care Delivery.

    Science.gov (United States)

    Noyes, Katia; Monson, John R T; Rizvi, Irfan; Savastano, Ann; Green, James S A; Sevdalis, Nick

    2016-11-01

    Teamwork is essential for addressing many of the challenges that arise in the coordination and delivery of cancer care, especially for the problems that are presented by patients who cross geographic boundaries and enter and exit multiple health care systems at various times during their cancer care journeys. The problem of coordinating the care of patients with cancer is further complicated by the growing number of treatment options and modalities, incompatibilities among the vast variety of technology platforms that have recently been adopted by the health care industry, and competing and misaligned incentives for providers and systems. Here we examine the issue of regional care coordination in cancer through the prism of a real patient journey. This article will synthesize and elaborate on existing knowledge about coordination approaches for complex systems, in particular, in general and cancer care multidisciplinary teams; define elements of coordination derived from organizational psychology and human factors research that are applicable to team-based cancer care delivery; and suggest approaches for improving multidisciplinary team coordination in regional cancer care delivery and avenues for future research. The phenomenon of the mobile, multisystem patient represents a growing challenge in cancer care. Paradoxically, development of high-quality, high-volume centers of excellence and the ease of virtual communication and data sharing by using electronic medical records have introduced significant barriers to effective team-based cancer care. These challenges urgently require solutions.

  18. Therapeutic gene editing: delivery and regulatory perspectives.

    Science.gov (United States)

    Shim, Gayong; Kim, Dongyoon; Park, Gyu Thae; Jin, Hyerim; Suh, Soo-Kyung; Oh, Yu-Kyoung

    2017-06-01

    Gene-editing technology is an emerging therapeutic modality for manipulating the eukaryotic genome by using target-sequence-specific engineered nucleases. Because of the exceptional advantages that gene-editing technology offers in facilitating the accurate correction of sequences in a genome, gene editing-based therapy is being aggressively developed as a next-generation therapeutic approach to treat a wide range of diseases. However, strategies for precise engineering and delivery of gene-editing nucleases, including zinc finger nucleases, transcription activator-like effector nuclease, and CRISPR/Cas9 (clustered regularly interspaced short palindromic repeats-associated nuclease Cas9), present major obstacles to the development of gene-editing therapies, as with other gene-targeting therapeutics. Currently, viral and non-viral vectors are being studied for the delivery of these nucleases into cells in the form of DNA, mRNA, or proteins. Clinical trials are already ongoing, and in vivo studies are actively investigating the applicability of CRISPR/Cas9 techniques. However, the concept of correcting the genome poses major concerns from a regulatory perspective, especially in terms of safety. This review addresses current research trends and delivery strategies for gene editing-based therapeutics in non-clinical and clinical settings and considers the associated regulatory issues.

  19. Scaling service delivery in a failed state

    NARCIS (Netherlands)

    Muilerman, Sander; Vellema, Sietze

    2017-01-01

    The increased use of sustainability standards in the international trade in cocoa challenges companies to find effective modes of service delivery to large numbers of small-scale farmers. A case study of the Sustainable Tree Crops Program targeting the small-scale cocoa producers in Côte d’Ivoire

  20. Accessing Safe Deliveries in Tanzania (IMCHA) | IDRC ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The project team will publish evidence on the effectiveness of the comprehensive emergency obstetrical and newborn care training program as it relates to health service delivery and health outcomes. Researchers will submit policy briefs to government officials and use a Web-based reporting tool to share lessons learned.

  1. MO-B-BRC-00: Prostate HDR Treatment Planning - Considering Different Imaging Modalities

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2016-06-15

    Brachytherapy has proven to be an effective treatment option for prostate cancer. Initially, prostate brachytherapy was delivered through permanently implanted low dose rate (LDR) radioactive sources; however, high dose rate (HDR) temporary brachytherapy for prostate cancer is gaining popularity. Needle insertion during prostate brachytherapy is most commonly performed under ultrasound (U/S) guidance; however, treatment planning may be performed utilizing several imaging modalities either in an intra- or post-operative setting. During intra-operative prostate HDR, the needles are imaged during implantation, and planning may be performed in real time. At present, the most common imaging modality utilized for intra-operative prostate HDR is U/S. Alternatively, in the post-operative setting, following needle implantation, patients may be simulated with computed tomography (CT) or magnetic resonance imaging (MRI). Each imaging modality and workflow provides its share of benefits and limitations. Prostate HDR has been adopted in a number of cancer centers across the nation. In this educational session, we will explore the role of U/S, CT, and MRI in HDR prostate brachytherapy. Example workflows and operational details will be shared, and we will discuss how to establish a prostate HDR program in a clinical setting. Learning Objectives: Review prostate HDR techniques based on the imaging modality Discuss the challenges and pitfalls introduced by the three imagebased options for prostate HDR brachytherapy Review the QA process and learn about the development of clinical workflows for these imaging options at different institutions.

  2. Rethinking the delivery of public services to citizens

    National Research Council Canada - National Science Library

    Institute for Research on Public Policy; Seidle, F. Leslie

    1995-01-01

    ... Sector Reform and Service Delivery in the Antipodes New Zealand: Transforming the State Australia: a Concerted Program of Management Reform Conclusion Notes 75 Chapter Four The Canadian Federal Government and Service Delivery Issues Perceptions of Service from the Federal Government The Mulroney Government and Public Service 2000 Special Operati...

  3. Predicting mode of delivery using mid-pregnancy ultrasonographic ...

    African Journals Online (AJOL)

    2011-11-11

    Nov 11, 2011 ... Programmed development of the uterus in early pregnancy plays an important role in labor and delivery.[1] It has been noted that the chance of preterm delivery is inversely related to the length of the cervical canal[2] and short cervix has been associated with increased risk of spontaneous preterm birth.

  4. Modality of Input and Vocabulary Acquisition

    Directory of Open Access Journals (Sweden)

    Tetyana Sydorenko

    2010-06-01

    Full Text Available This study examines the effect of input modality (video, audio, and captions, i.e., on-screen text in the same language as audio on (a the learning of written and aural word forms, (b overall vocabulary gains, (c attention to input, and (d vocabulary learning strategies of beginning L2 learners. Twenty-six second-semester learners of Russian participated in this study. Group one (N = 8 saw video with audio and captions (VAC; group two (N = 9 saw video with audio (VA; group three (N = 9 saw video with captions (VC. All participants completed written and aural vocabulary tests and a final questionnaire.The results indicate that groups with captions (VAC and VC scored higher on written than on aural recognition of word forms, while the reverse applied to the VA group. The VAC group learned more word meanings than the VA group. Results from the questionnaire suggest that learners paid most attention to captions, followed by video and audio, and acquired most words by associating them with visual images. Pedagogical implications of this study are that captioned video tends to aid recognition of written word forms and the learning of word meaning, while non-captioned video tends to improve listening comprehension as it facilitates recognition of aural word forms.

  5. Some Elements of Operational Modal Analysis

    Directory of Open Access Journals (Sweden)

    Rune Brincker

    2014-01-01

    Full Text Available This paper gives an overview of the main components of operational modal analysis (OMA and can serve as a tutorial for research oriented OMA applications. The paper gives a short introduction to the modeling of random responses and to the transforms often used in OMA such as the Fourier series, the Fourier integral, the Laplace transform, and the Z-transform. Then the paper introduces the spectral density matrix of the random responses and presents the theoretical solutions for correlation function and spectral density matrix under white noise loading. Some important guidelines for testing are mentioned and the most common techniques for signal processing of the operating signals are presented. The algorithms of some of the commonly used time domain and frequency domain identification techniques are presented and finally some issues are discussed such as mode shape scaling, and mode shape expansion. The different techniques are illustrated on the difficult case of identifying the three first closely spaced modes of the Heritage Court Tower building.

  6. Taste of Fat: A Sixth Taste Modality?

    Science.gov (United States)

    Besnard, Philippe; Passilly-Degrace, Patricia; Khan, Naim A

    2016-01-01

    An attraction for palatable foods rich in lipids is shared by rodents and humans. Over the last decade, the mechanisms responsible for this specific eating behavior have been actively studied, and compelling evidence implicates a taste component in the orosensory detection of dietary lipids [i.e., long-chain fatty acids (LCFA)], in addition to textural, olfactory, and postingestive cues. The interactions between LCFA and specific receptors in taste bud cells (TBC) elicit physiological changes that affect both food intake and digestive functions. After a short overview of the gustatory pathway, this review brings together the key findings consistent with the existence of a sixth taste modality devoted to the perception of lipids. The main steps leading to this new paradigm (i.e., chemoreception of LCFA in TBC, cell signaling cascade, transfer of lipid signals throughout the gustatory nervous pathway, and their physiological consequences) will be critically analyzed. The limitations to this concept will also be discussed in the light of our current knowledge of the sense of taste. Finally, we will analyze the recent literature on obesity-related dysfunctions in the orosensory detection of lipids ("fatty" taste?), in relation to the overconsumption of fat-rich foods and the associated health risks. Copyright © 2016 the American Physiological Society.

  7. Modal Vibration Analysis of Large Castings

    Science.gov (United States)

    Werlink, Rudolph J.; Margasahayam, Ravi N.

    2009-01-01

    The art of experimental modal vibration analysis (MVA) has been extended to apply to large castings. This extension was made to enable the use of experimental MVA as a relatively inexpensive, simple means of assessing the internal structural integrity of tread shoes of crawler transporters used to move spacecraft to the launch pad at Kennedy Space Center. Each tread shoe is made from cast iron and weighs about a ton (has a mass .907 kg). The present extended version of experimental MVA could also be applied to other large castings. It could be especially useful to manufacturers as a means of rapidly discriminating against large castings that contain unacceptably large concentrations of internal defects. The use of experimental MVA to assess structural integrity is not new. What are new here are those aspects of the extension of experimental MVA that pertain to the application of MVA to objects so massive that it may not be practical or cost effective to mount them in special test fixtures that impose special test boundary conditions to test them in place under normal conditions of use.

  8. Treatment modalities of thyroid related orbitopathy

    Directory of Open Access Journals (Sweden)

    Eric S Ahn

    2014-01-01

    Full Text Available Aims: The aim was to highlight recent advances in the treatment of thyroid eye disease. Settings and Design: Review article. Materials and Methods: Existing literature and the authors′ experience was reviewed. Results: Thyroid ophthalmopathy is a disfiguring and vision-threatening complication of autoimmune thyroid disease that may develop or persist even in the setting of well-controlled systemic thyroid status. Treatment response can be difficult to predict, and optimized algorithms for disease management do not exist. Thyroid ophthalmopathy should be graded for both severity and disease activity before choosing a treatment modality for each patient. The severity of the disease may not correlate directly with the activity; medical treatment is most effective in active disease, and surgery is usually reserved for quiescent disease with persistent proptosis and/or eyelid changes. Conclusions: Intravenous pulsed corticosteroids, orbital radiotherapy, and orbital surgical techniques form the mainstay of current management of thyroid ophthalmopathy. Immunosuppressive and biologic agents may have a role in treating active disease although additional safety and efficacy studies are needed.

  9. The Wigner distribution function in modal characterisation

    CSIR Research Space (South Africa)

    Mredlana, Prince

    2016-07-01

    Full Text Available function in modal characterisation P. MREDLANA1, D. NAIDOO1, C MAFUSIRE2, T. KRUGER2, A. DUDLEY1,3, A. FORBES1,3 1CSIR National Laser Centre, PO BOX 395, Pretoria 0001, South Africa. 2Department of Physics, Faculty of Natural and Agricultural..., the Wigner distribution of 𝑓 𝑥 is an integral of the correlation function 𝑓 𝑥 + 1 2 𝑥′ 𝑓 ∗ 𝑥 + 1 2 𝑥′ represented as: 𝑊𝑓 𝑥, 𝑒 = 𝑓 𝑥 + 1 2 𝑥′ 𝑓 ∗ 𝑥 + 1 2 𝑥′ 𝑒−𝑖𝑒𝑥′𝑑ð...

  10. A Comparison of Passion and Teaching Modality

    Directory of Open Access Journals (Sweden)

    Scott Greenberger

    2016-01-01

    Full Text Available Research exists that applies the dualistic model of passion to face-to-face teaching, but no research has applied this model to online instruction. Distance education theories imply a need to discover factors contributing to online faculty motivation to engage students. Although there has been extensive exploration of intrinsic and extrinsic motivation to teach online, factors contributing to consistent and optimal teaching behavior has received less attention. There is evidence that the passion construct is independent of both intrinsic and extrinsic motivation. A stratified random sample of online and face-to-face faculty (n = 92 were surveyed using the Passion Scale. The results showed that 95 percent of the sampled online faculty self-identified as passionate for their online instruction. In the between-groups analysis, there were no significant differences in the variables of passion orientation, harmonious passion, and obsessive passion by modality. This research provides a basis for future research of passion in online instruction. In addition, this study adds another dimension for research within distance education theory, providing increased evidence for what motivates online instructors to consistently and effectively engage students.

  11. Nonlinear modal enrichment in phononic crystals

    Science.gov (United States)

    Gonella, Stefano; Ganesh, R.

    Recent years have seen the advent of strategies to design metamaterials and phononic crystals with adaptive characteristics. Adaptivity is the ability of a system to autonomously modify its behavior in response to detected changes in the operating conditions. In this work we discuss the opportunities for the design of adaptive phononic crystals enabled by the exploitation of the nonlinearity embedded in the system. A well-known manifestation of nonlinearity is the generation of higher harmonics which, in complex dispersive systems, enables a rearrangement of the spectral response whereby part of the energy of an excited wave is deployed to a higher-frequency region of the band diagram, with the possibility to hop onto a different branch. The result is a mixture of modes with different (and possibly complementary) characteristics and an augmentation of the dynamic functionalities of the medium. In this work, we illustrate the versatility of this paradigm through a portfolio of lattice configurations. In these examples, mode hopping manifests either through the activation of new directional patterns in the wavefield, or through an enrichment of the wave modal content, for example by activating longitudinal components in wavefields originally dominated by shear mechanisms. National Science Foundation (CAREER Award CMMI-1452488).

  12. Imaging Functional Nucleic Acid Delivery to Skin.

    Science.gov (United States)

    Kaspar, Roger L; Hickerson, Robyn P; González-González, Emilio; Flores, Manuel A; Speaker, Tycho P; Rogers, Faye A; Milstone, Leonard M; Contag, Christopher H

    2016-01-01

    Monogenic skin diseases arise from well-defined single gene mutations, and in some cases a single point mutation. As the target cells are superficial, these diseases are ideally suited for treatment by nucleic acid-based therapies as well as monitoring through a variety of noninvasive imaging technologies. Despite the accessibility of the skin, there remain formidable barriers for functional delivery of nucleic acids to the target cells within the dermis and epidermis. These barriers include the stratum corneum and the layered structure of the skin, as well as more locally, the cellular, endosomal and nuclear membranes. A wide range of technologies for traversing these barriers has been described and moderate success has been reported for several approaches. The lessons learned from these studies include the need for combinations of approaches to facilitate nucleic acid delivery across these skin barriers and then functional delivery across the cellular and nuclear membranes for expression (e.g., reporter genes, DNA oligonucleotides or shRNA) or into the cytoplasm for regulation (e.g., siRNA, miRNA, antisense oligos). The tools for topical delivery that have been evaluated include chemical, physical and electrical methods, and the development and testing of each of these approaches has been greatly enabled by imaging tools. These techniques allow delivery and real time monitoring of reporter genes, therapeutic nucleic acids and also triplex nucleic acids for gene editing. Optical imaging is comprised of a number of modalities based on properties of light-tissue interaction (e.g., scattering, autofluorescence, and reflectance), the interaction of light with specific molecules (e.g., absorbtion, fluorescence), or enzymatic reactions that produce light (bioluminescence). Optical imaging technologies operate over a range of scales from macroscopic to microscopic and if necessary, nanoscopic, and thus can be used to assess nucleic acid delivery to organs, regions, cells

  13. Brain metastasis from uterine malignancies: treatment modalities and prognostic factors

    Directory of Open Access Journals (Sweden)

    Naoual Benhmidou

    2017-01-01

    Full Text Available Isolated brain metastases from gynecologic malignancies are unusual. Advances in therapeutic modalities including surgery, whole brain radiotherapy stereotactic radiosurgery and chemotherapy improved survival and quality of life in this population. Therapeutic decision is based on patients’ specific prognostic factors. We report three cases of isolated brain metastases from gynecologic cancers and discuss treatment modalities in the light of a literature review.

  14. A modal specification theory for components with data

    DEFF Research Database (Denmark)

    Bauer, Sebastian S.; Larsen, Kim G.; Legay, Axel

    2014-01-01

    Modal specification is a well-known formalism used as an abstraction theory for tran- sition systems. Modal specifications are transition systems equipped with two types of transitions: must-transitions that are mandatory to any implementation, and may- transitions that are optional. The duality ...

  15. Education Solutions for Child Poverty: New Modalities from New Zealand

    Science.gov (United States)

    Airini

    2015-01-01

    This article describes education solutions to child poverty. Through a focus on New Zealand, the article explores the meaning of child poverty, children's perspectives on child poverty and solutions, and modalities in citizenship, social and economics education to help address child poverty. Four modalities are proposed: centre our work in…

  16. A dynamically weighted multi-modal biometric security system

    CSIR Research Space (South Africa)

    Brown, Dane

    2016-09-01

    Full Text Available the match score-level. However, leveraging this potential requires a new approach. This work demonstrates a novel dynamic weighting algorithm for improved image-based biometric feature-fusion. A comparison is performed on uni-modal, bi-modal, tri...

  17. Basics and state-of-the-art of modal testing

    Indian Academy of Sciences (India)

    paving the way for routine modal investigations to be possible. The second requirement for modal testing is the excitation and, although the early efforts found a solution to the problem of exciting a rotating shaft via an extra bearing, these were not ideal. With the growing development of the magnetic bearings, these devices ...

  18. Output-only Modal Analysis by Frequency Domain Decomposition

    DEFF Research Database (Denmark)

    Brincker, Rune; Zhang, L.; Andersen, P.

    2000-01-01

    In this paper a new frequency domain technique is introduced for the modal identification of output-only systems, i.e. for the case where the modal parameters must be estimated without knowing the input exciting the system. By its user friendliness the technique is closely related to the classical...

  19. Modal Identification from Ambient Responses using Frequency Domain Decomposition

    DEFF Research Database (Denmark)

    Brincker, Rune; Zhang, L.; Andersen, P.

    2000-01-01

    In this paper a new frequency domain technique is introduced for the modal identification from ambient responses, ie. in the case where the modal parameters must be estimated without knowing the input exciting the system. By its user friendliness the technique is closely related to the classical...

  20. Dual-Priced Modal Transition Systems with Time Durations

    DEFF Research Database (Denmark)

    Beneš, Nikola; Kretínsky, Jan; Larsen, Kim Guldstrand

    2012-01-01

    Modal transition systems are a well-established specification formalism for a high-level modelling of component-based software systems. We present a novel extension of the formalism called modal transition systems with durations where time durations are modelled as controllable or uncontrollable ...

  1. Creating Pretence and Sharing Friendship: Modal Expressions in Children's Play

    Science.gov (United States)

    Hoyte, Frances; Torr, Jane; Degotardi, Sheila

    2015-01-01

    Friendships and play provide children with opportunities for mutual engagement, which both require and facilitate children's language use. Modality is a semantic system in the language associated with children's learning. One way in which modality is realised is through linguistic expressions which allow speakers to moderate the degree of…

  2. Cognitive-Aware Modality Allocation in Intelligent Multimodal Information Presentation

    Science.gov (United States)

    Cao, Yujia; Theune, Mariët; Nijholt, Anton

    Intelligent multimodal presentation (IMMP) systems are able to generate multimodal presentations adaptively, based on the run-time requirements of user-computer interaction. Modality allocation in IMMP system needs to adapt the modality choice to changes in various relevant factors, such as the type of information to be conveyed, the presentation goal, the characteristics of the available modalities, the user profile, the condition of the environment, and the type of user task. In this study, we emphasize that modality allocation in IMMP systems should also take into account the cognitive impacts of modality on human information processing. We first describe several modality-related cognitive and neuropsychological findings. Then a user study is presented to demonstrate the effects of modality on performance, cognitive load and stress, using a high-load and time-critical user task. Finally, we show a possible way to integrate relevant cognitive theories into a computational model that can systematically predict the suitability of a modality choice for a given presentation task.

  3. The effect of preference modality on self-control

    NARCIS (Netherlands)

    Klesse, Anne-Kathrin; Levav, J.; Goukens, C.

    2015-01-01

    The marketplace affords consumers various modalities to express their preferences (e.g., by pressing a button on a vending machine or making an oral request at a restaurant). In this paper, we compare speaking to manual preference expression modalities (button pressing, writing, and taking) and

  4. Cognitive-aware Modality Allocation in Intelligent Multimodal Information Presentation

    NARCIS (Netherlands)

    Cao, Y.; Theune, Mariet; Nijholt, Antinus; Shao, Ling; Shan, Caifeng; Luo, Jiebo; Etoh, Minoru

    2010-01-01

    Intelligent multimodal presentation (IMMP) systems are able to generate multimodal presentations adaptively, based on the run-time requirements of user-computer interaction. Modality allocation in IMMP system needs to adapt the modality choice to changes in various relevant factors, such as the type

  5. Modality Endowment in Foreign Language Learning. Final Report.

    Science.gov (United States)

    Pimsleur, Paul; And Others

    This project was designed to develop a test of modality (eye/ear) endowment and to determine the significance of this factor in foreign language instruction. Subjects were junior and senior high school students enrolled in French and Spanish classes. In phases 1 and 2 the Modality Endowment Battery of tests (MEB) was constructed and shown to have…

  6. Modal intersection types, two-level languages, and staged synthesis

    DEFF Research Database (Denmark)

    Henglein, Fritz; Rehof, Jakob

    2016-01-01

    A typed λ-calculus, λ∩ ⎕, is introduced, combining intersection types and modal types. We develop the metatheory of λ∩ ⎕, with particular emphasis on the theory of subtyping and distributivity of the modal and intersection type operators. We describe how a stratification of λ∩ ⎕ leads to a multi-linguistic...

  7. Comparative Modal Analysis of Sieve Hardware Designs

    Science.gov (United States)

    Thompson, Nathaniel

    2012-01-01

    The CMTB Thwacker hardware operates as a testbed analogue for the Flight Thwacker and Sieve components of CHIMRA, a device on the Curiosity Rover. The sieve separates particles with a diameter smaller than 150 microns for delivery to onboard science instruments. The sieving behavior of the testbed hardware should be similar to the Flight hardware for the results to be meaningful. The elastodynamic behavior of both sieves was studied analytically using the Rayleigh Ritz method in conjunction with classical plate theory. Finite element models were used to determine the mode shapes of both designs, and comparisons between the natural frequencies and mode shapes were made. The analysis predicts that the performance of the CMTB Thwacker will closely resemble the performance of the Flight Thwacker within the expected steady state operating regime. Excitations of the testbed hardware that will mimic the flight hardware were recommended, as were those that will improve the efficiency of the sieving process.

  8. Gd-based upconversion nanocarriers with yolk-shell structure for dual-modal imaging and enhanced chemotherapy to overcome multidrug resistance in breast cancer

    Science.gov (United States)

    Pan, Yuanwei; Zhang, Ling'e.; Zeng, Leyong; Ren, Wenzhi; Xiao, Xueshan; Zhang, Jichao; Zhang, Lili; Li, Aiguo; Lu, Guangming; Wu, Aiguo

    2015-12-01

    Multidrug resistance (MDR) of cancers is still a major challenge, and it is very important to develop visualized nanoprobes for the diagnosis and treatment of drug resistant cancers. In this work, we developed a multifunctional delivery system based on DOX-encapsulated NaYF4:Yb/Er@NaGdF4 yolk-shell nanostructures for simultaneous dual-modal imaging and enhanced chemotherapy in drug resistant breast cancer. Using the large pore volume of the nanostructure, the delivery system had a high loading efficiency and excellent stability. Also, an in vitro and in vivo toxicity study showed the good biocompatibility of the as-prepared yolk-shell nanomaterials. Moreover, by nanocarrier delivery, the uptake of DOX could be greatly increased in drug resistant MCF-7/ADR cells. Compared with free DOX, the as-prepared delivery system enhanced the chemotherapy efficacy against MCF-7/ADR cells, indicating the excellent capability for overcoming MDR. Furthermore, core-shell NaYF4:Yb/Er@NaGdF4 improved the upconversion luminescence (UCL) performance, and the designed delivery system could also be applied for simultaneous UCL and magnetic resonance (MR) imaging, which could be a good candidate as a dual-modal imaging nanoprobe. Therefore, we developed a multifunctional yolk-shell delivery system, which could have potential applications as a visualized theranostic nanoprobe to overcome MDR in breast cancer.

  9. Selected Instructional Delivery Methods and Teaching Techniques for Teaching School Law Courses.

    Science.gov (United States)

    Gordon, Howard R. D.

    This paper reviews the literature on the relevance of learner characteristics and learning styles when planning law school courses, focusing on the instructional delivery methods and teaching techniques applicable to law school courses. It examines the four major learning modalities: kinesthetic, tactual, auditory, and visual; and the four major…

  10. Breastfeeding After Cesarean Delivery

    Science.gov (United States)

    ... Stages Listen Español Text Size Email Print Share Breastfeeding After Cesarean Delivery Page Content Article Body A ... delivered vaginally. It is especially important to begin breastfeeding as soon as you are able and to ...

  11. Materials to clinical devices: technologies for remotely triggered drug delivery.

    Science.gov (United States)

    Timko, Brian P; Kohane, Daniel S

    2012-11-01

    Technologies in which a remote trigger is used to release drug from an implanted or injected device could enable on-demand release profiles that enhance therapeutic effectiveness or reduce systemic toxicity. A number of new materials have been developed that exhibit sensitivity to light, ultrasound, or electrical or magnetic fields. Delivery systems that incorporate these materials might be triggered externally by the patient, parent or physician to provide flexible control of dose magnitude and timing. To review injectable or implantable systems that are candidates for translation to the clinic, or ones that have already undergone clinical trials. Also considered are applicability in pediatrics and prospects for the future of drug delivery systems. We performed literature searches of the PubMed and Science Citation Index databases for articles in English that reported triggerable drug delivery devices, and for articles reporting related materials and concepts. Approaches to remotely-triggered systems that have clinical potential were identified. Ideally, these systems have been engineered to exhibit controlled on-state release kinetics, low baseline leak rates, and reproducible dosing across multiple cycles. Advances in remotely-triggered drug delivery have been brought about by the convergence of numerous scientific and engineering disciplines, and this convergence is likely to play an important part in the current trend to develop systems that provide more than one therapeutic modality. Preclinical systems must be carefully assessed for biocompatibility, and engineered to ensure pharmacokinetics within the therapeutic window. Future drug delivery systems may incorporate additional modalities, such as closed-loop sensing or onboard power generation, enabling more sophisticated drug delivery regimens. Copyright © 2012 Elsevier HS Journals, Inc. All rights reserved.

  12. Tools for managing image flow in the modality to clinical-image-review chain.

    Science.gov (United States)

    Clark, Kenneth W; Melson, David L; Moore, Stephen M; James Blaine, G James; Moulton, Ralph A; Clayton, William K; Peterson, Colin S; Vendt, Bruce A

    2003-09-01

    Web-based clinical-image viewing is commonplace in large medical centers. As demands for product and performance escalate, physicians, sold on the concept of "any image, anytime, anywhere," fret when image studies cannot be viewed in a time frame to which they are accustomed. Image delivery pathways in large medical centers are oftentimes complicated by multiple networks, multiple picture archiving and communication systems (PACS), and multiple groups responsible for image acquisition and delivery to multiple destinations. When studies are delayed, it may be difficult to rapidly pinpoint bottlenecks. Described here are the tools used to monitor likely failure points in our modality to clinical-image-viewing chain and tools for reporting volume and throughput trends. Though perhaps unique to our environment, we believe that tools of this type are essential for understanding and monitoring image-study flow, re-configuring resources to achieve better throughput, and planning for anticipated growth. Without such tools, quality clinical-image delivery may not be what it should.

  13. Risk factors for insufficient perioperative oral nutrition after hip fracture surgery within a multi-modal rehabilitation programme

    DEFF Research Database (Denmark)

    Foss, Nicolai B; Jensen, Pia S; Kehlet, Henrik

    2007-01-01

    To examine oral nutritional intake in the perioperative phase in elderly hip fracture patients treated according to a well-defined multi-modal rehabilitation program, including unselected oral nutritional supplementation, and to identify independent risk factors for insufficient nutritional intake....

  14. The Structure and Measurement of Unusual Sensory Experiences in Different Modalities: The Multi-Modality Unusual Sensory Experiences Questionnaire (MUSEQ

    Directory of Open Access Journals (Sweden)

    Claire A. A. Mitchell

    2017-08-01

    Full Text Available Hallucinations and other unusual sensory experiences (USE can occur in all modalities in the general population. Yet, the existing literature is dominated by investigations into auditory hallucinations (“voices”, while other modalities remain under-researched. Furthermore, there is a paucity of measures which can systematically assess different modalities, which limits our ability to detect individual and group differences across modalities. The current study explored such differences using a new scale, the Multi-Modality Unusual Sensory Experiences Questionnaire (MUSEQ. The MUSEQ is a 43-item self-report measure which assesses USE in six modalities: auditory, visual, olfactory, gustatory, bodily sensations, and sensed presence. Scale development and validation involved a total of 1,300 participants, which included: 513 students and community members for initial development, 32 individuals with schizophrenia spectrum disorder or bipolar disorder for validation, 659 students for factor replication, and 96 students for test-retest reliability. Confirmatory factor analyses showed that a correlated-factors model and bifactor model yielded acceptable model fit, while a unidimensional model fitted poorly. These findings were confirmed in the replication sample. Results showed contributions from a general common factor, as well as modality-specific factors. The latter accounted for less variance than the general factor, but could still detect theoretically meaningful group differences. The MUSEQ showed good reliability, construct validity, and could discriminate non-clinical and clinical groups. The MUSEQ offers a reliable means of measuring hallucinations and other USE in six different modalities.

  15. Modality independence of order coding in working memory: Evidence from cross-modal order interference at recall.

    Science.gov (United States)

    Vandierendonck, André

    2016-01-01

    Working memory researchers do not agree on whether order in serial recall is encoded by dedicated modality-specific systems or by a more general modality-independent system. Although previous research supports the existence of autonomous modality-specific systems, it has been shown that serial recognition memory is prone to cross-modal order interference by concurrent tasks. The present study used a serial recall task, which was performed in a single-task condition and in a dual-task condition with an embedded memory task in the retention interval. The modality of the serial task was either verbal or visuospatial, and the embedded tasks were in the other modality and required either serial or item recall. Care was taken to avoid modality overlaps during presentation and recall. In Experiment 1, visuospatial but not verbal serial recall was more impaired when the embedded task was an order than when it was an item task. Using a more difficult verbal serial recall task, verbal serial recall was also more impaired by another order recall task in Experiment 2. These findings are consistent with the hypothesis of modality-independent order coding. The implications for views on short-term recall and the multicomponent view of working memory are discussed.

  16. The optimal hormonal replacement modality selection for multiple organ procurement from brain-dead organ donors

    Directory of Open Access Journals (Sweden)

    Mi Z

    2014-12-01

    Full Text Available Zhibao Mi,1 Dimitri Novitzky,2 Joseph F Collins,1 David KC Cooper3 1Cooperative Studies Program Coordinating Center, VA Maryland Health Care Systems, Perry Point, MD, USA; 2Department of Cardiothoracic Surgery, University of South Florida, Tampa, FL, USA; 3Thomas E Starzl Transplantation Institute, University of Pittsburgh, Pittsburgh, PA, USA Abstract: The management of brain-dead organ donors is complex. The use of inotropic agents and replacement of depleted hormones (hormonal replacement therapy is crucial for successful multiple organ procurement, yet the optimal hormonal replacement has not been identified, and the statistical adjustment to determine the best selection is not trivial. Traditional pair-wise comparisons between every pair of treatments, and multiple comparisons to all (MCA, are statistically conservative. Hsu’s multiple comparisons with the best (MCB – adapted from the Dunnett’s multiple comparisons with control (MCC – has been used for selecting the best treatment based on continuous variables. We selected the best hormonal replacement modality for successful multiple organ procurement using a two-step approach. First, we estimated the predicted margins by constructing generalized linear models (GLM or generalized linear mixed models (GLMM, and then we applied the multiple comparison methods to identify the best hormonal replacement modality given that the testing of hormonal replacement modalities is independent. Based on 10-year data from the United Network for Organ Sharing (UNOS, among 16 hormonal replacement modalities, and using the 95% simultaneous confidence intervals, we found that the combination of thyroid hormone, a corticosteroid, antidiuretic hormone, and insulin was the best modality for multiple organ procurement for transplantation. Keywords: best treatment selection, brain-dead organ donors, hormonal replacement, multiple binary endpoints, organ procurement, multiple comparisons

  17. Scientific and industrial challenges of developing nanoparticle-based theranostics and multiple-modality contrast agents for clinical application

    Science.gov (United States)

    Wáng, Yì Xiáng J.; Idée, Jean-Marc; Corot, Claire

    2015-10-01

    Designing of theranostics and dual or multi-modality contrast agents are currently two of the hottest topics in biotechnology and biomaterials science. However, for single entity theranostics, a right ratio of their diagnostic component and their therapeutic component may not always be realized in a composite suitable for clinical application. For dual/multiple modality molecular imaging agents, after in vivo administration, there is an optimal time window for imaging, when an agent is imaged by one modality, the pharmacokinetics of this agent may not allow imaging by another modality. Due to reticuloendothelial system clearance, efficient in vivo delivery of nanoparticles to the lesion site is sometimes difficult. The toxicity of these entities also remains poorly understood. While the medical need of theranostics is admitted, the business model remains to be established. There is an urgent need for a global and internationally harmonized re-evaluation of the approval and marketing processes of theranostics. However, a reasonable expectation exists that, in the near future, the current obstacles will be removed, thus allowing the wide use of these very promising agents.

  18. Adapting Behavioral Interventions for Social Media Delivery.

    Science.gov (United States)

    Pagoto, Sherry; Waring, Molly E; May, Christine N; Ding, Eric Y; Kunz, Werner H; Hayes, Rashelle; Oleski, Jessica L

    2016-01-29

    Patients are increasingly using online social networks (ie, social media) to connect with other patients and health care professionals--a trend called peer-to-peer health care. Because online social networks provide a means for health care professionals to communicate with patients, and for patients to communicate with each other, an opportunity exists to use social media as a modality to deliver behavioral interventions. Social media-delivered behavioral interventions have the potential to reduce the expense of behavioral interventions by eliminating visits, as well as increase our access to patients by becoming embedded in their social media feeds. Trials of online social network-delivered behavioral interventions have shown promise, but much is unknown about intervention development and methodology. In this paper, we discuss the process by which investigators can translate behavioral interventions for social media delivery. We present a model that describes the steps and decision points in this process, including the necessary training and reporting requirements. We also discuss issues pertinent to social media-delivered interventions, including cost, scalability, and privacy. Finally, we identify areas of research that are needed to optimize this emerging behavioral intervention modality.

  19. Adapting Behavioral Interventions for Social Media Delivery

    Science.gov (United States)

    Waring, Molly E; May, Christine N; Ding, Eric Y; Kunz, Werner H; Hayes, Rashelle; Oleski, Jessica L

    2016-01-01

    Patients are increasingly using online social networks (ie, social media) to connect with other patients and health care professionals—a trend called peer-to-peer health care. Because online social networks provide a means for health care professionals to communicate with patients, and for patients to communicate with each other, an opportunity exists to use social media as a modality to deliver behavioral interventions. Social media-delivered behavioral interventions have the potential to reduce the expense of behavioral interventions by eliminating visits, as well as increase our access to patients by becoming embedded in their social media feeds. Trials of online social network-delivered behavioral interventions have shown promise, but much is unknown about intervention development and methodology. In this paper, we discuss the process by which investigators can translate behavioral interventions for social media delivery. We present a model that describes the steps and decision points in this process, including the necessary training and reporting requirements. We also discuss issues pertinent to social media-delivered interventions, including cost, scalability, and privacy. Finally, we identify areas of research that are needed to optimize this emerging behavioral intervention modality. PMID:26825969

  20. More Than A Meal? A Randomized Control Trial Comparing the Effects of Home-Delivered Meals Programs on Participants' Feelings of Loneliness.

    Science.gov (United States)

    Thomas, Kali S; Akobundu, Ucheoma; Dosa, David

    2016-11-01

    Nutrition service providers are seeking alternative delivery models to control costs and meet the growing need for home-delivered meals. The objective of this study was to evaluate the extent to which the home-delivered meals program, and the type of delivery model, reduces homebound older adults' feelings of loneliness. This project utilizes data from a three-arm, fixed randomized control study conducted with 626 seniors on waiting lists at eight Meals on Wheels programs across the United States. Seniors were randomly assigned to either (i) receive daily meal delivery; (ii) receive once-weekly meal delivery; or (iii) remain on the waiting list. Participants were surveyed at baseline and again at 15 weeks. Analysis of covariance was used to test for differences in loneliness between groups, over time and logistic regression was used to assess differences in self-rated improvement in loneliness. Participants receiving meals had lower adjusted loneliness scores at follow-up compared with the control group. Individuals who received daily-delivered meals were more likely to self-report that home-delivered meals improved their loneliness than the group receiving once-weekly delivered meals. This article includes important implications for organizations that provide home-delivered meals in terms of cost, delivery modality, and potential recipient benefits. Published by Oxford University Press on behalf of the Gerontological Society of America 2015. This work is written by (a) US Government employee(s) and is in the public domain in the US.

  1. Simulating Marine New Particle Formation and Growth Using the M7 Modal Aerosol Dynamics Modal

    Directory of Open Access Journals (Sweden)

    Ciaran Monahan

    2010-01-01

    Full Text Available A modal atmospheric aerosol model (M7 is evaluated in terms of predicting marine new particle formation and growth. Simulations were carried out for three different nucleation schemes involving (1 kinetic self-nucleation of OIO (2 nucleation via OIO activation by H2SO4 and (3 nucleation via OIO activation by H2SO4 plus condensation of a low-volatility organic vapour. Peak OIO and H2SO4 vapour concentrations were both limited to 6×106 molecules cm-3 at noontime while the peak organic vapour concentration was limited to 12×106 molecules cm-3. All simulations produced significant concentrations of new particles in the Aitken mode. From a base case particle concentration of 222 cm-3 at radii >15 nm, increases in concentrations to 366 cm-3 were predicted from the OIO-OIO case, 722 cm-3 for the OIO-H2SO4 case, and 1584 cm-3 for the OIO-H2SO4 case with additional condensing organic vapours. The results indicate that open ocean new particle production is feasible for clean conditions; however, new particle production becomes most significant when an additional condensable organic vapour is available to grow the newly formed particles to larger sizes. Comparison to sectional model for a typical case study demonstrated good agreement and the validity of using the modal model.

  2. Cross-modal recognition of familiar conspecifics in goats

    Science.gov (United States)

    Briefer, Elodie F.; Baciadonna, Luigi; McElligott, Alan G.

    2017-01-01

    When identifying other individuals, animals may match current cues with stored information about that individual from the same sensory modality. Animals may also be able to combine current information with previously acquired information from other sensory modalities, indicating that they possess complex cognitive templates of individuals that are independent of modality. We investigated whether goats (Capra hircus) possess cross-modal representations (auditory–visual) of conspecifics. We presented subjects with recorded conspecific calls broadcast equidistant between two individuals, one of which was the caller. We found that, when presented with a stablemate and another herd member, goats looked towards the caller sooner and for longer than the non-caller, regardless of caller identity. By contrast, when choosing between two herd members, other than their stablemate, goats did not show a preference to look towards the caller. Goats show cross-modal recognition of close social partners, but not of less familiar herd members. Goats may employ inferential reasoning when identifying conspecifics, potentially facilitating individual identification based on incomplete information. Understanding the prevalence of cross-modal recognition and the degree to which different sensory modalities are integrated provides insight into how animals learn about other individuals, and the evolution of animal communication. PMID:28386412

  3. On the dependence of response inhibition processes on sensory modality.

    Science.gov (United States)

    Bodmer, Benjamin; Beste, Christian

    2017-04-01

    The ability to inhibit responses is a central sensorimotor function but only recently the importance of sensory processes for motor inhibition mechanisms went more into the research focus. In this regard it is elusive, whether there are differences between sensory modalities to trigger response inhibition processes. Due to functional neuroanatomical considerations strong differences may exist, for example, between the visual and the tactile modality. In the current study we examine what neurophysiological mechanisms as well as functional neuroanatomical networks are modulated during response inhibition. Therefore, a Go/NoGo-paradigm employing a novel combination of visual, tactile, and visuotactile stimuli was used. The data show that the tactile modality is more powerful than the visual modality to trigger response inhibition processes. However, the tactile modality loses its efficacy to trigger response inhibition processes when being combined with the visual modality. This may be due to competitive mechanisms leading to a suppression of certain sensory stimuli and the response selection level. Variations in sensory modalities specifically affected conflict monitoring processes during response inhibition by modulating activity in a frontal parietal network including the right inferior frontal gyrus, anterior cingulate cortex and the temporoparietal junction. Attentional selection processes are not modulated. The results suggest that the functional neuroanatomical networks involved in response inhibition critically depends on the nature of the sensory input. Hum Brain Mapp 38:1941-1951, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  4. Obtaining Cross Modal Similarity Metric with Deep Neural Architecture

    Directory of Open Access Journals (Sweden)

    Ruifan Li

    2015-01-01

    Full Text Available Analyzing complex system with multimodal data, such as image and text, has recently received tremendous attention. Modeling the relationship between different modalities is the key to address this problem. Motivated by recent successful applications of deep neural learning in unimodal data, in this paper, we propose a computational deep neural architecture, bimodal deep architecture (BDA for measuring the similarity between different modalities. Our proposed BDA architecture has three closely related consecutive components. For image and text modalities, the first component can be constructed using some popular feature extraction methods in their individual modalities. The second component has two types of stacked restricted Boltzmann machines (RBMs. Specifically, for image modality a binary-binary RBM is stacked over a Gaussian-binary RBM; for text modality a binary-binary RBM is stacked over a replicated softmax RBM. In the third component, we come up with a variant autoencoder with a predefined loss function for discriminatively learning the regularity between different modalities. We show experimentally the effectiveness of our approach to the task of classifying image tags on public available datasets.

  5. Modal Testing of Seven Shuttle Cargo Elements for Space Station

    Science.gov (United States)

    Kappus, Kathy O.; Driskill, Timothy C.; Parks, Russel A.; Patterson, Alan (Technical Monitor)

    2001-01-01

    From December 1996 to May 2001, the Modal and Control Dynamics Team at NASA's Marshall Space Flight Center (MSFC) conducted modal tests on seven large elements of the International Space Station. Each of these elements has been or will be launched as a Space Shuttle payload for transport to the International Space Station (ISS). Like other Shuttle payloads, modal testing of these elements was required for verification of the finite element models used in coupled loads analyses for launch and landing. The seven modal tests included three modules - Node, Laboratory, and Airlock, and four truss segments - P6, P3/P4, S1/P1, and P5. Each element was installed and tested in the Shuttle Payload Modal Test Bed at MSFC. This unique facility can accommodate any Shuttle cargo element for modal test qualification. Flexure assemblies were utilized at each Shuttle-to-payload interface to simulate a constrained boundary in the load carrying degrees of freedom. For each element, multiple-input, multiple-output burst random modal testing was the primary approach with controlled input sine sweeps for linearity assessments. The accelerometer channel counts ranged from 252 channels to 1251 channels. An overview of these tests, as well as some lessons learned, will be provided in this paper.

  6. Analysis of modal frequency optimization of railway vehicle car body

    Directory of Open Access Journals (Sweden)

    Wenjing Sun

    2016-04-01

    Full Text Available High structural modal frequencies of car body are beneficial as they ensure better vibration control and enhance ride quality of railway vehicles. Modal sensitivity optimization and elastic suspension parameters used in the design of equipment beneath the chassis of the car body are proposed in order to improve the modal frequencies of car bodies under service conditions. Modal sensitivity optimization is based on sensitivity analysis theory which considers the thickness of the body frame at various positions as variables in order to achieve optimization. Equipment suspension design analyzes the influence of suspension parameters on the modal frequencies of the car body through the use of an equipment-car body coupled model. Results indicate that both methods can effectively improve the modal parameters of the car body. Modal sensitivity optimization increases vertical bending frequency from 9.70 to 10.60 Hz, while optimization of elastic suspension parameters increases the vertical bending frequency to 10.51 Hz. The suspension design can be used without alteration to the structure of the car body while ensuring better ride quality.

  7. Transdermal Spray in Hormone Delivery

    African Journals Online (AJOL)

    market for the delivery system and ongoing development of transdermal sprays for hormone delivery. Keywords: Transdermal, Delivery systems, ... delivery compared with gels, emulsions, patches, and subcutaneous implants. Among .... In a safety announcement, the US Food and. Drug Administration (FDA) warned that ...

  8. A novel modal-independent ultrasonic motor with dual stator.

    Science.gov (United States)

    Liu, Jian; Jin, Jiamei; Ji, Ruinan; Chen, Di

    2017-04-01

    In this paper, a novel modal-independent ultrasonic motor with dual stator is proposed, in order to relieve the difficulty of adjustment for coincidence of modal frequencies of a stator for multi-modal coupling type ultrasonic motor (USM). It consists of two stators (an upper stator and a lower stator) and a rotor. The stators are excited the 3rd longitudinal vibration mode, by arranging the location of rotor and two stators, the rotor can realize rotary motion by friction effect with the stators. The rotor is mounted between the maximum deformation location of the upper stator and the nodal line of the lower stator. Since two stators are the same and are excited the same vibration mode, the modal-independent USM can adjust the coincidence of modal frequencies conveniently. Furthermore, the stator of the modal-independent USM has the characteristics of simple structure, which promised advantages of easy designing, manufacturing, miniaturizing and suitable for the mass production of USM. Modal test shows the disparity between the modal frequencies of the stators is 0.78%. Mechanical characteristic test shows the rotary speed of the USM is 75 revolutions per minute (clockwise) and 65.8 revolutions per minute (anti-clockwise) at the voltage of 400Vp-p. And at the same voltage, the maximum torque is 8.4N·mm. The resolution of the modal-independent USM can up to 0.34mrad at the applied voltage of 400Vp-p. Copyright © 2017 Elsevier B.V. All rights reserved.

  9. Cyclic delivery scheduling to customers with different priorities

    Directory of Open Access Journals (Sweden)

    Katarzyna Zofia Gdowska

    2013-12-01

    Full Text Available Background: In this paper a cyclic delivery scheduling problem for customers with different priorities is presented. Shops, which are provided with deliveries, are occasionally located in places which are crucial for the proper flow of traffic. In such places coordination of deliveries is crucial; therefore it allows to completely eliminate the phenomenon of the simultaneous arrivals of suppliers. Methods: In this paper the cyclic delivery scheduling problem for customers with different priorities was presented. To this theoretical problem a mix integer programming model was developed. Specific approach to the cyclic delivery scheduling problem is inspired by timetabling problem for urban public transport. Results: Mixed integer programming model was employed for solving four cases of cyclic delivery scheduling problem for customers with different priorities. When the value of the synchronization priority assigned to a single customer raised then the total number of synchronizations in the whole network decreased. In order to compare solutions a synchronization rate was utilized. A simple factor was utilized - the proportion of number of synchronizations of deliveries to a given customer to the total number of synchronizations obtained for the whole network. When the value of synchronization priority raised then the value of synchronization rate of this customer improved significantly. Conclusions: The mixed integer programming model for the cyclic delivery scheduling problem for customers with different priorities presented in this paper can be utilized for generating schedules of serving customers located in places where only one delivery can be received and unloaded at one go and where there is no space for other suppliers to wait in a queue. Such a schedule can be very useful for organizing deliveries to small shops united in a franchising network, since they operate in a way that is very similar to the network presented in this paper

  10. Iterated Dynamic Condensation Technique and Its Applications in Modal Testing

    Directory of Open Access Journals (Sweden)

    Zhikun Hou

    1997-01-01

    Full Text Available This article addresses an application of the dynamic condensation in modal testing, which requires measurements of natural frequencies and a limited number of components of modal shapes only. The measured frequencies can be employed as the initial estimates in the iterated dynamic condensation to effectively find an exact solution for the original eigenvalue problem and determine the transformation matrix between the testing and nontesting coordinates. Complete modal shapes including the nontesting coordinates can then be estimated based on the limited measurements. Numerical results are presented to illustrate the feasibility and efficiency of the iterated dynamic condensation. A comparison with the experimental results of a multiple disk system is also provided.

  11. Modal Ring Method for the Scattering of Electromagnetic Waves

    Science.gov (United States)

    Baumeister, Kenneth J.; Kreider, Kevin L.

    1993-01-01

    The modal ring method for electromagnetic scattering from perfectly electric conducting (PEC) symmetrical bodies is presented. The scattering body is represented by a line of finite elements (triangular) on its outer surface. The infinite computational region surrounding the body is represented analytically by an eigenfunction expansion. The modal ring method effectively reduces the two dimensional scattering problem to a one-dimensional problem similar to the method of moments. The modal element method is capable of handling very high frequency scattering because it has a highly banded solution matrix.

  12. Modal-noise generation in biconical-taper couplers.

    Science.gov (United States)

    Kawasaki, B S; Hill, K O; Tremblay, Y

    1981-10-01

    The modal noise resulting from the dividing of coherent light in fused biconical-taper star and access couplers is measured. The theoretical explanation of the results is presented. It is found that modal-noise generation is not severe even in those cases in which the light is strongly subdivided by a biconical-taper star coupler with a large number of ports. The performance of most digital fiber systems using such couplers is not expected to be significantly degraded by the measured levels of modal noise.

  13. Fourier modal method and its applications in computational nanophotonics

    CERN Document Server

    Kim, Hwi

    2012-01-01

    Most available books on computational electrodynamics are focused on FDTD, FEM, or other specific technique developed in microwave engineering. In contrast, Fourier Modal Method and Its Applications in Computational Nanophotonics is a complete guide to the principles and detailed mathematics of the up-to-date Fourier modal method of optical analysis. It takes readers through the implementation of MATLAB(R) codes for practical modeling of well-known and promising nanophotonic structures. The authors also address the limitations of the Fourier modal method. Features Provides a comprehensive guid

  14. Neuroscience of synesthesia and cross-modal associations.

    Science.gov (United States)

    Neckar, Marcel; Bob, Petr

    2014-01-01

    Synesthesia is a condition in which stimulation of one sensory modality causes unusual experiences in a different, unstimulated modality. Recent findings suggest that research on synesthesia offers a unique opportunity to study the neural basis of subjective experiences in healthy and pathological brains. This review summarizes and reflects current knowledge concerning synesthesia in its various aspects, including its cognitive, neural, and behavioral aspects. In this context, recent data suggest new connections between specific conditions related to synesthesic mechanisms and association processes linked to construction of synesthetic cross-modal metaphors that may play a role in psychopathological thinking and imagination.

  15. On the use of Kripke modality in language theory

    DEFF Research Database (Denmark)

    Nielsen, Karsten Hvidtfelt

    2006-01-01

     claim to have described this feature decidably in natural language; hence my appeal to formal language. I show the modal system (model) capable of decidably eluding the sceptic's paradox to be characterised by the following relations: irreflexibility, converse well-foundedness, transitivity and......The article shows how the formal modal technique known as 'Kripke-Modality' can be used as a descriptive tool in language theory. My use is motivated by a version of the well-known liar's paradox: anyone claiming natural language to be semantically undecidable may only on pain on inconsistency...

  16. Model mismatch analysis and compensation for modal phase measuring deflectometry.

    Science.gov (United States)

    Huang, Lei; Xue, Junpeng; Gao, Bo; McPherson, Chris; Beverage, Jacob; Idir, Mourad

    2017-01-23

    The correspondence residuals due to the discrepancy between the reality and the shape model in use are analyzed for the modal phase measuring deflectometry. Slope residuals are calculated from these discrepancies between the modal estimation and practical acquisition. Since the shape mismatch mainly occurs locally, zonal integration methods which are good at dealing with local variations are used to reconstruct the height residual for compensation. Results of both simulation and experiment indicate the proposed height compensation method is effective, which can be used as a post-complement for the modal phase measuring deflectometry.

  17. Treatment modalities for hyperpigmented skin lesions: A brief overview

    Directory of Open Access Journals (Sweden)

    Yan Teng Khoo

    2016-07-01

    Full Text Available Skin hyperpigmentation involves a broad range of skin conditions, including epidermal pigmented lesions, dermal pigmented lesions, and mixed pigmented lesions. Treatment includes various modalities such as brightening cream, chemical peeling, and laser therapy. Responses to various treatment modalities can be quite varied depending on the type of treatment and the degree of pigmentation. Sometimes a lesion can lighten or even partially disappear, while other lesions may recur. This paper provides a brief overview of treatment modalities available for hyperpigmented skin lesions including the importance of photoprotection, various types of brightening creams, suitable types of chemical peels, specific laser therapies targeted for skin hyperpigmentation, and surgery.

  18. Use of Simulation in Canadian Neonatal-Perinatal Medicine Training Programs.

    Science.gov (United States)

    Wong, Jonathan; Finan, Emer; Campbell, Douglas

    2017-07-08

    Introduction Simulation is used for the delivery of education and on occasion assessment. Before such a tool is used routinely in neonatal training programs across Canada, a need assessment is required to determine its current usage by accredited training programs. Our aim was to characterize the type of simulation modalities used and the perceived simulation-based training needs in Canadian neonatal-perinatal medicine (NPM) training programs. Methods A 22-item and 13-item online descriptive survey was sent to all NPM program directors and fellows in Canada, respectively. The survey was modeled on a previously validated tool by Johnston, et al. and responses were collected over 30 days. Results In total, eight (63%) program directors and 24 (28%) fellows completed the survey, with all respondents indicating that simulation is being used. Both lab-based and in situ simulations are occurring, with a range of simulation modalities employed to primarily teach resuscitation, procedural and communication skills. Fellows indicated that simulation should also be used to also teach other important topics, including disease-specific management, crisis resource management, and prevention of medical error. Five (63%) programs have faculty with formal simulation training and four (50%) programs have at least one faculty involved in simulation research. Conclusion Simulation is widely used in Canadian NPM training programs, with program directors and fellows identifying this as an important tool. Simulation can be used to teach a range of skills, but programs need to align their curriculum with both training objectives and learner needs. There is an opportunity for faculty development and increased simulation research.

  19. A Combination of Modal Synthesis and Subspace Iteration for an Efficient Algorithm for Modal Analysis within a FE-Code

    Directory of Open Access Journals (Sweden)

    M.W. Zehn

    2003-01-01

    Full Text Available Various well-known modal synthesis methods exist in the literature, which are all based upon certain assumptions for the relation of generalised modal co-ordinates with internal modal co-ordinates. If employed in a dynamical FE substructure/superelement technique the generalised modal co-ordinates are represented by the master degrees of freedom (DOF of the master nodes of the substructure. To conduct FE modal analysis the modal synthesis method can be integrated to reduce the number of necessary master nodes or to ease the process of defining additional master points within the structure. The paper presents such a combined method, which can be integrated very efficiently and seamless into a special subspace eigenvalue problem solver with no need to alter the FE system matrices within the FE code. Accordingly, the merits of using the new algorithm are the easy implementation into a FE code, the less effort to carry out modal synthesis, and the versatility in dealing with superelements. The paper presents examples to illustrate the proper work of the algorithm proposed.

  20. Comparing uni-modal and multi-modal therapies for improving writing in acquired dysgraphia after stroke.

    Science.gov (United States)

    Thiel, Lindsey; Sage, Karen; Conroy, Paul

    2016-01-01

    Writing therapy studies have been predominantly uni-modal in nature; i.e., their central therapy task has typically been either writing to dictation or copying and recalling words. There has not yet been a study that has compared the effects of a uni-modal to a multi-modal writing therapy in terms of improvements to spelling accuracy. A multiple-case study with eight participants aimed to compare the effects of a uni-modal and a multi-modal therapy on the spelling accuracy of treated and untreated target words at immediate and follow-up assessment points. A cross-over design was used and within each therapy a matched set of words was targeted. These words and a matched control set were assessed before as well as immediately after each therapy and six weeks following therapy. The two approaches did not differ in their effects on spelling accuracy of treated or untreated items or degree of maintenance. All participants made significant improvements on treated and control items; however, not all improvements were maintained at follow-up. The findings suggested that multi-modal therapy did not have an advantage over uni-modal therapy for the participants in this study. Performance differences were instead driven by participant variables.

  1. The development and therapeutic modalities of a transcultural child psychiatry service.

    Science.gov (United States)

    Measham, Toby; Rousseau, Cécile; Nadeau, Lucie

    2005-08-01

    To look at the specificities of the work of a Transcultural Child Psychiatry Team developed to meet the need for specialized services for Montreal and Quebec's culturally diverse immigrant and refugee pediatric population. A Transcultural Child Psychiatry Team was started at McGill University in 1995. The clinic's development and method of service provision for its patient population will be described. Modalities of assessment and treatment are modified to meet the needs of the team's clientele and also reflect the philosophical underpinnings of the team's practitioners. In this model of service delivery, current mental health care practice is modified in order to address the social specificities and cultural diversity of transcultural child psychiatric populations.

  2. Joint Architecture Standard (JAS) Reliable Data Delivery Protocol (RDDP) specification.

    Energy Technology Data Exchange (ETDEWEB)

    Enderle, Justin Wayne; Daniels, James W.; Gardner, Michael T.; Eldridge, John M.; Hunt, Richard D.; Gallegos, Daniel E.

    2011-05-01

    The Joint Architecture Standard (JAS) program at Sandia National Laboratories requires the use of a reliable data delivery protocol over SpaceWire. The National Aeronautics and Space Administration at the Goddard Spaceflight Center in Greenbelt, Maryland, developed and specified a reliable protocol for its Geostationary Operational Environment Satellite known as GOES-R Reliable Data Delivery Protocol (GRDDP). The JAS program implemented and tested GRDDP and then suggested a number of modifications to the original specification to meet its program specific requirements. This document details the full RDDP specification as modified for JAS. The JAS Reliable Data Delivery Protocol uses the lower-level SpaceWire data link layer to provide reliable packet delivery services to one or more higher-level host application processes. This document specifies the functional requirements for JRDDP but does not specify the interfaces to the lower- or higher-level processes, which may be implementation-dependent.

  3. The Use of Simulation in Physician Assistant Programs: A National Survey.

    Science.gov (United States)

    Coerver, Donald; Multak, Nina; Marquardt, Ashley; Larson, Eric H

    2017-12-01

    The purpose of this study was to develop a national-level description of the current use of simulation activities in physician assistant (PA) education and to assess the degree to which the use of simulation varies by PA program size and institutional type. An electronic survey on medical simulation was sent to 177 PA program directors or to a designated simulation activities coordinator, using the directory on the Physician Assistant Education Association website. The survey addressed program characteristics, types of simulation modalities in use, and frequency of use of those modalities in PA training. The specific content areas addressed were error disclosure, medical knowledge, patient care, and psychomotor skills. The survey was emailed 3 times from early April to mid-May 2014, with a follow-up call to nonrespondents in August 2014. Of the 177 PA programs contacted, 63 completed the survey, for a response rate of 35.6%. Results indicate widespread use of simulation by survey respondents, especially in teaching, assessment of medical knowledge, and clinical skills, with somewhat lower levels of use in content areas such as error disclosure, delivery of bad news, and team training. Although barriers exist to its use in training health care professionals, simulation has become an important tool for training PAs in a variety of medical and interpersonal skills. It is also clear that simulation is an important tool for conducting interprofessional training. More research is needed to identify optimal approaches to the use of simulation in health care professions training.

  4. MODALITIES OF MANAGEMENT OF VERNAL KERATOCONJUNCTIVITIS

    Directory of Open Access Journals (Sweden)

    Bajantri

    2015-03-01

    Full Text Available BACKGROUND: Ocular allergy is a common disorder which can be debilitating for patients and, at times, challenging for physicians to diagnose and treat . Allergic disease affects 30 – 50% of the population . Vernal kerato conjunctivitis has predilection for young age group and the diagnosis is generally based on signs and symptoms of the disease . This study is undertaken to stress upon the importance of clinical manifestations, management and prevent the complications of the disease and those secondary to its long - term medication . AIM OF STUDY: To study the different modalities in management of VKC patients . MATERIALS & METHODS: 74 patients with VKC selected at random, who attended the department of ophthalmology KIMS, Hubli from December 2012 to May 2014 . The relevant details of history and clinical examination of the patients were recorded on a specifically designed Proforma . The type and severity of VKC and its association with corneal involvement was noted . Clinical observation and evaluation of clinical signs and symptoms were performed before and after drug therapy at first visit, weekly interval for 2 weeks and at the end of 3 months . Therapeutic options are many, in most cases topical and chosen on the basis of the severity of the disease . RESULTS: 68/74 (91 . 89% patients were put on 0 . 1% olopatadine eye drops 2 times a day at 0 visit . Additional treatment such as 0 . 5% ketorolac 4 times a day in 13/68 patients, 0 . 1% bromofenac 2 times a day in 3/68 patients and 0 . 1% Napafenac 2 times a day in 1/68 patient was added along with olopatadine at visit 0 . In 16/68 patients with persistent symptoms with olopatadine alone 0 . 5% ketorolac was added in subsequent visits . 15/68 patients with persistent symptoms received Flurometholone 0 . 1% in the subsequent visits along with 0 . 1% olopatadine . All these patients who received 0 . 5% ketorolac alone or with other drugs responded well . Fallow – up patients using 0 . 1

  5. Aeroelastic modal dynamics of wind turbines including anisotropic effects

    DEFF Research Database (Denmark)

    Skjoldan, Peter Fisker

    Several methods for aeroelastic modal analysis of a rotating wind turbine are developed and used to analyse the modal dynamics of two simplified models and a complex model in isotropic and anisotropic conditions. The Coleman transformation is used to enable extraction of the modal frequencies...... frequency is thus identified as the dominant frequency in the response of a pure excitation of the mode observed in the inertial frame. A modal analysis tool based directly on the complex aeroelastic wind turbine code BHawC is presented. It uses the Coleman approach in isotropic conditions...... and the computationally efficient implicit Floquet analysis in anisotropic conditions. The tool is validated against system identifications with the partial Floquet method on the nonlinear BHawC model of a 2.3 MW wind turbine. System identification results show that nonlinear effects on the 2.3 MW turbine in most cases...

  6. Modal interval analysis new tools for numerical information

    CERN Document Server

    Sainz, Miguel A; Calm, Remei; Herrero, Pau; Jorba, Lambert; Vehi, Josep

    2014-01-01

    This book presents an innovative new approach to interval analysis. Modal Interval Analysis (MIA) is an attempt to go beyond the limitations of classic intervals in terms of their structural, algebraic and logical features. The starting point of MIA is quite simple: It consists in defining a modal interval that attaches a quantifier to a classical interval and in introducing the basic relation of inclusion between modal intervals by means of the inclusion of the sets of predicates they accept. This modal approach introduces interval extensions of the real continuous functions, identifies equivalences between logical formulas and interval inclusions, and provides the semantic theorems that justify these equivalences, along with guidelines for arriving at these inclusions. Applications of these equivalences in different areas illustrate the obtained results. The book also presents a new interval object: marks, which aspire to be a new form of numerical treatment of errors in measurements and computations.

  7. Modalities to Implement the Multilinguality in Web DYNPRO ABAP

    National Research Council Canada - National Science Library

    Ana Daniela CRISTEA; Adela Diana BERDIE; Mihaela OSACI; Emil Dragomir MOLNAR

    2010-01-01

    .... The Multilinguality being a property of this platform. The purpose of this article is to highlight the modality to internationalize a Web Dynpro ABAP project The techniquesused for the internationalization of a Web Dynpro ABAP application are: the OTR...

  8. State-space formulation of multi-shaker modal analysis

    Science.gov (United States)

    Craig, Roy R., Jr.; Kurdila, Andrew J.; Kim, Hyoung M.

    1987-01-01

    As modal testing techniques have improved in recent years, the demands placed on the accuracy of modal test results have increased. This paper describes a new multi-input, multi-output modal parameter estimation algorithm suitable for the identification of reduced-order models of structures. The method described is a frequency-domain method based on excitation and response spectra. The principal features of the algorithm are: (1) applicability to general linear, time-invariant systems, (2) direct use of multiple input and multiple response data, (3) identification of reduced-order models with minimum user interaction through the use of two automatic model-reduction techniques, (4) identification of a consistent set of modal parameters through the use of numerically stable least-squares techniques, and (5) complete user documentation.

  9. Multivariate Chemical Image Fusion of Vibrational Spectroscopic Imaging Modalities

    Directory of Open Access Journals (Sweden)

    Aoife A. Gowen

    2016-07-01

    Full Text Available Chemical image fusion refers to the combination of chemical images from different modalities for improved characterisation of a sample. Challenges associated with existing approaches include: difficulties with imaging the same sample area or having identical pixels across microscopic modalities, lack of prior knowledge of sample composition and lack of knowledge regarding correlation between modalities for a given sample. In addition, the multivariate structure of chemical images is often overlooked when fusion is carried out. We address these challenges by proposing a framework for multivariate chemical image fusion of vibrational spectroscopic imaging modalities, demonstrating the approach for image registration, fusion and resolution enhancement of chemical images obtained with IR and Raman microscopy.

  10. The measurement of the modal strain fields using digital shearography

    Directory of Open Access Journals (Sweden)

    Gomes J.M.

    2010-06-01

    Full Text Available This work presents a Michelson shearography interferometer configuration associated with stroboscopic double illumination technique for the measurement of modal rotation fields and their strain fields on a clamped circular aluminium plate. The speckle pattern is frozen by the synchronization between the LASER illumination and the modal vibration of the object. The quantitative evaluation is performed for each digital shearogram using a time modulation technique. The setup of double illumination LASER with out-of-plane opposite sensitivity allows the two phase maps measurement of the modal spatial gradient. The modal rotation and strain fields are extracted by the combination of this two digital phase maps. Image processing techniques are applied on the phase maps to obtain full-field measurements using a dedicated post-processing algorithm. Finally, is presented a comparison between the experimental measurement and the numerical solution.

  11. Robustness of Modal Parameter Estimation Methods Applied to Lightweight Structures

    DEFF Research Database (Denmark)

    Dickow, Kristoffer Ahrens; Kirkegaard, Poul Henning; Andersen, Lars Vabbersgaard

    2013-01-01

    . The ability to handle closely spaced modes and broad frequency ranges is investigated for a numerical model of a lightweight junction under dierent signal-to-noise ratios. The selection of both excitation points and response points are discussed. It is found that both the Rational Fraction Polynomial-Z method...... of nominally identical test subjects. However, the literature on modal testing of timber structures is rather limited and the applicability and robustness of dierent curve tting methods for modal analysis of such structures is not described in detail. The aim of this paper is to investigate the robustness...... of two parameter estimation methods built into the commercial modal testing software B&K Pulse Re ex Advanced Modal Analysis. The investigations are done by means of frequency response functions generated from a nite-element model and subjected to articial noise before being analyzed with Pulse Re ex...

  12. Modal and Mixed Specifications: Key Decision Problems and their Complexities

    DEFF Research Database (Denmark)

    Antonik, Adam; Huth, Michael; Larsen, Kim Guldstrand

    2010-01-01

    Modal and mixed transition systems are specification formalisms that allow mixing of over- and under-approximation. We discuss three fundamental decision problems for such specifications: whether a set of specifications has a common implementation, whether a sole specification has an implementation......, and whether all implementations of one specification are implementations of another one. For each of these decision problems we investigate the worst-case computational complexity for the modal and mixed case. We show that the first decision problem is EXPTIME-complete for modal as well as for mixed...... specifications. We prove that the second decision problem is EXPTIME-complete for mixed specifications (while it is known to be trivial for modal ones). The third decision problem is furthermore demonstrated to be EXPTIME-complete for mixed specifications....

  13. Certification of Prefixed Tableau Proofs for Modal Logic

    Directory of Open Access Journals (Sweden)

    Tomer Libal

    2016-09-01

    Full Text Available Different theorem provers tend to produce proof objects in different formats and this is especially the case for modal logics, where several deductive formalisms (and provers based on them have been presented. This work falls within the general project of establishing a common specification language in order to certify proofs given in a wide range of deductive formalisms. In particular, by using a translation from the modal language into a first-order polarized language and a checker whose small kernel is based on a classical focused sequent calculus, we are able to certify modal proofs given in labeled sequent calculi, prefixed tableaux and free-variable prefixed tableaux. We describe the general method for the logic K, present its implementation in a prolog-like language, provide some examples and discuss how to extend the approach to other normal modal logics

  14. Multi-Modal Intelligent Traffic Signal Systems GPS

    Data.gov (United States)

    Department of Transportation — Data were collected during the Multi-Modal Intelligent Transportation Signal Systems (MMITSS) study. MMITSS is a next-generation traffic signal system that seeks to...

  15. Cycling, modality styles and variation by urban environment

    DEFF Research Database (Denmark)

    Olafsson, Anton Stahl; Nielsen, Thomas Alexander Sick; Carstensen, Trine Agervig

    The aim for this study is to improve the understanding of cycling usage in relation to other modes of transport and the urban environment. Modality styles, i.e. the mode of transport or set of modes that a person habitually uses, are revealed by data on seven days transport inventory on modes...... and transport purposes from a representative sample of Danes (n=1,957). A combined factor and cluster analysis is uses to define five modality styles (education transport; public transport; retirement transport; leisure transport; and car-based transport). Modality styles categorized as education, public....... However, the results show that cycling is a part of all five modality styles, and hence, cycling in a Danish context is characterised by inter- and multimodality. Differences in type of cycling are present. Utility cycling for work and child transport is most widespread in public, leisure, and car...

  16. Complexity of Decision Problems for Mixed and Modal Specifications

    DEFF Research Database (Denmark)

    Antonik, Adam; Huth, Michael; Nyman, Ulrik Mathias

    2008-01-01

    We consider decision problems for modal and mixed transition systems used as specifications: the common implementation problem (whether a set of specifications has a common implementation), the consistency problem (whether a single specification has an implementation), and the thorough refinement...

  17. [Selection of treatment modalities in patients with spasticity].

    Science.gov (United States)

    Ota, Tetsuo

    2014-09-01

    Spasticity is the most common abnormality of muscle tone. Typically, oral antispastic drugs, phenol blocks, motor-point blocks, selective dorsal rhizotomies, and selective peripheral neurotomies are used to reduce muscle tone and/or improve ranges of motion. Recently, botulinum toxin injections and intrathecal baclofen have been used as treatment modalities. The selection of the most appropriate treatment modality by doctors treating patients with spasticity is critical. Furthermore, rehabilitation techniques, such as physiotherapy, occupational therapy, therapeutic electrical nerve stimulation, and orthosis, are useful as combination therapy for the treatment of spasticity. The purpose of this study was to outline the various modalities that are currently used for the treatment of spasticity. Regardless of the modality selected, it is imperative that treatment goals are carefully identified. The reduction of spasticity is not an appropriate treatment goal. Appropriate goals include improving gait, activities of daily living, and the quality of life.

  18. Multi-Modal Intelligent Traffic Signal Systems (MMITSS) impacts assessment.

    Science.gov (United States)

    2015-08-01

    The study evaluates the potential network-wide impacts of the Multi-Modal Intelligent Transportation Signal System : (MMITSS) based on a field data analysis utilizing data collected from a MMITSS prototype and a simulation analysis. : The Intelligent...

  19. Global Delivery Models

    DEFF Research Database (Denmark)

    Manning, Stephan; Møller Larsen, Marcus; Bharati, Pratyush

    We investigate antecedents and contingencies of location configurations supporting global delivery models (GDMs) in global outsourcing. GDMs are a new form of IT-enabled client-specific investment promoting services provision integration with clients by exploiting client proximity and time-zone s...... commoditized. Findings imply that coordination across time zones increasingly affects international operations in business-to-business and born-global industries.......We investigate antecedents and contingencies of location configurations supporting global delivery models (GDMs) in global outsourcing. GDMs are a new form of IT-enabled client-specific investment promoting services provision integration with clients by exploiting client proximity and time-zone...

  20. MINERVA - A Multi-Modal Radiation Treatment Planning System

    Energy Technology Data Exchange (ETDEWEB)

    D. E. Wessol; C. A. Wemple; D. W. Nigg; J. J. Cogliati; M. L. Milvich; C. Frederickson; M. Perkins; G. A. Harkin

    2004-10-01

    Recently, research efforts have begun to examine the combination of BNCT with external beam photon radiotherapy (Barth et al. 2004). In order to properly prepare treatment plans for patients being treated with combinations of radiation modalities, appropriate planning tools must be available. To facilitiate this, researchers at the Idaho National Engineering and Environmental Laboratory (INEEL)and Montana State University (MSU) have undertaken development of a fully multi-modal radiation treatment planning system.

  1. Multiple Mechanosensory Modalities Influence Development of Auditory Function

    OpenAIRE

    Horowitz, Seth S.; Tanyu, Leslie H.; Simmons, Andrea Megela

    2007-01-01

    Sensory development can be dependent on input from multiple modalities. During metamorphic development, ranid frogs exhibit rapid reorganization of pathways mediating auditory, vestibular, and lateral line modalities as the animal transforms from an aquatic to an amphibious form. Here we show that neural sensitivity to the underwater particle motion component of sound follows a different developmental trajectory than that of the pressure component. Throughout larval stages, cells in the media...

  2. A Framework for Optimal Dynamic Modelling of Sensing Modalities

    OpenAIRE

    Mkhitaryan, Artashes

    2015-01-01

    In this thesis we present a framework for optimal registration of different sensory modalities to each other. Our system is capable of finding the most advantageous set of mathematical and physical transformations between the initial and the target modality. It takes into account, the requirements of the problem and can optimize for minimum complexity, minimum error, or strike a balance in optimizing for both in the resulting fusion. In dieser Dissertation präsentieren wir ein Framework ...

  3. Dual-Modality Prostate Imaging with PET and Transrectal Ultrasound

    Science.gov (United States)

    2011-09-01

    Downloaded on April 07,2010 at 23:12:26 UTC from IEEE Xplore . Restrictions apply. HUBER et al.: MULTI-MODALITY PHANTOM DEVELOPMENT 2723 As soon as...allow Authorized licensed use limited to: Lawrence Berkeley National Laboratory. Downloaded on April 07,2010 at 23:12:26 UTC from IEEE Xplore ...April 07,2010 at 23:12:26 UTC from IEEE Xplore . Restrictions apply. HUBER et al.: MULTI-MODALITY PHANTOM DEVELOPMENT 2725 Fig. 3. Reconstructed

  4. Modal data for the BARC challenge problem Test Report

    Energy Technology Data Exchange (ETDEWEB)

    Rohe, Daniel Peter [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2018-01-22

    Modal testing was performed on the uncut BARC structure as a whole and broken into its two sub-assemblies. The structure was placed on soft foam during the test. Excitation was provided with a small modal hammer attached to an actuator. Responses were measured using a 3D Scanning Laser Doppler Vibrometer. Data, shapes, and geometry from this test can be downloaded in Universal File Format from the Sandia Connect SharePoint site.

  5. Dialysis modality selection: physician guided or patient led?

    OpenAIRE

    Winterbottom, A; Bekker, H; Mooney, A.

    2016-01-01

    The process of choosing dialysis modality for patients is complex and requires input from the expert renal team. Although it is commonplace for nephrologists to recommend dialysis modalities to patients, this might not always lead to the patient receiving treatment which they regard as most suitable. Nephrologists should consider whether it is appropriate for pre-dialysis education to be directive, or whether the choice between treatment options should be led by the patient.

  6. Synesthesia strengthens sound-symbolic cross-modal correspondences.

    Science.gov (United States)

    Lacey, Simon; Martinez, Margaret; McCormick, Kelly; Sathian, K

    2016-11-01

    Synesthesia is a phenomenon in which an experience in one domain is accompanied by an involuntary secondary experience in another, unrelated domain; in classical synesthesia, these associations are arbitrary and idiosyncratic. Cross-modal correspondences refer to universal associations between seemingly unrelated sensory features, e.g., auditory pitch and visual size. Some argue that these phenomena form a continuum, with classical synesthesia being an exaggeration of universal cross-modal correspondences, whereas others contend that the two are quite different, since cross-modal correspondences are non-arbitrary, non-idiosyncratic, and do not involve secondary experiences. Here, we used the implicit association test to compare synesthetes' and non-synesthetes' sensitivity to cross-modal correspondences. We tested the associations between auditory pitch and visual elevation, auditory pitch and visual size, and sound-symbolic correspondences between auditory pseudowords and visual shapes. Synesthetes were more sensitive than non-synesthetes to cross-modal correspondences involving sound-symbolic, but not low-level sensory, associations. We conclude that synesthesia heightens universally experienced cross-modal correspondences, but only when these involve sound symbolism. This is only partly consistent with the idea of a continuum between synesthesia and cross-modal correspondences, but accords with the idea that synesthesia is a high-level, post-perceptual phenomenon, with spillover of the abilities of synesthetes into domains outside their synesthesias. To our knowledge, this is the first demonstration that synesthetes, relative to non-synesthetes, experience stronger cross-modal correspondences outside their synesthetic domains. © 2016 Federation of European Neuroscience Societies and John Wiley & Sons Ltd.

  7. REEVALUASI PEMBIAYAAN PERUSAHAAN MELALUI MODAL VENTURA DI INDONESIA

    Directory of Open Access Journals (Sweden)

    Sihabudin SIHABUDIN

    2016-11-01

    Full Text Available Abstract This paper aims to discuss the development of venture capital reevaluation in Indonesia that provides an opportunity for businesses to develop the corporation through financing. This paper uses normative juridical research. The results of the analysis is that the regulation and legal policy which can provide adequate legal protection is needed to support the corporation neither the corporation founded by the State or by private parties. Capital is needed in the establishment and operation of an enterprise, including through venture capital. Therefore, the existence of venture capital should be supported by the government as a regulator and facilitator and community businesses which can grow better so that not only large companies but also small firms and medium can be helped by the growth of venture capital. On the other hand, since the inclusion of funds to the venture capital system is high risk for investors, then early investors must be careful in order to save funds or capital is entered into the corporation's business partners.   Abstrak Tulisan ini bertujuan untuk membahas mengenai reevaluasi Pengembangan modal ventura di indonesia memberikan kesempatan bagi pelaku bisnis untuk mengembangkan perusahaannya melalui pembiayaan.Tulisan ini menggunakan penelitian yuridis normatif. Hasil dari analisis dalam tulisan ini adalah bahwa  Pengaturan dan kebijakan hukum yang dapat memberikan  perlindungan hukum yang memadai diperlukan untuk mendukung kegiatan perusahaan baik perusahaan yang didirikan oleh Negara maupun oleh pihak swasta . Dalam pendirian dan operasional sebuah perusahaan dibutuhkan modal termasuk melalui modal ventura. Oleh karena itu keberadaan modal ventura harus didukung oleh pemerintah sebagai regulator dan fasilitator serta masyarakat pelaku bisnis agar modal ventura dapat berkembang lebih baik sehingga bukan hanya perusahaan besar, namun juga perusahaaan kecil dan menengah dapat terbantu oleh pertumbuhan modal

  8. Dynamic Modal Analysis of Vertical Machining Centre Components

    OpenAIRE

    Anayet U. Patwari; Waleed F. Faris; A. K. M. Nurul Amin; S. K. Loh

    2009-01-01

    The paper presents a systematic procedure and details of the use of experimental and analytical modal analysis technique for structural dynamic evaluation processes of a vertical machining centre. The main results deal with assessment of the mode shape of the different components of the vertical machining centre. The simplified experimental modal analysis of different components of milling machine was carried out. This model of the different machine tool's structure is made by design software...

  9. On Some Syntactic Properties of the Modalized Heyting Calculus

    OpenAIRE

    Muravitsky, Alexei

    2016-01-01

    We show that the modalized Heyting calculus introduced by Leo Esakia admits a normal axiomatization. Then, we prove that the inference rules $\\square\\alpha/\\alpha$ and $\\square\\alpha\\rightarrow\\alpha/\\alpha$ are admissible in this calculus. Finally, we show that this calculus and intuitionistic propositional calculus are assertorically equipollent, which leads to a variant of limited separation property for the modalized Heyting calculus.

  10. Estimating modal instability threshold for photonic crystal rod fiber amplifiers

    DEFF Research Database (Denmark)

    Johansen, Mette Marie; Hansen, Kristian Rymann; Laurila, Marko

    2013-01-01

    We present a semi-analytic numerical model to estimate the transverse modal instability (TMI) threshold for photonic crystal rod amplifiers. The model includes thermally induced waveguide perturbations in the fiber cross section modeled with finite element simulations, and the relative intensity ...... noise (RIN) of the seed laser, which seeds mode coupling between the fundamental and higher order mode. The TMI threshold is predicted to ~370 W – 440 W depending on RIN for the distributed modal filtering rod fiber....

  11. Non-destructive inspection of composite structures using modal analysis

    OpenAIRE

    Matthews, Timothy Stirling.

    1995-01-01

    Anomalies from manufacturing variability or in-service damage are manifested as subtle differences in the inertial and stiffness matrices of otherwise identical components. Modal analysis seeks to model these constitutive relations by examining a structure's dynamic response to applied vibrations. In this investigation, characterization of anomalies in composite structures is attempted through multi-input, multi-output modal analysis. Two graphite-epoxy specimens manufactured by different pro...

  12. Many-dimensional modal logics theory and applications

    CERN Document Server

    Gabbay, D M; Wolter, F; Zakharyaschev, M

    2003-01-01

    Modal logics, originally conceived in philosophy, have recently found many applications in computer science, artificial intelligence, the foundations of mathematics, linguistics and other disciplines. Celebrated for their good computational behaviour, modal logics are used as effective formalisms for talking about time, space, knowledge, beliefs, actions, obligations, provability, etc. However, the nice computational properties can drastically change if we combine some of these formalisms into a many-dimensional system, say, to reason about knowledge bases developing in time or moving objects.

  13. Preparation and characterization of a magnetic and optical dual-modality molecular probe

    Energy Technology Data Exchange (ETDEWEB)

    Bumb, A; Brechbiel, M W [Radioimmune and Inorganic Chemistry Section, Radiation Oncology Branch, NCI, NIH, Building 10, Room 1B53, 10 Center Drive, Bethesda, MD 20892 (United States); Regino, C A S; Ogawa, M; Choyke, P L [Molecular Imaging Program, NCI, NIH, Building 10, Room B3B69, 10 Center Drive, Bethesda, MD 20892 (United States); Perkins, M R [Vaccine Research Center, NIAID, NIH, Building 40, Room 3608B, 40 Convent Drive, Bethesda, MD 20892 (United States); Bernardo, M [SAIC-Frederick Inc., NCI-Frederick, Frederick, MD 21702 (United States); Fugger, L [MRC Human Immunology Unit, Weatherall Institute of Molecular Medicine, John Radcliffe Hospital, The University of Oxford, Oxford OX3 9DS (United Kingdom); Dobson, P J, E-mail: Bumba@mail.nih.gov, E-mail: martinwb@mail.nih.gov [Oxford University Begbroke Science Park, Sandy Lane, Kidlington, Oxon OX5 1PF (United Kingdom)

    2010-04-30

    Multi-modality imaging probes combine the advantages of individual imaging techniques to yield highly detailed anatomic and molecular information in living organisms. Herein, we report the synthesis and characterization of a dual-modality nanoprobe that couples the magnetic properties of ultrasmall superparamagnetic iron oxide nanoparticles (USPIOs) with the near infrared fluorescence of Cy5.5. The fluorophore is encapsulated in a biocompatible shell of silica surrounding the iron oxide core for a final diameter of {approx} 17 nm. This silica-coated iron oxide nanoparticle (SCION) has been analyzed by transmission electron microscopy, dynamic light scattering, and superconducting quantum interference device (SQUID). The particle demonstrates a strong negative surface charge and maintains colloidal stability in the physiological pH range. Magnetic hysteresis analysis confirms superparamagnetic properties that could be manipulated for thermotherapy. The viability of primary human monocytes, T cells, and B cells incubated with the particle has been examined in vitro. In vivo analysis of agent leakage into subcutaneous A431 tumors in mice was also conducted. This particle has been designed for diagnostic application with magnetic resonance and fluorescence imaging, and has future potential to serve as a heat-sensitive targeted drug delivery platform.

  14. Preparation and characterization of a magnetic and optical dual-modality molecular probe

    Science.gov (United States)

    Bumb, A.; Regino, C. A. S.; Perkins, M. R.; Bernardo, M.; Ogawa, M.; Fugger, L.; Choyke, P. L.; Dobson, P. J.; Brechbiel, M. W.

    2010-04-01

    Multi-modality imaging probes combine the advantages of individual imaging techniques to yield highly detailed anatomic and molecular information in living organisms. Herein, we report the synthesis and characterization of a dual-modality nanoprobe that couples the magnetic properties of ultrasmall superparamagnetic iron oxide nanoparticles (USPIOs) with the near infrared fluorescence of Cy5.5. The fluorophore is encapsulated in a biocompatible shell of silica surrounding the iron oxide core for a final diameter of ~ 17 nm. This silica-coated iron oxide nanoparticle (SCION) has been analyzed by transmission electron microscopy, dynamic light scattering, and superconducting quantum interference device (SQUID). The particle demonstrates a strong negative surface charge and maintains colloidal stability in the physiological pH range. Magnetic hysteresis analysis confirms superparamagnetic properties that could be manipulated for thermotherapy. The viability of primary human monocytes, T cells, and B cells incubated with the particle has been examined in vitro. In vivo analysis of agent leakage into subcutaneous A431 tumors in mice was also conducted. This particle has been designed for diagnostic application with magnetic resonance and fluorescence imaging, and has future potential to serve as a heat-sensitive targeted drug delivery platform.

  15. Sistemas multi–modales de profundidad restringida Multi-modal systems of restricted depth

    Directory of Open Access Journals (Sweden)

    Manuel Sierra A.

    2008-12-01

    Full Text Available Se presentan como extensiones del cálculo proposicional clásico, la jerarquíade sistemas deductivos SMM–n con n > 1. SMM–n es el sistema multi–modalde profundidad–n. El sistema SMM–1 es el cálculo proposicional clásico. Elsistema SMM–(n + 1 puede ser visto como el resultado de aplicar la regla denecesariedad, asociada a los razonadores con suficiente capacidad de razona-miento, una vez a los teoremas del sistema SMM–n. El sistema SMM resultade la reunión de los sistemas de la jerarquía, y puede ser visto como el sis-tema de lógica multi–modal Km con restricciones. Los sistemas SMM–n soncaracterizados con una semántica al estilo Kripke, en la cual, la longitud delas cadenas de mundos posibles se encuentra restringida.They are presented as extensions of the classical propositional logic, the hierarchy of deductive systems SMM–n with n > 1. SMM–n is the multi–modal system of depth–n. The system SMM–1 is the classical propositional logic. The system SMM–(n + 1 it can be seen as the result of applying the necesariedad rule, associated to the reasoners with enough reasoning capacity, once to the theorems of the system SMM–n. The system SMM is of the union of the systems of the hierarchy, and it can be seen as the system of logic multimodal Km with restrictions. The systems SMM–n are characterized with a semantics to the style Kripke, in the one which, the longitude of the chains of possible worlds is restricted.

  16. Course Delivery Platform Changes and Instructional Delivery Methods: Student Attitudes and Perceptions

    Science.gov (United States)

    Garner, William E.; Pack, Tresvil G.; Szirony, Gary M.; Beeson, Eric T.

    2013-01-01

    The purposes of this study were to examine students' perceptions and attitudes toward changes in Distance Education (DE) course management systems and to evaluate their instructional delivery preferences. Students (N = 145) enrolled in an online master's degree program on either a full- or part-time basis completed an online survey instrument…

  17. Stochastic Subspace Method for Experimental Modal Analysis

    Directory of Open Access Journals (Sweden)

    Liu Dazhi

    2016-01-01

    Full Text Available The formula of stochastic subspace identification method is deduced in details and the program is written out. The two methods are verified by a vibration test on a 5-floor rigid frame model. In this test the gauss white noise generated from a shaker table to simulate the ambient vibration on the model, and the response signals are measured. Next, the response data of experiment are processed by auto-cross spectrum density method and stochastic subspace identification method respectively, the two methods are verified by comparing with the theory result. and bearing out the superiority of stochastic subspace identification method compared to auto-cross spectrum density method.

  18. Global 2-D intercomparison of sectional and modal aerosol modules

    Directory of Open Access Journals (Sweden)

    D. K. Weisenstein

    2007-01-01

    Full Text Available We present an intercomparison of several aerosol modules, sectional and modal, in a global 2-D model in order to differentiate their behavior for tropospheric and stratospheric applications. We model only binary sulfuric acid-water aerosols in this study. Three versions of the sectional model and three versions of the modal model are used to test the sensitivity of background aerosol mass and size distribution to the number of bins or modes and to the prescribed width of the largest mode. We find modest sensitivity to the number of bins (40 vs. 150 used in the sectional model. Aerosol mass is found to be reduced in a modal model if care is not taken in selecting the width of the largest lognormal mode, reflecting differences in sedimentation in the middle stratosphere. The size distributions calculated by the sectional model can be better matched by a modal model with four modes rather than three modes in most but not all situations. A simulation of aerosol decay following the 1991 eruption of Mt. Pinatubo shows that the representation of the size distribution can have a signficant impact on model-calculated aerosol decay rates in the stratosphere. Between 1991 and 1995, aerosol extinction and surface area density calculated by two versions of the modal model adequately match results from the sectional model. Calculated effective radius for the same time period shows more intermodel variability, with a 20-bin sectional model performing much better than any of the modal models.

  19. The impact of modality and working memory capacity on achievement in a multimedia environment

    Science.gov (United States)

    Stromfors, Charlotte M.

    This study explored the impact of working memory capacity and student learning in a dual modality, multimedia environment titled Visualizing Topography. This computer-based instructional program focused on the basic skills in reading and interpreting topographic maps. Two versions of the program presented the same instructional content but varied the modality of verbal information: the audio-visual condition coordinated topographic maps and narration; the visual-visual condition provided the same topographic maps with readable text. An analysis of covariance procedure was conducted to evaluate the effects due to the two conditions in relation to working memory capacity, controlling for individual differences in spatial visualization and prior knowledge. The scores on the Figural Intersection Test were used to separate subjects into three levels in terms of their measured working memory capacity: low, medium, and high. Subjects accessed Visualizing Topography by way of the Internet and proceeded independently through the program. The program architecture was linear in format. Subjects had a minimum amount of flexibility within each of five segments, but not between segments. One hundred and fifty-one subjects were randomly assigned to either the audio-visual or the visual-visual condition. The average time spent in the program was thirty-one minutes. The results of the ANCOVA revealed a small to moderate modality effect favoring an audio-visual condition. The results also showed that subjects with low and medium working capacity benefited more from the audio-visual condition than the visual-visual condition, while subjects with a high working memory capacity did not benefit from either condition. Although splitting the data reduced group sizes, ANCOVA results by gender suggested that the audio-visual condition favored females with low working memory capacities. The results have implications for designers of educational software, the teachers who select software, and

  20. A Medical Delivery Device

    DEFF Research Database (Denmark)

    2010-01-01

    The present invention relates to a medical delivery device comprising at least two membrane electrode assembly units each of which comprises three layers: an upper and a lower electrode and a selective ionic conductive membrane provided there-between. At least one of the three layers are shared...